Thermal stability of the superalloys Inconel 625 and Nimonic 86
International Nuclear Information System (INIS)
Kohl, H.K.; Peng, K.
1981-01-01
The thermal stability of Inconel 625 and Nimonic 86, as received, cold worked (10, 20, and 40%), and solution treated, was investigated in the temperature range 500-900 0 C. The annealing times varied from 0.3 (0.03) to 100 days. Precipitation hardening and recovery (recrystallisation) takes place in cold worked material, beginning after shorter times in cold worked material than in as received material. The temperature interval for precipitation hardening is extended in Nimonic 86, due to cold working, from about 500-600 0 C to about 450-700 0 C. It is possible to suppress or retard the precipitation hardening in solution treated Inconel 625 and Nimonic 86 by fast cooling after solution annealing. Hardness was measured at room temperature with five different loads, so that the parameters k and n from Meyer's-law, and the Brinell hardness number (for F / D 2 = 30) could be determined. The lattice contraction of Inconel 625 due to ageing was investigated with X-ray measurements. The change of intensities of the diffractometer traces due to recovery was also determined. (orig.)
Czech Academy of Sciences Publication Activity Database
Mandal, A.; Dixit, A. R.; Chattopadhyaya, S.; Paramanik, A.; Hloch, Sergej; Królczyk, G.
2017-01-01
Roč. 93, 1-4 (2017), s. 433-443 ISSN 0268-3768 Institutional support: RVO:68145535 Keywords : surface integrity * wire-EDM * Nimonic C-263 * multi-cut * recast layer Subject RIV: JQ - Machines ; Tools OBOR OECD: Mechanical engineering Impact factor: 2.209, year: 2016 https://link.springer.com/article/10.1007/s00170-017-9993-x
Czech Academy of Sciences Publication Activity Database
Mandal, A.; Dixit, A. R.; Chattopadhyaya, S.; Paramanik, A.; Hloch, Sergej; Królczyk, G.
2017-01-01
Roč. 93, 1-4 (2017), s. 433-443 ISSN 0268-3768 Institutional support: RVO:68145535 Keywords : surface integrity * wire-EDM * Nimonic C-263 * multi-cut * recast layer Subject RIV: JQ - Machines ; Tools OBOR OECD: Mechanical engineering Impact factor: 2.209, year: 2016 https://link.springer.com/ article /10.1007/s00170-017-9993-x
Characterization of a NIMONIC TYPE super alloy
International Nuclear Information System (INIS)
Zamora Rangel, L.; Martinez Martinez, E.
1985-01-01
Mechanical properties of strength and thermofluence of a NIMONIC type super alloy under thermal treatment was determined. The relationship between microstructure, phases and precipitates was also studied. (author)
Recovery of creep properties of the nickel-base superalloy nimonic 105
CSIR Research Space (South Africa)
Girdwood, RB
1996-01-01
Full Text Available Uniaxial constant stress creep tests were performed on the wrought nickel-base superalloy Nimonic 105. Entire creep curves were recorded and curve shapes analysed using the Theta Projection Concept. Rejuventive procedures were applied to pre...
Effect of microstructure on elevated temperature LCF behaviour of nimonic PE16 superalloy
International Nuclear Information System (INIS)
Valsan, M.; Bhanu Sankara Rao, K.; Mannan, S.L.
1989-01-01
The influence of microstructure on elevated temperature low cycle fatigue (LCF) behaviour of Nimonic PE16 superalloy has been studied. Samples with the following three different prior microstructures were chosen for testing: (A) a fine grain structure, free from carbides and γ'(1313K/4h); (B) microstructure with intra and intergranular M 23 C 6 and uniform distribution of spherical and peak aged γ' of 18 nm diameter (1313K/4h + 1073K/2h + 973K/16h); and (C) microstructure with predominantly intergranular MC and uniform distribution of coarse γ' of 35 nm diameter (1313K/4h+1173K/1h+1023K/8h). Total strain controlled LCF tests were carried out on all the three microstructures at 823 and 923K and at a constant strain rate of 3.2x10 -3 s -1 over strain amplitudes ranging from ±0.25 ±1.00 per cent. (author). 54 refs., 17 figs., 3 tabs
Measurement of γ'precipitates in nimonic PE16
International Nuclear Information System (INIS)
Baker, C.; Lobb, R.C.
1977-09-01
γ' precipitates in Nimonic PE16 have been examined using bright and dark field imaging techniques in an electron microscope. The validity of these techniques to determine mean precipitate diameters, precipitate density and volume fraction is discussed. It is concluded that bright field imaging techniques are sufficiently accurate to measure γ' precipitate diameters but it is essential to use dark field imaging techniques to determine γ' precipitate density or volume fraction. (author)
Segregation to grain boundaries in nimonic PE16 superalloy
International Nuclear Information System (INIS)
Nettleship, D.J.; Wild, R.K.
1990-01-01
Nimonic PE16 alloy is a nickel-based superalloy containing 34 wt.% iron and 16wt.% chromium with additions of molybdenum, titanium and aluminium. It is used in the fuel assembly of the UK advanced gas-cooled reactors (AGR). This component supports significant loads in service and its mechanical integrity is therefore of paramount importance. Mechanical properties may be influenced by the grain size and grain boundary composition, both of which can themselves alter during service. Scanning Auger microscopy is a well-established method for investigating grain boundaries, and has now been applied to the study of PE16. In order to expose PE16 grain boundary surfaces it is necessary to hydrogen charge samples and fracture by pulling in tension at a slow strain rate within the ultra-high vacuum chamber of the Auger microprobe. A series of casts of nimonic PE16 alloy that have received a range of thermal ageing treatments have been fractured in an intergranular manner and the grain boundary composition determined. Segregation of trace and minority elements, particularly Mo and P, has been detected at grain boundaries. Significant variations between different as-manufactured casts were observed, whilst ageing brought about the growth of chromium-rich particles on the grain boundaries. Ductile fracture in PE16 followed a path through Ti(C, N) particles. Many of these particles incorporated large amounts of sulphur. (author)
Ring ductility of irradiated Inconel 706 and Nimonic PE16
International Nuclear Information System (INIS)
Huang, F.H.; Fish, R.L.
1984-01-01
The tensile ductility of fast neutron-irradiated, precipitation-hardened alloys Inconel 706 and Nimonic PE16 has been observed to be very low for certain test conditions. Explanations for the low ductility behavior have been sought by examination of broken tensile specimens with microscopy and other similar techniques. A ring compression test provides a method of evaluating the ductility of irradiated cladding specimens. Unlike the conventional uniaxial tensile testing in which the tensile specimen is deformed uniformly, the ring specimen is subjected to localized bending where the crack is initiated. The ductility can be estimated through an analysis of the bending of a ring in terms of strain hardening. Ring sections from irradiated, solution-treated Inconel 706 and Nimonic PE16 were compressed in the diametral direction to provide load-deflection records over a wide range of irradiation and test temperatures. Results showed that ductility in both alloys decreased with increasing test temperatures. The poorest ductility was exhibited at different irradiation temperatures in the two alloys - near 550 0 C for PE16 and 460 to 520 0 C for Inconel 706. The ring ductility data indicate that the grain boundary strength is a major factor in controlling the ductility of the PE16 alloy
NIMONIC 263 microstructure and surface characterization after laser shock peening
Directory of Open Access Journals (Sweden)
P. Drobnjak
2015-07-01
Full Text Available The Laser Shock Peening (LSP is applied to the surface of Nimonic 263 alloy. The changes in microstructure and surface topography are observed and analyzed by Scanning Electron Microscopy (SEM, profilometer and microhardness tester. Various laser regimes are chosen which provoke effects of both mechanical and thermo-mechanical treatments of the sample surface. The optimal process parameters, that result in the finest microstructure, smooth and clean surface, are determined. Some wanted and unwanted phases leading to the crack formation are observed.
Fatigue performance of HFIR-irradiated Nimonic PE-16 at 4300C
International Nuclear Information System (INIS)
Grossbeck, M.L.; Liu, K.C.
1983-01-01
Nimonic PE-16 was irradiated in the HFIR to 6 to 9 dpa and 560 to 1000 at. ppM He at 430 0 C. Postirradiation fatigue tests revealed a reduction in fatigue life by about a factor of 10 at 430 0 C. In contrast to AISI type 316 stainless steel, no endurance limit was observed. All irradiated specimens exhibited some intergranular fracture with an increasing tendency toward cleavage-like intragranular fracture for low strain ranges
Reschka, S.; Munk, L.; Wriggers, P.; Maier, H. J.
2017-12-01
Nimonic 101 is one of the early nickel-based superalloys developed for the use in gas turbines. In such environments, the material is exposed to a combination of both high temperatures and mechanical loads for a long duration. Hence, thermal creep is of the utmost concern as it often limits service life. This study focuses on creep tests, carried out on Nimonic 101 at different temperatures under a constant tensile load of 735 MPa. To characterize the microstructural evolution, electron backscatter diffraction (EBSD) measurements were employed before and after loading. At higher temperatures, a significant change of the microstructure was observed. The grains elongated and aligned their orientation along the load axis. In parallel, a crystal plasticity material model has been set up in the classical large deformation framework. Modeling results are compared to the acquired EBSD data.
Evaluation of fatigue properties of HFIR-irradiated nimonic PE-16 at 4300C
International Nuclear Information System (INIS)
Grossbeck, M.L.; Liu, K.C.
1984-01-01
Nimonic PE-16 was irradiated in the HFIR to 6 to 9 dpa and 560 to 1000 at. ppM He at 430 0 C. Postirradiation fatigue tests revealed a reduction in fatigue life by about a factor of 10 at 430 0 C. In contrast with AISI type 316 stainless steel, no endurance limit was observed. All irradiated specimens exhibited some intergranular fracture with an increasing tendency toward cleavage like intragranular fracture for low strain ranges
Trim cut machining and surface integrity analysis of Nimonic 80A alloy using wire cut EDM
Directory of Open Access Journals (Sweden)
Amitesh Goswami
2017-02-01
Full Text Available This present work deals with the features of trim cut wire EDM machining of Nimonic 80A in terms of machining parameters, to predict material removal rate (MRR, surface roughness (Ra, wire wear ratio (WWR and microstructure analysis. Trim cut is performed after rough cut to remove the rough layer deposited after machining due to melting and re-solidification of the eroded metal from workpiece as well as from wire electrode. Taguchi’s design of experiments methodology has been used for planning and designing the experiments. The relative significance of various factors has also been evaluated and analyzed using ANOVA. The results clearly indicate trim cut potential for high surface finish compared to rough cut machining.
International Nuclear Information System (INIS)
Guillen Giron, Teodolito; Leon Salazar, Jose Luis
2015-01-01
TEM (Transmission Electron Microscopy) probes are analyzed in aeronautical applications. Intercrystalline defects present in the Nimonic 80A superalloy are studied after being thermally treated and then subjecting the specimens to cyclic stresses. The TEM test specimens are pre-tested under high frequency (1 000 Hz and 20 000 Hz) fatigue at the University of Siegen in Germany simulating the working conditions of this alloy in aircraft turbines or other types of aeronautical applications. The mechanical stress has generated many deformations and nanometric defects in this material, evidenced in the dislocations. Defects are observed using very powerful microscopy techniques such as TEM. The results are obtained from the TEM analysis and have revealed characteristic precipitates in the Nimonic 80A sample when subjected to thermal treatments. The alloy has evidenced the formation of dislocations resulting from the mechanical stresses of the specimens. The influence of rainfall is evidenced in the mechanism of formation, grouping and movement of the dislocations in the microstructure of the samples used. (author) [es
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFJ816 (Link to dictyBase) - - - Contig-U16255-1 CFJ816P (Link... to Original site) CFJ816F 562 CFJ816Z 721 CFJ816P 1263 - - Show CFJ816 Library CF (Link to library) Clone ID CFJ816 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTT...PATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTTG GSTTGSHTTTGGSTTGSHTTTGGS
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Conversion of a 5-year level premium term policy as provided for under § 1904 of title 38 U.S.C. 8.16 Section 8.16 Pensions... Plan § 8.16 Conversion of a 5-year level premium term policy as provided for under § 1904 of title 38 U...
30 CFR 816.151 - Primary roads.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Primary roads. 816.151 Section 816.151 Mineral... roads. Primary roads shall meet the requirements of section 816.150 and the additional requirements of this section. (a) Certification. The construction or reconstruction of primary roads shall be certified...
30 CFR 816.181 - Support facilities.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Support facilities. 816.181 Section 816.181... § 816.181 Support facilities. (a) Support facilities shall be operated in accordance with a permit... results. (b) In addition to the other provisions of this part, support facilities shall be located...
2018-01-01
The inclusive $\\Upsilon$ production in p-Pb interactions at the centre-of-mass energy per nucleon-nucleon collision $\\sqrt{s_{\\rm NN}} = 8.16$ TeV is studied with the ALICE detector at the CERN LHC. The measurement has been performed reconstructing $\\Upsilon$(1S) and $\\Upsilon$(2S) mesons via their dimuon decay channel, in the centre-of-mass rapidities $2.03 < y_{\\rm cms} < 3.53$ and $-4.46 < y_{\\rm cms} < -2.96$, down to zero transverse momentum. Preliminary results on the inclusive $\\Upsilon$(1S) nuclear modification factors ($R_{\\rm pPb}$) as a function of rapidity, transverse momentum ($p_{\\rm T}$) and centrality of the collisions will be presented. The results will be compared with those obtained by ALICE in p-Pb collisions at $\\sqrt{s_{\\rm NN}} = 8.16$ TeV and with theoretical model calculations. The inclusive $\\Upsilon$(2S) $R_{\\rm pPb}$ will also be discussed and compared to the corresponding $\\Upsilon(1S)$ measurement.
The X-40 sub-scale technology demonstrator and its U.S. Army CH-47 Chinook helicopter mothership fly
2000-01-01
The X-40 sub-scale technology demonstrator and its U.S. Army CH-47 Chinook helicopter mothership fly over a dry lakebed runway during a captive-carry test flight from NASA's Dryden Flight Research Center, Edwards, California. The X-40 is attached to a sling which is suspended from the CH-47 by a 110-foot-long cable during the tests, while a small parachute trails behind to provide stability. The captive carry flights are designed to verify the X-40's navigation and control systems, rigging angles for its sling, and stability and control of the helicopter while carrying the X-40 on a tether. Following a series of captive-carry flights, the X-40 made free flights from a launch altitude of about 15,000 feet above ground, gliding to a fully autonomous landing. The X-40 is an unpowered 82 percent scale version of the X-37, a Boeing-developed spaceplane designed to demonstrate various advanced technologies for development of future lower-cost access to space vehicles. The X-37 will be carried into space aboard a space shuttle and then released to perform various maneuvers and a controlled re-entry through the Earth's atmosphere to an airplane-style landing on a runway, controlled entirely by pre-programmed computer software.
17 CFR 8.16 - Settlement offers.
2010-04-01
... Section 8.16 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION EXCHANGE PROCEDURES FOR DISCIPLINARY, SUMMARY, AND MEMBERSHIP DENIAL ACTIONS Disciplinary Procedure § 8.16 Settlement... the disciplinary committee at any time after the investigation report is completed. The disciplinary...
Microstructural investigation of variations in the proof strength of Nimonic PE16
International Nuclear Information System (INIS)
Riley, B.F.; Wilson, E.G.; Jones, A.R.
1987-01-01
Nimonic PE16 shows a correlation of stress rupture behaviour after irradiation with proof strength. Proof testing of material from bars from several casts yielded a relationship (Hall-Petch) between the peak-aged proof stress and grain size -1/2 but the scatter in proof stress values at a given grain size merited further microstructural study. Transmission electron microscopy revealed that high proof stress material contained dislocation densities consistent with material which had received 1 to 2% cold work, verified by examination of lightly prestrained tensile specimens. Ageing to peak strength induced partial recovery but some variability in proof stress remained. Variations in γ' size and composition having been eliminated, the scatter in proof stress values was attributed to variable cold work induced by the commercial bar straightening process. (Author)
Damage structure in Nimonic PE16 alloy ion bombarded to high doses and gas levels
International Nuclear Information System (INIS)
Farrell, K.; Packan, N.H.
1981-01-01
The Nimonic PE16 alloy in solution-treated-and-aged condition was bombarded simultaneously with nickel ions and α and deuteron beams at 625 0 C to doses of 80 to 313 dpa at He/dpa = 10 and D/dpa = 25. Microstructural changes consisted of the introduction of dislocations and of cavities, and the redistribuion of γ' precipitates to these defects. Cavitational swelling remained below 1%. Cavities were represented by several distinct size classes, the smaller ones believed to be gas bubbles, and some larger ones associated with preferred growth of precipitate. Formation of bubbles at grain boundaries, and large cavities at incoherent twins intensified the possibility of mechanical separation of interfaces under high-gas irradiation conditions
Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Flechl, Martin; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Grossmann, Johannes; Hrubec, Josef; Jeitler, Manfred; König, Axel; Krammer, Natascha; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Pree, Elias; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Di Croce, Davide; Janssen, Xavier; Lauwers, Jasper; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lontkovskyi, Denys; Lowette, Steven; Moortgat, Seth; Moreels, Lieselotte; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Beghin, Diego; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Dorney, Brian; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Karapostoli, Georgia; Lenzi, Thomas; Luetic, Jelena; Maerschalk, Thierry; Marinov, Andrey; Seva, Tomislav; Starling, Elizabeth; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Yonamine, Ryo; Zenoni, Florian; Zhang, Fengwangdong; Cimmino, Anna; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Roskas, Christos; Salva Diblen, Sinem; Tytgat, Michael; Verbeke, Willem; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caputo, Claudio; Caudron, Adrien; David, Pieter; De Visscher, Simon; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Komm, Matthias; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Quertenmont, Loic; Saggio, Alessia; Vidal Marono, Miguel; Wertz, Sébastien; Zobec, Joze; Beliy, Nikita; Aldá Júnior, Walter Luiz; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Correa Martins Junior, Marcos; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Coelho, Eduardo; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; Fonseca De Souza, Sandro; Huertas Guativa, Lina Milena; Malbouisson, Helena; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Sanchez Rosas, Luis Junior; Santoro, Alberto; Sznajder, Andre; Thiel, Mauricio; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Ruiz Vargas, José Cupertino; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Misheva, Milena; Rodozov, Mircho; Shopova, Mariana; Sultanov, Georgi; Dimitrov, Anton; Glushkov, Ivan; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Yuan, Li; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liao, Hongbo; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhang, Sijing; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Li, Qiang; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Avila, Carlos; Cabrera, Andrés; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Ruiz Alvarez, José David; Segura Delgado, Manuel Alejandro; Courbon, Benoit; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Ribeiro Cipriano, Pedro M; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Starodumov, Andrei; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Carrera Jarrin, Edgar; Abdelalim, Ahmed Ali; Mohammed, Yasser; Salama, Elsayed; Dewanjee, Ram Krishna; Kadastik, Mario; Perrini, Lucia; Raidal, Martti; Tiko, Andres; Veelken, Christian; Eerola, Paula; Kirschenmann, Henning; Pekkanen, Juska; Voutilainen, Mikko; Havukainen, Joona; Heikkilä, Jaana Kristiina; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Laurila, Santeri; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Siikonen, Hannu; Tuominen, Eija; Tuominiemi, Jorma; Talvitie, Joonas; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Ghosh, Saranya; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Kucher, Inna; Leloup, Clément; Locci, Elizabeth; Machet, Martina; Malcles, Julie; Negro, Giulia; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Amendola, Chiara; Antropov, Iurii; Baffioni, Stephanie; Beaudette, Florian; Busson, Philippe; Cadamuro, Luca; Charlot, Claude; Granier de Cassagnac, Raphael; Jo, Mihee; Lisniak, Stanislav; Lobanov, Artur; Martin Blanco, Javier; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Paganini, Pascal; Pigard, Philipp; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Stahl Leiton, Andre Govinda; Strebler, Thomas; Yilmaz, Yetkin; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Buttignol, Michael; Chabert, Eric Christian; Chanon, Nicolas; Collard, Caroline; Conte, Eric; Coubez, Xavier; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Jansová, Markéta; Le Bihan, Anne-Catherine; Tonon, Nicolas; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Schomakers, Christian; Schulz, Johannes; Zhukov, Valery; Albert, Andreas; Dietz-Laursonn, Erik; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Erdweg, Sören; Esch, Thomas; Fischer, Robert; Güth, Andreas; Hamer, Matthias; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Knutzen, Simon; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Teyssier, Daniel; Thüer, Sebastian; Flügge, Günter; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bermúdez Martínez, Armando; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Diez Pardos, Carmen; Eckerlin, Guenter; Eckstein, Doris; Eichhorn, Thomas; Eren, Engin; Gallo, Elisabetta; Garay Garcia, Jasone; Geiser, Achim; Gizhko, Andrii; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Guthoff, Moritz; Harb, Ali; Hauk, Johannes; Hempel, Maria; Jung, Hannes; Kalogeropoulos, Alexis; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Korol, Ievgen; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Leonard, Jessica; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mittag, Gregor; Mnich, Joachim; Mussgiller, Andreas; Ntomari, Eleni; Pitzl, Daniel; Raspereza, Alexei; Savitskyi, Mykola; Saxena, Pooja; Shevchenko, Rostyslav; Spannagel, Simon; Stefaniuk, Nazar; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Aggleton, Robin; Bein, Samuel; Blobel, Volker; Centis Vignali, Matteo; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hinzmann, Andreas; Hoffmann, Malte; Karavdina, Anastasia; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Lapsien, Tobias; Marchesini, Ivan; Marconi, Daniele; Meyer, Mareike; Niedziela, Marek; Nowatschin, Dominik; Pantaleo, Felice; Peiffer, Thomas; Perieanu, Adrian; Scharf, Christian; Schleper, Peter; Schmidt, Alexander; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Tholen, Heiner; Troendle, Daniel; Usai, Emanuele; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baselga, Marta; Baur, Sebastian; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Faltermann, Nils; Freund, Benedikt; Friese, Raphael; Giffels, Manuel; Harrendorf, Marco Alexander; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Kudella, Simon; Mildner, Hannes; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Topsis-Giotis, Iasonas; Karathanasis, George; Kesisoglou, Stilianos; Panagiotou, Apostolos; Saoulidou, Niki; Kousouris, Konstantinos; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Mallios, Stavros; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Csanad, Mate; Filipovic, Nicolas; Pasztor, Gabriella; Surányi, Olivér; Veres, Gabor Istvan; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Hunyadi, Ádám; Sikler, Ferenc; Veszpremi, Viktor; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Bahinipati, Seema; Bhowmik, Sandeep; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Sahoo, Niladribihari; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chawla, Ridhi; Dhingra, Nitish; Kalsi, Amandeep Kaur; Kaur, Anterpreet; Kaur, Manjit; Kaur, Sandeep; Kumar, Ramandeep; Kumari, Priyanka; Mehta, Ankita; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Shah, Aashaq; Bhardwaj, Ashutosh; Chauhan, Sushil; Choudhary, Brajesh C; Garg, Rocky Bala; Keshri, Sumit; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Sharma, Ramkrishna; Bhardwaj, Rishika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Bhawandeep, Bhawandeep; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Majumdar, Nayana; Modak, Atanu; Mondal, Kuntal; Mukhopadhyay, Supratik; Nandan, Saswati; Purohit, Arnab; Roy, Ashim; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Mohanty, Ajit Kumar; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Dugad, Shashikant; Mahakud, Bibhuprasad; Mitra, Soureek; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sarkar, Tanmay; Wickramage, Nadeesha; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Paktinat Mehdiabadi, Saeid; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Errico, Filippo; Fiore, Luigi; Iaselli, Giuseppe; Lezki, Samet; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Borgonovi, Lisa; Braibant-Giacomelli, Sylvie; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Costa, Salvatore; Di Mattia, Alessandro; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Calvelli, Valerio; Ferro, Fabrizio; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Beschi, Andrea; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pauwels, Kristof; Pedrini, Daniele; Pigazzini, Simone; Ragazzi, Stefano; Redaelli, Nicola; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Guida, Salvatore; Fabozzi, Francesco; Fienga, Francesco; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Thyssen, Filip; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Carlin, Roberto; Carvalho Antunes De Oliveira, Alexandra; Checchia, Paolo; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Margoni, Martino; Meneguzzo, Anna Teresa; Pozzobon, Nicola; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Biasini, Maurizio; Bilei, Gian Mario; Cecchi, Claudia; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Leonardi, Roberto; Manoni, Elisa; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Rossi, Alessandro; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Giannini, Leonardo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Lomtadze, Teimuraz; Manca, Elisabetta; Mandorli, Giulio; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Daci, Nadir; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Margaroli, Fabrizio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Costa, Marco; Covarelli, Roberto; Degano, Alessandro; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Ravera, Fabio; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Traczyk, Piotr; Belforte, Stefano; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Moon, Chang-Seong; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Lee, Ari; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Brochero Cifuentes, Javier Andres; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Kim, Yongsun; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Choi, Minkyoo; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Reyes-Almanza, Rogelio; Ramirez-Sanchez, Gabriel; Duran-Osuna, Cecilia; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Rabadán-Trejo, Raúl Iraq; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Galinhas, Bruno; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Seixas, Joao; Strong, Giles; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Bylinkin, Alexander; Chadeeva, Marina; Parygin, Pavel; Philippov, Dmitry; Polikarpov, Sergey; Popova, Elena; Rusinov, Vladimir; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Demiyanov, Andrey; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Korotkikh, Vladimir; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Vardanyan, Irina; Blinov, Vladimir; Skovpen, Yuri; Shtol, Dmitry; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Mandrik, Petr; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Rekovic, Vladimir; Alcaraz Maestre, Juan; Barrio Luna, Mar; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Escalante Del Valle, Alberto; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Moran, Dermot; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Álvarez Fernández, Adrian; Albajar, Carmen; de Trocóniz, Jorge F; Missiroli, Marino; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Sanchez Cruz, Sergio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Curras, Esteban; Duarte Campderros, Jordi; Fernandez, Marcos; Garcia-Ferrero, Juan; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Akgun, Bora; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Bendavid, Joshua; Bianco, Michele; Bloch, Philippe; Bocci, Andrea; Botta, Cristina; Camporesi, Tiziano; Castello, Roberto; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Gruttola, Michele; De Roeck, Albert; Deelen, Nikkie; Dobson, Marc; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fallavollita, Francesco; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gilbert, Andrew; Gill, Karl; Glege, Frank; Gulhan, Doga; Harris, Philip; Hegeman, Jeroen; Innocente, Vincenzo; Jafari, Abideh; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Knünz, Valentin; Kornmayer, Andreas; Kortelainen, Matti J; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Lucchini, Marco Toliman; Malgeri, Luca; Mannelli, Marcello; Martelli, Arabella; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Neugebauer, Hannes; Ngadiuba, Jennifer; Orfanelli, Styliani; Orsini, Luciano; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Rabady, Dinyar; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Stakia, Anna; Steggemann, Jan; Stoye, Markus; Tosi, Mia; Treille, Daniel; Triossi, Andrea; Tsirou, Andromachi; Veckalns, Viesturs; Verweij, Marta; Zeuner, Wolfram Dietrich; Bertl, Willi; Caminada, Lea; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Backhaus, Malte; Bäni, Lukas; Berger, Pirmin; Bianchini, Lorenzo; Casal, Bruno; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dorfer, Christian; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Kasieczka, Gregor; Klijnsma, Thomas; Lustermann, Werner; Mangano, Boris; Marionneau, Matthieu; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Quittnat, Milena; Reichmann, Michael; Sanz Becerra, Diego Alejandro; Schönenberger, Myriam; Shchutska, Lesya; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Canelli, Maria Florencia; De Cosa, Annapaola; Del Burgo, Riccardo; Donato, Silvio; Galloni, Camilla; Hreus, Tomas; Kilminster, Benjamin; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Schweiger, Korbinian; Seitz, Claudia; Takahashi, Yuta; Zucchetta, Alberto; Candelise, Vieri; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Fiori, Francesco; Hou, George Wei-Shu; Hsiung, Yee; Liu, Yueh-Feng; Lu, Rong-Shyang; Paganis, Efstathios; Psallidas, Andreas; Steen, Arnaud; Tsai, Jui-fa; Asavapibhop, Burin; Kovitanggoon, Kittikul; Singh, Gurpreet; Srimanobhas, Norraphat; Bakirci, Mustafa Numan; Bat, Ayse; Boran, Fatma; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Tali, Bayram; Tok, Ufuk Guney; Topakli, Huseyin; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Bilin, Bugra; Karapinar, Guler; Ocalan, Kadir; Yalvac, Metin; Zeyrek, Mehmet; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Nazlim Agaras, Merve; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Grynyov, Boris; Levchuk, Leonid; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Davignon, Olivier; Flacher, Henning; Goldstein, Joel; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Newbold, Dave M; Paramesvaran, Sudarshan; Sakuma, Tai; Seif El Nasr-storey, Sarah; Smith, Dominic; Smith, Vincent J; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Calligaris, Luigi; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Auzinger, Georg; Bainbridge, Robert; Borg, Johan; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Citron, Matthew; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; De Wit, Adinda; Della Negra, Michel; Di Maria, Riccardo; Elwood, Adam; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Lane, Rebecca; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Mastrolorenzo, Luca; Matsushita, Takashi; Nash, Jordan; Nikitenko, Alexander; Palladino, Vito; Pesaresi, Mark; Raymond, David Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Vazquez Acosta, Monica; Virdee, Tejinder; Wardle, Nicholas; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Zahid, Sema; Borzou, Ahmad; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Pastika, Nathaniel; Smith, Caleb; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Avetisyan, Aram; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Cutts, David; Garabedian, Alex; Hadley, Mary; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Lee, Jangbae; Mao, Zaixing; Narain, Meenakshi; Pazzini, Jacopo; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Yu, David; Band, Reyer; Brainerd, Christopher; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Gardner, Michael; Ko, Winston; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Smith, John; Stolp, Dustin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Regnard, Simon; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Ellison, John Anthony; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Heilman, Jesse; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Si, Weinan; Wang, Long; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Gilbert, Dylan; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Macneill, Ian; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; George, Christopher; Golf, Frank; Gouskos, Loukas; Gran, Jason; Heller, Ryan; Incandela, Joe; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Yoo, Jaehyeok; Anderson, Dustin; Bornheim, Adolf; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Pena, Cristian; Spiropulu, Maria; Vlimant, Jean-Roch; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Russ, James; Sun, Menglei; Vogel, Helmut; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Leontsinis, Stefanos; Mulholland, Troy; Stenson, Kevin; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Chu, Jennifer; Dittmer, Susan; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Quach, Dan; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Alyari, Maral; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cerati, Giuseppe Benedetto; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lopes De Sá, Rafael; Lykken, Joseph; Maeshima, Kaori; Magini, Nicolo; Marraffino, John Michael; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Carnes, Andrew; Carver, Matthew; Curry, David; Field, Richard D; Furic, Ivan-Kresimir; Gleyzer, Sergei V; Joshi, Bhargav Madhusudan; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Rank, Douglas; Shi, Kun; Sperka, David; Terentyev, Nikolay; Thomas, Laurent; Wang, Jian; Wang, Sean-Jiun; Yelton, John; Joshi, Yagya Raj; Linn, Stephan; Markowitz, Pete; Rodriguez, Jorge Luis; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Martinez, German; Perry, Thomas; Prosper, Harrison; Saha, Anirban; Santra, Arka; Sharma, Varun; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Trauger, Hallie; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zhang, Jingyu; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Yi, Kai; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Royon, Christophe; Sanders, Stephen; Schmitz, Erich; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Maravin, Yurii; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Toda, Sachiko; Rebassoo, Finn; Wright, Douglas; Anelli, Christopher; Baden, Drew; Baron, Owen; Belloni, Alberto; Calvert, Brian; Eno, Sarah Catherine; Feng, Yongbin; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Barbieri, Richard; Baty, Austin; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hsu, Dylan; Hu, Miao; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lai, Yue Shi; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Salfeld-Nebgen, Jakob; Stephans, George; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Hiltbrand, Joshua; Kalafut, Sean; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Turkewitz, Jared; Wadud, Mohammad Abrar; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Dolen, James; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Alverson, George; Barberis, Emanuela; Hortiangtham, Apichart; Massironi, Andrea; Morse, David Michael; Orimoto, Toyoko; Teixeira De Lima, Rafael; Trocino, Daniele; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Liu, Bingxuan; Luo, Wuming; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Driga, Olga; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Higginbotham, Samuel; Lange, David; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Stickland, David; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Das, Souvik; Folgueras, Santiago; Gutay, Laszlo; Jha, Manoj; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Miller, David Harry; Neumeister, Norbert; Peng, Cheng-Chieh; Qiu, Hao; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xie, Wei; Cheng, Tongguang; Parashar, Neeti; Stupak, John; Adair, Antony; Chen, Zhenyu; Ecklund, Karl Matthew; Freed, Sarah; Geurts, Frank JM; Guilbaud, Maxime; Kilpatrick, Matthew; Li, Wei; Michlin, Benjamin; Northup, Michael; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Shi, Wei; Tu, Zhoudunming; Zabel, James; Zhang, Aobo; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Verzetti, Mauro; Ciesielski, Robert; Goulianos, Konstantin; Mesropian, Christina; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Foerster, Mark; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Tatarinov, Aysen; Ulmer, Keith; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Faulkner, James; Gurpinar, Emine; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Libeiro, Terence; Mengke, Tielige; Muthumuni, Samila; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Padeken, Klaas; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Joyce, Matthew; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Harr, Robert; Karchin, Paul Edmund; Poudyal, Nabin; Sturdy, Jared; Thapa, Prakash; Zaleski, Shawn; Brodski, Michael; Buchanan, James; Caillol, Cécile; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Polese, Giovanni; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Taylor, Devin; Woods, Nathaniel
2018-01-11
The pseudorapidity distributions of charged hadrons in proton-lead collisions at nucleon-nucleon center-of-mass energies ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 5.02 and 8.16 TeV are presented. The measurements are based on data samples collected by the CMS experiment at the LHC. The number of primary charged hadrons produced in non-single-diffractive proton-lead collisions is determined in the pseudorapidity range $| \\eta_{\\text{lab}} | } | _ {| \\eta_{\\text{cm}} | < 0.5 }$ are 17.31 $\\pm$ 0.01 (stat) $\\pm$ 0.59 (syst) and 20.10 $\\pm$ 0.01 (stat) $\\pm$ 0.85 (syst) at ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 5.02 and 8.16 TeV, respectively. The particle densities per participant nucleon are compared to similar measurements in proton-proton, proton-nucleus, and nucleus-nucleus collisions.
30 CFR 816.83 - Coal mine waste: Refuse piles.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Coal mine waste: Refuse piles. 816.83 Section... ACTIVITIES § 816.83 Coal mine waste: Refuse piles. Refuse piles shall meet the requirements of § 816.81, the... drainage may not be diverted over the outslope of the refuse piles. Runoff from the areas above the refuse...
30 CFR 816.79 - Protection of underground mining.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Protection of underground mining. 816.79 Section 816.79 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PERMANENT PROGRAM PERFORMANCE STANDARDS PERMANENT PROGRAM PERFORMANCE STANDARDS-SURFACE MINING...
30 CFR 816.46 - Hydrologic balance: Siltation structures.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Hydrologic balance: Siltation structures. 816...-SURFACE MINING ACTIVITIES § 816.46 Hydrologic balance: Siltation structures. (a) For the purpose of this... activities include diversion ditches, siltation structures, or roads that are designed constructed and...
Sirunyan, A. M.; Tumasyan, A.; Adam, W.; Ambrogi, F.; Asilar, E.; Bergauer, T.; Brandstetter, J.; Brondolin, E.; Drag-icevic, M.; Erö, J.; Flechl, M.; Friedl, M.; Frühwirth, R.; Ghete, V. M.; Grossmann, J.; Hrubec, J.; Jeitler, M.; König, A.; Krammer, N.; Krätschmer, I.; Liko, D.; Madlener, T.; Mikulec, I.; Pree, E.; Rad, N.; Rohringer, H.; Schieck, J.; Schöfbeck, R.; Spanring, M.; Spitzbart, D.; Waltenberger, W.; Wittmann, J.; Wulz, C.-E.; Zarucki, M.; Chekhovsky, V.; Mossolov, V.; Suarez Gonzalez, J.; De Wolf, E. A.; Di Croce, D.; Janssen, X.; Lauwers, J.; Van De Klundert, M.; Van Haevermaet, H.; Van Mechelen, P.; Van Remortel, N.; Abu Zeid, S.; Blekman, F.; D'Hondt, J.; De Bruyn, I.; De Clercq, J.; Deroover, K.; Flouris, G.; Lontkovskyi, D.; Lowette, S.; Moortgat, S.; Moreels, L.; Python, Q.; Skovpen, K.; Tavernier, S.; Van Doninck, W.; Van Mulders, P.; Van Parijs, I.; Beghin, D.; Brun, H.; Clerbaux, B.; De Lentdecker, G.; Delannoy, H.; Dorney, B.; Fasanella, G.; Favart, L.; Goldouzian, R.; Grebenyuk, A.; Karapostoli, G.; Lenzi, T.; Luetic, J.; Maerschalk, T.; Marinov, A.; Seva, T.; Starling, E.; Vander Velde, C.; Vanlaer, P.; Vannerom, D.; Yonamine, R.; Zenoni, F.; Zhang, F.; Cimmino, A.; Cornelis, T.; Dobur, D.; Fagot, A.; Gul, M.; Khvastunov, I.; Poyraz, D.; Roskas, C.; Salva, S.; Tytgat, M.; Verbeke, W.; Zaganidis, N.; Bakhshiansohi, H.; Bondu, O.; Brochet, S.; Bruno, G.; Caputo, C.; Caudron, A.; David, P.; De Visscher, S.; Delaere, C.; Delcourt, M.; Francois, B.; Giammanco, A.; Komm, M.; Krintiras, G.; Lemaitre, V.; Magitteri, A.; Mertens, A.; Musich, M.; Piotrzkowski, K.; Quertenmont, L.; Saggio, A.; Vidal Marono, M.; Wertz, S.; Zobec, J.; Beliy, N.; Aldá Júnior, W. L.; Alves, F. L.; Alves, G. A.; Brito, L.; Correa Martins Junior, M.; Hensel, C.; Moraes, A.; Pol, M. E.; Rebello Teles, P.; Belchior Batista Das Chagas, E.; Carvalho, W.; Chinellato, J.; Coelho, E.; Da Costa, E. M.; Da Silveira, G. G.; De Jesus Damiao, D.; Fonseca De Souza, S.; Huertas Guativa, L. M.; Malbouisson, H.; Melo De Almeida, M.; Mora Herrera, C.; Mundim, L.; Nogima, H.; Sanchez Rosas, L. J.; Santoro, A.; Sznajder, A.; Thiel, M.; Tonelli Manganote, E. J.; Torres Da Silva De Araujo, F.; Vilela Pereira, A.; Ahuja, S.; Bernardes, C. A.; Fernandez Perez Tomei, T. R.; Gregores, E. M.; Mercadante, P. G.; Novaes, S. F.; Padula, Sandra S.; Romero Abad, D.; Ruiz Vargas, J. C.; Aleksandrov, A.; Hadjiiska, R.; Iaydjiev, P.; Misheva, M.; Rodozov, M.; Shopova, M.; Sultanov, G.; Dimitrov, A.; Glushkov, I.; Litov, L.; Pavlov, B.; Petkov, P.; Fang, W.; Gao, X.; Yuan, L.; Ahmad, M.; Bian, J. G.; Chen, G. M.; Chen, H. S.; Chen, M.; Chen, Y.; Jiang, C. H.; Leggat, D.; Liao, H.; Liu, Z.; Romeo, F.; Shaheen, S. M.; Spiezia, A.; Tao, J.; Wang, C.; Wang, Z.; Yazgan, E.; Zhang, H.; Zhang, S.; Zhao, J.; Ban, Y.; Chen, G.; Li, Q.; Liu, S.; Mao, Y.; Qian, S. J.; Wang, D.; Xu, Z.; Avila, C.; Cabrera, A.; Chaparro Sierra, L. F.; Florez, C.; González Hernández, C. F.; Ruiz Alvarez, J. D.; Segura Delgado, M. A.; Courbon, B.; Godinovic, N.; Lelas, D.; Puljak, I.; Ribeiro Cipriano, P. M.; Sculac, T.; Antunovic, Z.; Kovac, M.; Brigljevic, V.; Ferencek, D.; Kadija, K.; Mesic, B.; Starodumov, A.; Susa, T.; Ather, M. W.; Attikis, A.; Mavromanolakis, G.; Mousa, J.; Nicolaou, C.; Ptochos, F.; Razis, P. A.; Rykaczewski, H.; Finger, M.; Finger, M.; Carrera Jarrin, E.; Abdelalim, A. A.; Mohammed, Y.; Salama, E.; Dewanjee, R. K.; Kadastik, M.; Perrini, L.; Raidal, M.; Tiko, A.; Veelken, C.; Eerola, P.; Kirschenmann, H.; Pekkanen, J.; Voutilainen, M.; Havukainen, J.; Heikkilä, J. K.; Järvinen, T.; Karimäki, V.; Kinnunen, R.; Lampén, T.; Lassila-Perini, K.; Laurila, S.; Lehti, S.; Lindén, T.; Luukka, P.; Siikonen, H.; Tuominen, E.; Tuominiemi, J.; Talvitie, J.; Tuuva, T.; Besancon, M.; Couderc, F.; Dejardin, M.; Denegri, D.; Faure, J. L.; Ferri, F.; Ganjour, S.; Ghosh, S.; Givernaud, A.; Gras, P.; Hamel de Monchenault, G.; Jarry, P.; Kucher, I.; Leloup, C.; Locci, E.; Machet, M.; Malcles, J.; Negro, G.; Rander, J.; Rosowsky, A.; Sahin, M. Ö.; Titov, M.; Abdulsalam, A.; Amendola, C.; Antropov, I.; Baffioni, S.; Beaudette, F.; Busson, P.; Cadamuro, L.; Charlot, C.; Granier de Cassagnac, R.; Jo, M.; Lisniak, S.; Lobanov, A.; Martin Blanco, J.; Nguyen, M.; Ochando, C.; Ortona, G.; Paganini, P.; Pigard, P.; Salerno, R.; Sauvan, J. B.; Sirois, Y.; Stahl Leiton, A. G.; Strebler, T.; Yilmaz, Y.; Zabi, A.; Zghiche, A.; Agram, J.-L.; Andrea, J.; Bloch, D.; Brom, J.-M.; Buttignol, M.; Chabert, E. C.; Chanon, N.; Collard, C.; Conte, E.; Coubez, X.; Fontaine, J.-C.; Gelé, D.; Goerlach, U.; Jansová, M.; Le Bihan, A.-C.; Tonon, N.; Van Hove, P.; Gadrat, S.; Beauceron, S.; Bernet, C.; Boudoul, G.; Chierici, R.; Contardo, D.; Depasse, P.; El Mamouni, H.; Fay, J.; Finco, L.; Gascon, S.; Gouzevitch, M.; Grenier, G.; Ille, B.; Lagarde, F.; Laktineh, I. B.; Lethuillier, M.; Mirabito, L.; Pequegnot, A. L.; Perries, S.; Popov, A.; Sordini, V.; Vander Donckt, M.; Viret, S.; Toriashvili, T.; Tsamalaidze, Z.; Autermann, C.; Feld, L.; Kiesel, M. K.; Klein, K.; Lipinski, M.; Preuten, M.; Schomakers, C.; Schulz, J.; Zhukov, V.; Albert, A.; Dietz-Laursonn, E.; Duchardt, D.; Endres, M.; Erdmann, M.; Erdweg, S.; Esch, T.; Fischer, R.; Güth, A.; Hamer, M.; Hebbeker, T.; Heidemann, C.; Hoepfner, K.; Knutzen, S.; Merschmeyer, M.; Meyer, A.; Millet, P.; Mukherjee, S.; Pook, T.; Radziej, M.; Reithler, H.; Rieger, M.; Scheuch, F.; Teyssier, D.; Thüer, S.; Flügge, G.; Kargoll, B.; Kress, T.; Künsken, A.; Müller, T.; Nehrkorn, A.; Nowack, A.; Pistone, C.; Pooth, O.; Stahl, A.; Aldaya Martin, M.; Arndt, T.; Asawatangtrakuldee, C.; Beernaert, K.; Behnke, O.; Behrens, U.; Bermúdez Martínez, A.; Bin Anuar, A. A.; Borras, K.; Botta, V.; Campbell, A.; Connor, P.; Contreras-Campana, C.; Costanza, F.; Diez Pardos, C.; Eckerlin, G.; Eckstein, D.; Eichhorn, T.; Eren, E.; Gallo, E.; Garay Garcia, J.; Geiser, A.; Gizhko, A.; Grados Luyando, J. M.; Grohsjean, A.; Gunnellini, P.; Guthoff, M.; Harb, A.; Hauk, J.; Hempel, M.; Jung, H.; Kalogeropoulos, A.; Kasemann, M.; Keaveney, J.; Kleinwort, C.; Korol, I.; Krücker, D.; Lange, W.; Lelek, A.; Lenz, T.; Leonard, J.; Lipka, K.; Lohmann, W.; Mankel, R.; Melzer-Pellmann, I.-A.; Meyer, A. B.; Mittag, G.; Mnich, J.; Mussgiller, A.; Ntomari, E.; Pitzl, D.; Raspereza, A.; Savitskyi, M.; Saxena, P.; Shevchenko, R.; Spannagel, S.; Stefaniuk, N.; Van Onsem, G. P.; Walsh, R.; Wen, Y.; Wichmann, K.; Wissing, C.; Zenaiev, O.; Aggleton, R.; Bein, S.; Blobel, V.; Centis Vignali, M.; Dreyer, T.; Garutti, E.; Gonzalez, D.; Haller, J.; Hinzmann, A.; Hoffmann, M.; Karavdina, A.; Klanner, R.; Kogler, R.; Kovalchuk, N.; Kurz, S.; Lapsien, T.; Marchesini, I.; Marconi, D.; Meyer, M.; Niedziela, M.; Nowatschin, D.; Pantaleo, F.; Peiffer, T.; Perieanu, A.; Scharf, C.; Schleper, P.; Schmidt, A.; Schumann, S.; Schwandt, J.; Sonneveld, J.; Stadie, H.; Steinbrück, G.; Stober, F. M.; Stöver, M.; Tholen, H.; Troendle, D.; Usai, E.; Vanhoefer, A.; Vormwald, B.; Akbiyik, M.; Barth, C.; Baselga, M.; Baur, S.; Butz, E.; Caspart, R.; Chwalek, T.; Colombo, F.; De Boer, W.; Dierlamm, A.; Faltermann, N.; Freund, B.; Friese, R.; Giffels, M.; Harrendorf, M. A.; Hartmann, F.; Heindl, S. M.; Husemann, U.; Kassel, F.; Kudella, S.; Mildner, H.; Mozer, M. U.; Müller, Th.; Plagge, M.; Quast, G.; Rabbertz, K.; Schröder, M.; Shvetsov, I.; Sieber, G.; Simonis, H. J.; Ulrich, R.; Wayand, S.; Weber, M.; Weiler, T.; Williamson, S.; Wöhrmann, C.; Wolf, R.; Anagnostou, G.; Daskalakis, G.; Geralis, T.; Kyriakis, A.; Loukas, D.; Topsis-Giotis, I.; Karathanasis, G.; Kesisoglou, S.; Panagiotou, A.; Saoulidou, N.; Kousouris, K.; Evangelou, I.; Foudas, C.; Kokkas, P.; Mallios, S.; Manthos, N.; Papadopoulos, I.; Paradas, E.; Strologas, J.; Triantis, F. A.; Csanad, M.; Filipovic, N.; Pasztor, G.; Surányi, O.; Veres, G. I.; Bencze, G.; Hajdu, C.; Horvath, D.; Hunyadi, Á.; Sikler, F.; Veszpremi, V.; Beni, N.; Czellar, S.; Karancsi, J.; Makovec, A.; Molnar, J.; Szillasi, Z.; Bartók, M.; Raics, P.; Trocsanyi, Z. L.; Ujvari, B.; Choudhury, S.; Komaragiri, J. R.; Bahinipati, S.; Bhowmik, S.; Mal, P.; Mandal, K.; Nayak, A.; Sahoo, D. K.; Sahoo, N.; Swain, S. K.; Bansal, S.; Beri, S. B.; Bhatnagar, V.; Chawla, R.; Dhingra, N.; Kalsi, A. K.; Kaur, A.; Kaur, M.; Kaur, S.; Kumar, R.; Kumari, P.; Mehta, A.; Singh, J. B.; Walia, G.; Kumar, Ashok; Shah, Aashaq; Bhardwaj, A.; Chauhan, S.; Choudhary, B. C.; Garg, R. B.; Keshri, S.; Kumar, A.; Malhotra, S.; Naimuddin, M.; Ranjan, K.; Sharma, R.; Bhardwaj, R.; Bhattacharya, R.; Bhattacharya, S.; Bhawandeep, U.; Dey, S.; Dutt, S.; Dutta, S.; Ghosh, S.; Majumdar, N.; Modak, A.; Mondal, K.; Mukhopadhyay, S.; Nandan, S.; Purohit, A.; Roy, A.; Roy Chowdhury, S.; Sarkar, S.; Sharan, M.; Thakur, S.; Behera, P. K.; Chudasama, R.; Dutta, D.; Jha, V.; Kumar, V.; Mohanty, A. K.; Netrakanti, P. K.; Pant, L. M.; Shukla, P.; Topkar, A.; Aziz, T.; Dugad, S.; Mahakud, B.; Mitra, S.; Mohanty, G. B.; Sur, N.; Sutar, B.; Banerjee, S.; Bhattacharya, S.; Chatterjee, S.; Das, P.; Guchait, M.; Jain, Sa.; Kumar, S.; Maity, M.; Majumder, G.; Mazumdar, K.; Sarkar, T.; Wickramage, N.; Chauhan, S.; Dube, S.; Hegde, V.; Kapoor, A.; Kothekar, K.; Pandey, S.; Rane, A.; Sharma, S.; Chenarani, S.; Eskandari Tadavani, E.; Etesami, S. M.; Khakzad, M.; Mohammadi Najafabadi, M.; Naseri, M.; Paktinat Mehdiabadi, S.; Rezaei Hosseinabadi, F.; Safarzadeh, B.; Zeinali, M.; Felcini, M.; Grunewald, M.; Abbrescia, M.; Calabria, C.; Colaleo, A.; Creanza, D.; Cristella, L.; De Filippis, N.; De Palma, M.; Errico, F.; Fiore, L.; Iaselli, G.; Lezki, S.; Maggi, G.; Maggi, M.; Miniello, G.; My, S.; Nuzzo, S.; Pompili, A.; Pugliese, G.; Radogna, R.; Ranieri, A.; Selvaggi, G.; Sharma, A.; Silvestris, L.; Venditti, R.; Verwilligen, P.; Abbiendi, G.; Battilana, C.; Bonacorsi, D.; Borgonovi, L.; Braibant-Giacomelli, S.; Campanini, R.; Capiluppi, P.; Castro, A.; Cavallo, F. R.; Chhibra, S. S.; Codispoti, G.; Cuffiani, M.; Dallavalle, G. M.; Fabbri, F.; Fanfani, A.; Fasanella, D.; Giacomelli, P.; Grandi, C.; Guiducci, L.; Marcellini, S.; Masetti, G.; Montanari, A.; Navarria, F. L.; Perrotta, A.; Rossi, A. M.; Rovelli, T.; Siroli, G. P.; Tosi, N.; Albergo, S.; Costa, S.; Di Mattia, A.; Giordano, F.; Potenza, R.; Tricomi, A.; Tuve, C.; Barbagli, G.; Chatterjee, K.; Ciulli, V.; Civinini, C.; D'Alessandro, R.; Focardi, E.; Lenzi, P.; Meschini, M.; Paoletti, S.; Russo, L.; Sguazzoni, G.; Strom, D.; Viliani, L.; Benussi, L.; Bianco, S.; Fabbri, F.; Piccolo, D.; Primavera, F.; Calvelli, V.; Ferro, F.; Robutti, E.; Tosi, S.; Benaglia, A.; Beschi, A.; Brianza, L.; Brivio, F.; Ciriolo, V.; Dinardo, M. E.; Fiorendi, S.; Gennai, S.; Ghezzi, A.; Govoni, P.; Malberti, M.; Malvezzi, S.; Manzoni, R. A.; Menasce, D.; Moroni, L.; Paganoni, M.; Pauwels, K.; Pedrini, D.; Pigazzini, S.; Ragazzi, S.; Redaelli, N.; Tabarelli de Fatis, T.; Buontempo, S.; Cavallo, N.; Di Guida, S.; Fabozzi, F.; Fienga, F.; Iorio, A. O. M.; Khan, W. A.; Lista, L.; Meola, S.; Paolucci, P.; Sciacca, C.; Thyssen, F.; Azzi, P.; Bacchetta, N.; Benato, L.; Bisello, D.; Boletti, A.; Carlin, R.; Carvalho Antunes De Oliveira, A.; Checchia, P.; De Castro Manzano, P.; Dorigo, T.; Dosselli, U.; Gasparini, F.; Gasparini, U.; Gozzelino, A.; Lacaprara, S.; Margoni, M.; Meneguzzo, A. T.; Pozzobon, N.; Ronchese, P.; Rossin, R.; Simonetto, F.; Torassa, E.; Zanetti, M.; Zotto, P.; Zumerle, G.; Braghieri, A.; Magnani, A.; Montagna, P.; Ratti, S. P.; Re, V.; Ressegotti, M.; Riccardi, C.; Salvini, P.; Vai, I.; Vitulo, P.; Alunni Solestizi, L.; Biasini, M.; Bilei, G. M.; Cecchi, C.; Ciangottini, D.; Fanò, L.; Lariccia, P.; Leonardi, R.; Manoni, E.; Mantovani, G.; Mariani, V.; Menichelli, M.; Rossi, A.; Santocchia, A.; Spiga, D.; Androsov, K.; Azzurri, P.; Bagliesi, G.; Boccali, T.; Borrello, L.; Castaldi, R.; Ciocci, M. A.; Dell'Orso, R.; Fedi, G.; Giannini, L.; Giassi, A.; Grippo, M. T.; Ligabue, F.; Lomtadze, T.; Manca, E.; Mandorli, G.; Messineo, A.; Palla, F.; Rizzi, A.; Savoy-Navarro, A.; Spagnolo, P.; Tenchini, R.; Tonelli, G.; Venturi, A.; Verdini, P. G.; Barone, L.; Cavallari, F.; Cipriani, M.; Daci, N.; Del Re, D.; Di Marco, E.; Diemoz, M.; Gelli, S.; Longo, E.; Margaroli, F.; Marzocchi, B.; Meridiani, P.; Organtini, G.; Paramatti, R.; Preiato, F.; Rahatlou, S.; Rovelli, C.; Santanastasio, F.; Amapane, N.; Arcidiacono, R.; Argiro, S.; Arneodo, M.; Bartosik, N.; Bellan, R.; Biino, C.; Cartiglia, N.; Cenna, F.; Costa, M.; Covarelli, R.; Degano, A.; Demaria, N.; Kiani, B.; Mariotti, C.; Maselli, S.; Migliore, E.; Monaco, V.; Monteil, E.; Monteno, M.; Obertino, M. M.; Pacher, L.; Pastrone, N.; Pelliccioni, M.; Pinna Angioni, G. L.; Ravera, F.; Romero, A.; Ruspa, M.; Sacchi, R.; Shchelina, K.; Sola, V.; Solano, A.; Staiano, A.; Traczyk, P.; Belforte, S.; Casarsa, M.; Cossutti, F.; Della Ricca, G.; Zanetti, A.; Kim, D. H.; Kim, G. N.; Kim, M. S.; Lee, J.; Lee, S.; Lee, S. W.; Moon, C. S.; Oh, Y. D.; Sekmen, S.; Son, D. C.; Yang, Y. C.; Lee, A.; Kim, H.; Moon, D. H.; Oh, G.; Brochero Cifuentes, J. A.; Goh, J.; Kim, T. J.; Cho, S.; Choi, S.; Go, Y.; Gyun, D.; Ha, S.; Hong, B.; Jo, Y.; Kim, Y.; Lee, K.; Lee, K. S.; Lee, S.; Lim, J.; Park, S. K.; Roh, Y.; Almond, J.; Kim, J.; Kim, J. S.; Lee, H.; Lee, K.; Nam, K.; Oh, S. B.; Radburn-Smith, B. C.; Seo, S. h.; Yang, U. K.; Yoo, H. D.; Yu, G. B.; Choi, M.; Kim, H.; Kim, J. H.; Lee, J. S. H.; Park, I. C.; Choi, Y.; Hwang, C.; Lee, J.; Yu, I.; Dudenas, V.; Juodagalvis, A.; Vaitkus, J.; Ahmed, I.; Ibrahim, Z. A.; Ali, M. A. B. Md; Mohamad Idris, F.; Wan Abdullah, W. A. T.; Yusli, M. N.; Zolkapli, Z.; Reyes-Almanza, R.; Ramirez-Sanchez, G.; Duran-Osuna, M. C.; Castilla-Valdez, H.; De La Cruz-Burelo, E.; Heredia-De La Cruz, I.; Rabadan-Trejo, R. I.; Lopez-Fernandez, R.; Mejia Guisao, J.; Sanchez-Hernandez, A.; Carrillo Moreno, S.; Oropeza Barrera, C.; Vazquez Valencia, F.; Pedraza, I.; Salazar Ibarguen, H. A.; Uribe Estrada, C.; Morelos Pineda, A.; Krofcheck, D.; Butler, P. H.; Ahmad, A.; Ahmad, M.; Hassan, Q.; Hoorani, H. R.; Saddique, A.; Shah, M. A.; Shoaib, M.; Waqas, M.; Bialkowska, H.; Bluj, M.; Boimska, B.; Frueboes, T.; Górski, M.; Kazana, M.; Nawrocki, K.; Szleper, M.; Zalewski, P.; Bunkowski, K.; Byszuk, A.; Doroba, K.; Kalinowski, A.; Konecki, M.; Krolikowski, J.; Misiura, M.; Olszewski, M.; Pyskir, A.; Walczak, M.; Bargassa, P.; Beirão Da Cruz E Silva, C.; Di Francesco, A.; Faccioli, P.; Galinhas, B.; Gallinaro, M.; Hollar, J.; Leonardo, N.; Lloret Iglesias, L.; Nemallapudi, M. V.; Seixas, J.; Strong, G.; Toldaiev, O.; Vadruccio, D.; Varela, J.; Afanasiev, S.; Bunin, P.; Gavrilenko, M.; Golutvin, I.; Gorbunov, I.; Kamenev, A.; Karjavin, V.; Lanev, A.; Malakhov, A.; Matveev, V.; Palichik, V.; Perelygin, V.; Shmatov, S.; Shulha, S.; Skatchkov, N.; Smirnov, V.; Voytishin, N.; Zarubin, A.; Ivanov, Y.; Kim, V.; Kuznetsova, E.; Levchenko, P.; Murzin, V.; Oreshkin, V.; Smirnov, I.; Sulimov, V.; Uvarov, L.; Vavilov, S.; Vorobyev, A.; Andreev, Yu.; Dermenev, A.; Gninenko, S.; Golubev, N.; Karneyeu, A.; Kirsanov, M.; Krasnikov, N.; Pashenkov, A.; Tlisov, D.; Toropin, A.; Epshteyn, V.; Gavrilov, V.; Lychkovskaya, N.; Popov, V.; Pozdnyakov, I.; Safronov, G.; Spiridonov, A.; Stepennov, A.; Toms, M.; Vlasov, E.; Zhokin, A.; Aushev, T.; Bylinkin, A.; Chadeeva, M.; Parygin, P.; Philippov, D.; Polikarpov, S.; Popova, E.; Rusinov, V.; Andreev, V.; Azarkin, M.; Dremin, I.; Kirakosyan, M.; Terkulov, A.; Baskakov, A.; Belyaev, A.; Boos, E.; Demiyanov, A.; Ershov, A.; Gribushin, A.; Kodolova, O.; Korotkikh, V.; Lokhtin, I.; Miagkov, I.; Obraztsov, S.; Petrushanko, S.; Savrin, V.; Snigirev, A.; Vardanyan, I.; Blinov, V.; Skovpen, Y.; Shtol, D.; Azhgirey, I.; Bayshev, I.; Bitioukov, S.; Elumakhov, D.; Kachanov, V.; Kalinin, A.; Konstantinov, D.; Mandrik, P.; Petrov, V.; Ryutin, R.; Sobol, A.; Troshin, S.; Tyurin, N.; Uzunian, A.; Volkov, A.; Adzic, P.; Cirkovic, P.; Devetak, D.; Dordevic, M.; Milosevic, J.; Rekovic, V.; Alcaraz Maestre, J.; Barrio Luna, M.; Cerrada, M.; Colino, N.; De La Cruz, B.; Delgado Peris, A.; Escalante Del Valle, A.; Fernandez Bedoya, C.; Fernández Ramos, J. P.; Flix, J.; Fouz, M. C.; Gonzalez Lopez, O.; Goy Lopez, S.; Hernandez, J. M.; Josa, M. I.; Moran, D.; Pérez-Calero Yzquierdo, A.; Puerta Pelayo, J.; Quintario Olmeda, A.; Redondo, I.; Romero, L.; Soares, M. S.; Álvarez Fernández, A.; Albajar, C.; de Trocóniz, J. F.; Missiroli, M.; Cuevas, J.; Erice, C.; Fernandez Menendez, J.; Gonzalez Caballero, I.; González Fernández, J. R.; Palencia Cortezon, E.; Sanchez Cruz, S.; Vischia, P.; Vizan Garcia, J. M.; Cabrillo, I. J.; Calderon, A.; Chazin Quero, B.; Curras, E.; Duarte Campderros, J.; Fernandez, M.; Garcia-Ferrero, J.; Gomez, G.; Lopez Virto, A.; Marco, J.; Martinez Rivero, C.; Martinez Ruiz del Arbol, P.; Matorras, F.; Piedra Gomez, J.; Rodrigo, T.; Ruiz-Jimeno, A.; Scodellaro, L.; Trevisani, N.; Vila, I.; Vilar Cortabitarte, R.; Abbaneo, D.; Akgun, B.; Auffray, E.; Baillon, P.; Ball, A. H.; Barney, D.; Bendavid, J.; Bianco, M.; Bloch, P.; Bocci, A.; Botta, C.; Camporesi, T.; Castello, R.; Cepeda, M.; Cerminara, G.; Chapon, E.; Chen, Y.; d'Enterria, D.; Dabrowski, A.; Daponte, V.; David, A.; De Gruttola, M.; De Roeck, A.; Deelen, N.; Dobson, M.; du Pree, T.; Dünser, M.; Dupont, N.; Elliott-Peisert, A.; Everaerts, P.; Fallavollita, F.; Franzoni, G.; Fulcher, J.; Funk, W.; Gigi, D.; Gilbert, A.; Gill, K.; Glege, F.; Gulhan, D.; Harris, P.; Hegeman, J.; Innocente, V.; Jafari, A.; Janot, P.; Karacheban, O.; Kieseler, J.; Knünz, V.; Kornmayer, A.; Kortelainen, M. J.; Krammer, M.; Lange, C.; Lecoq, P.; Lourenço, C.; Lucchini, M. T.; Malgeri, L.; Mannelli, M.; Martelli, A.; Meijers, F.; Merlin, J. A.; Mersi, S.; Meschi, E.; Milenovic, P.; Moortgat, F.; Mulders, M.; Neugebauer, H.; Ngadiuba, J.; Orfanelli, S.; Orsini, L.; Pape, L.; Perez, E.; Peruzzi, M.; Petrilli, A.; Petrucciani, G.; Pfeiffer, A.; Pierini, M.; Rabady, D.; Racz, A.; Reis, T.; Rolandi, G.; Rovere, M.; Sakulin, H.; Schäfer, C.; Schwick, C.; Seidel, M.; Selvaggi, M.; Sharma, A.; Silva, P.; Sphicas, P.; Stakia, A.; Steggemann, J.; Stoye, M.; Tosi, M.; Treille, D.; Triossi, A.; Tsirou, A.; Veckalns, V.; Verweij, M.; Zeuner, W. D.; Bertl, W.; Caminada, L.; Deiters, K.; Erdmann, W.; Horisberger, R.; Ingram, Q.; Kaestli, H. C.; Kotlinski, D.; Langenegger, U.; Rohe, T.; Wiederkehr, S. A.; Backhaus, M.; Bäni, L.; Berger, P.; Bianchini, L.; Casal, B.; Dissertori, G.; Dittmar, M.; Donegà, M.; Dorfer, C.; Grab, C.; Heidegger, C.; Hits, D.; Hoss, J.; Kasieczka, G.; Klijnsma, T.; Lustermann, W.; Mangano, B.; Marionneau, M.; Meinhard, M. T.; Meister, D.; Micheli, F.; Musella, P.; Nessi-Tedaldi, F.; Pandolfi, F.; Pata, J.; Pauss, F.; Perrin, G.; Perrozzi, L.; Quittnat, M.; Reichmann, M.; Sanz Becerra, D. A.; Schönenberger, M.; Shchutska, L.; Tavolaro, V. R.; Theofilatos, K.; Vesterbacka Olsson, M. L.; Wallny, R.; Zhu, D. H.; Aarrestad, T. K.; Amsler, C.; Canelli, M. F.; De Cosa, A.; Del Burgo, R.; Donato, S.; Galloni, C.; Hreus, T.; Kilminster, B.; Pinna, D.; Rauco, G.; Robmann, P.; Salerno, D.; Schweiger, K.; Seitz, C.; Takahashi, Y.; Zucchetta, A.; Candelise, V.; Doan, T. H.; Jain, Sh.; Khurana, R.; Kuo, C. M.; Lin, W.; Pozdnyakov, A.; Yu, S. S.; Kumar, Arun; Chang, P.; Chao, Y.; Chen, K. F.; Chen, P. H.; Fiori, F.; Hou, W.-S.; Hsiung, Y.; Liu, Y. F.; Lu, R.-S.; Paganis, E.; Psallidas, A.; Steen, A.; Tsai, J. f.; Asavapibhop, B.; Kovitanggoon, K.; Singh, G.; Srimanobhas, N.; Bakirci, M. N.; Bat, A.; Boran, F.; Damarseckin, S.; Demiroglu, Z. S.; Dozen, C.; Girgis, S.; Gokbulut, G.; Guler, Y.; Hos, I.; Kangal, E. E.; Kara, O.; Kiminsu, U.; Oglakci, M.; Onengut, G.; Ozdemir, K.; Ozturk, S.; Polatoz, A.; Tali, B.; Tok, U. G.; Topakli, H.; Turkcapar, S.; Zorbakir, I. S.; Zorbilmez, C.; Bilin, B.; Karapinar, G.; Ocalan, K.; Yalvac, M.; Zeyrek, M.; Gülmez, E.; Kaya, M.; Kaya, O.; Tekten, S.; Yetkin, E. A.; Agaras, M. N.; Atay, S.; Cakir, A.; Cankocak, K.; Grynyov, B.; Levchuk, L.; Ball, F.; Beck, L.; Brooke, J. J.; Burns, D.; Clement, E.; Cussans, D.; Davignon, O.; Flacher, H.; Goldstein, J.; Heath, G. P.; Heath, H. F.; Kreczko, L.; Newbold, D. M.; Paramesvaran, S.; Sakuma, T.; Seif El Nasr-storey, S.; Smith, D.; Smith, V. J.; Belyaev, A.; Brew, C.; Brown, R. M.; Calligaris, L.; Cieri, D.; Cockerill, D. J. A.; Coughlan, J. A.; Harder, K.; Harper, S.; Olaiya, E.; Petyt, D.; Shepherd-Themistocleous, C. H.; Thea, A.; Tomalin, I. R.; Williams, T.; Auzinger, G.; Bainbridge, R.; Borg, J.; Breeze, S.; Buchmuller, O.; Bundock, A.; Casasso, S.; Citron, M.; Colling, D.; Corpe, L.; Dauncey, P.; Davies, G.; De Wit, A.; Della Negra, M.; Di Maria, R.; Elwood, A.; Haddad, Y.; Hall, G.; Iles, G.; James, T.; Lane, R.; Laner, C.; Lyons, L.; Magnan, A.-M.; Malik, S.; Mastrolorenzo, L.; Matsushita, T.; Nash, J.; Nikitenko, A.; Palladino, V.; Pesaresi, M.; Raymond, D. M.; Richards, A.; Rose, A.; Scott, E.; Seez, C.; Shtipliyski, A.; Summers, S.; Tapper, A.; Uchida, K.; Vazquez Acosta, M.; Virdee, T.; Wardle, N.; Winterbottom, D.; Wright, J.; Zenz, S. C.; Cole, J. E.; Hobson, P. R.; Khan, A.; Kyberd, P.; Reid, I. D.; Symonds, P.; Teodorescu, L.; Turner, M.; Zahid, S.; Borzou, A.; Call, K.; Dittmann, J.; Hatakeyama, K.; Liu, H.; Pastika, N.; Smith, C.; Bartek, R.; Dominguez, A.; Buccilli, A.; Cooper, S. I.; Henderson, C.; Rumerio, P.; West, C.; Arcaro, D.; Avetisyan, A.; Bose, T.; Gastler, D.; Rankin, D.; Richardson, C.; Rohlf, J.; Sulak, L.; Zou, D.; Benelli, G.; Cutts, D.; Garabedian, A.; Hadley, M.; Hakala, J.; Heintz, U.; Hogan, J. M.; Kwok, K. H. M.; Laird, E.; Landsberg, G.; Lee, J.; Mao, Z.; Narain, M.; Pazzini, J.; Piperov, S.; Sagir, S.; Syarif, R.; Yu, D.; Band, R.; Brainerd, C.; Burns, D.; Calderon De La Barca Sanchez, M.; Chertok, M.; Conway, J.; Conway, R.; Cox, P. T.; Erbacher, R.; Flores, C.; Funk, G.; Gardner, M.; Ko, W.; Lander, R.; Mclean, C.; Mulhearn, M.; Pellett, D.; Pilot, J.; Shalhout, S.; Shi, M.; Smith, J.; Stolp, D.; Tos, K.; Tripathi, M.; Wang, Z.; Bachtis, M.; Bravo, C.; Cousins, R.; Dasgupta, A.; Florent, A.; Hauser, J.; Ignatenko, M.; Mccoll, N.; Regnard, S.; Saltzberg, D.; Schnaible, C.; Valuev, V.; Bouvier, E.; Burt, K.; Clare, R.; Ellison, J.; Gary, J. W.; Ghiasi Shirazi, S. M. A.; Hanson, G.; Heilman, J.; Kennedy, E.; Lacroix, F.; Long, O. R.; Olmedo Negrete, M.; Paneva, M. I.; Si, W.; Wang, L.; Wei, H.; Wimpenny, S.; Yates, B. R.; Branson, J. G.; Cittolin, S.; Derdzinski, M.; Gerosa, R.; Gilbert, D.; Hashemi, B.; Holzner, A.; Klein, D.; Kole, G.; Krutelyov, V.; Letts, J.; Macneill, I.; Masciovecchio, M.; Olivito, D.; Padhi, S.; Pieri, M.; Sani, M.; Sharma, V.; Simon, S.; Tadel, M.; Vartak, A.; Wasserbaech, S.; Wood, J.; Würthwein, F.; Yagil, A.; Zevi Della Porta, G.; Amin, N.; Bhandari, R.; Bradmiller-Feld, J.; Campagnari, C.; Dishaw, A.; Dutta, V.; Franco Sevilla, M.; George, C.; Golf, F.; Gouskos, L.; Gran, J.; Heller, R.; Incandela, J.; Ovcharova, A.; Qu, H.; Richman, J.; Stuart, D.; Suarez, I.; Yoo, J.; Anderson, D.; Bornheim, A.; Lawhorn, J. M.; Newman, H. B.; Nguyen, T.; Pena, C.; Spiropulu, M.; Vlimant, J. R.; Xie, S.; Zhang, Z.; Zhu, R. Y.; Andrews, M. B.; Ferguson, T.; Mudholkar, T.; Paulini, M.; Russ, J.; Sun, M.; Vogel, H.; Vorobiev, I.; Weinberg, M.; Cumalat, J. P.; Ford, W. T.; Jensen, F.; Johnson, A.; Krohn, M.; Leontsinis, S.; Mulholland, T.; Stenson, K.; Wagner, S. R.; Alexander, J.; Chaves, J.; Chu, J.; Dittmer, S.; Mcdermott, K.; Mirman, N.; Patterson, J. R.; Quach, D.; Rinkevicius, A.; Ryd, A.; Skinnari, L.; Soffi, L.; Tan, S. M.; Tao, Z.; Thom, J.; Tucker, J.; Wittich, P.; Zientek, M.; Abdullin, S.; Albrow, M.; Alyari, M.; Apollinari, G.; Apresyan, A.; Apyan, A.; Banerjee, S.; Bauerdick, L. A. T.; Beretvas, A.; Berryhill, J.; Bhat, P. C.; Bolla, G.; Burkett, K.; Butler, J. N.; Canepa, A.; Cerati, G. B.; Cheung, H. W. K.; Chlebana, F.; Cremonesi, M.; Duarte, J.; Elvira, V. D.; Freeman, J.; Gecse, Z.; Gottschalk, E.; Gray, L.; Green, D.; Grünendahl, S.; Gutsche, O.; Harris, R. M.; Hasegawa, S.; Hirschauer, J.; Hu, Z.; Jayatilaka, B.; Jindariani, S.; Johnson, M.; Joshi, U.; Klima, B.; Kreis, B.; Lammel, S.; Lincoln, D.; Lipton, R.; Liu, M.; Liu, T.; Lopes De Sá, R.; Lykken, J.; Maeshima, K.; Magini, N.; Marraffino, J. M.; Mason, D.; McBride, P.; Merkel, P.; Mrenna, S.; Nahn, S.; O'Dell, V.; Pedro, K.; Prokofyev, O.; Rakness, G.; Ristori, L.; Schneider, B.; Sexton-Kennedy, E.; Soha, A.; Spalding, W. J.; Spiegel, L.; Stoynev, S.; Strait, J.; Strobbe, N.; Taylor, L.; Tkaczyk, S.; Tran, N. V.; Uplegger, L.; Vaandering, E. W.; Vernieri, C.; Verzocchi, M.; Vidal, R.; Wang, M.; Weber, H. A.; Whitbeck, A.; Acosta, D.; Avery, P.; Bortignon, P.; Bourilkov, D.; Brinkerhoff, A.; Carnes, A.; Carver, M.; Curry, D.; Field, R. D.; Furic, I. K.; Gleyzer, S. V.; Joshi, B. M.; Konigsberg, J.; Korytov, A.; Kotov, K.; Ma, P.; Matchev, K.; Mei, H.; Mitselmakher, G.; Rank, D.; Shi, K.; Sperka, D.; Terentyev, N.; Thomas, L.; Wang, J.; Wang, S.; Yelton, J.; Joshi, Y. R.; Linn, S.; Markowitz, P.; Rodriguez, J. L.; Ackert, A.; Adams, T.; Askew, A.; Hagopian, S.; Hagopian, V.; Johnson, K. F.; Kolberg, T.; Martinez, G.; Perry, T.; Prosper, H.; Saha, A.; Santra, A.; Sharma, V.; Yohay, R.; Baarmand, M. M.; Bhopatkar, V.; Colafranceschi, S.; Hohlmann, M.; Noonan, D.; Roy, T.; Yumiceva, F.; Adams, M. R.; Apanasevich, L.; Berry, D.; Betts, R. R.; Cavanaugh, R.; Chen, X.; Evdokimov, O.; Gerber, C. E.; Hangal, D. A.; Hofman, D. J.; Jung, K.; Kamin, J.; Sandoval Gonzalez, I. D.; Tonjes, M. B.; Trauger, H.; Varelas, N.; Wang, H.; Wu, Z.; Zhang, J.; Bilki, B.; Clarida, W.; Dilsiz, K.; Durgut, S.; Gandrajula, R. P.; Haytmyradov, M.; Khristenko, V.; Merlo, J.-P.; Mermerkaya, H.; Mestvirishvili, A.; Moeller, A.; Nachtman, J.; Ogul, H.; Onel, Y.; Ozok, F.; Penzo, A.; Snyder, C.; Tiras, E.; Wetzel, J.; Yi, K.; Blumenfeld, B.; Cocoros, A.; Eminizer, N.; Fehling, D.; Feng, L.; Gritsan, A. V.; Maksimovic, P.; Roskes, J.; Sarica, U.; Swartz, M.; Xiao, M.; You, C.; Al-bataineh, A.; Baringer, P.; Bean, A.; Boren, S.; Bowen, J.; Castle, J.; Khalil, S.; Kropivnitskaya, A.; Majumder, D.; Mcbrayer, W.; Murray, M.; Royon, C.; Sanders, S.; Schmitz, E.; Tapia Takaki, J. D.; Wang, Q.; Ivanov, A.; Kaadze, K.; Maravin, Y.; Mohammadi, A.; Saini, L. K.; Skhirtladze, N.; Toda, S.; Rebassoo, F.; Wright, D.; Anelli, C.; Baden, A.; Baron, O.; Belloni, A.; Calvert, B.; Eno, S. C.; Feng, Y.; Ferraioli, C.; Hadley, N. J.; Jabeen, S.; Jeng, G. Y.; Kellogg, R. G.; Kunkle, J.; Mignerey, A. C.; Ricci-Tam, F.; Shin, Y. H.; Skuja, A.; Tonwar, S. C.; Abercrombie, D.; Allen, B.; Azzolini, V.; Barbieri, R.; Baty, A.; Bi, R.; Brandt, S.; Busza, W.; Cali, I. A.; D'Alfonso, M.; Demiragli, Z.; Gomez Ceballos, G.; Goncharov, M.; Hsu, D.; Hu, M.; Iiyama, Y.; Innocenti, G. M.; Klute, M.; Kovalskyi, D.; Lai, Y. S.; Lee, Y.-J.; Levin, A.; Luckey, P. D.; Maier, B.; Marini, A. C.; Mcginn, C.; Mironov, C.; Narayanan, S.; Niu, X.; Paus, C.; Roland, C.; Roland, G.; Salfeld-Nebgen, J.; Stephans, G. S. F.; Tatar, K.; Velicanu, D.; Wang, J.; Wang, T. W.; Wyslouch, B.; Benvenuti, A. C.; Chatterjee, R. M.; Evans, A.; Hansen, P.; Hiltbrand, J.; Kalafut, S.; Kubota, Y.; Lesko, Z.; Mans, J.; Nourbakhsh, S.; Ruckstuhl, N.; Rusack, R.; Turkewitz, J.; Wadud, M. A.; Acosta, J. G.; Oliveros, S.; Avdeeva, E.; Bloom, K.; Claes, D. R.; Fangmeier, C.; Gonzalez Suarez, R.; Kamalieddin, R.; Kravchenko, I.; Monroy, J.; Siado, J. E.; Snow, G. R.; Stieger, B.; Dolen, J.; Godshalk, A.; Harrington, C.; Iashvili, I.; Nguyen, D.; Parker, A.; Rappoccio, S.; Roozbahani, B.; Alverson, G.; Barberis, E.; Hortiangtham, A.; Massironi, A.; Morse, D. M.; Orimoto, T.; Teixeira De Lima, R.; Trocino, D.; Wood, D.; Bhattacharya, S.; Charaf, O.; Hahn, K. A.; Mucia, N.; Odell, N.; Pollack, B.; Schmitt, M. H.; Sung, K.; Trovato, M.; Velasco, M.; Dev, N.; Hildreth, M.; Hurtado Anampa, K.; Jessop, C.; Karmgard, D. J.; Kellams, N.; Lannon, K.; Loukas, N.; Marinelli, N.; Meng, F.; Mueller, C.; Musienko, Y.; Planer, M.; Reinsvold, A.; Ruchti, R.; Smith, G.; Taroni, S.; Wayne, M.; Wolf, M.; Woodard, A.; Alimena, J.; Antonelli, L.; Bylsma, B.; Durkin, L. S.; Flowers, S.; Francis, B.; Hart, A.; Hill, C.; Ji, W.; Liu, B.; Luo, W.; Winer, B. L.; Wulsin, H. W.; Cooperstein, S.; Driga, O.; Elmer, P.; Hardenbrook, J.; Hebda, P.; Higginbotham, S.; Lange, D.; Luo, J.; Marlow, D.; Mei, K.; Ojalvo, I.; Olsen, J.; Palmer, C.; Piroué, P.; Stickland, D.; Tully, C.; Malik, S.; Norberg, S.; Barker, A.; Barnes, V. E.; Das, S.; Folgueras, S.; Gutay, L.; Jha, M. K.; Jones, M.; Jung, A. W.; Khatiwada, A.; Miller, D. H.; Neumeister, N.; Peng, C. C.; Qiu, H.; Schulte, J. F.; Sun, J.; Wang, F.; Xie, W.; Cheng, T.; Parashar, N.; Stupak, J.; Adair, A.; Chen, Z.; Ecklund, K. M.; Freed, S.; Geurts, F. J. M.; Guilbaud, M.; Kilpatrick, M.; Li, W.; Michlin, B.; Northup, M.; Padley, B. P.; Roberts, J.; Rorie, J.; Shi, W.; Tu, Z.; Zabel, J.; Zhang, A.; Bodek, A.; de Barbaro, P.; Demina, R.; Duh, Y. t.; Ferbel, T.; Galanti, M.; Garcia-Bellido, A.; Han, J.; Hindrichs, O.; Khukhunaishvili, A.; Lo, K. H.; Tan, P.; Verzetti, M.; Ciesielski, R.; Goulianos, K.; Mesropian, C.; Agapitos, A.; Chou, J. P.; Gershtein, Y.; Gómez Espinosa, T. A.; Halkiadakis, E.; Heindl, M.; Hughes, E.; Kaplan, S.; Kunnawalkam Elayavalli, R.; Kyriacou, S.; Lath, A.; Montalvo, R.; Nash, K.; Osherson, M.; Saka, H.; Salur, S.; Schnetzer, S.; Sheffield, D.; Somalwar, S.; Stone, R.; Thomas, S.; Thomassen, P.; Walker, M.; Delannoy, A. G.; Foerster, M.; Heideman, J.; Riley, G.; Rose, K.; Spanier, S.; Thapa, K.; Bouhali, O.; Castaneda Hernandez, A.; Celik, A.; Dalchenko, M.; De Mattia, M.; Delgado, A.; Dildick, S.; Eusebi, R.; Gilmore, J.; Huang, T.; Kamon, T.; Mueller, R.; Pakhotin, Y.; Patel, R.; Perloff, A.; Perniè, L.; Rathjens, D.; Safonov, A.; Tatarinov, A.; Ulmer, K. A.; Akchurin, N.; Damgov, J.; De Guio, F.; Dudero, P. R.; Faulkner, J.; Gurpinar, E.; Kunori, S.; Lamichhane, K.; Lee, S. W.; Libeiro, T.; Mengke, T.; Muthumuni, S.; Peltola, T.; Undleeb, S.; Volobouev, I.; Wang, Z.; Greene, S.; Gurrola, A.; Janjam, R.; Johns, W.; Maguire, C.; Melo, A.; Ni, H.; Padeken, K.; Sheldon, P.; Tuo, S.; Velkovska, J.; Xu, Q.; Arenton, M. W.; Barria, P.; Cox, B.; Hirosky, R.; Joyce, M.; Ledovskoy, A.; Li, H.; Neu, C.; Sinthuprasith, T.; Wang, Y.; Wolfe, E.; Xia, F.; Harr, R.; Karchin, P. E.; Poudyal, N.; Sturdy, J.; Thapa, P.; Zaleski, S.; Brodski, M.; Buchanan, J.; Caillol, C.; Dasu, S.; Dodd, L.; Duric, S.; Gomber, B.; Grothe, M.; Herndon, M.; Hervé, A.; Hussain, U.; Klabbers, P.; Lanaro, A.; Levine, A.; Long, K.; Loveless, R.; Polese, G.; Ruggles, T.; Savin, A.; Smith, N.; Smith, W. H.; Taylor, D.; Woods, N.
2018-01-01
The pseudorapidity distributions of charged hadrons in proton-lead collisions at nucleon-nucleon center-of-mass energies √{s_{NN}}=5.02 and 8.16 TeV are presented. The measurements are based on data samples collected by the CMS experiment at the LHC. The number of primary charged hadrons produced in non-single-diffractive proton-lead collisions is determined in the pseudorapidity range | η lab| < 2 .4. The charged-hadron multiplicity distributions are compared to the predictions from theoretical calculations and Monte Carlo event generators. In the center-of-mass pseudorapidity range | η cm| < 0 .5, the average charged-hadron multiplicity densities 〈d N ch/d η cm〉| ηcm| < 0.5 are 17 .31 ± 0 .01 (stat) ± 0 .59 (syst) and 20 .10 ± 0 .01 (stat) ± 0 .85(syst) at √{s_{NN}}=5.02 and 8.16 TeV, respectively. The particle densities per participant nucleon are compared to similar measurements in proton-proton, proton-nucleus, and nucleus-nucleus collisions. [Figure not available: see fulltext.
Microstructural basis and crack growth theories for post-irradiation ductility loss in Nimonic PE16
International Nuclear Information System (INIS)
Chang, A.L.
1982-01-01
A study has been carried out to investigate the degradation of postirradiation ductility at reactor temperatures in Nimonic PE16, a Fe-Cr-Ni-based precipitation-hardened superalloy. Fractographic and microstructural investigations show that the grain matrix is capable of deformation and does not limit the postirradiation tensile ductility. Grain-boundary helium bubbles formed during neutron irradiation seem to be crack nucleation sites under stress. Growth and coalescence of these microcracks under stress lead to intergranular fracture. A rigid-grain fracture model is shown to be able to correlate the observed microstructures with most features of the mechanical properties, except the strain rate dependence of the ductility. By incorporating the interactions between diffusion and plastic deformation, a plastic-grain fracture model has been developed which can explain all postirradiation tensile ductility data quantitatively. 13 references
The role of particle ripening on the creep acceleration of Nimonic 263 superalloy
Directory of Open Access Journals (Sweden)
Angella Giuliano
2014-01-01
Full Text Available Physically based constitutive equations need to incorporate the most relevant microstructural features of materials to adequately describe their mechanical behaviour. To accurately model the creep behaviour of precipitation hardened alloys, the value and the evolution of strengthening particle size are important parameters to be taken into account. In the present work, creep tests have been run on virgin and overaged (up to 3500 h at 800 ∘C Nimonic 263, a polycrystalline nickel base superalloy used for combustion chambers of gas turbines. The experimental results suggest that the reinforcing particle evolution is not the main reason for the creep acceleration that seems to be better described by a strain correlated damage, such as the accumulation of mobile dislocations or the grain boundary cavitation. The coarsened microstructure, obtained by overageing the alloy at high temperature before creep testing, mainly influences the initial stage of the creep, resulting in a higher minimum creep rate and a corresponding reduction of the creep resistance.
30 CFR 816.14 - Casing and sealing of drilled holes: Temporary.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Casing and sealing of drilled holes: Temporary. 816.14 Section 816.14 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT...-SURFACE MINING ACTIVITIES § 816.14 Casing and sealing of drilled holes: Temporary. Each exploration hole...
CMS Collaboration
2018-01-01
The production of W bosons has been measured in proton-lead collisions at a nucleon-nucleon center-of-mass energy of $\\sqrt{s_{\\mathrm{NN}}} = 8.16~\\mathrm{TeV}$. The measurement of W bosons is performed in the $\\mathrm{W}\\rightarrow\\mu\
30 CFR 816.105 - Backfilling and grading: Thick overburden.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Backfilling and grading: Thick overburden. 816...-SURFACE MINING ACTIVITIES § 816.105 Backfilling and grading: Thick overburden. (a) Definition. Thick... surrounding terrain. (b) Performance standards. Where thick overburden occurs within the permit area, the...
21 CFR 172.816 - Methyl glucoside-coconut oil ester.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Methyl glucoside-coconut oil ester. 172.816 Section... HUMAN CONSUMPTION Multipurpose Additives § 172.816 Methyl glucoside-coconut oil ester. Methyl glucoside-coconut oil ester may be safely used in food in accordance with the following conditions: (a) It is the...
30 CFR 816.81 - Coal mine waste: General requirements.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Coal mine waste: General requirements. 816.81... ACTIVITIES § 816.81 Coal mine waste: General requirements. (a) General. All coal mine waste disposed of in an... within a permit area, which are approved by the regulatory authority for this purpose. Coal mine waste...
Energy Technology Data Exchange (ETDEWEB)
Ankamma, Kandula; Chandra Mohan Reddy, Gangireddy [Mahatma Ghandi Institute of Technology, Hyderabad (India). Mechanical Engineering Dept.; Singh, Ashok Kumar; Prasad, Konduri Satya [Defence Research and Development Organisation (DRDO), Hyderabad (India). Defence Metallurgical Research Lab.; Komaraiah, Methuku [Malla Reddy College of Engineering and Technology, Secunderabad (India); Eswara Prasad, Namburi [Regional Centre for Military Airworthiness (Materials), Hyderabad (India)
2011-10-15
The deformation behavior under uni-axial tensile loading is investigated and reported in the case of cold rolled Nimonic C-263 alloy sheet products of different thicknesses (0.5 mm and 1 mm) in the solution treated and aged conditions. The studies conducted include (i) Microstructure, (ii) X-ray diffraction, (iii) Texture and (iv) Tensile properties and inplane anisotropy in the yield behavior (both tensile yield strength and ultimate tensile strength as well as ductility). The results of the present study showed that despite the presence of weak crystallographic texture in this crystal symmetric material, the degrees of in-plane anisotropy in strength as well as plastic deformation properties are found to be significant in both solution treated and aged conditions, thus having significant technological relevance for both further processing and design purposes. Further, the influence of aging and sheet thickness on the tensile deformation behaviour is also found to be considerable. A brief discussion on the technological implications of these results is also included. (orig.)
20 CFR 408.816 - When does SVB entitlement end due to death?
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When does SVB entitlement end due to death? 408.816 Section 408.816 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Suspensions and Terminations Termination § 408.816 When does SVB entitlement end due to death? Your SVB entitlement ends wit...
High-pressure X-ray diffraction studies on ThS up to 40 GPa using synchrotron radiation
International Nuclear Information System (INIS)
Benedict, U.; Spirlet, J.C.; Gerward, L.; Olsen, J.S.
1983-12-01
High-pressure X-ray diffraction studies have been performed on ThS up to 40 GPa using synchrotron radiation and a diamond anvil cell. The measured value of the bulk modulus B 0 =145 GPa is in disagreement with a previous measurement. The high-pressure behaviour indicates a phase transformation to ThS II starting at 15 to 20 GPa. The transformation is of second order nature, the resulting structure can be described as distorted fcc. (orig.)
High pressure X-ray diffraction studies on ThS up to 40 GPa using synchrotron radiation
International Nuclear Information System (INIS)
Benedict, U.; Spirlet, J.C.; Gerward, L.; Olsen, J.S.
1984-01-01
High pressure X-ray diffraction studies (up to 40 GPa) were performed on ThS using synchrotron radiation and a diamond anvil cell. The measured value of 145 GPa for the bulk modulus B 0 disagrees with a previous measurement. The high pressure behaviour indicates a phase transformation to ThS II starting at 15 - 20 GPa. The transformation is of the second-order type, and the resulting structure can be described as distorted f.c.c. (Auth.)
2010-07-01
... into underground mines without approval of the regulatory authority under § 816.41(i). (2) The... construction of all diversions of perennial and intermittent streams and all stream restorations. The design... diversion or stream restoration meets all construction requirements of this section and is in accordance...
d'Enterria, David
Total and fiducial top pair ($t\\bar{t}$) production cross sections in proton-lead (pPb) collisions at $\\sqrt{s_{NN}}$ = 8.16 TeV are computed at next-to-next-to-leading-order (NNLO) accuracy including next-to-next-to-leading-log (NNLL) gluon resummation, using the CT14 and CT10 proton parton distribution functions (PDF), and the EPPS16 and EPS09 nuclear PDF parametrizations for the lead ion. The total cross sections amount to $\\sigma(pPb\\to t\\bar{t}+X) = 59.0 \\pm 5.3$(CT14+EPPS16)$\\,^{+1.6}_{-2.1}$(scale) nb, and $57.5 \\pm \\,^{+4.3}_{-3.3}$(CT10+EPS09)$\\,^{+1.5}_{-2.0}$(scale) nb, with small modifications with respect to the result computed using the free proton PDF alone. The normalized ratio of pPb to pp cross sections (nuclear modification factor) is $R_{pPb} = 1.04 \\,^{\\pm 0.07(EPPS16)}_{\\pm0.03(EPS09)}$. In the lepton+jets decay mode, $t\\bar{t} \\to b\\bar{b} W(\\ell\
File list: Unc.Emb.50.AllAg.8-16h_embryos [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Emb.50.AllAg.8-16h_embryos dm3 Unclassified Embryo 8-16h embryos SRX025491,SRX0...25483,SRX025465,SRX025481 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Unc.Emb.50.AllAg.8-16h_embryos.bed ...
File list: Unc.Emb.10.AllAg.8-16h_embryos [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Emb.10.AllAg.8-16h_embryos dm3 Unclassified Embryo 8-16h embryos SRX025491,SRX0...25483,SRX026868,SRX026870,SRX025481,SRX025465 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Unc.Emb.10.AllAg.8-16h_embryos.bed ...
Electron microscopy observations of helium bubble-void transition effects in nimonic PE16 alloys
International Nuclear Information System (INIS)
Mazey, D.J.; Nelson, R.S.
1980-01-01
High-nickel alloys based on the Nimonic PE16 composition have been injected at temperatures of 525 0 C and 625 0 C with 1000 ppm helium to produce a high gas-bubble concentration and subsequently irradiated with 36 MeV nickel ions. Extensive heterogeneous nucleation of bubbles is observed on faulted interstitial loops and dislocations. Evidence is found in standard PE16 alloy for bimodal bubble plus void distributions which persist during nickel-ion irradiation to 30 and 60 dpa at 625 0 C and result in a low void volume swelling of approximately 1%. The observations can be correlated with the critical bubble/void transition radius which is calculated from theory to be approximately 4.4 nm. Pre-injection of helium into a 'matrix' PE16 (low Si, Ti and Al) alloy produced an initial bubble population whose average size was above the calculated transition radius such that all bubbles eventually grew as voids during subsequent nickel-ion irradiation up to 60 dpa at 625 0 C where the void volume swelling reached approximately 12%. The observations are discussed briefly and related to theoretical predictions of the bubble/void transition radius. (author)
ALICE luminosity determination for p-Pb collisions at $\\sqrt{s_{\\rm NN}}=8.16$ TeV
2018-01-01
Luminosity determination in ALICE is based on visible cross sections measured in van der Meer scans. In 2016, the Large Hadron Collider provided proton-lead collisions at a centre-of-mass energy of $\\sqrt{s_{\\rm NN}}=8.16$ TeV. There were two scans, one with the proton beam traveling towards the ALICE forward muon spectrometer and the second with the proton beam traveling in the opposite direction. During these scans cross sections were measured for two classes of visible interactions, based on particle detection in the ALICE luminometers: the T0 detector with pseudorapidity coverage $4.6<\\eta< 4.9$, $-3.3<\\eta<-3.0$ and the V0 detector covering $2.8<\\eta< 5.1$, $-3.7<\\eta<-1.7$. This document describes the experimental setup for such measurements and reports their results.
DEFF Research Database (Denmark)
Phung, Bengt; Kazi, Julhash U; Lundby, Alicia
2017-01-01
The oncogenic D816V mutation of the KIT receptor is well characterized in systemic mastocytosis and acute myeloid leukemia. Although KIT(D816V) has been found in melanoma, its function and involvement in this malignancy is not understood. Here we show that KIT(D816V) induces tyrosine phosphorylat......The oncogenic D816V mutation of the KIT receptor is well characterized in systemic mastocytosis and acute myeloid leukemia. Although KIT(D816V) has been found in melanoma, its function and involvement in this malignancy is not understood. Here we show that KIT(D816V) induces tyrosine.......Implications: This study demonstrates that an oncogenic tyrosine kinase mutant, KIT(D816V), can alter the transcriptional program of the transcription factor MITF in melanoma Mol Cancer Res; 15(9); 1265-74. ©2017 AACR....
30 CFR 816.150 - Roads: general.
2010-07-01
... altering the normal flow of water in streambeds or drainage channels; (6) Prevent or control damage to... part of any road shall be located in the channel of an intermittent or perennial stream unless... 816.57 of this chapter. (2) Roads shall be located to minimize downstream sedimentation and flooding...
CMS Collaboration
2018-01-01
The second- and third-order azimuthal anisotropy Fourier harmonics are studied in pPb collisions at $\\sqrt{s_{_\\text{NN}}}=8.16~\\mathrm{TeV}$ over a wide range of event multiplicities. The second-order, ``elliptic'' harmonic moment is obtained through four-, six-, and eight-particle correlations and the third-order, ``triangular'' harmonic moment is studied using four-particle correlations. The data were collected by the CMS experiment during the 2016 LHC run. A sample of peripheral PbPb collisions at $\\sqrt{s_{_{\\text{NN}}}}=5.02~\\mathrm{TeV}$, covering a similar range of event multiplicities to the pPb results, is also analyzed. Theoretical predictions that assume a hydrodynamic evolution of the created medium with initial-state density fluctuations are compared to the experimental results.
30 CFR 816.131 - Cessation of operations: Temporary.
2010-07-01
..., revegetation, environmental monitoring, and water treatment activities that will continue during the temporary... Section 816.131 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PERMANENT PROGRAM PERFORMANCE STANDARDS PERMANENT PROGRAM PERFORMANCE STANDARDS-SURFACE MINING...
Prompt and nonprompt J/ψ production and nuclear modification in pPb collisions at sNN=8.16 TeV
Directory of Open Access Journals (Sweden)
R. Aaij
2017-11-01
Full Text Available The production of J/ψ mesons is studied in proton-lead collisions at the centre-of-mass energy per nucleon pair sNN=8.16 TeV with the LHCb detector at the LHC. The double differential cross-sections of prompt and nonprompt J/ψ production are measured as a function of the J/ψ transverse momentum and rapidity in the nucleon–nucleon centre-of-mass frame. Forward-to-backward ratios and nuclear modification factors are determined. The results are compared with theoretical calculations based on collinear factorisation using nuclear parton distribution functions, on the colour glass condensate or on coherent energy loss models.
30 CFR 816.47 - Hydrologic balance: Discharge structures.
2010-07-01
...-SURFACE MINING ACTIVITIES § 816.47 Hydrologic balance: Discharge structures. Discharge from sedimentation... shall be controlled, by energy dissipators, riprap channels, and other devices, where necessary, to reduce erosion, to prevent deepening or enlargement of stream channels, and to minimize disturbance of...
Mendez, Aida G; Juncal, Andrea Boente; Silva, Siguara B L; Thomas, Olivier P; Martín Vázquez, Víctor; Alfonso, Amparo; Vieytes, Mercedes R; Vale, Carmen; Botana, Luís M
2017-07-19
Crambescidin 816 is a guanidine alkaloid produced by the sponge Crambe crambe with known antitumoral activity. While the information describing the effects of this alkaloid in central neurons is scarce, Cramb816 is known to block voltage dependent calcium channels being selective for L-type channels. Moreover, Cramb816 reduced neuronal viability through an unknown mechanism. Here, we aimed to describe the toxic activity of Cramb816 in cortical neurons. Since calcium influx is considered the main mechanism responsible for neuronal cell death, the effects of Cramb816 in the cytosolic calcium concentration of cortical neurons were studied. The alkaloid decreased neuronal viability and induced a dose-dependent increase in cytosolic calcium that was also related to the presence of calcium in the extracellular media. The increase in calcium influx was age dependent, being higher in younger neurons. Moreover, this effect was prevented by glutamate receptor antagonists, which did not fully block the cytotoxic effect of Cramb816 after 24 h of treatment but completely prevented Cramb816 cytotoxicity after 10 min exposure. Therefore, the findings presented herein provide new insights into the cytotoxic effect of Cramb816 in cortical neurons.
46 CFR 176.816 - Miscellaneous systems and equipment.
2010-10-01
... 100 GROSS TONS) INSPECTION AND CERTIFICATION Material Inspections § 176.816 Miscellaneous systems and equipment. At each initial and subsequent inspection for certification the owner or managing operator shall be prepared to test and make available for inspection all items in the ship's outfit, such as ground...
Deposition and characterization of (Cd sub(x) Zn sub(1-x)) S thin films
International Nuclear Information System (INIS)
Ferreira, C.L.
1984-01-01
Thin films of (Cd sub(x) Zn sub(1-x)) S were deposited on the substrates of soda-lime glass and borosilicate glass by coevaporation of CdS and ZnS, using the technique of hot wall. The temperatures for substrate (200 0 C), wall (350 0 C), CdS source (900 0 -1000 0 C) and ZnS source (900 0 -1200 0 C) were found to be optimum for formation of the films with deposition rates in the range of 0.5 μm.min -1 . The films obtained were with Wurtzite structure, with the crystallographic planes oriented in (001) direction. A linear variation of the parameter C 0 of hexagonal lattice with the concentration of Zn, in the range of 20% to 60%, was observed. For lower and higher concentration outside this range there was a tendency of saturation of C 0 . Measurements of Hall voltage and resistivity demonstrated the mobility and carrier concentration in the range of 10-40 cm 2 v -1 sec -1 and 1.45 x 10 19 - 3.83 x 10 20 cm -3 , respectively, whereas the resistivity of the films ranged from 2.11 x 10 -2 Ω.cm for the Zn concentration variation from 20% to 70%. Measurements of optical absorption revealed linear variation of refractive index of the films with Zn concentration for the wavelenght in the range of 0.5 to 2.0 μm. (Cd sub(x) Zn sub(1-x)) S films with 0.7 2 S. (Author) [pt
Structure and magnetic properties of (Nd1-xErx)3Fe25Cr4.0 (0 ≤ x ≤ 0.8) compounds
International Nuclear Information System (INIS)
Luo Hongzhi; Jia Lin; Li Yangxian; Meng Fanbin; Shen Jiang; Chen Nanxian; Wu Guangheng; Yang Fuming
2004-01-01
The structure and magnetic properties of (Nd 1-x Er x ) 3 Fe 25 Cr 4.0 compounds with x = 0-0.8 have been investigated using x-ray powder diffraction (XRD) and magnetic measurements. It has been found that all the compounds crystallize in a Nd 3 (Fe,Ti) 29 -type structure. Substitution of Er for Nd leads to a contraction of the unit-cell volume. The Curie temperature, T c , and the saturation magnetization, M s , of (Nd 1-x Er x ) 3 Fe 25 Cr 4.0 decrease monotonically with increasing Er content. The easy magnetization direction (EMD) of Nd 3 Fe 25 Cr 4.0 at room temperature is close to the [040] direction but may be a little out of the basal plane. With increasing Er content, the EMD changes closer to the [40-2] direction and the tilt angle increases. Both the XRD patterns and ac susceptibility indicate the appearance of a spin reorientation for x = 0-0.4 as the temperature decreases from room temperature to 77 K. The spin reorientation temperature, T sr , increases monotonically with increasing Er content from 158 K for x = 0 to 198 K for x = 0.4. A first order magnetization process (FOMP) occurs for all the compounds, and the critical field of the FOMP decreases with increasing Er content from 6.6 T for x = 0 to 2.0 T for x = 0.7
Directory of Open Access Journals (Sweden)
Víctor Martín Vázquez
2014-06-01
In summary, our data suggest that the cytotoxic effect of 10 μM Cramb816 in cortical neurons may be related to an increase in the cytosolic calcium concentration elicited by the toxin, which is shown to be mediated by glutamate receptor activation. Further studies analyzing the effect of glutamate receptor blockers on the cytotoxic effect of Cramb816 are needed to confirm this hypothesis.
Prompt photon production in $\\sqrt{s_\\mathrm{NN}} = 8.16$ TeV $p$+Pb collisions with ATLAS
The ATLAS collaboration
2017-01-01
The inclusive production cross-section for isolated, prompt photons in $p$+Pb collisions at $\\sqrt{s_\\mathrm{NN}} = 8.16$~TeV is studied with the ATLAS detector at the LHC using a data set with an integrated luminosity of $162$~nb$^{-1}$. The cross-section is measured as a function of photon transverse energy from $25$ to $500$~GeV and over nearly five units of pseudorapidity, including kinematic regions in both the downstream proton-- and nucleus--going directions. Results are reported in the nucleon--nucleon center of mass collision frame. The nuclear modification factor $R_{p\\mathrm{Pb}}$ is reported using a extrapolation, derived using NLO pQCD, of a previous measurement of photon production in $pp$ collisions at $8$~TeV. The cross-sections and $R_{p\\mathrm{Pb}}$ values are compared to the results of a next-to-leading order perturbative QCD calculation and to the expectations based on a picture of the energy loss of partons incoming to the hard scattering. At large nucleus-going rapidity, the cross-sectio...
21 CFR 1020.40 - Cabinet x-ray systems.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Cabinet x-ray systems. 1020.40 Section 1020.40 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... are all x-ray systems designed primarily for the inspection of carry-on baggage at airline, railroad...
Strength and structure during hot deformation of nickel-base superalloys
International Nuclear Information System (INIS)
Ribeiro, N.D.; Sellars, C.M.
1984-01-01
The effect of deformational variables on the flow stress and microstructure developed by plane strain compression testing and experimental rolling of three otherwise well characterized nickel-base super alloys, Nimonic 80A, Nimonic 90 and Waspaloy are presented. Rolled or tested samples were sectioned longitudinally at mid-width and were prepared for optical metallography. X-ray analysis of particles observed in several samples was carried out on polished and lightly etehed surfaces using a diffractometer with CoKα radiation. For other samples, energy dispersive x-ray analysis was also carried out in a scanning microscope. (E.G.) [pt
40x40: Curriculum for Academic Excellence and Holistic Development
Cárdenas, Alejandra Natalia
2016-01-01
The arts school partnerships under the policy "40x40" in Bogotá-Colombia are an example of the international interest in new ways to redress social and educational disadvantages. The main purpose of the policy is to improve education by gradually extending school daytime. This vignette explores three important issues for the…
Sirunyan, Albert M; CMS Collaboration; Adam, Wolfgang; Ambrogi, Federico; Asilar, Ece; Bergauer, Thomas; Brandstetter, Johannes; Brondolin, Erica; Dragicevic, Marko; Erö, Janos; Escalante Del Valle, Alberto; Flechl, Martin; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hrubec, Josef; Jeitler, Manfred; Krammer, Natascha; Krätschmer, Ilse; Liko, Dietrich; Madlener, Thomas; Mikulec, Ivan; Rad, Navid; Rohringer, Herbert; Schieck, Jochen; Schöfbeck, Robert; Spanring, Markus; Spitzbart, Daniel; Taurok, Anton; Waltenberger, Wolfgang; Wittmann, Johannes; Wulz, Claudia-Elisabeth; Zarucki, Mateusz; Chekhovsky, Vladimir; Mossolov, Vladimir; Suarez Gonzalez, Juan; De Wolf, Eddi A; Di Croce, Davide; Janssen, Xavier; Lauwers, Jasper; Pieters, Maxim; Van De Klundert, Merijn; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Abu Zeid, Shimaa; Blekman, Freya; D'Hondt, Jorgen; De Bruyn, Isabelle; De Clercq, Jarne; Deroover, Kevin; Flouris, Giannis; Lontkovskyi, Denys; Lowette, Steven; Marchesini, Ivan; Moortgat, Seth; Moreels, Lieselotte; Python, Quentin; Skovpen, Kirill; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Parijs, Isis; Beghin, Diego; Bilin, Bugra; Brun, Hugues; Clerbaux, Barbara; De Lentdecker, Gilles; Delannoy, Hugo; Dorney, Brian; Fasanella, Giuseppe; Favart, Laurent; Goldouzian, Reza; Grebenyuk, Anastasia; Kalsi, Amandeep Kaur; Lenzi, Thomas; Luetic, Jelena; Postiau, Nicolas; Starling, Elizabeth; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Vannerom, David; Wang, Qun; Cornelis, Tom; Dobur, Didar; Fagot, Alexis; Gul, Muhammad; Khvastunov, Illia; Poyraz, Deniz; Roskas, Christos; Trocino, Daniele; Tytgat, Michael; Verbeke, Willem; Vermassen, Basile; Vit, Martina; Zaganidis, Nicolas; Bakhshiansohi, Hamed; Bondu, Olivier; Brochet, Sébastien; Bruno, Giacomo; Caputo, Claudio; David, Pieter; Delaere, Christophe; Delcourt, Martin; Francois, Brieuc; Giammanco, Andrea; Krintiras, Georgios; Lemaitre, Vincent; Magitteri, Alessio; Mertens, Alexandre; Musich, Marco; Piotrzkowski, Krzysztof; Saggio, Alessia; Vidal Marono, Miguel; Wertz, Sébastien; Zobec, Joze; Alves, Fábio Lúcio; Alves, Gilvan; Brito, Lucas; Correia Silva, Gilson; Hensel, Carsten; Moraes, Arthur; Pol, Maria Elena; Rebello Teles, Patricia; Belchior Batista Das Chagas, Ewerton; Carvalho, Wagner; Chinellato, Jose; Coelho, Eduardo; Melo Da Costa, Eliza; Da Silveira, Gustavo Gil; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Malbouisson, Helena; Matos Figueiredo, Diego; Melo De Almeida, Miqueias; Mora Herrera, Clemencia; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Sanchez Rosas, Luis Junior; Santoro, Alberto; Sznajder, Andre; Thiel, Mauricio; Tonelli Manganote, Edmilson José; Torres Da Silva De Araujo, Felipe; Vilela Pereira, Antonio; Ahuja, Sudha; Bernardes, Cesar Augusto; Calligaris, Luigi; Tomei, Thiago; De Moraes Gregores, Eduardo; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Romero Abad, David; Aleksandrov, Aleksandar; Hadjiiska, Roumyana; Iaydjiev, Plamen; Marinov, Andrey; Misheva, Milena; Rodozov, Mircho; Shopova, Mariana; Sultanov, Georgi; Dimitrov, Anton; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Fang, Wenxing; Gao, Xuyang; Yuan, Li; Ahmad, Muhammad; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Chen, Mingshui; Chen, Ye; Jiang, Chun-Hua; Leggat, Duncan; Liao, Hongbo; Liu, Zhenan; Romeo, Francesco; Shaheen, Sarmad Masood; Spiezia, Aniello; Tao, Junquan; Wang, Chunjie; Wang, Zheng; Yazgan, Efe; Zhang, Huaqiao; Zhao, Jingzhou; Ban, Yong; Chen, Geng; Li, Jing; Li, Linwei; Li, Qiang; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Xu, Zijun; Wang, Yi; Avila, Carlos; Cabrera, Andrés; Carrillo Montoya, Camilo Andres; Chaparro Sierra, Luisa Fernanda; Florez, Carlos; González Hernández, Carlos Felipe; Segura Delgado, Manuel Alejandro; Courbon, Benoit; Godinovic, Nikola; Lelas, Damir; Puljak, Ivica; Sculac, Toni; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Ferencek, Dinko; Kadija, Kreso; Mesic, Benjamin; Starodumov, Andrei; Susa, Tatjana; Ather, Mohsan Waseem; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Rykaczewski, Hans; Finger, Miroslav; Finger Jr, Michael; Ayala, Edy; Carrera Jarrin, Edgar; Mahmoud, Mohammed; Mohammed, Yasser; Salama, Elsayed; Bhowmik, Sandeep; Carvalho Antunes De Oliveira, Alexandra; Dewanjee, Ram Krishna; Ehataht, Karl; Kadastik, Mario; Raidal, Martti; Veelken, Christian; Eerola, Paula; Kirschenmann, Henning; Pekkanen, Juska; Voutilainen, Mikko; Havukainen, Joona; Heikkilä, Jaana Kristiina; Jarvinen, Terhi; Karimäki, Veikko; Kinnunen, Ritva; Lampén, Tapio; Lassila-Perini, Kati; Laurila, Santeri; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Siikonen, Hannu; Tuominen, Eija; Tuominiemi, Jorma; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Leloup, Clément; Locci, Elizabeth; Malcles, Julie; Negro, Giulia; Rander, John; Rosowsky, André; Sahin, Mehmet Özgür; Titov, Maksym; Abdulsalam, Abdulla; Amendola, Chiara; Antropov, Iurii; Beaudette, Florian; Busson, Philippe; Charlot, Claude; Granier de Cassagnac, Raphael; Kucher, Inna; Lisniak, Stanislav; Lobanov, Artur; Martin Blanco, Javier; Nguyen, Matthew; Ochando, Christophe; Ortona, Giacomo; Pigard, Philipp; Salerno, Roberto; Sauvan, Jean-Baptiste; Sirois, Yves; Stahl Leiton, Andre Govinda; Zabi, Alexandre; Zghiche, Amina; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Chabert, Eric Christian; Cherepanov, Vladimir; Collard, Caroline; Conte, Eric; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Jansová, Markéta; Le Bihan, Anne-Catherine; Tonon, Nicolas; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Bernet, Colin; Boudoul, Gaelle; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Finco, Linda; Gascon, Susan; Gouzevitch, Maxime; Grenier, Gérald; Ille, Bernard; Lagarde, Francois; Laktineh, Imad Baptiste; Lattaud, Hugues; Lethuillier, Morgan; Mirabito, Laurent; Pequegnot, Anne-Laure; Perries, Stephane; Popov, Andrey; Sordini, Viola; Vander Donckt, Muriel; Viret, Sébastien; Zhang, Sijing; Toriashvili, Tengizi; Tsamalaidze, Zviad; Autermann, Christian; Feld, Lutz; Kiesel, Maximilian Knut; Klein, Katja; Lipinski, Martin; Preuten, Marius; Rauch, Max Philip; Schomakers, Christian; Schulz, Johannes; Teroerde, Marius; Wittmer, Bruno; Zhukov, Valery; Albert, Andreas; Duchardt, Deborah; Endres, Matthias; Erdmann, Martin; Esch, Thomas; Fischer, Robert; Ghosh, Saranya; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Keller, Henning; Knutzen, Simon; Mastrolorenzo, Luca; Merschmeyer, Markus; Meyer, Arnd; Millet, Philipp; Mukherjee, Swagata; Pook, Tobias; Radziej, Markus; Reithler, Hans; Rieger, Marcel; Scheuch, Florian; Schmidt, Alexander; Teyssier, Daniel; Flügge, Günter; Hlushchenko, Olena; Kargoll, Bastian; Kress, Thomas; Künsken, Andreas; Müller, Thomas; Nehrkorn, Alexander; Nowack, Andreas; Pistone, Claudia; Pooth, Oliver; Sert, Hale; Stahl, Achim; Aldaya Martin, Maria; Arndt, Till; Asawatangtrakuldee, Chayanit; Babounikau, Illia; Beernaert, Kelly; Behnke, Olaf; Behrens, Ulf; Bermúdez Martínez, Armando; Bertsche, David; Bin Anuar, Afiq Aizuddin; Borras, Kerstin; Botta, Valeria; Campbell, Alan; Connor, Patrick; Contreras-Campana, Christian; Costanza, Francesco; Danilov, Vladyslav; De Wit, Adinda; Defranchis, Matteo Maria; Diez Pardos, Carmen; Domínguez Damiani, Daniela; Eckerlin, Guenter; Eichhorn, Thomas; Elwood, Adam; Eren, Engin; Gallo, Elisabetta; Geiser, Achim; Grados Luyando, Juan Manuel; Grohsjean, Alexander; Gunnellini, Paolo; Guthoff, Moritz; Haranko, Mykyta; Harb, Ali; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Keaveney, James; Kleinwort, Claus; Knolle, Joscha; Krücker, Dirk; Lange, Wolfgang; Lelek, Aleksandra; Lenz, Teresa; Lipka, Katerina; Lohmann, Wolfgang; Mankel, Rainer; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Meyer, Mareike; Missiroli, Marino; Mittag, Gregor; Mnich, Joachim; Myronenko, Volodymyr; Pflitsch, Svenja Karen; Pitzl, Daniel; Raspereza, Alexei; Savitskyi, Mykola; Saxena, Pooja; Schütze, Paul; Schwanenberger, Christian; Shevchenko, Rostyslav; Singh, Akshansh; Stefaniuk, Nazar; Tholen, Heiner; Vagnerini, Antonio; Van Onsem, Gerrit Patrick; Walsh, Roberval; Wen, Yiwen; Wichmann, Katarzyna; Wissing, Christoph; Zenaiev, Oleksandr; Aggleton, Robin; Bein, Samuel; Benecke, Anna; Blobel, Volker; Centis Vignali, Matteo; Dreyer, Torben; Garutti, Erika; Gonzalez, Daniel; Haller, Johannes; Hinzmann, Andreas; Hoffmann, Malte; Karavdina, Anastasia; Kasieczka, Gregor; Klanner, Robert; Kogler, Roman; Kovalchuk, Nataliia; Kurz, Simon; Kutzner, Viktor; Lange, Johannes; Marconi, Daniele; Multhaup, Jens; Niedziela, Marek; Nowatschin, Dominik; Perieanu, Adrian; Reimers, Arne; Rieger, Oliver; Scharf, Christian; Schleper, Peter; Schumann, Svenja; Schwandt, Joern; Sonneveld, Jory; Stadie, Hartmut; Steinbrück, Georg; Stober, Fred-Markus Helmut; Stöver, Marc; Troendle, Daniel; Usai, Emanuele; Vanhoefer, Annika; Vormwald, Benedikt; Akbiyik, Melike; Barth, Christian; Baselga, Marta; Baur, Sebastian; Butz, Erik; Caspart, René; Chwalek, Thorsten; Colombo, Fabio; De Boer, Wim; Dierlamm, Alexander; Faltermann, Nils; Freund, Benedikt; Giffels, Manuel; Harrendorf, Marco Alexander; Hartmann, Frank; Heindl, Stefan Michael; Husemann, Ulrich; Kassel, Florian; Katkov, Igor; Kudella, Simon; Mildner, Hannes; Mitra, Soureek; Mozer, Matthias Ulrich; Müller, Thomas; Plagge, Michael; Quast, Gunter; Rabbertz, Klaus; Schröder, Matthias; Shvetsov, Ivan; Sieber, Georg; Simonis, Hans-Jürgen; Ulrich, Ralf; Wayand, Stefan; Weber, Marc; Weiler, Thomas; Williamson, Shawn; Wöhrmann, Clemens; Wolf, Roger; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Paspalaki, Garyfallia; Topsis-Giotis, Iasonas; Karathanasis, George; Kesisoglou, Stilianos; Kontaxakis, Pantelis; Panagiotou, Apostolos; Saoulidou, Niki; Tziaferi, Eirini; Vellidis, Konstantinos; Kousouris, Konstantinos; Papakrivopoulos, Ioannis; Tsipolitis, Georgios; Evangelou, Ioannis; Foudas, Costas; Gianneios, Paraskevas; Katsoulis, Panagiotis; Kokkas, Panagiotis; Mallios, Stavros; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Strologas, John; Triantis, Frixos A; Tsitsonis, Dimitrios; Csanad, Mate; Filipovic, Nicolas; Major, Péter; Nagy, Marton Imre; Pasztor, Gabriella; Surányi, Olivér; Veres, Gabor Istvan; Bencze, Gyorgy; Hajdu, Csaba; Horvath, Dezso; Hunyadi, Ádám; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Vámi, Tamás Álmos; Beni, Noemi; Czellar, Sandor; Karancsi, János; Makovec, Alajos; Molnar, Jozsef; Szillasi, Zoltan; Bartók, Márton; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Choudhury, Somnath; Komaragiri, Jyothsna Rani; Tiwari, Praveen Chandra; Bahinipati, Seema; Mal, Prolay; Mandal, Koushik; Nayak, Aruna; Sahoo, Deepak Kumar; Swain, Sanjay Kumar; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Chauhan, Sushil; Chawla, Ridhi; Dhingra, Nitish; Gupta, Rajat; Kaur, Anterpreet; Kaur, Amandeep; Kaur, Manjit; Kaur, Sandeep; Kumar, Ramandeep; Kumari, Priyanka; Lohan, Manisha; Mehta, Ankita; Sandeep, Kaur; Sharma, Sandeep; Singh, Jasbir; Walia, Genius; Kumar, Ashok; Shah, Aashaq; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Garg, Rocky Bala; Gola, Mohit; Keshri, Sumit; Malhotra, Shivali; Naimuddin, Md; Priyanka, Priyanka; Ranjan, Kirti; Sharma, Ramkrishna; Bhardwaj, Rishika; Bharti, Monika; Bhattacharya, Rajarshi; Bhattacharya, Satyaki; Bhawandeep, Bhawandeep; Bhowmik, Debabrata; Dey, Sourav; Dutt, Suneel; Dutta, Suchandra; Ghosh, Shamik; Mondal, Kuntal; Nandan, Saswati; Purohit, Arnab; Rout, Prasant Kumar; Roy, Ashim; Roy Chowdhury, Suvankar; Sarkar, Subir; Sharan, Manoj; Singh, Bipen; Thakur, Shalini; Behera, Prafulla Kumar; Chudasama, Ruchi; Dutta, Dipanwita; Jha, Vishwajeet; Kumar, Vineet; Netrakanti, Pawan Kumar; Pant, Lalit Mohan; Shukla, Prashant; Ravindra Kumar Verma, Ravindra; Aziz, Tariq; Bhat, Muzamil Ahmad; Dugad, Shashikant; Mohanty, Gagan Bihari; Sur, Nairit; Sutar, Bajrang; Banerjee, Sudeshna; Bhattacharya, Soham; Chatterjee, Suman; Das, Pallabi; Guchait, Monoranjan; Jain, Sandhya; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Sahoo, Niladribihari; Sarkar, Tanmay; Chauhan, Shubhanshu; Dube, Sourabh; Hegde, Vinay; Kapoor, Anshul; Kothekar, Kunal; Pandey, Shubham; Rane, Aditee; Sharma, Seema; Chenarani, Shirin; Eskandari Tadavani, Esmaeel; Etesami, Seyed Mohsen; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Naseri, Mohsen; Rezaei Hosseinabadi, Ferdos; Safarzadeh, Batool; Zeinali, Maryam; Felcini, Marta; Grunewald, Martin; Abbrescia, Marcello; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; Cristella, Leonardo; De Filippis, Nicola; De Palma, Mauro; Di Florio, Adriano; Errico, Filippo; Fiore, Luigi; Gelmi, Andrea; Iaselli, Giuseppe; Lezki, Samet; Maggi, Giorgio; Maggi, Marcello; Miniello, Giorgia; My, Salvatore; Nuzzo, Salvatore; Pompili, Alexis; Pugliese, Gabriella; Radogna, Raffaella; Ranieri, Antonio; Selvaggi, Giovanna; Sharma, Archana; Silvestris, Lucia; Venditti, Rosamaria; Verwilligen, Piet; Zito, Giuseppe; Abbiendi, Giovanni; Battilana, Carlo; Bonacorsi, Daniele; Borgonovi, Lisa; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Chhibra, Simranjit Singh; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Albergo, Sebastiano; Di Mattia, Alessandro; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Chatterjee, Kalyanmoy; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Latino, Giuseppe; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Russo, Lorenzo; Sguazzoni, Giacomo; Strom, Derek; Viliani, Lorenzo; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Primavera, Federica; Ferro, Fabrizio; Ravera, Fabio; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Beschi, Andrea; Brianza, Luca; Brivio, Francesco; Ciriolo, Vincenzo; Di Guida, Salvatore; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; Di Crescenzo, Antonia; Fabozzi, Francesco; Fienga, Francesco; Galati, Giuliana; Iorio, Alberto Orso Maria; Khan, Wajid Ali; Lista, Luca; Meola, Sabino; Paolucci, Pierluigi; Sciacca, Crisostomo; Voevodina, Elena; Azzi, Patrizia; Bacchetta, Nicola; Benato, Lisa; Bisello, Dario; Boletti, Alessio; Bragagnolo, Alberto; Carlin, Roberto; Checchia, Paolo; Dall'Osso, Martino; De Castro Manzano, Pablo; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Gozzelino, Andrea; Lacaprara, Stefano; Lujan, Paul; Margoni, Martino; Meneguzzo, Anna Teresa; Ronchese, Paolo; Rossin, Roberto; Simonetto, Franco; Tiko, Andres; Torassa, Ezio; Zanetti, Marco; Zotto, Pierluigi; Zumerle, Gianni; Braghieri, Alessandro; Magnani, Alice; Montagna, Paolo; Ratti, Sergio P; Re, Valerio; Ressegotti, Martina; Riccardi, Cristina; Salvini, Paola; Vai, Ilaria; Vitulo, Paolo; Alunni Solestizi, Luisa; Biasini, Maurizio; Bilei, Gian Mario; Cecchi, Claudia; Ciangottini, Diego; Fanò, Livio; Lariccia, Paolo; Manoni, Elisa; Mantovani, Giancarlo; Mariani, Valentina; Menichelli, Mauro; Rossi, Alessandro; Santocchia, Attilio; Spiga, Daniele; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bianchini, Lorenzo; Boccali, Tommaso; Borrello, Laura; Castaldi, Rino; Ciocci, Maria Agnese; Dell'Orso, Roberto; Fedi, Giacomo; Giannini, Leonardo; Giassi, Alessandro; Grippo, Maria Teresa; Ligabue, Franco; Manca, Elisabetta; Mandorli, Giulio; Messineo, Alberto; Palla, Fabrizio; Rizzi, Andrea; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Cipriani, Marco; Daci, Nadir; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Gelli, Simone; Longo, Egidio; Marzocchi, Badder; Meridiani, Paolo; Organtini, Giovanni; Pandolfi, Francesco; Paramatti, Riccardo; Preiato, Federico; Rahatlou, Shahram; Rovelli, Chiara; Santanastasio, Francesco; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bartosik, Nazar; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Cenna, Francesca; Cometti, Simona; Costa, Marco; Covarelli, Roberto; Demaria, Natale; Kiani, Bilal; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Monteil, Ennio; Monteno, Marco; Obertino, Maria Margherita; Pacher, Luca; Pastrone, Nadia; Pelliccioni, Mario; Pinna Angioni, Gian Luca; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Shchelina, Ksenia; Sola, Valentina; Solano, Ada; Soldi, Dario; Staiano, Amedeo; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Vazzoler, Federico; Zanetti, Anna; Kim, Dong Hee; Kim, Gui Nyun; Kim, Min Suk; Lee, Jeongeun; Lee, Sangeun; Lee, Seh Wook; Moon, Chang-Seong; Oh, Young Do; Sekmen, Sezen; Son, Dong-Chul; Yang, Yu Chul; Kim, Hyunchul; Moon, Dong Ho; Oh, Geonhee; Goh, Junghwan; Kim, Tae Jeong; Cho, Sungwoong; Choi, Suyong; Go, Yeonju; Gyun, Dooyeon; Ha, Seungkyu; Hong, Byung-Sik; Jo, Youngkwon; Lee, Kisoo; Lee, Kyong Sei; Lee, Songkyo; Lim, Jaehoon; Park, Sung Keun; Roh, Youn; Kim, Hyunsoo; Almond, John; Kim, Junho; Kim, Jae Sung; Lee, Haneol; Lee, Kyeongpil; Nam, Kyungwook; Oh, Sung Bin; Radburn-Smith, Benjamin Charles; Seo, Seon-hee; Yang, Unki; Yoo, Hwi Dong; Yu, Geum Bong; Kim, Hyunyong; Kim, Ji Hyun; Lee, Jason Sang Hun; Park, Inkyu; Choi, Young-Il; Hwang, Chanwook; Lee, Jongseok; Yu, Intae; Dudenas, Vytautas; Juodagalvis, Andrius; Vaitkus, Juozas; Ahmed, Ijaz; Ibrahim, Zainol Abidin; Md Ali, Mohd Adli Bin; Mohamad Idris, Faridah; Wan Abdullah, Wan Ahmad Tajuddin; Yusli, Mohd Nizam; Zolkapli, Zukhaimira; Reyes-Almanza, Rogelio; Ramirez-Sanchez, Gabriel; Duran-Osuna, Cecilia; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-De La Cruz, Ivan; Rabadán-Trejo, Raúl Iraq; Lopez-Fernandez, Ricardo; Mejia Guisao, Jhovanny; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Oropeza Barrera, Cristina; Vazquez Valencia, Fabiola; Eysermans, Jan; Pedraza, Isabel; Salazar Ibarguen, Humberto Antonio; Uribe Estrada, Cecilia; Morelos Pineda, Antonio; Krofcheck, David; Bheesette, Srinidhi; Butler, Philip H; Ahmad, Ashfaq; Ahmad, Muhammad; Asghar, Muhammad Irfan; Hassan, Qamar; Hoorani, Hafeez R; Saddique, Asif; Shah, Mehar Ali; Shoaib, Muhammad; Waqas, Muhammad; Bialkowska, Helena; Bluj, Michal; Boimska, Bozena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Traczyk, Piotr; Zalewski, Piotr; Bunkowski, Karol; Byszuk, Adrian; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Olszewski, Michal; Pyskir, Andrzej; Walczak, Marek; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Di Francesco, Agostino; Faccioli, Pietro; Galinhas, Bruno; Gallinaro, Michele; Hollar, Jonathan; Leonardo, Nuno; Lloret Iglesias, Lara; Nemallapudi, Mythra Varun; Seixas, Joao; Strong, Giles; Toldaiev, Oleksii; Vadruccio, Daniele; Varela, Joao; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavine, Vladimir; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Shulha, Siarhei; Skatchkov, Nikolai; Smirnov, Vitaly; Voytishin, Nikolay; Zarubin, Anatoli; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Kuznetsova, Ekaterina; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sosnov, Dmitry; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Pozdnyakov, Ivan; Safronov, Grigory; Spiridonov, Alexander; Stepennov, Anton; Stolin, Viatcheslav; Toms, Maria; Vlasov, Evgueni; Zhokin, Alexander; Aushev, Tagir; Bylinkin, Alexander; Chistov, Ruslan; Danilov, Mikhail; Parygin, Pavel; Philippov, Dmitry; Polikarpov, Sergey; Tarkovskii, Evgenii; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V; Terkulov, Adel; Baskakov, Alexey; Belyaev, Andrey; Boos, Edouard; Ershov, Alexander; Gribushin, Andrey; Kaminskiy, Alexandre; Kodolova, Olga; Korotkikh, Vladimir; Lokhtin, Igor; Miagkov, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Vardanyan, Irina; Blinov, Vladimir; Dimova, Tatyana; Kardapoltsev, Leonid; Shtol, Dmitry; Skovpen, Yuri; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Elumakhov, Dmitry; Godizov, Anton; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Mandrik, Petr; Petrov, Vladimir; Ryutin, Roman; Slabospitskii, Sergei; Sobol, Andrei; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Babaev, Anton; Baidali, Sergei; Adzic, Petar; Cirkovic, Predrag; Devetak, Damir; Dordevic, Milos; Milosevic, Jovan; Alcaraz Maestre, Juan; Bachiller, Irene; Barrio Luna, Mar; Brochero Cifuentes, Javier Andres; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Flix, Jose; Fouz, Maria Cruz; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Moran, Dermot; Pérez-Calero Yzquierdo, Antonio María; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Senghi Soares, Mara; Triossi, Andrea; Álvarez Fernández, Adrian; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Erice, Carlos; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; González Fernández, Juan Rodrigo; Palencia Cortezon, Enrique; Rodríguez Bouza, Víctor; Sanchez Cruz, Sergio; Vischia, Pietro; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chazin Quero, Barbara; Duarte Campderros, Jordi; Fernandez, Marcos; Fernández Manteca, Pedro José; Garcia-Ferrero, Juan; García Alonso, Andrea; Gomez, Gervasio; Lopez Virto, Amparo; Marco, Jesus; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Piedra Gomez, Jonatan; Prieels, Cédric; Rodrigo, Teresa; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Trevisani, Nicolò; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Akgun, Bora; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Bendavid, Joshua; Bianco, Michele; Bocci, Andrea; Botta, Cristina; Camporesi, Tiziano; Cepeda, Maria; Cerminara, Gianluca; Chapon, Emilien; Chen, Yi; Cucciati, Giacomo; D'Enterria, David; Dabrowski, Anne; Daponte, Vincenzo; David Tinoco Mendes, Andre; De Roeck, Albert; Deelen, Nikkie; Dobson, Marc; Du Pree, Tristan; Dünser, Marc; Dupont, Niels; Elliott-Peisert, Anna; Everaerts, Pieter; Fallavollita, Francesco; Fasanella, Daniele; Franzoni, Giovanni; Fulcher, Jonathan; Funk, Wolfgang; Gigi, Dominique; Gilbert, Andrew; Gill, Karl; Glege, Frank; Gulhan, Doga; Hegeman, Jeroen; Innocente, Vincenzo; Jafari, Abideh; Janot, Patrick; Karacheban, Olena; Kieseler, Jan; Kornmayer, Andreas; Krammer, Manfred; Lange, Clemens; Lecoq, Paul; Lourenco, Carlos; Malgeri, Luca; Mannelli, Marcello; Meijers, Frans; Merlin, Jeremie Alexandre; Mersi, Stefano; Meschi, Emilio; Milenovic, Predrag; Moortgat, Filip; Mulders, Martijn; Ngadiuba, Jennifer; Orfanelli, Styliani; Orsini, Luciano; Pantaleo, Felice; Pape, Luc; Perez, Emmanuel; Peruzzi, Marco; Petrilli, Achille; Petrucciani, Giovanni; Pfeiffer, Andreas; Pierini, Maurizio; Pitters, Florian Michael; Rabady, Dinyar; Racz, Attila; Reis, Thomas; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Seidel, Markus; Selvaggi, Michele; Sharma, Archana; Silva, Pedro; Sphicas, Paraskevas; Stakia, Anna; Steggemann, Jan; Tosi, Mia; Treille, Daniel; Tsirou, Andromachi; Veckalns, Viesturs; Zeuner, Wolfram Dietrich; Bertl, Willi; Caminada, Lea; Deiters, Konrad; Erdmann, Wolfram; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; Kotlinski, Danek; Langenegger, Urs; Rohe, Tilman; Wiederkehr, Stephan Albert; Backhaus, Malte; Bäni, Lukas; Berger, Pirmin; Chernyavskaya, Nadezda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dorfer, Christian; Grab, Christoph; Heidegger, Constantin; Hits, Dmitry; Hoss, Jan; Klijnsma, Thomas; Lustermann, Werner; Manzoni, Riccardo Andrea; Marionneau, Matthieu; Meinhard, Maren Tabea; Meister, Daniel; Micheli, Francesco; Musella, Pasquale; Nessi-Tedaldi, Francesca; Pata, Joosep; Pauss, Felicitas; Perrin, Gaël; Perrozzi, Luca; Pigazzini, Simone; Quittnat, Milena; Reichmann, Michael; Ruini, Daniele; Sanz Becerra, Diego Alejandro; Schönenberger, Myriam; Shchutska, Lesya; Tavolaro, Vittorio Raoul; Theofilatos, Konstantinos; Vesterbacka Olsson, Minna Leonora; Wallny, Rainer; Zhu, De Hua; Aarrestad, Thea Klaeboe; Amsler, Claude; Brzhechko, Danyyl; Canelli, Maria Florencia; De Cosa, Annapaola; Del Burgo, Riccardo; Donato, Silvio; Galloni, Camilla; Hreus, Tomas; Kilminster, Benjamin; Neutelings, Izaak; Pinna, Deborah; Rauco, Giorgia; Robmann, Peter; Salerno, Daniel; Schweiger, Korbinian; Seitz, Claudia; Takahashi, Yuta; Zucchetta, Alberto; Chang, Yu-Hsiang; Cheng, Kai-yu; Doan, Thi Hien; Jain, Shilpi; Khurana, Raman; Kuo, Chia-Ming; Lin, Willis; Pozdnyakov, Andrey; Yu, Shin-Shan; Kumar, Arun; Chang, Paoti; Chao, Yuan; Chen, Kai-Feng; Chen, Po-Hsun; Hou, George Wei-Shu; Li, You-ying; Lu, Rong-Shyang; Paganis, Efstathios; Psallidas, Andreas; Steen, Arnaud; Tsai, Jui-fa; Asavapibhop, Burin; Srimanobhas, Norraphat; Suwonjandee, Narumon; Bat, Ayse; Boran, Fatma; Cerci, Salim; Damarseckin, Serdal; Demiroglu, Zuhal Seyma; Dozen, Candan; Dumanoglu, Isa; Girgis, Semiray; Gokbulut, Gul; Guler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Kara, Ozgun; Kayis Topaksu, Aysel; Kiminsu, Ugur; Oglakci, Mehmet; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Sunar Cerci, Deniz; Tali, Bayram; Tok, Ufuk Guney; Turkcapar, Semra; Zorbakir, Ibrahim Soner; Zorbilmez, Caglar; Isildak, Bora; Karapinar, Guler; Yalvac, Metin; Zeyrek, Mehmet; Atakisi, Ismail Okan; Gülmez, Erhan; Kaya, Mithat; Kaya, Ozlem; Tekten, Sevgi; Yetkin, Elif Asli; Agaras, Merve Nazlim; Atay, Serhat; Cakir, Altan; Cankocak, Kerem; Komurcu, Yildiray; Sen, Sercan; Grynyov, Boris; Levchuk, Leonid; Ball, Fionn; Beck, Lana; Brooke, James John; Burns, Douglas; Clement, Emyr; Cussans, David; Davignon, Olivier; Flacher, Henning; Goldstein, Joel; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Newbold, Dave M; Paramesvaran, Sudarshan; Penning, Bjoern; Sakuma, Tai; Smith, Dominic; Smith, Vincent J; Taylor, Joseph; Titterton, Alexander; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cieri, Davide; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Linacre, Jacob; Olaiya, Emmanuel; Petyt, David; Shepherd-Themistocleous, Claire; Thea, Alessandro; Tomalin, Ian R; Williams, Thomas; Womersley, William John; Auzinger, Georg; Bainbridge, Robert; Bloch, Philippe; Borg, Johan; Breeze, Shane; Buchmuller, Oliver; Bundock, Aaron; Casasso, Stefano; Colling, David; Corpe, Louie; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Di Maria, Riccardo; Haddad, Yacine; Hall, Geoffrey; Iles, Gregory; James, Thomas; Komm, Matthias; Laner, Christian; Lyons, Louis; Magnan, Anne-Marie; Malik, Sarah; Martelli, Arabella; Nash, Jordan; Nikitenko, Alexander; Palladino, Vito; Pesaresi, Mark; Richards, Alexander; Rose, Andrew; Scott, Edward; Seez, Christopher; Shtipliyski, Antoni; Strebler, Thomas; Summers, Sioni; Tapper, Alexander; Uchida, Kirika; Virdee, Tejinder; Wardle, Nicholas; Winterbottom, Daniel; Wright, Jack; Zenz, Seth Conrad; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Mackay, Catherine Kirsty; Morton, Alexander; Reid, Ivan; Teodorescu, Liliana; Zahid, Sema; Call, Kenneth; Dittmann, Jay; Hatakeyama, Kenichi; Liu, Hongxuan; Madrid, Christopher; Mcmaster, Brooks; Pastika, Nathaniel; Smith, Caleb; Bartek, Rachel; Dominguez, Aaron; Buccilli, Andrew; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; West, Christopher; Arcaro, Daniel; Bose, Tulika; Gastler, Daniel; Rankin, Dylan; Richardson, Clint; Rohlf, James; Sulak, Lawrence; Zou, David; Benelli, Gabriele; Coubez, Xavier; Cutts, David; Hadley, Mary; Hakala, John; Heintz, Ulrich; Hogan, Julie Managan; Kwok, Ka Hei Martin; Laird, Edward; Landsberg, Greg; Lee, Jangbae; Mao, Zaixing; Narain, Meenakshi; Pazzini, Jacopo; Piperov, Stefan; Sagir, Sinan; Syarif, Rizki; Yu, David; Band, Reyer; Brainerd, Christopher; Breedon, Richard; Burns, Dustin; Calderon De La Barca Sanchez, Manuel; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Flores, Chad; Funk, Garrett; Ko, Winston; Kukral, Ota; Lander, Richard; Mclean, Christine; Mulhearn, Michael; Pellett, Dave; Pilot, Justin; Shalhout, Shalhout; Shi, Mengyao; Stolp, Dustin; Taylor, Devin; Tos, Kyle; Tripathi, Mani; Wang, Zhangqier; Zhang, Fengwangdong; Bachtis, Michail; Bravo, Cameron; Cousins, Robert; Dasgupta, Abhigyan; Florent, Alice; Hauser, Jay; Ignatenko, Mikhail; Mccoll, Nickolas; Regnard, Simon; Saltzberg, David; Schnaible, Christian; Valuev, Vyacheslav; Bouvier, Elvire; Burt, Kira; Clare, Robert; Gary, J William; Ghiasi Shirazi, Seyyed Mohammad Amin; Hanson, Gail; Karapostoli, Georgia; Kennedy, Elizabeth; Lacroix, Florent; Long, Owen Rosser; Olmedo Negrete, Manuel; Paneva, Mirena Ivova; Si, Weinan; Wang, Long; Wei, Hua; Wimpenny, Stephen; Yates, Brent; Branson, James G; Cittolin, Sergio; Derdzinski, Mark; Gerosa, Raffaele; Gilbert, Dylan; Hashemi, Bobak; Holzner, André; Klein, Daniel; Kole, Gouranga; Krutelyov, Vyacheslav; Letts, James; Masciovecchio, Mario; Olivito, Dominick; Padhi, Sanjay; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tadel, Matevz; Vartak, Adish; Wasserbaech, Steven; Wood, John; Würthwein, Frank; Yagil, Avraham; Zevi Della Porta, Giovanni; Amin, Nick; Bhandari, Rohan; Bradmiller-Feld, John; Campagnari, Claudio; Citron, Matthew; Dishaw, Adam; Dutta, Valentina; Franco Sevilla, Manuel; Gouskos, Loukas; Heller, Ryan; Incandela, Joe; Ovcharova, Ana; Qu, Huilin; Richman, Jeffrey; Stuart, David; Suarez, Indara; Wang, Sicheng; Yoo, Jaehyeok; Anderson, Dustin; Bornheim, Adolf; Lawhorn, Jay Mathew; Newman, Harvey B; Nguyen, Thong; Spiropulu, Maria; Vlimant, Jean-Roch; Wilkinson, Richard; Xie, Si; Zhang, Zhicai; Zhu, Ren-Yuan; Andrews, Michael Benjamin; Ferguson, Thomas; Mudholkar, Tanmay; Paulini, Manfred; Sun, Menglei; Vorobiev, Igor; Weinberg, Marc; Cumalat, John Perry; Ford, William T; Jensen, Frank; Johnson, Andrew; Krohn, Michael; Leontsinis, Stefanos; MacDonald, Emily; Mulholland, Troy; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chaves, Jorge; Cheng, Yangyang; Chu, Jennifer; Datta, Abhisek; Mcdermott, Kevin; Mirman, Nathan; Patterson, Juliet Ritchie; Quach, Dan; Rinkevicius, Aurelijus; Ryd, Anders; Skinnari, Louise; Soffi, Livia; Tan, Shao Min; Tao, Zhengcheng; Thom, Julia; Tucker, Jordan; Wittich, Peter; Zientek, Margaret; Abdullin, Salavat; Albrow, Michael; Alyari, Maral; Apollinari, Giorgio; Apresyan, Artur; Apyan, Aram; Banerjee, Sunanda; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Bolla, Gino; Burkett, Kevin; Butler, Joel Nathan; Canepa, Anadi; Cerati, Giuseppe Benedetto; Cheung, Harry; Chlebana, Frank; Cremonesi, Matteo; Duarte, Javier; Elvira, Victor Daniel; Freeman, Jim; Gecse, Zoltan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Grünendahl, Stefan; Gutsche, Oliver; Hanlon, Jim; Harris, Robert M; Hasegawa, Satoshi; Hirschauer, James; Hu, Zhen; Jayatilaka, Bodhitha; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kortelainen, Matti J; Kreis, Benjamin; Lammel, Stephan; Lincoln, Don; Lipton, Ron; Liu, Miaoyuan; Liu, Tiehui; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; Merkel, Petra; Mrenna, Stephen; Nahn, Steve; O'Dell, Vivian; Pedro, Kevin; Prokofyev, Oleg; Rakness, Gregory; Ristori, Luciano; Savoy-Navarro, Aurore; Schneider, Basil; Sexton-Kennedy, Elizabeth; Soha, Aron; Spalding, William J; Spiegel, Leonard; Stoynev, Stoyan; Strait, James; Strobbe, Nadja; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vernieri, Caterina; Verzocchi, Marco; Vidal, Richard; Wang, Michael; Weber, Hannsjoerg Artur; Whitbeck, Andrew; Acosta, Darin; Avery, Paul; Bortignon, Pierluigi; Bourilkov, Dimitri; Brinkerhoff, Andrew; Cadamuro, Luca; Carnes, Andrew; Carver, Matthew; Curry, David; Field, Richard D; Gleyzer, Sergei V; Joshi, Bhargav Madhusudan; Konigsberg, Jacobo; Korytov, Andrey; Ma, Peisen; Matchev, Konstantin; Mei, Hualin; Mitselmakher, Guenakh; Shi, Kun; Sperka, David; Wang, Jian; Wang, Sean-Jiun; Joshi, Yagya Raj; Linn, Stephan; Ackert, Andrew; Adams, Todd; Askew, Andrew; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Kolberg, Ted; Martinez, German; Perry, Thomas; Prosper, Harrison; Saha, Anirban; Santra, Arka; Sharma, Varun; Yohay, Rachel; Baarmand, Marc M; Bhopatkar, Vallary; Colafranceschi, Stefano; Hohlmann, Marcus; Noonan, Daniel; Rahmani, Mehdi; Roy, Titas; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Berry, Douglas; Betts, Russell Richard; Cavanaugh, Richard; Chen, Xuan; Dittmer, Susan; Evdokimov, Olga; Gerber, Cecilia Elena; Hangal, Dhanush Anil; Hofman, David Jonathan; Jung, Kurt; Kamin, Jason; Mills, Corrinne; Sandoval Gonzalez, Irving Daniel; Tonjes, Marguerite; Varelas, Nikos; Wang, Hui; Wu, Zhenbin; Zhang, Jingyu; Alhusseini, Mohammad; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Durgut, Süleyman; Gandrajula, Reddy Pratap; Haytmyradov, Maksat; Khristenko, Viktor; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Penzo, Aldo; Snyder, Christina; Tiras, Emrah; Wetzel, James; Blumenfeld, Barry; Cocoros, Alice; Eminizer, Nicholas; Fehling, David; Feng, Lei; Gritsan, Andrei; Hung, Wai Ting; Maksimovic, Petar; Roskes, Jeffrey; Sarica, Ulascan; Swartz, Morris; Xiao, Meng; You, Can; Al-bataineh, Ayman; Baringer, Philip; Bean, Alice; Boren, Samuel; Bowen, James; Castle, James; Khalil, Sadia; Kropivnitskaya, Anna; Majumder, Devdatta; Mcbrayer, William; Murray, Michael; Rogan, Christopher; Sanders, Stephen; Schmitz, Erich; Tapia Takaki, Daniel; Wang, Quan; Ivanov, Andrew; Kaadze, Ketino; Kim, Doyeong; Maravin, Yurii; Mendis, Dalath Rachitha; Mitchell, Tyler; Modak, Atanu; Mohammadi, Abdollah; Saini, Lovedeep Kaur; Skhirtladze, Nikoloz; Rebassoo, Finn; Wright, Douglas; Baden, Drew; Baron, Owen; Belloni, Alberto; Eno, Sarah Catherine; Feng, Yongbin; Ferraioli, Charles; Hadley, Nicholas John; Jabeen, Shabnam; Jeng, Geng-Yuan; Kellogg, Richard G; Kunkle, Joshua; Mignerey, Alice; Ricci-Tam, Francesca; Shin, Young Ho; Skuja, Andris; Tonwar, Suresh C; Wong, Kak; Abercrombie, Daniel; Allen, Brandon; Azzolini, Virginia; Barbieri, Richard; Baty, Austin; Bauer, Gerry; Bi, Ran; Brandt, Stephanie; Busza, Wit; Cali, Ivan Amos; D'Alfonso, Mariarosaria; Demiragli, Zeynep; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Harris, Philip; Hsu, Dylan; Hu, Miao; Iiyama, Yutaro; Innocenti, Gian Michele; Klute, Markus; Kovalskyi, Dmytro; Lee, Yen-Jie; Levin, Andrew; Luckey, Paul David; Maier, Benedikt; Marini, Andrea Carlo; Mcginn, Christopher; Mironov, Camelia; Narayanan, Siddharth; Niu, Xinmei; Paus, Christoph; Roland, Christof; Roland, Gunther; Stephans, George; Sumorok, Konstanty; Tatar, Kaya; Velicanu, Dragos; Wang, Jing; Wang, Ta-Wei; Wyslouch, Bolek; Zhaozhong, Shi; Benvenuti, Alberto; Chatterjee, Rajdeep Mohan; Evans, Andrew; Hansen, Peter; Kalafut, Sean; Kubota, Yuichi; Lesko, Zachary; Mans, Jeremy; Nourbakhsh, Shervin; Ruckstuhl, Nicole; Rusack, Roger; Turkewitz, Jared; Wadud, Mohammad Abrar; Acosta, John Gabriel; Oliveros, Sandra; Avdeeva, Ekaterina; Bloom, Kenneth; Claes, Daniel R; Fangmeier, Caleb; Golf, Frank; Gonzalez Suarez, Rebeca; Kamalieddin, Rami; Kravchenko, Ilya; Monroy, Jose; Siado, Joaquin Emilo; Snow, Gregory R; Stieger, Benjamin; Godshalk, Andrew; Harrington, Charles; Iashvili, Ia; Kharchilava, Avto; Nguyen, Duong; Parker, Ashley; Rappoccio, Salvatore; Roozbahani, Bahareh; Barberis, Emanuela; Freer, Chad; Hortiangtham, Apichart; Morse, David Michael; Orimoto, Toyoko; Teixeira De Lima, Rafael; Wamorkar, Tanvi; Wang, Bingran; Wisecarver, Andrew; Wood, Darien; Bhattacharya, Saptaparna; Charaf, Otman; Hahn, Kristan Allan; Mucia, Nicholas; Odell, Nathaniel; Schmitt, Michael Henry; Sung, Kevin; Trovato, Marco; Velasco, Mayda; Bucci, Rachael; Dev, Nabarun; Hildreth, Michael; Hurtado Anampa, Kenyi; Jessop, Colin; Karmgard, Daniel John; Kellams, Nathan; Lannon, Kevin; Li, Wenzhao; Loukas, Nikitas; Marinelli, Nancy; Meng, Fanbo; Mueller, Charles; Musienko, Yuri; Planer, Michael; Reinsvold, Allison; Ruchti, Randy; Siddireddy, Prasanna; Smith, Geoffrey; Taroni, Silvia; Wayne, Mitchell; Wightman, Andrew; Wolf, Matthias; Woodard, Anna; Alimena, Juliette; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Flowers, Sean; Francis, Brian; Hart, Andrew; Hill, Christopher; Ji, Weifeng; Ling, Ta-Yung; Luo, Wuming; Winer, Brian L; Wulsin, Howard Wells; Cooperstein, Stephane; Elmer, Peter; Hardenbrook, Joshua; Hebda, Philip; Higginbotham, Samuel; Kalogeropoulos, Alexis; Lange, David; Lucchini, Marco Toliman; Luo, Jingyu; Marlow, Daniel; Mei, Kelvin; Ojalvo, Isabel; Olsen, James; Palmer, Christopher; Piroué, Pierre; Salfeld-Nebgen, Jakob; Stickland, David; Tully, Christopher; Malik, Sudhir; Norberg, Scarlet; Barker, Anthony; Barnes, Virgil E; Gutay, Laszlo; Jones, Matthew; Jung, Andreas Werner; Khatiwada, Ajeeta; Mahakud, Bibhuprasad; Miller, David Harry; Neumeister, Norbert; Peng, Cheng-Chieh; Qiu, Hao; Schulte, Jan-Frederik; Sun, Jian; Wang, Fuqiang; Xiao, Rui; Xie, Wei; Cheng, Tongguang; Dolen, James; Parashar, Neeti; Chen, Zhenyu; Ecklund, Karl Matthew; Freed, Sarah; Geurts, Frank JM; Guilbaud, Maxime; Kilpatrick, Matthew; Li, Wei; Michlin, Benjamin; Padley, Brian Paul; Roberts, Jay; Rorie, Jamal; Shi, Wei; Tran, Benjamin; Tu, Zhoudunming; Zabel, James; Zhang, Aobo; Bodek, Arie; de Barbaro, Pawel; Demina, Regina; Duh, Yi-ting; Dulemba, Joseph Lynn; Fallon, Colin; Ferbel, Thomas; Galanti, Mario; Garcia-Bellido, Aran; Han, Jiyeon; Hindrichs, Otto; Khukhunaishvili, Aleko; Lo, Kin Ho; Tan, Ping; Taus, Rhys; Verzetti, Mauro; Agapitos, Antonis; Chou, John Paul; Gershtein, Yuri; Gómez Espinosa, Tirso Alejandro; Halkiadakis, Eva; Heindl, Maximilian; Hughes, Elliot; Kaplan, Steven; Kunnawalkam Elayavalli, Raghav; Kyriacou, Savvas; Lath, Amitabh; Montalvo, Roy; Nash, Kevin; Osherson, Marc; Saka, Halil; Salur, Sevil; Schnetzer, Steve; Sheffield, David; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Delannoy, Andrés G; Heideman, Joseph; Riley, Grant; Rose, Keith; Spanier, Stefan; Thapa, Krishna; Bouhali, Othmane; Castaneda Hernandez, Alfredo; Celik, Ali; Dalchenko, Mykhailo; De Mattia, Marco; Delgado, Andrea; Dildick, Sven; Eusebi, Ricardo; Gilmore, Jason; Huang, Tao; Kamon, Teruki; Luo, Sifu; Mueller, Ryan; Pakhotin, Yuriy; Patel, Rishi; Perloff, Alexx; Perniè, Luca; Rathjens, Denis; Safonov, Alexei; Tatarinov, Aysen; Akchurin, Nural; Damgov, Jordan; De Guio, Federico; Dudero, Phillip Russell; Kunori, Shuichi; Lamichhane, Kamal; Lee, Sung Won; Mengke, Tielige; Muthumuni, Samila; Peltola, Timo; Undleeb, Sonaina; Volobouev, Igor; Wang, Zhixing; Greene, Senta; Gurrola, Alfredo; Janjam, Ravi; Johns, Willard; Maguire, Charles; Melo, Andrew; Ni, Hong; Padeken, Klaas; Ruiz Alvarez, José David; Sheldon, Paul; Tuo, Shengquan; Velkovska, Julia; Verweij, Marta; Xu, Qiao; Arenton, Michael Wayne; Barria, Patrizia; Cox, Bradley; Hirosky, Robert; Joyce, Matthew; Ledovskoy, Alexander; Li, Hengne; Neu, Christopher; Sinthuprasith, Tutanon; Wang, Yanchu; Wolfe, Evan; Xia, Fan; Harr, Robert; Karchin, Paul Edmund; Poudyal, Nabin; Sturdy, Jared; Thapa, Prakash; Zaleski, Shawn; Brodski, Michael; Buchanan, James; Caillol, Cécile; Carlsmith, Duncan; Dasu, Sridhara; Dodd, Laura; Duric, Senka; Gomber, Bhawna; Grothe, Monika; Herndon, Matthew; Hervé, Alain; Hussain, Usama; Klabbers, Pamela; Lanaro, Armando; Levine, Aaron; Long, Kenneth; Loveless, Richard; Ruggles, Tyler; Savin, Alexander; Smith, Nicholas; Smith, Wesley H; Woods, Nathaniel
2018-01-01
The elliptic azimuthal anisotropy coefficient ($v_2$) is measured for charm ($ {\\mathrm{D^0}} $) and strange ($ {\\mathrm{K^0_S}} $, $ \\Lambda $, $ \\Xi^-$, and $ \\Omega^-$) hadrons, using a data sample of pPb collisions collected by the CMS experiment, at a nucleon-nucleon center-of-mass energy ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 8.16 TeV. A significant positive $v_2$ signal from long-range azimuthal correlations is observed for all particle species in high-multiplicity pPb collisions. The measurement represents the first observation of possible long-range collectivity for open heavy flavor hadrons in small systems. The results suggest that charm quarks have a smaller $v_2$ than the lighter quarks, probably reflecting a weaker collective behavior. This effect is not seen in the larger PbPb collision system at ${\\sqrt {\\smash [b]{s_{_{\\mathrm {NN}}}}}} = $ 5.02 TeV, also presented.
CMS Collaboration
2018-01-01
First measurements of the elliptic flow of prompt D$^{0}$ mesons in comparison to $\\mathrm{K^0_S}$, $\\Lambda$, $\\Xi^{-}$, and $\\Omega^{-}$ hadrons in pPb collisions at $\\sqrt{s_{_{NN}}} = 8.16~\\mathrm{TeV}$ are reported. The results are based on data collected by the CMS experiment at the LHC and are presented for particles at midrapidity with transverse momentum up to 8 GeV/c after correcting for the contribution of back-to-back jet correlations. The results are compared to PbPb collision data at $\\sqrt{s_{_{NN}}} = 5.02~\\mathrm{TeV}$ for $30-50\\%$ centrality. A significant elliptic flow ($v_2$) signal is observed for all particles, in very high-multiplicity ($\\sim 200$ charged particles) pPb events. When divided by the number of constituent quarks and studied as function of the transverse kinetic energy per quark, the D$^{0}$ $v_2$ values are observed to be significantly smaller than those of light flavor particles, an effect not observed in PbPb collisions. These results show a weaker collective flow assoc...
DEFF Research Database (Denmark)
Kielsgaard Kristensen, Thomas; Vestergaard, H; Bindslev-Jensen, C
2017-01-01
BACKGROUND: Sensitive KIT D816V mutation analysis of blood has been proposed to guide bone marrow (BM) investigation in suspected systemic mastocytosis (SM). The aim of this prospective study was for the first time to compare the D816V status of the "screening blood sample" used to guide BM biopsy...... in suspected SM to the outcome of the subsequent BM investigation. METHODS: Fifty-eight adult patients with suspected SM were included. The outcome of sensitive KIT D816V analysis of blood was compared to the result of the BM investigation. RESULTS: Screening blood samples from 44 of 58 patients tested D816V...... patients did not fulfill any diagnostic SM criteria (excluding tryptase criterion). Of the 48 SM patients, 90% tested D816V-positive. Thirteen SM patients presented with Hymenoptera venom-induced anaphylaxis, no skin lesions, and baseline serum tryptase ≤20 ng/mL. Of these, 92% tested D816V...
Numerical analysis of In_xGa_1_−_xN/SnS and Al_xGa_1_−_xN/SnS heterojunction solar cells
International Nuclear Information System (INIS)
Lin, Shuo; Li, Xirong; Pan, Huaqing; Chen, Huanting; Li, Xiuyan; Li, Yan; Zhou, Jinrong
2016-01-01
Highlights: • In_xGa_1_−_xN/SnS and Al_xGa_1_−_xN/SnS solar cells are studied by numerical analysis. • Performances of In_xGa_1_−_xN/SnS solar cells enhanced with decreasing In content. • The electron barrier leads to the degraded efficiency of Al_xGa_1_−_xN/SnS solar cells. • GaN/SnS solar cell exhibits the highest efficiency 26.34%. - Abstract: In this work the photovoltaic properties of In_xGa_1_−_xN/SnS and Al_xGa_1_−_xN/SnS heterojunction solar cells are studied by numerical analysis. The photovoltaic performances of In_xGa_1_−_xN/SnS solar cells are enhanced with the decreasing In content and the GaN/SnS solar cell exhibits the highest efficiency. The efficiencies of GaN/SnS solar cell improve with the increased SnS thickness and the reduced GaN thickness. For the Al_xGa_1_−_xN/SnS solar cells, there is electron barrier in the Al_xGa_1_−_xN/SnS interface. The electron barrier becomes larger with increasing Al content and lead to the degraded efficiency of Al_xGa_1_−_xN/SnS solar cells. The simulation contributes to designing and fabricating SnS solar cells.
Energy Technology Data Exchange (ETDEWEB)
Bastide, S.; Tena-Zaera, R.; Alleno, E.; Godart, C.; Levy-Clement, C. [Centre National de la Recherche Scientifique (CNRS), Lab. de Chimie Metallurgique des Terres Rares, 94 - Thiais (France); Hodes, G. [Weizmann Institute of Science, Rehovot (Israel)
2006-07-01
In this work, an electrochemical method to produce H{sub 2}X (X=S, Se, Te) hydrides in a controlled way (without being able to store them) and to transfer them directly in the synthesis reactor has been perfected. By this method, the use of H{sub 2}Te has been possible. The method uses the reduction of the elementary chalcogenide in acid medium. The Te being conductor, it can be directly used as electrode, on the other hand S and Se are insulators. Nevertheless, graphite-S or Se conducing composite electrodes can also be used. When the electrolyte composition (pH, salts presence) is well adjusted, the essential of the cathodic current is consumed by the chalcogenide reduction (low evolution of H{sub 2}) with faradic yields of about 100% for H{sub 2}S and H{sub 2}Se and 40% for HeTe. The use of H{sub 2}X allows the synthesis of nano-particles of metals chalcogenides directly by reaction with dissolved metallic salts in aqueous or organic medium and precipitation. Thus it has been possible to prepare all the CdX compounds under the form of nano-particles of diameter between 3 and 5 nm by bubbling of the gaseous hydrides in aqueous acetate solutions of Cd. In producing concomitantly H{sub 2}S and H{sub 2}Se, nano-particles of solid solutions CdS{sub x}Se{sub 1-x} have been synthesized too. (O.M.)
AdS3 xw (S3 x S3 x S1) solutions of type IIB string theory
International Nuclear Information System (INIS)
Donos, Aristomenis; Gauntlett, Jerome P.; Imperial College, London; Sparks, James
2008-10-01
We analyse a recently constructed class of local solutions of type IIB supergravity that consist of a warped product of AdS 3 with a sevendimensional internal space. In one duality frame the only other nonvanishing fields are the NS three-form and the dilaton. We analyse in detail how these local solutions can be extended to globally well-defined solutions of type IIB string theory, with the internal space having topology S 3 x S 3 x S 1 and with properly quantised three-form flux. We show that many of the dual (0,2) SCFTs are exactly marginal deformations of the (0,2) SCFTs whose holographic duals are warped products of AdS 3 with seven-dimensional manifolds of topology S 3 x S 2 x T 2 . (orig.)
Acharya, Shreyasi; The ALICE collaboration; Adamova, Dagmar; Adolfsson, Jonatan; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahn, Sang Un; Aiola, Salvatore; Akindinov, Alexander; Al-turany, Mohammad; Alam, Sk Noor; Silva De Albuquerque, Danilo; Aleksandrov, Dmitry; Alessandro, Bruno; Alfaro Molina, Jose Ruben; Ali, Yasir; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altenkamper, Lucas; Altsybeev, Igor; Andrei, Cristian; Andreou, Dimitra; Andrews, Harry Arthur; Andronic, Anton; Angeletti, Massimo; Anguelov, Venelin; Anson, Christopher Daniel; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Anwar, Rafay; Apadula, Nicole; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Arnaldi, Roberta; Arnold, Oliver Werner; Arsene, Ionut Cristian; Arslandok, Mesut; Audurier, Benjamin; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Ball, Markus; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barioglio, Luca; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Barth, Klaus; Bartsch, Esther; Bastid, Nicole; Basu, Sumit; Batigne, Guillaume; Batyunya, Boris; Batzing, Paul Christoph; Bazo Alba, Jose Luis; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Espinoza Beltran, Lucina Gabriela; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhaduri, Partha Pratim; Bhasin, Anju; Bhat, Inayat Rasool; Bhatt, Himani; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Antonio; Bianchi, Livio; Bianchi, Nicola; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biro, Gabor; Biswas, Rathijit; Biswas, Saikat; Blair, Justin Thomas; Blau, Dmitry; Blume, Christoph; Boca, Gianluigi; Bock, Friederike; Bogdanov, Alexey; Boldizsar, Laszlo; Bombara, Marek; Bonomi, Germano; Bonora, Matthias; Borel, Herve; Borissov, Alexander; Borri, Marcello; Botta, Elena; Bourjau, Christian; Bratrud, Lars; Braun-munzinger, Peter; Bregant, Marco; Broker, Theo Alexander; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buhler, Paul; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Bashir Butt, Jamila; Buxton, Jesse Thomas; Cabala, Jan; Caffarri, Davide; Caines, Helen Louise; Caliva, Alberto; Calvo Villar, Ernesto; Soto Camacho, Rabi; Camerini, Paolo; Capon, Aaron Allan; Carena, Francesco; Carena, Wisla; Carnesecchi, Francesca; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Ceballos Sanchez, Cesar; Chandra, Sinjini; Chang, Beomsu; Chang, Wan; Chapeland, Sylvain; Chartier, Marielle; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chauvin, Alex; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Cho, Soyeon; Chochula, Peter; Chowdhury, Tasnuva; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Concas, Matteo; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Costanza, Susanna; Crkovska, Jana; Crochet, Philippe; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Dani, Sanskruti; Danisch, Meike Charlotte; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Conti, Camila; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Derradi De Souza, Rafael; Franz Degenhardt, Hermann; Deisting, Alexander; Deloff, Andrzej; Delsanto, Silvia; Deplano, Caterina; Dhankher, Preeti; Di Bari, Domenico; Di Mauro, Antonio; Di Ruzza, Benedetto; Arteche Diaz, Raul; Dietel, Thomas; Dillenseger, Pascal; Ding, Yanchun; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Van Doremalen, Lennart Vincent; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dudi, Sandeep; Duggal, Ashpreet Kaur; Dukhishyam, Mallick; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Endress, Eric; Engel, Heiko; Epple, Eliane; Erazmus, Barbara Ewa; Erhardt, Filip; Ersdal, Magnus Rentsch; Espagnon, Bruno; Eulisse, Giulio; Eum, Jongsik; Evans, David; Evdokimov, Sergey; Fabbietti, Laura; Faggin, Mattia; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Feliciello, Alessandro; Feofilov, Grigorii; Fernandez Tellez, Arturo; Ferretti, Alessandro; Festanti, Andrea; Feuillard, Victor Jose Gaston; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiorenza, Gabriele; Flor, Fernando; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Francisco, Audrey; Frankenfeld, Ulrich Michael; Fronze, Gabriele Gaetano; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gajdosova, Katarina; Gallio, Mauro; Duarte Galvan, Carlos; Ganoti, Paraskevi; Garabatos Cuadrado, Jose; Garcia-solis, Edmundo Javier; Garg, Kunal; Gargiulo, Corrado; Gasik, Piotr Jan; Gauger, Erin Frances; De Leone Gay, Maria Beatriz; Germain, Marie; Ghosh, Jhuma; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Glassel, Peter; Gomez Coral, Diego Mauricio; Gomez Ramirez, Andres; Gonzalez, Victor; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Graham, Katie Leanne; Greiner, Leo Clifford; Grelli, Alessandro; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Gronefeld, Julius Maximilian; Grosa, Fabrizio; Grosse-oetringhaus, Jan Fiete; Grosso, Raffaele; Guernane, Rachid; Guerzoni, Barbara; Guittiere, Manuel; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Bautista Guzman, Irais; Haake, Rudiger; Habib, Michael Karim; Hadjidakis, Cynthia Marie; Hamagaki, Hideki; Hamar, Gergoe; Hamid, Mohammed; Hamon, Julien Charles; Hannigan, Ryan; Haque, Md Rihan; Harris, John William; Harton, Austin Vincent; Hassan, Hadi; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Hellbar, Ernst; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Gonzalez Hernandez, Emma; Herrera Corral, Gerardo Antonio; Herrmann, Florian; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hills, Christopher; Hippolyte, Boris; Hohlweger, Bernhard; Horak, David; Hornung, Sebastian; Hosokawa, Ritsuya; Hota, Jyotishree; Hristov, Peter Zahariev; Huang, Chun-lu; Hughes, Charles; Huhn, Patrick; Humanic, Thomas; Hushnud, Hushnud; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Iddon, James Philip; Iga Buitron, Sergio Arturo; Ilkaev, Radiy; Inaba, Motoi; Ippolitov, Mikhail; Islam, Md Samsul; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacak, Barbara; Jacazio, Nicolo; Jacobs, Peter Martin; Jadhav, Manoj Bhanudas; Jadlovska, Slavka; Jadlovsky, Jan; Jaelani, Syaefudin; Jahnke, Cristiane; Jakubowska, Monika Joanna; Janik, Malgorzata Anna; Jena, Chitrasen; Jercic, Marko; Jimenez Bustamante, Raul Tonatiuh; Jin, Muqing; Jones, Peter Graham; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karczmarczyk, Przemyslaw; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Ketzer, Bernhard Franz; Khabanova, Zhanna; Khan, Ahsan Mehmood; Khan, Shaista; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Khatun, Anisa; Khuntia, Arvind; Kielbowicz, Miroslaw Marek; Kileng, Bjarte; Kim, Byungchul; Kim, Daehyeok; Kim, Dong Jo; Kim, Eun Joo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Jiyoung; Kim, Minjung; Kim, Se Yong; Kim, Taejun; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-boesing, Christian; Klewin, Sebastian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobdaj, Chinorat; Varga-kofarago, Monika; Kohler, Markus Konrad; Kollegger, Thorsten; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Konyushikhin, Maxim; Kovalenko, Oleksandr; Kovalenko, Vladimir; Kowalski, Marek; Kralik, Ivan; Kravcakova, Adela; Kreis, Lukas; Krivda, Marian; Krizek, Filip; Kruger, Mario; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kumar, Jitendra; Kumar, Lokesh; Kumar, Shyam; Kundu, Sourav; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lai, Yue Shi; Lakomov, Igor; Langoy, Rune; Lapidus, Kirill; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Larionov, Pavel; Laudi, Elisa; Lavicka, Roman; Lea, Ramona; Leardini, Lucia; Lee, Seongjoo; Lehas, Fatiha; Lehner, Sebastian; Lehrbach, Johannes; Lemmon, Roy Crawford; Leon Monzon, Ildefonso; Levai, Peter; Li, Xiaomei; Li, Xing Long; Lien, Jorgen Andre; Lietava, Roman; Lim, Bong-hwi; Lindal, Svein; Lindenstruth, Volker; Lindsay, Scott William; Lippmann, Christian; Lisa, Michael Annan; Litichevskyi, Vladyslav; Liu, Alwina; Ljunggren, Hans Martin; Llope, William; Lodato, Davide Francesco; Loginov, Vitaly; Loizides, Constantinos; Loncar, Petra; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Luettig, Philipp Johannes; Luhder, Jens Robert; Lunardon, Marcello; Luparello, Grazia; Lupi, Matteo; Maevskaya, Alla; Mager, Magnus; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Malik, Qasim Waheed; Malinina, Liudmila; Mal'kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manko, Vladislav; Manso, Franck; Manzari, Vito; Mao, Yaxian; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martin, Nicole Alice; Martinengo, Paolo; Martinez, Jacobb Lee; Martinez Hernandez, Mario Ivan; Martinez-garcia, Gines; Martinez Pedreira, Miguel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Masson, Erwann; Mastroserio, Annalisa; Mathis, Andreas Michael; Toledo Matuoka, Paula Fernanda; Matyja, Adam Tomasz; Mayer, Christoph; Mazzilli, Marianna; Mazzoni, Alessandra Maria; Meddi, Franco; Melikyan, Yuri; Menchaca-rocha, Arturo Alejandro; Meninno, Elisa; Mercado-perez, Jorge; Meres, Michal; Soncco Meza, Carlos; Mhlanga, Sibaliso; Miake, Yasuo; Micheletti, Luca; Mieskolainen, Matti Mikael; Mihaylov, Dimitar Lubomirov; Mikhaylov, Konstantin; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Auro Prasad; Mohanty, Bedangadas; Khan, Mohammed Mohisin; Moreira De Godoy, Denise Aparecida; Perez Moreno, Luis Alberto; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Munning, Konstantin; Arratia Munoz, Miguel Ignacio; Munzer, Robert Helmut; Murakami, Hikari; Murray, Sean; Musa, Luciano; Musinsky, Jan; Myers, Corey James; Myrcha, Julian Wojciech; Naik, Bharati; Nair, Rahul; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Narayan, Amrendra; Naru, Muhammad Umair; Nassirpour, Adrian Fereydon; Ferreira Natal Da Luz, Pedro Hugo; Nattrass, Christine; Rosado Navarro, Sebastian; Nayak, Kishora; Nayak, Ranjit; Nayak, Tapan Kumar; Nazarenko, Sergey; Negrao De Oliveira, Renato Aparecido; Nellen, Lukas; Nesbo, Simon Voigt; Neskovic, Gvozden; Ng, Fabian; Nicassio, Maria; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Cabanillas Noris, Juan Carlos; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oh, Hoonjung; Ohlson, Alice Elisabeth; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Orava, Risto; Oravec, Matej; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Pachmayer, Yvonne Chiara; Pacik, Vojtech; Pagano, Davide; Paic, Guy; Palni, Prabhakar; Pan, Jinjin; Pandey, Ashutosh Kumar; Panebianco, Stefano; Papikyan, Vardanush; Pareek, Pooja; Park, Jonghan; Parkkila, Jasper Elias; Parmar, Sonia; Passfeld, Annika; Pathak, Surya Prakash; Patra, Rajendra Nath; Paul, Biswarup; Pei, Hua; Peitzmann, Thomas; Peng, Xinye; Pereira, Luis Gustavo; Pereira Da Costa, Hugo Denis Antonio; Peresunko, Dmitry Yurevich; Perez Lezama, Edgar; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrovici, Mihai; Petta, Catia; Peretti Pezzi, Rafael; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Ozelin De Lima Pimentel, Lais; Pinazza, Ombretta; Pinsky, Lawrence; Pisano, Silvia; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pliquett, Fabian; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Poppenborg, Hendrik; Porteboeuf, Sarah Julie; Pozdniakov, Valeriy; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Punin, Valery; Putschke, Jorn Henning; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Rami, Fouad; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Ratza, Viktor; Ravasenga, Ivan; Read, Kenneth Francis; Redlich, Krzysztof; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reshetin, Andrey; Revol, Jean-pierre; Reygers, Klaus Johannes; Riabov, Viktor; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-lucian; Rode, Sudhir Pandurang; Rodriguez Cahuantzi, Mario; Roeed, Ketil; Rogalev, Roman; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Rokita, Przemyslaw Stefan; Ronchetti, Federico; Dominguez Rosas, Edgar; Roslon, Krystian; Rosnet, Philippe; Rossi, Andrea; Rotondi, Alberto; Roukoutakis, Filimon; Roy, Christelle Sophie; Roy, Pradip Kumar; Vazquez Rueda, Omar; Rui, Rinaldo; Rumyantsev, Boris; Rustamov, Anar; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Saarinen, Sampo; Sadhu, Samrangy; Sadovskiy, Sergey; Safarik, Karel; Saha, Sumit Kumar; Sahoo, Baidyanath; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sandoval, Andres; Sarkar, Amal; Sarkar, Debojit; Sarkar, Nachiketa; Sarma, Pranjal; Sas, Mike Henry Petrus; Scapparone, Eugenio; Scarlassara, Fernando; Schaefer, Brennan; Scheid, Horst Sebastian; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schmidt, Marten Ole; Schmidt, Martin; Schmidt, Nicolas Vincent; Schukraft, Jurgen; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Sefcik, Michal; Seger, Janet Elizabeth; Sekiguchi, Yuko; Sekihata, Daiki; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Senyukov, Serhiy; Serradilla Rodriguez, Eulogio; Sett, Priyanka; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shahoyan, Ruben; Shaikh, Wadut; Shangaraev, Artem; Sharma, Anjali; Sharma, Ankita; Sharma, Meenakshi; Sharma, Natasha; Sheikh, Ashik Ikbal; Shigaki, Kenta; Shimomura, Maya; Shirinkin, Sergey; Shou, Qiye; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singh, Randhir; Singhal, Vikas; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Song, Jihye; Soramel, Francesca; Sorensen, Soren Pontoppidan; Sozzi, Federica; Sputowska, Iwona Anna; Stachel, Johanna; Stan, Ionel; Stankus, Paul; Stenlund, Evert Anders; Stocco, Diego; Storetvedt, Maksim Melnik; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Suljic, Miljenko; Sultanov, Rishat; Sumbera, Michal; Sumowidagdo, Suharyo; Suzuki, Ken; Swain, Sagarika; Szabo, Alexander; Szarka, Imrich; Tabassam, Uzma; Takahashi, Jun; Tambave, Ganesh Jagannath; Tanaka, Naoto; Tarhini, Mohamad; Tariq, Mohammad; Tarzila, Madalina-gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terrevoli, Cristina; Teyssier, Boris; Thakur, Dhananjaya; Thakur, Sanchari; Thomas, Deepa; Thoresen, Freja; Tieulent, Raphael Noel; Tikhonov, Anatoly; Timmins, Anthony Robert; Toia, Alberica; Topilskaya, Nataliya; Toppi, Marco; Rojas Torres, Solangel; Tripathy, Sushanta; Trogolo, Stefano; Trombetta, Giuseppe; Tropp, Lukas; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Trzcinski, Tomasz Piotr; Trzeciak, Barbara Antonina; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Umaka, Ejiro Naomi; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vala, Martin; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vazquez Doce, Oton; Vechernin, Vladimir; Veen, Annelies Marianne; Vercellin, Ermanno; Vergara Limon, Sergio; Vermunt, Luuk; Vernet, Renaud; Vertesi, Robert; Vickovic, Linda; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Villatoro Tello, Abraham; Vinogradov, Alexander; Virgili, Tiziano; Vislavicius, Vytautas; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Voscek, Dominik; Vranic, Danilo; Vrlakova, Janka; Wagner, Boris; Wang, Hongkai; Wang, Mengliang; Watanabe, Yosuke; Weber, Michael; Weber, Steffen Georg; Wegrzynek, Adam; Weiser, Dennis Franz; Wenzel, Sandro Christian; Wessels, Johannes Peter; Westerhoff, Uwe; Whitehead, Andile Mothegi; Wiechula, Jens; Wikne, Jon; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Willems, Guido Alexander; Williams, Crispin; Willsher, Emily; Windelband, Bernd Stefan; Witt, William Edward; Xu, Ran; Yalcin, Serpil; Yamakawa, Kosei; Yano, Satoshi; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-kwon; Yoon, Jin Hee; Yurchenko, Volodymyr; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correa Zanoli, Henrique Jose; Zardoshti, Nima; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zhalov, Mikhail; Zhang, Xiaoming; Zhang, Yonghong; Zhang, Zuman; Zhao, Chengxin; Zherebchevskii, Vladimir; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Ya; Zichichi, Antonino; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zmeskal, Johann; Zou, Shuguang
2018-01-01
Inclusive J/$\\psi$ production is studied in p-Pb interactions at a centre-of-mass energy per nucleon-nucleon collision $\\sqrt{s_{NN}}$ = 8.16 TeV, using the ALICE detector at the CERN LHC. The J/$\\psi$ meson is reconstructed, via its decay to a muon pair, in the centre-of-mass rapidity intervals 2.03 < $y_{cms}$ < 3.53 and −4.46 < $y_{cms}$ < −2.96, where positive and negative $y_{cms}$ refer to the p-going and Pb-going direction, respectively. The transverse momentum coverage is $p_{T}$ < 20 GeV/$c$. In this paper, $y_{cms}$- and $p_{T}$-differential cross sections for inclusive J/$\\psi$ production are presented, and the corresponding nuclear modification factors RpPb are shown. Forward results show a suppression of the J/ψ yield with respect to pp collisions, concentrated in the region $p_{T}$ $\\lesssim$ 5 GeV/$c$. At backward rapidity no significant suppression is observed. The results are compared to previous measurements by ALICE in p-Pb collisions at $\\sqrt{s_{NN}}$ = 5.02 TeV and to...
DEFF Research Database (Denmark)
Kielsgaard Kristensen, Thomas; Broesby-Olsen, Sigurd; Vestergaard, Hanne
2013-01-01
Most adults with systemic mastocytosis (SM) carry the somatic KIT D816V mutation, but the occurrence of the mutation in lesional skin remains to be characterized.......Most adults with systemic mastocytosis (SM) carry the somatic KIT D816V mutation, but the occurrence of the mutation in lesional skin remains to be characterized....
Sensitive KIT D816V mutation analysis of blood as a diagnostic test in mastocytosis
DEFF Research Database (Denmark)
Kielsgaard Kristensen, Thomas; Vestergaard, Hanne; Bindslev-Jensen, Carsten
2014-01-01
The recent progress in sensitive KIT D816V mutation analysis suggests that mutation analysis of peripheral blood (PB) represents a promising diagnostic test in mastocytosis. However, there is a need for systematic assessment of the analytical sensitivity and specificity of the approach in order...... to establish its value in clinical use. We therefore evaluated sensitive KIT D816V mutation analysis of PB as a diagnostic test in an entire case-series of adults with mastocytosis. We demonstrate for the first time that by using a sufficiently sensitive KIT D816V mutation analysis, it is possible to detect...... the mutation in PB in nearly all adult mastocytosis patients. The mutation was detected in PB in 78 of 83 systemic mastocytosis (94%) and 3 of 4 cutaneous mastocytosis patients (75%). The test was 100% specific as determined by analysis of clinically relevant control patients who all tested negative. Mutation...
Effect of small cold forming on the creep behaviour of gas turbine blades made of Nimonic 90
International Nuclear Information System (INIS)
Keienburg, K.H.; Krueger, H.; Pickert, U.; Bautz, G.
1987-01-01
In order to obtain information on the material behaviour of Nimonic 90 with and without cold forming at the main temperature of use of 560deg C for large gas turbine blades, creep and relaxation samples were taken from the large volume foot of a gas turbine blade, part of which were tensioned by 3% cold in a tensile test machine. The selected cold forming was obtained as the upper limit from DMS measurements on a gas turbine blade when aligning. The negative effect of cold forming on the creep behaviour known from the literature for other γ hardened nickel base alloys was confirmed. The grain (matrix) is strengthened and the grain boundary is simultaneously weakened by cold forming. The material is also sensitized, so that fine separation occurs in the grain at the sliding bands and at the grain boundaries. Both circumstances contribute to the worsening of the creep behaviour, significantly for stresses below the technical elastic limit in the cold formed state. It follows, relative to large gas turbine blades, that: 1) Aligning operations must be restricted to the absolute minimum necessary and should be avoided completely if possible. 2) Aligned blades should be subjected to renewed solution annealing and separation hardening. 3.) Blades deformed in operation should also be subjected to renewed complete heat treatment. (orig.) [de
Ferromagnetic resonance studies on (Co40Fe40B20)x(SiO2)1-x granular magnetic films
International Nuclear Information System (INIS)
Yildiz, F.; Kazan, S.; Aktas, B.; Tarapov, S.I.; Tagirov, L.; Granovsky, B.
2006-01-01
Magnetic properties of granular (Co 40 Fe 40 B 20 ) x (SiO 2 ) 1-x thin films (x=0.37-0.53) have been studied by ferromagnetic resonance (FMR) technique. Samples have been prepared by ion-beam deposition of Co-Fe-B particles and SiO 2 on sitall ceramic substrate. The FMR measurements have been done for different orientations of DC magnetic field with respect to the sample plane. It was found that the deduced value of effective magnetization from FMR data of the thin granular film is reduced by the volume-filling factor of the bulk saturation magnetization. The overall magnetization changes from 152 to 515G depending on the ratio of the magnetic nanoparticles in the SiO 2 matrix. From angular measurements an induced in-plane uniaxial anisotropy has been obtained due to the preparation of the film conditions as well
Czech Academy of Sciences Publication Activity Database
Bureš, Zbyněk; Bartošová, Jolana; Lindovský, Jiří; Chumak, Tetyana; Popelář, Jiří; Syka, Josef
2014-01-01
Roč. 40, č. 11 (2014), s. 3674-3683 ISSN 0953-816X R&D Projects: GA ČR(CZ) GAP303/12/1347; GA ČR(CZ) GBP304/12/G069; GA MŠk EE2.3.30.0018 Institutional support: RVO:68378041 Keywords : attention-dependent plasticity * auditory system * critical period Subject RIV: FH - Neurology Impact factor: 3.181, year: 2014
8x40 Gb/s RZ all-optical broadcasting utilizing an electroabsorption modulator
DEFF Research Database (Denmark)
Xu, Lin; Chi, Nan; Yvind, Kresten
2004-01-01
We experimentally demonstrate all-optical broadcasting through simultaneous 8 × 40 Gb/s wavelength conversion in the RZ format based on cross absorption modulation in an electroabsorption modulator. The original intensity-modulated information is successfully duplicated onto eight wavelengths...
DEFF Research Database (Denmark)
Kielsgaard Kristensen, Thomas; Broesby-Olsen, Sigurd; Vestergaard, Hanne
2016-01-01
mutation levels. In this study, we established an NGS-based KIT mutation analysis and analyzed the sensitivity of D816V detection using the Ion Torrent platform. Eighty-two individual NGS analyses were included in the study. All samples were also analyzed using highly sensitive KIT D816V mutation...
Daily Magnetograms for 1978 from the AFGL (Air Force Geophysics Laboratory) Network.
1985-01-08
rj4TE Y rCCE#i~nT * 9 vEflEL(6-1"i( LI"ISI( td HEUs 813 7..8... ... .... M 5 3 ... . .. .. .... .. . .. ... .. .. ... .... .. .. .. . .. .. I?’ a 7...Y LS 7 .. .. . .. . . . .. . . . . . . . . .. . - ’ - S U E . . ... . . . .. . . . .. . . . . . . .. . .. . . 534S 4349QO L.~ El jIjI -2 td [w1.2...8M) iHQ ’~LTP FLMAfEOEO EUR FLUNG.ATE X CLVRC8ET 40 HIfMO1SLAM’TVUOR DIVISION 18S33 172707 81%6 TPA 2595 .’g 977 FL-ttTY-C4FLVA()T 40 tbMTES-LAS#1’VUOR
Directory of Open Access Journals (Sweden)
Martina Fink
2012-12-01
Full Text Available Background: D816V mutation in the C-KIT gene is present in more than 90 % of patients with systemic mastocytosis (SM and 2–7 % of patients with acute myeloid leukemia (AML. D816V mutation is caused by the substitution of adenine with thymine at 2447 nucleotide sequence in the C-KIT gene. This nucleotide substitution causes the replacment of aspartate acid by valine at codon 816 of the KIT protein. KIT protein with D816V mutation acts as constitutively active tyrosine kinase that promotes cell proliferation and inhibits apoptosis. The purpose of our study was to determine the incidence of D816V mutation in the C-KIT gene in Slovenian patients with AML and in patients with suspected systemic mastocytosis. Patients and methods: In the retrospective study, 71 patients with AML and 25 patients with suspected systemic mastocytosis were included. D816V mutation in the C-KIT gene was determined by polymerase chain reaction (PCR and the resulting PCR products were analyzed by agarose gel electrophoresis. Results: D816V mutation in KIT protein was determined in 7 % of patients with AML and in 32 % patients with suspected systemic mastocytosis. Conclusions: Identification of D816V mutation in the C-KIT gene must always be performed in patients with suspected systemic mastocytosis. The determination of this mutation contributes to the diagnosis and treatment selection. The finding of D816V mutation in the C-KIT gene in patients with AML and concomitant genetic modifications RUNX-RUNX1T1 (typical translocation t(8; 21 (q22, q22 or CBFB-MYH11, which is the result of inversion on chromosome 16–(inv (16 (p13, q22, however, indicates a faster, more aggressive course of the disease and predicts a worse outcome. The finding of the mutation in other patients with AML may indicate the presence of concomitant AML and SM, which was not found in our patients.
30 CFR 816.15 - Casing and sealing of drilled holes: Permanent.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Casing and sealing of drilled holes: Permanent...-SURFACE MINING ACTIVITIES § 816.15 Casing and sealing of drilled holes: Permanent. When no longer needed... exploration hole, other drilled hole or borehole, well, and other exposed underground opening shall be capped...
30 CFR 816.73 - Disposal of excess spoil: Durable rock fills.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Disposal of excess spoil: Durable rock fills...-SURFACE MINING ACTIVITIES § 816.73 Disposal of excess spoil: Durable rock fills. The regulatory authority may approve the alternative method of disposal of excess durable rock spoil by gravity placement in...
Energy Technology Data Exchange (ETDEWEB)
Sharma, Jyoti; Suresh, K.G., E-mail: suresh@phy.iitb.ac.in
2015-01-25
Highlights: • Mn{sub 50}Ni{sub 40−x}Co{sub x}Sn{sub 10} Heusler alloys exhibit multifunctional properties. • Co doping results decrease in martensitic transition temperature and increase in T{sub C}{sup A}. • Ferromagnetic coupling increases with increase in Co concentration. • Large positive ΔS{sub M} of 10.5 J/kg K and large RCP of 125 J/kg was obtained for x = 1. • Large exchange bias field of 833 Oe was observed for Mn{sub 50}Ni{sub 39}Co{sub 1}Sn{sub 10} alloy. - Abstract: A series of Co doped Mn{sub 50}Ni{sub 40−x}Co{sub x}Sn{sub 10} (x = 0, 1, 2, 2.5, 3, 4 and 6) Heusler alloys has been investigated for their structural, magnetic, magnetocaloric and exchange bias properties. The martensitic transition temperatures are found to decrease with the increase in Co concentration due to the decrease in valence electron concentration (e/a ratio). The Curie temperature of austenite phase increases significantly with increasing Co concentration. A large positive magnetic entropy change (ΔS{sub M}) of 8.6 and 10.5 J/kg K, for a magnetic field change of 50 kOe is observed for x = 0 and 1 alloys, and ΔS{sub M} values decreases for higher Co concentrations. The relative cooling power shows a monotonic increase with the increase in Co concentration. Large exchange bias fields of 920 Oe and 833 Oe have been observed in the alloys with compositions x = 0 and 1, after field cooling in presence of 10 kOe. The unidirectional anisotropy arising at the interface between the frustrated and ferromagnetic phases is responsible for the large exchange bias observed in these alloys. With increase in Co, the magnetically frustrated phase diminishes in strength, giving rise to a decrease in the exchange bias effect for larger Co concentration. The exchange bias fields observed for compositions x = 0 and 1, in the present case are larger than that reported for Co doped Ni–Mn–Z (Z = Sn, Sb, and Ga) alloys. Temperature and cooling field dependence of the exchange bias
Phase transition in Smsub(1-x)Gdsub(x)S and Smsub(1-x)Tmsub(x)S solid solutions under pressure
International Nuclear Information System (INIS)
Kaminskij, V.V.; Stepanov, N.N.; Romanova, M.V.
1985-01-01
Experiments are conducted on studying the effect of the n quantity on Psub(pt) (phase transition pressure) for SmS and systems of solid solutions Smsub(1-x)Gdsub(x)S and Smsub(1-x)Tmsub(x)S with conductivity electron concentrations approximately 10 19 -10 21 cm -3 corresponding to the semiconducting phase of these solutions. The investigated monocrystal samples have been prepared by the method of planar crystallization from the melt, have been chipped off over the cleavage planes [100], their characteristic sizes not exceeding 2 mm. Samples of the Smsub(1-x)Tmsub(x)S system were polycrystalline and they had characteristic dimensions of approximately 3mm. Concentration of conductivity electrons has been determined from measurements of the Hall constant. Hydrostatic compression of the samples has been exercised in a piston high-pressure chamber at T=300 K. The observed electric conductivity jump determined by the standard d.c. compensation technique was a criterion of the presence of the phase transition to the metal state. Dependences of Psub(pt) in SmS base solid solutions with approximately 10 19 -10 21 cm -3 concentration of conductivity electrons have similar tendency in behaviour: a certain increase in the phase transition pressure with n growth and then its drop at n approaching concentrations corresponding to compositions close to critical ones for the semiconductor-metal phase transition in any system of solid solutions. If the first mechanism prevails at small as then further on the second mechanism swelling by a power law with a high index plays the main role
Energy Technology Data Exchange (ETDEWEB)
Cook, J. [Austin Peay State University, Clarksville, TN 37075 (United States); Slang, S. [Faculty of Chemical Technology, University of Pardubice, 53210 Pardubice (Czech Republic); Golovchak, R. [Austin Peay State University, Clarksville, TN 37075 (United States); Jain, H. [International Materials Institute for New Functionality in Glass, Lehigh University, Bethlehem, PA 18015 (United States); Vlcek, M. [Faculty of Chemical Technology, University of Pardubice, 53210 Pardubice (Czech Republic); Kovalskiy, A., E-mail: kovalskyya@apsu.edu [Austin Peay State University, Clarksville, TN 37075 (United States)
2015-08-31
Spin-coating technology offers a convenient method for fabricating photostable chalcogenide glass thin films that are especially attractive for applications in IR optics. In this paper we report the structure of spin-coated As{sub x}S{sub 100−x} (x = 30, 35, 40) thin films as determined using high resolution X-ray photoelectron spectroscopy (XPS) and Raman spectroscopy, especially in relation to composition (i.e. As/S ratio) and preparation process variables. It was observed that As atoms during preparation have a tendency to precipitate out in close to stoichiometric compositions. The mechanism of bonding between the inorganic matrix and organic residuals is discussed based on the experimental data. A weak interaction between S ions and amine-based clusters is proposed as the basis of structural organization of the organic–inorganic interface. - Highlights: • As–S spin-coated chalcogenide thin films with different As/S were fabricated. • XPS measurements support the cluster-like structure of spin-coated films. • As{sub 2}O{sub 3} was confirmed as the composition of precipitate formed during dissolution. • Lack of As–As bonds explains the observed photostability of the thin films.
30 CFR 816.13 - Casing and sealing of drilled holes: General requirements.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Casing and sealing of drilled holes: General...-SURFACE MINING ACTIVITIES § 816.13 Casing and sealing of drilled holes: General requirements. Each exploration hole, other drill or borehole, well, or other exposed underground opening shall be cased, sealed...
Magnetocaloric effect and transport properties of Gd5Ge2(Si1-x Sn x )2 (x=0.23 and 0.40) compounds
International Nuclear Information System (INIS)
Campoy, J.C.P.; Plaza, E.J.R.; Nascimento, F.C.; Coelho, A.A.; Pereira, M.C.; Fabris, J.D.; Raposo, M.T.; Cardoso, L.P.; Persiano, A.I.C.; Gama, S.
2007-01-01
We report a study about the structural properties of polycrystalline samples of nominal composition Gd 5 Ge 2 (Si 1- x Sn x ) 2 (x=0.23, 0.40) that closely influence their physical behavior particularly related to electric resistivity and magnetocaloric (MCE) effect. The samples were characterized by X-ray diffraction (XRD) using the Rietveld refinement method, metallographic analyses, 119 Sn Moessbauer spectroscopy, DC magnetization and electrical transport measurements. It was identified a Gd 5 Si 2 Ge 2 -monoclinic phase for x=0.23 and a Sm 5 Sn 4 -orthorhombic phase (type II) for x=0.40, both with two non-equivalent crystallographic sites for the Sn ions. We were able to infer on the role of tin on the magnetic and transport properties in these compounds
International Nuclear Information System (INIS)
Sarlar, Kagan; Kucuk, Ilker
2015-01-01
The effect of Fe concentration on the glass forming ability (GFA) and magnetic properties in Co (40.2−x) Fe (20.1+x) Ni 6.7 B 22.7 Si 5.3 Nb 5 (x=0–10) bulk metallic glasses were investigated. By suction casting method, the bulk metallic glasses with diameters up to 2 mm were produced. We try to find out which Fe concentration makes an influence on Co based system's magnetic properties and glass forming ability. The curves of thermal analysis, obtained using differential scanning calorimetry (DSC), show that the Co (40.2−x) Fe (20.1+x) Ni 6.7 B 22.7 Si 5.3 Nb 5 (x=0–10) have a supercooled liquid region (∆T x ) of about 44 K. The saturation magnetizations (J s ) for as-cast BMG alloys were in the range of 0.62 T−0.81 T. - Highlights: • The effect of Fe concentration on the glass forming ability. • The substitution of an appropriate amount of Fe can enhance the GFA. • The substitution of Fe for Co also improves soft magnetic properties of the BMGs. • The high of J s 0.62−0.81 T with a low H c of 2−289 A/m of the alloys
Local structure in (MnS)2x(CuInS2)1-x alloys
International Nuclear Information System (INIS)
Pietnoczka, A.; Bacewicz, R.; Schorr, S.
2006-01-01
Local structure around Mn atoms in (MnS) 2x (CuInS 2 ) 1-x alloys for x≤0.09 has been determined using near-edge and extended X-ray absorption fine structure (XANES and EXAFS) measured at the Mn K-edge. We found that for the Mn concentration up to 9 at% Mn atoms substitute preferentially for indium in the chalcopyrite lattice. The Mn-S bond length is 2.43±0.015 Aa, and is about 2% shorter than the In-S bond length. (copyright 2006 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (Abstract Copyright [2006], Wiley Periodicals, Inc.)
Ikeda, Shuntaro; Sugimoto, Miki; Kume, Shinichi
2018-04-13
Bovine preimplantation embryos exhibit dramatic biological changes between before and after the 8-16-cell stage. Here we report a simple lipofection method to transfect siRNA into bovine 8-16-cell stage embryos using zona removal and the well-of-the-well (WOW) culture system. Bovine one-cell embryos produced in vitro were freed from the zona pellucida and cultured up to the 8-16-cell stage in WOW dishes. The 8-16-cell embryos were lipofected with siRNA and the transfection efficiency was assessed at 48 h of transfection. Lipofection with a red fluorescent non-targeting siRNA revealed the importance of zona removal for transfection of siRNA into embryos. Using this method, we knocked down the methionine adenosyltransferase 2A (MAT2A) gene, achieving a significant reduction in MAT2A expression (P lipofection', may be useful to analyze gene functions in bovine preimplantation embryos without expensive equipment and skill-intensive techniques.
30 CFR 816.87 - Coal mine waste: Burning and burned waste utilization.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Coal mine waste: Burning and burned waste...-SURFACE MINING ACTIVITIES § 816.87 Coal mine waste: Burning and burned waste utilization. (a) Coal mine... extinguishing operations. (b) No burning or burned coal mine waste shall be removed from a permitted disposal...
Short-range order parameters in amorphous YBaS4X7(X-S, SE, TE) films
International Nuclear Information System (INIS)
Hajiyev, E.S.
2005-01-01
Full text : Electron scattering intensity curves from amorphous YbAs 4 X 7 (X-S, SE, TE) films have ben obtained by the transmission electron diffraction (TED) method with rotation sector before screen up. The energy of electrons was 100 keV. Amorphous samples were crystallized and the composition of the products were measured by TED. The atomic radial distribution function has been calculated by the Fourier synthesis of intensities in the TED of amorphous YbAs 4 X 7 (X-S, SE, TE) films. The interatomic average distances of As - S (Se, Te) and As-Yb + 2 and partial coordination numbers have been estimated in these thilms. Based on these numbers, chemical orders in these films differ. This difference is due to differing topological order in the amorphous YbAs 4 X 7 (X-S, SE, TE) films
Energy Technology Data Exchange (ETDEWEB)
Kostyrya, S.A.; Idzikowski, B. [Institute of Molecular Physics, Polish Academy of Sciences, M. Smoluchowskiego 17, 60-179 Poznan (Poland); Tkatch, V.I.; Popov, V.V.; Rassolov, S.G. [Donetsk Physics and Engineering Institute of National Academy of Sciences of Ukraine, R. Luxemburg 72, 83114 Donetsk (Ukraine)
2006-01-01
Amorphous structure and its thermal stability as well as magnetic properties of Fe{sub 80-x}Co{sub x}P{sub 14}B{sub 6} (20{<=}x{<=}40) glasses have been studied by X-ray diffraction, non-isothermal differential scanning calorimetry (DSC) and thermomagnetic (TMG) measurements. The Curie temperature increases with Co content, while the glass transition and crystallization onset temperatures decrease. As a result, for alloys x=30, 32 and 35 at%, the transition into paramagnetic state take place close to glass transition temperature. However, for x=40 at% the TMG curve, in the vicinity of magnetic transition temperature, is overlapped by ferromagnetic crystallization products. (copyright 2006 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Study of the CdX-B2X3-X (X=S, Se), CdTe-B-Te systems
International Nuclear Information System (INIS)
Odin, I.N.; Grin'ko, V.V.; Safronov, E.V.; Kozlovskij, V.F.
2001-01-01
Liquidus surfaces of the CdX-B 2 X 3 -X (X=S, Se), CdTe-B-Te systems are plotted for the first time. It is shown that in equilibrium solid solutions on the basis of ternary Cd 2 B 2 X 5 compounds and binary B 2 X 3 , CdX, BS 2 compounds take part with liquid phases. p gen -T and T-x projects of p-T-x phase diagram of B-S (59-100 at. % S), B-Se (59-100 at. % Se), B-Te systems are plotted . B 2 X 3 , BS 2 compounds are formed in that regions of compositions of B-X systems . In the B-Te system compounds are not formed. Ternary compounds are not formed in the CdTe-B-Te system [ru
Directory of Open Access Journals (Sweden)
Sandra Andrea Mayén-Hernández
2014-01-01
Full Text Available The effects of vacuum annealing at different temperatures on the optical, electrical and photocatalytic properties of polycrystalline and amorphous thin films of the ternary semiconductor alloys ZnxCd1-xS, CuxCd1-xS and CuxZn1-xS were investigated in stacks of binary semiconductors obtained by chemical bath deposition. The electrical properties were measured at room temperature using a four-contact probe in the Van der Pauw configuration. The energy band gap of the films varied from 2.30 to 2.85 eV. The photocatalytic activity of the semiconductor thin films was evaluated by the degradation of an aqueous methylene blue solution. The thin film of ZnxCd1-xS annealed under vacuum at 300°C exhibited the highest photocatalytic activity.
Energy Technology Data Exchange (ETDEWEB)
Legarra, E., E-mail: estibaliz.legarra@ehu.es [Dpto. Electricidad y Electronica, Universidad del Pais Vasco (UPV/EHU), CP. 644, 48080 Bilbao (Spain); Apiñaniz, E. [Dpto. Fisica Aplicada I, Universidad del Pais Vasco, Alameda de Urquijo s/n, 48013 Bilbao (Spain); Plazaola, F. [Dpto. Electricidad y Electronica, Universidad del Pais Vasco (UPV/EHU), CP. 644, 48080 Bilbao (Spain); Jimenez, J.A. [Centro Nacional de Investigaciones Metalurgicas (CENIM), Avda. Gregorio del amo 8, 28040 Madrid (Spain)
2014-02-15
Highlights: • Fe{sub 60}Al{sub 40−x}Si{sub x} alloys were disordered by means of planetary ball milling technique. • Paramagnetic to ferromagnetic transition is observed with disordering. • Si addition hinders the disordering process and the increase of the lattice parameter. • Si addition promotes the paramagnetic to ferromagnetic transition. -- Abstract: We have used Mössbauer spectroscopy and X-ray diffraction to study the influence of different Al/Si ratios on the structural and magnetic properties of the mechanically deformed Fe{sub 60}Al{sub 40−x}Si{sub x} alloys. The results indicate that ternary alloys also present the magnetic transition with disordering observed in binary Fe{sub 60}Al{sub 40} alloys. Besides, Si introduction has two opposite contributions. From a structural point of view, hinders the disordering process, but, from a magnetic point of view promotes the magnetic transition.
Studies on electrodeposited Cd1-xFe xS thin films
International Nuclear Information System (INIS)
Deshmukh, S.K.; Kokate, A.V.; Sathe, D.J.
2005-01-01
Thin films of Cd 1-x Fe x S have been prepared on stainless steel and fluorine doped tin oxide (FTO) coated glass substrates using electrodeposition technique. Double distilled water containing precursors of Cd, Fe and S are used with ethylene diamine tetra-acetic acid (EDTA) disodium salt as a complexing agent to obtain good quality deposits by controlling the rate of reactions. The different preparative parameters like concentration of bath, deposition time, pH of the bath and Fe content in the bath have been optimized by photoelectrochemical (PEC) technique in order to get good quality thin films. Different techniques have been used to characterize electrodeposited Cd 1-x Fe x S thin films. The X-ray diffraction (XRD) analysis reveals that the films Cd 1-x Fe x S are polycrystalline in nature with crystallite size 282 A for the films deposited with optimized preparative parameters. Scanning electron microscopy (SEM) study for the sample deposited at optimized preparative parameters reveals that all grains uniformly distributed over the surface of stainless steel substrate indicates well defined growth of polycrystalline Cd-Fe-S material. Optical absorption shows the presence of direct transition and band gap energy decreases from 2.43 to 0.81 eV with the increase of Fe content from 0 to 1. PEC study shows the films of Cd 1-x Fe x S with x = 0.2 are more photosensitive than other compositions
Energy Technology Data Exchange (ETDEWEB)
Udaka, Yusuke; Takaki, Shin' ichi; Isowaki, Keisuke; Terada, Norio [Graduate School of Science and Engineering, Kagoshima University, 1-21-40 Korimoto, Kagoshima 890-0065 (Japan); Nagai, Takehiko; Kim, Kang Min; Kim, Shinho; Tampo, Hitoshi; Shibata, Hajime; Matsubara, Koji; Niki, Shigeru [Research Center for Photovoltaics, National Institute of Advanced Industrial Science and Technology, 1-1-1 Umezono, Tsukuba 305-8568 (Japan); Sakai, Noriyuki; Kato, Takuya; Sugimoto, Hiroki [Solar Frontier K.K., 123-1 Shimo-Kawairi, Atsugi 243-0206 (Japan)
2017-06-15
Changes of the electronic structure of the Cu{sub 2}ZnSn(S{sub x}Se{sub 1-x}){sub 4} [CZTSSe] films and the band alignment at the interfaces between CdS buffer and the CZTSSe in conjunction with the anion-mixing ratio x = 0-1 have been investigated using in situ X-ray, ultraviolet photoemission spectroscopy (XPS, UPS), and inverse photoemission spectroscopy (IPES). Changes of the UPS and IPES spectra in conjunction with x have revealed that the electronic structure of the CZTSSe surface is characterized with the preferential rise of conduction band minimum (CBM) in conjunction with the increase of x. As x increases, interface induced band bending decreases from 0.5 to 0.6 at the CdS/CZTSe (x = 0) interface to 0.1-0.2 at the CdS/CZTS (x = 1) one. And the downward shift of CBM due to the deposition of the CdS layer is enhanced as x increases. These changes result in the monotonous decrease of conduction band offset (CBO) in conjunction with the increase of x: CBO at the x = 0 and 1 interfaces are +0.5 and -0.14 to -0.15 eV, respectively. The values of CBO are consistent with the device properties; occasional emergence of double junction like current-voltage characteristics in the CdS/CZTSe-based cells, serious voltage-loss in the CdS/CZTS ones, and the highest performance achieved in the CdS/CZTSSe ones. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Energy Technology Data Exchange (ETDEWEB)
Kumar, Bhaskar [Florida Solar Energy Center, University of Central Florida, Cocoa, FL 32922 (United States); Vasekar, Parag [Florida Solar Energy Center, University of Central Florida, Cocoa, FL 32922 (United States)], E-mail: psvasekar@yahoo.com; Pethe, Shirish A.; Dhere, Neelkanth G. [Florida Solar Energy Center, University of Central Florida, Cocoa, FL 32922 (United States); Koishiyev, Galymzhan T. [Physics Department, Colorado State University, Fort Collins, CO 80523 (United States)
2009-02-02
Zinc cadmium sulfide (Zn{sub x}Cd{sub 1-x}S) heterojunction partner layer prepared with chemical bath deposition (CBD) has exhibited better blue photon response and higher current densities due to its higher bandgap than that of conventional cadmium sulfide (CdS) layer for CuIn{sub 1-x}Ga{sub x}S{sub 2} (CIGS2) solar cells. CIGS2/Zn{sub x}Cd{sub 1-x}S devices have also shown higher open circuit voltage, V{sub oc} indicating improved junction properties. A conduction band offset has been observed by J-V curves at various temperatures indicating that still higher V{sub oc} can be obtained by optimizing the conduction band offset. This contribution discusses the effect of variation of parameters such as concentration of compounds, pH of solution and deposition time during CBD on device properties and composition and crystallinity of film. Efficiencies comparable to CIGS2/CdS devices have been achieved for CIGS2/Zn{sub x}Cd{sub 1-x}S devices.
X = S, Se, Te) heterostructures
Zhang, Qingyun; Schwingenschlö gl, Udo
2018-01-01
Using first-principles calculations, we investigate the electronic properties of the two-dimensional GaX/MX2 (M = Mo, W; X = S, Se, Te) heterostructures. Orbital hybridization between GaX and MX2 is found to result in Rashba splitting at the valence
Structure and properties of heat-treated Ti-(40-4X)%Nb-X%Mo alloys with IE (SME)
International Nuclear Information System (INIS)
Silva, Marcia Almeida; Matlakhova, Lioudmila Aleksandrovna; Matlakhov, Anatoliy Nikolaevich; Paes Junior, Herval Ramos; Goncharenko, Boris Andreevich
2010-01-01
Whereas the inelastic effects (IE) are related with reversible martensitic transformation, in this work, was analyzed the structure and properties of heat treated Ti-(40-4x)%Nb-x%Mo alloys, where the contents of niobium and molybdenum are between 24-40%Nb and 0-4%Mo (% weight). The structural and phase analysis were done through optical microscopy and X-rays diffraction. The properties measured in this study were electrical resistivity and density. The Ti-40%Nb alloy shows a structure consisting of the β phase and αα’’ martensite with a minor participation of the α’ and ω. The alloys with 1 to 4%Mo have similar structures consisting of the β phase and traces of the α’’ phase. Thus, was observed greater capacity of Mo as a β stabilizer. The increase in Mo content in the composition of the alloys causes an increase in electrical resistivity of these. The samples may have undergone change in volume, caused by phase transformation, what possibly caused the difference between the density values calculated (theoretical) and experimental. (author)
Photoluminescence studies on Cd(1-x)Zn(x)S:Mn2+ nanocrystals.
Sethi, Ruchi; Kumar, Lokendra; Pandey, A C
2009-09-01
Highly monodispersed, undoped and doped with Mn2+, binary and ternary (CdS, ZnS, Cd(1-x)Zn(x)S) compound semiconductor nanocrystals have been synthesized by co-precipitation method using citric acid as a stabilizer. As prepared sample are characterized by X-ray diffraction, Small angle X-ray scattering, Transmission electron microscope, Optical absorption and Photoluminescence spectroscopy, for their optical and structural properties. X-ray diffraction, Small angle X-ray scattering and Transmission electron microscope results confirm the preparation of monodispersed nanocrystals. Photoluminescence studies show a significant blue shift in the wavelength with an increasing concentration of Zn in alloy nanocrystals.
Physical properties of Zr50Cu40-xAl10Pdx bulk glassy alloys
International Nuclear Information System (INIS)
Wencka, M.; Jagodic, M.; Gradisek, A.; Kocjan, A.; Jaglicic, Z.; McGuiness, P.J.; Apih, T.; Yokoyama, Y.; Dolinsek, J.
2010-01-01
It was shown recently (Yokoyama et al. ) that the addition of a small amount of Pd to the Zr 50 Cu 40 Al 10 bulk glassy alloy (BGA) has a beneficial effect on fatigue-strength enhancement, where the composition Zr 50 Cu 37 Al 10 Pd 3 behaved in a resonant-like way by showing the highest fatigue limit of 1050 MPa and the minimum Vickers hardness. We performed a study of the magnetic properties, the specific heat, the electrical resistivity and the hydrogen-diffusion constant for a series of compositions Zr 50 Cu 40-x Al 10 Pd x (x = 0-7 at.%), in order to determine their physical properties and to check for the influence of the Pd content on these properties. The Zr 50 Cu 40-x Al 10 Pd x BGAs are nonmagnetic, conducting alloys, where the Pauli spin susceptibility of the conduction electrons is the only source of paramagnetism. The low-temperature specific heat indicates an enhancement of the conduction-electron effective mass m* below 5 K, suggesting that the Zr 50 Cu 40-x Al 10 Pd x BGAs are not free-electron-like compounds. The electrical resistivities of the Zr 50 Cu 40-x Al 10 Pd x BGAs amount to about 200 μΩ cm and show a small, negative temperature coefficient (NTC) with an increase from 300 to 2 K of 4%. The hydrogen self-diffusion constant D in hydrogen-loaded samples shows classical over-barrier-hopping temperature dependence and is of comparable magnitude to the related icosahedral and amorphous Zr 69.5 Cu 12 Ni 11 Al 7.5 hydrogen-storage alloys. No correlation between the investigated physical parameters and the Pd content of the samples could be observed.
International Nuclear Information System (INIS)
Campoy, J. C. P.; Santos, A. O. dos; Cardoso, L. P.; Paesano, A.; Raposo, M. T.; Fabris, J. D.
2010-01-01
We report the structural characterization of Gd 5 Ge 2 (Si 1-x Sn x ) 2 (x = 0.23 and x = 0.40) compounds by means of 100 and 298 K-X-ray diffractometry (XRD) and 4 K- 155 Gd and 298 K- 119 Sn Moessbauer spectroscopy. These compounds order ferromagnetically at 218.4 and 172.7 K, respectively. At ∼100 K, it was identified the Gd 5 Si 4 -orthorhombic phase (type I) for both samples. At ∼298 K, it was identified a Gd 5 Si 2 Ge 2 -monoclinic phase, for x = 0.23 and a Sm 5 Sn 4 -orthorhombic phase (type II), for x 0.40. The Rietveld analysis of XRD data suggests a first order magneto-structural transition at Curie temperature for both compositions. Moessbauer results are well consistent with the proposed crystallographic models for these systems.
The high energy X-ray spectrum of 4U 0900-40 observed from OSO 8
Dolan, J. F.; Crannell, C. J.; Dennis, B. R.; Frost, K. J.; Orwig, L. E.; Ellison, D. C.
1981-01-01
The X-ray source 4U 0900-40 (= Vela XR-1) was observed with the high-energy X-ray spectrometer on OSO 8 for one week in 1976 and three weeks in 1978. Spectra of the source are presented above 16 keV. No systematic difference exists between the X-ray eclipse centers and the eclipse centers predicted from optical ephermerides. Short period intrinsic variability in the system's X-ray intensity may be related to changes in the Compton scattering optical depth in the system and does not require sporadic mass transfer via Roche lobe overflow. The 282 s modulation in the source's X-ray flux above 21 keV consists of two essentially similar pulses per period, most easily interpreted as arising from the two different magnetic poles of a rotating neutron star. The secondary appears to be a spherically accreting, magnetic neutron star.
AC conductivity and dielectric properties of amorphous GexSb40-xSe60 thin films
International Nuclear Information System (INIS)
Atyia, H.E.; Farid, A.M.; Hegab, N.A.
2008-01-01
Measurements of AC conductivity and dielectric properties have been made for chalcogenide film samples of Ge x Sb 40-x Se 60 (with x=0, 10 and 20 at%) at different temperatures (303-393 K) and various frequencies (10 2 -10 5 Hz). It was found that the AC conductivity obeys the law σ(ω, T)=Aω s . The exponent s 1 and dielectric loss ε 2 were found to decrease with frequency and increase with temperature. The maximum barrier height W M was calculated from dielectric measurements according to the Guintini equation. It was found that the obtained value of W m agrees with that proposed by the theory of hopping of charge carriers over potential barrier as suggested by Elliott in case of chalcogenide glasses. The density of localized states N(E F ) has also been calculated for the studied compositions. The effect of decreasing the Sb content at the expense of the Ge content was investigated for the obtained results of the studied parameters
Laser-fusion 40Ar/39Ar Ages of Darwin Impact Glass
Lo, Ching-Hua; Howard, Kieren T.; Chung, Sun-Lin; Meffre, Sebastien
2002-11-01
Three samples of Darwin Glass, an impact glass found in Tasmania, Australia at the edge of the Australasian tektite strewn field were dated using the 40Ar/39Ar single-grain laser fusion technique, yielding isochron ages of 796-815 ka with an overall weighted mean of 816 ± 7 ka. These data are statistically indistinguishable from those recently reported for the Australasian tektites from Southeast Asia and Australia (761-816 ka; with a mean weighted age of 803 ± 3 ka). However, considering the compositional and textural differences and the disparity from the presumed impact crater area for Australasian tektites, Darwin Glass is more likely to have resulted from a distinct impact during the same period of time.
Sample (S): SE40_S24 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available SE40_S24 Solanum lycopersicum Kyotemari fruit Solanum lycopersicum NCBI taxonomy:40...81 Solanum lycopersicum Kyotemari fruit are grown in greenhouses of the Experimental Farm of Kyoto University (Takatsuki, Osaka, Japan) from winter 2013 to spring 2014. ...
International Nuclear Information System (INIS)
Teng, T.Y.; Huang, H.W.; Olah, G.A.
1987-01-01
A previous extended X-ray absorption fine structure (EXAFS) study of photolyzed carboxymyoglobin (MbCO) has provoked much discussion on the heme structure of the photoproduct (Mb*CO). The EXAFS interpretation that the Fe-Co distance increases by no more than 0.05 A following photodissociation has been regarded as inconsistent with optical, infrared, and magnetic susceptibility studies. The present experiment was performed with well-characterized dry film samples in which MbCO molecules were embedded in a poly(vinyl alcohol) matrix. The sample had a high protein concentration (12 mM) to yield adequate EXAFS signals but was very thin (40 μm) so that complete photolysis could be easily achieved by a single flash from a xenon lamp. Although the electronic state of Mb*CO resembles that of deoxymyoglobin (deoxy-Mb), direct comparison of EXAFS spectra indicates that structurally Mb*CO is much closer to MbCO than to deoxy-Mb. Our EXAFS analysis shows that photolysis of MbCO at 5 K leads to a stable intermediate state in which CO has moved away from iron by a distance of 0.27-0.45 A, but the 5-coordinate heme structure is strained in a form similar to that of MbCO; the resolution of the CO position depends on the structure parameters of MbCO which we use as a reference for the analysis of Mb*CO. At 40 K, from 1 to 10 s after photolysis, 42% of the photoproduct has relaxed to the ground state, and the EXAFS spectrum of the remaining photoproduct is indistinguishable from that of the 5 K photoproduct
SOFT X-RAY IRRADIATION OF H{sub 2}S ICE AND THE PRESENCE OF S{sub 2} IN COMETS
Energy Technology Data Exchange (ETDEWEB)
Jimenez-Escobar, A.; Munoz Caro, G. M. [Centro de Astrobiologia (CSIC-INTA), Carretera de Ajalvir, km 4, Torrejon de Ardoz, 28850 Madrid (Spain); Ciaravella, A.; Candia, R.; Micela, G. [INAF-Osservatorio Astronomico di Palermo, P.za Parlamento 1, 90134 Palermo (Italy); Cecchi-Pestellini, C., E-mail: munozcg@cab.inta-csic.es [INAF-Osservatorio Astronomico di Cagliari, Strada n.54, Loc. Poggio dei Pini, I-09012 Capoterra (Canada) (Italy)
2012-06-01
Little is known about the effects of X-rays in interstellar ices. To understand the sulfur depletion in dense clouds and the presence of S{sub 2} in comets, we simulated experimentally the soft X-ray processing (0.3 keV) of H{sub 2}S ice for the first time. Experiments were performed under ultrahigh vacuum conditions at 8 K using infrared and quadrupole mass spectrometry to monitor the solid and gas phases, respectively. A UV irradiation experiment using a similar dose was made for comparison. After X-ray irradiation, an infrared absorption appears near 4.0 {mu}m which is attributed to H{sub 2}S{sub 2} formation in the ice. This identification is also supported by the desorption at 133 K of m/z 66, 65, 64, corresponding to the mass fragments of H{sub 2}S{sub 2}. The H{sub 2}S{sub 2} species is expected to be present in interstellar and cometary ices that were processed by X-rays. Further irradiation leads to dissociation of this molecule forming S{sub 2} and larger S-molecules up to S{sub 8}, which may explain the depletion of sulfur in dense clouds. CS{sub 2} was so far the parent molecule proposed for S{sub 2} formation in comets. But the abundance of H{sub 2}S{sub 2}, formed by irradiation of pure H{sub 2}S or H{sub 2}S in an H{sub 2}O-ice matrix, should be larger than that of CS{sub 2} in the ice, the latter requiring a carbon source for its formation. Based on our experimental results, we propose that S{sub 2} in comets could be formed by dissociation of H{sub 2}S{sub 2} in the ice.
Energy Technology Data Exchange (ETDEWEB)
Yildiz, F. [Department of Physics, Faculty of Sciences and Arts, Celal Bayar University, Muradiye/Manisa (Turkey) and Department of Physics, Electron Spin Science Center, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of)]. E-mail: fyildiz@gyte.edu.tr; Kazan, S. [Gebze Institute of Technology, 41400 Gebze-Kocaeli (Turkey); Aktas, B. [Gebze Institute of Technology, 41400 Gebze-Kocaeli (Turkey); Tarapov, S.I. [Institute of Radiophysics and Electronics, National Academy of Sciences of Ukraine, Kharkov 61085 (Ukraine); Tagirov, L. [Gebze Institute of Technology, 41400 Gebze-Kocaeli (Turkey); Granovsky, B. [Moscow State University, 119992 Moscow (Russian Federation)
2006-10-15
Magnetic properties of granular (Co{sub 40}Fe{sub 40}B{sub 20}){sub x}(SiO{sub 2}){sub 1-x} thin films (x=0.37-0.53) have been studied by ferromagnetic resonance (FMR) technique. Samples have been prepared by ion-beam deposition of Co-Fe-B particles and SiO{sub 2} on sitall ceramic substrate. The FMR measurements have been done for different orientations of DC magnetic field with respect to the sample plane. It was found that the deduced value of effective magnetization from FMR data of the thin granular film is reduced by the volume-filling factor of the bulk saturation magnetization. The overall magnetization changes from 152 to 515G depending on the ratio of the magnetic nanoparticles in the SiO{sub 2} matrix. From angular measurements an induced in-plane uniaxial anisotropy has been obtained due to the preparation of the film conditions as well.
DEFF Research Database (Denmark)
Kielsgaard Kristensen, Thomas; Vestergaard, Hanne; Møller, Michael Boe
2011-01-01
The vast majority of patients with systemic mastocytosis (SM) carry the somatic D816V mutation in the KIT gene. The KIT D816V mutation is one of the minor criteria for a diagnosis of SM according to the 2008 World Health Organization classification of myeloproliferative neoplasms. In the present ...
DEFF Research Database (Denmark)
Kiamehr, Saeed; Dahl, Kristian Vinter; Montgomery, Melanie
2016-01-01
for 168 h in flowing N2(g)+5%O2(g)+15%H2O(g) (vol.%) with samples covered under KCl powder. A KCl-free exposure was also performed for comparison.Corrosion morphology and products were studied with scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDS) and X-ray diffractometry (XRD......Laboratory testing on selected alumina and silica-forming alloys was performed to evaluate their performance against high temperature corrosion induced by potassium chloride (KCl). The alloys studied were FeCrAlY, Kanthal APM, Nimonic 80A, 214, 153MA and HR160. Exposure was conducted at 600 °C......-chromium-silicon-oxygen containing layer forms as the innermost corrosion product. The layer was uniformly distributed over the surface and appears to render some protection as this alloy exhibited the best performance among the investigated alloys. To reveal further aspects of the corrosion mechanism, Nimonic 80A was exposed...
Ab-initio calculations of Co-based diluted magnetic semiconductors Cd 1-xCoxX (X=S, Se, Te)
Saeed, Yasir
2010-10-01
Ab-initio calculations are performed to investigate the structural, electronic and magnetic properties of spin-polarized diluted magnetic semiconductors composed of IIVI compounds Cd1-xCoxX (X=S, Se, Te) at x=0.25. From the calculated results of band structure and density of states, the half-metallic character and stability of ferromagnetic state for Cd1-xCoxS, Cd1-xCoxSe and Cd 1-xCoxTe alloys are determined. It is found that the tetrahedral crystal field gives rise to triple degeneracy t2g and double degeneracy eg. Furthermore, we predict the values of spin-exchange splitting energies Δx(d) and Δ x(p-d) and exchange constants N0α and N 0β produced by the Co 3d states. Calculated total magnetic moments and the robustness of half-metallicity of Cd1-xCo xX (X=S, Se, Te) with respect to the variation in lattice parameters are also discussed. We also extend our calculations to x=0.50, 0.75 for S compounds in order to observe the change due to increase in Co. © 2010 Elsevier B.V.
Ruan, Yunjun; Lv, Lin; Li, Zhishan; Wang, Chundong; Jiang, Jianjun
2017-11-23
Because of the advanced nature of their high power density, fast charge/discharge time, excellent cycling stability, and safety, supercapacitors have attracted intensive attention for large-scale applications. Nevertheless, one of the obstacles for their further development is their low energy density caused by sluggish redox reaction kinetics, low electroactive electrode materials, and/or high internal resistance. Here, we develop a facile and simple nitridation process to successfully synthesize hierarchical Ni nanoparticle decorated Ni 0.2 Mo 0.8 N nanorod arrays on a nickel foam (Ni-Mo-N NRA/NF) from its NiMoO 4 precursor, which delivers a high areal capacity of 2446 mC cm -2 at a current density of 2 mA cm -2 and shows outstanding cycling stability. The superior performance of the Ni-Mo-N NRA/NF can be ascribed to the metallic conductive nature of the Ni-Mo nitride, the fast surface redox reactions for the electrolyte ions and electrode materials, and the low contacted resistance between the active materials and the current collectors. Furthermore, a hybrid supercapacitor (HSC) is assembled using the Ni-Mo-N NRA/NF as the positive electrode and reduced graphene oxide (RGO) as the negative electrode. The optimized HSC exhibits excellent electrochemical performance with a high energy density of 40.9 W h kg -1 at a power density of 773 W kg -1 and a retention of 80.1% specific capacitance after 6000 cycles. These results indicate that the Ni-Mo-N NRA/NF have a promising potential for use in high-performance supercapacitors.
40_245 - 250_Hussaini, A. Ahmad and S. Sani
African Journals Online (AJOL)
user pc
Bajopas Volume 10 Number 2 December, 2017. Table 4: Conductivity measurement of the complex compounds. Complexes. Concentration moldm-3. Electrical conductivity ohm-1 cm-1. Molar conductivity ohm-1cm2 mol-1. [NiL2]. 2H2O. 1 x 10-3. 9.40x10-6. 94.0. [CuL2]. 2H2O. 1 x 10-3. 6.85x10-6. 68.5. Table 5: Infrared ...
Energy Technology Data Exchange (ETDEWEB)
Sarlar, Kagan [Physics Department, Faculty of Arts and Sciences, Uludag University, Gorukle Campus, 16059 Bursa (Turkey); Physics Department, Kamil Ozdag Faculty of Sciences, Karamanoglu Mehmetbey University, YunusEmre Campus, 70100 Karaman (Turkey); Kucuk, Ilker, E-mail: ikucuk@uludag.edu.tr [Physics Department, Faculty of Arts and Sciences, Uludag University, Gorukle Campus, 16059 Bursa (Turkey)
2015-01-15
The effect of Fe concentration on the glass forming ability (GFA) and magnetic properties in Co{sub (40.2−x)}Fe{sub (20.1+x)}Ni{sub 6.7}B{sub 22.7}Si{sub 5.3}Nb{sub 5} (x=0–10) bulk metallic glasses were investigated. By suction casting method, the bulk metallic glasses with diameters up to 2 mm were produced. We try to find out which Fe concentration makes an influence on Co based system's magnetic properties and glass forming ability. The curves of thermal analysis, obtained using differential scanning calorimetry (DSC), show that the Co{sub (40.2−x)}Fe{sub (20.1+x)}Ni{sub 6.7}B{sub 22.7}Si{sub 5.3}Nb{sub 5} (x=0–10) have a supercooled liquid region (∆T{sub x}) of about 44 K. The saturation magnetizations (J{sub s}) for as-cast BMG alloys were in the range of 0.62 T−0.81 T. - Highlights: • The effect of Fe concentration on the glass forming ability. • The substitution of an appropriate amount of Fe can enhance the GFA. • The substitution of Fe for Co also improves soft magnetic properties of the BMGs. • The high of J{sub s} 0.62−0.81 T with a low H{sub c} of 2−289 A/m of the alloys.
Repair in mouse lung of multifraction X rays and neutrons: extension to 40 fractions
International Nuclear Information System (INIS)
Parkins, C.S.; Fowler, J.F.
1985-01-01
Repair parameters were calculated from measurements of breathing rate and lethality at monthly intervals up to 17 months after irradiation with 1, 10, 20 or 40 equal fractions, down to 1.1 Gy of x-rays and 0.18 Gy of 3 MeV neutrons per fraction. Sparing of neutron damage was negligible when the neutron dose was divided into multiple fractions; progressively greater repair of lung damage was seen after increasing x-ray fractions. Significant increase in the iso-effect dose for 40 x-ray fractions was found compared with 20, even at two fractions per day at six hour intervals, as was the case in the 40 fraction experiment. Data were well fitted by the linear quadratic formula for response vs. dose per fraction and the ratio γ/β yielded values of approx. 3 Gy after x-rays and 30 to 40 Gy after neutron irradiation, not different from γ/β ratios found for up to 20 fractions. Single dose RBE was less than 2, increasing to about six at the lowest dose per fraction measured, agreeing with previous results. The ratio of the γ component for neutrons to that for x-rays was approx. 8, which is therefore the limiting RBE predicted for infinitely small fractional doses. (U.K.)
International Nuclear Information System (INIS)
Ubale, A.U.; Bargal, A.N.
2011-01-01
Highlights: → Thin films of (NiS) x (CdS) (1-x) with variable composition (x = 1 to 0) were deposited onto glass substrates by the successive ionic layer adsorption and reaction (SILAR) method. → The structural, surface morphological and electrical characterizations of the as deposited and annealed films were studied. → The bandgap and activation energy of annealed (NiS) x (CdS) (1-x) film decrease with improvement in photosensitive nature. -- Abstract: Recently ternary semiconductor nanostructured composite materials have attracted the interest of researchers because of their photovoltaic applications. Thin films of (NiS) x (CdS) (1-x) with variable composition (x = 1-0) had been deposited onto glass substrates by the successive ionic layer adsorption and reaction (SILAR) method. As grown and annealed films were characterised by X-ray diffraction, scanning electron microscopy and EDAX to investigate structural and morphological properties. The (NiS) x (CdS) (1-x) films were polycrystalline in nature having mixed phase of rhombohedral and hexagonal crystal structure due to NiS and CdS respectively. The optical and electrical properties of (NiS) x (CdS) (1-x) thin films were studied to determine compsition dependent bandgap, activation energy and photconductivity. The bandgap and activation energy of annealed (NiS) x (CdS) (1-x) film decrease with improvement in photosensitive nature.
Potencial genético de progênies de feijão-caupi segregantes quanto ao tipo da inflorescência
Directory of Open Access Journals (Sweden)
Fábio Ribeiro Barros
2011-02-01
Full Text Available O objetivo deste trabalho foi avaliar o potencial genético produtivo de progênies de feijão-caupi (Vigna unguiculata segregantes quanto ao tipo da inflorescência. Foram avaliadas 68 progênies F4 obtidas dos retrocruzamentos: (TV x 5058-09C x Cacheado-roxo x TV x 5058-09C e (AU94-MOB-816 x Cacheado-roxo x AU94-MOB-816, com os genitores. Dois experimentos foram conduzidos no delineamento de blocos ao acaso, tendo-se avaliado 17 progênies, com quatro repetições, em parcelas subdivididas quanto à inflorescência: simples e composta. A análise estatística foi realizada por modelos mistos via procedimento REML/BLUP. As estimativas das variâncias genéticas foram significativas para todos os caracteres estudados. Os caracteres comprimento do pedúnculo, número médio de vagens por pedúnculo e floração inicial apresentaram alta variabilidade e expressão do componente genético para a inflorescência composta. As progênies de inflorescência simples apresentam potencial genético produtivo similar às progênies de inflorescência composta. As progênies resultantes do retrocruzamento (AU94-MOB-816 x Cacheado-roxo x AU94-MOB-816 são promissoras como estratégia para aumentar os níveis atuais de produtividade do feijão-caupi.
International Nuclear Information System (INIS)
Brambila-Paz, F.; Duong Minh Duc.
1990-12-01
A scattering theory for the wave equation with compactly supported perturbations was developed by Lax-Phillips in 1967. Using Enss approach, Phillips developed a Lax-Phillips scattering theory with short range perturbations of the type: V(x)=o((1)/|x| β ), β > 2. In this paper we develop a scattering theory for more general perturbations, i.e. for V(x)=(φ(x))/|x| β , where β=2-(n)/s, φ is an element of L s (R n ), s > 2 and s ≥ (n)/2. Refs
Lansbury, G. B.; Stern, D.; Aird, J.; Alexander, D. M.; Fuentes, C.; Harrison, F. A.; Treister, E.; Bauer, F. E.; Tomsick, J. A.; Baloković, M.; Del Moro, A.; Gandhi, P.; Ajello, M.; Annuar, A.; Ballantyne, D. R.; Boggs, S. E.; Brandt, W. N.; Brightman, M.; Chen, C.-T. J.; Christensen, F. E.; Civano, F.; Comastri, A.; Craig, W. W.; Forster, K.; Grefenstette, B. W.; Hailey, C. J.; Hickox, R. C.; Jiang, B.; Jun, H. D.; Koss, M.; Marchesi, S.; Melo, A. D.; Mullaney, J. R.; Noirot, G.; Schulze, S.; Walton, D. J.; Zappacosta, L.; Zhang, W. W.
2017-02-01
We present the first full catalog and science results for the Nuclear Spectroscopic Telescope Array (NuSTAR) serendipitous survey. The catalog incorporates data taken during the first 40 months of NuSTAR operation, which provide ≈20 Ms of effective exposure time over 331 fields, with an areal coverage of 13 deg2, and 497 sources detected in total over the 3-24 keV energy range. There are 276 sources with spectroscopic redshifts and classifications, largely resulting from our extensive campaign of ground-based spectroscopic follow-up. We characterize the overall sample in terms of the X-ray, optical, and infrared source properties. The sample is primarily composed of active galactic nuclei (AGNs), detected over a large range in redshift from z = 0.002 to 3.4 (median of =0.56), but also includes 16 spectroscopically confirmed Galactic sources. There is a large range in X-ray flux, from {log}({f}3-24{keV}/{erg} {{{s}}}-1 {{cm}}-2)≈ -14 to -11, and in rest-frame 10-40 keV luminosity, from {log}({L}10-40{keV}/{erg} {{{s}}}-1)≈ 39 to 46, with a median of 44.1. Approximately 79% of the NuSTAR sources have lower-energy ( {10}44 erg s-1) to ≈80% at the lowest luminosities ({L}{{X}}< {10}43 erg s-1). Our optical spectroscopic analysis finds that the observed fraction of optically obscured AGNs (I.e., the type 2 fraction) is {F}{Type2}={53}-15+14 % , for a well-defined subset of the 8-24 keV selected sample. This is higher, albeit at a low significance level, than the type 2 fraction measured for redshift- and luminosity-matched AGNs selected by <10 keV X-ray missions.
The Malarial Exported PFA0660w Is an Hsp40 Co-Chaperone of PfHsp70-x.
Directory of Open Access Journals (Sweden)
Michael O Daniyan
Full Text Available Plasmodium falciparum, the human pathogen responsible for the most dangerous malaria infection, survives and develops in mature erythrocytes through the export of proteins needed for remodelling of the host cell. Molecular chaperones of the heat shock protein (Hsp family are prominent members of the exportome, including a number of Hsp40s and a Hsp70. PFA0660w, a type II Hsp40, has been shown to be exported and possibly form a complex with PfHsp70-x in the infected erythrocyte cytosol. However, the chaperone properties of PFA0660w and its interaction with human and parasite Hsp70s are yet to be investigated. Recombinant PFA0660w was found to exist as a monomer in solution, and was able to significantly stimulate the ATPase activity of PfHsp70-x but not that of a second plasmodial Hsp70 (PfHsp70-1 or a human Hsp70 (HSPA1A, indicating a potential specific functional partnership with PfHsp70-x. Protein binding studies in the presence and absence of ATP suggested that the interaction of PFA0660w with PfHsp70-x most likely represented a co-chaperone/chaperone interaction. Also, PFA0660w alone produced a concentration-dependent suppression of rhodanese aggregation, demonstrating its chaperone properties. Overall, we have provided the first biochemical evidence for the possible role of PFA0660w as a chaperone and as co-chaperone of PfHsp70-x. We propose that these chaperones boost the chaperone power of the infected erythrocyte, enabling successful protein trafficking and folding, and thereby making a fundamental contribution to the pathology of malaria.
The first back-side illuminated types of Kyoto's X-ray astronomy SOIPIX
Energy Technology Data Exchange (ETDEWEB)
Itou, Makoto, E-mail: itou@cr.scphys.kyoto-u.ac [Department of Physics, Graduate School of Science, Kyoto University, Kitashirakawa Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Tsuru, Takeshi Go; Tanaka, Takaaki; Takeda, Ayaki; Matsumura, Hideaki; Ohmura, Shunichi; Uchida, Hiroyuki [Department of Physics, Graduate School of Science, Kyoto University, Kitashirakawa Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Nakashima, Shinya [Institute of Space and Astronautical Science (ISAS)/JAXA, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Arai, Yasuo; Kurachi, Ikuo [Institute of Particle and Nuclear Studies, High Energy Accelerator Research Org., KEK, 1-1 Oho, Tsukuba 305-0801 (Japan); Mori, Koji; Takenaka, Ryota; Nishioka, Yusuke [Department of Applied Physics, Faculty of Engineering, University of Miyazaki,1-1 Gakuen Kibana-dai Nishi, Miyazaki 889-2192 (Japan); Kohmura, Takayoshi; Tamasawa, Koki [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba 278-8510 (Japan); Tindall, Craig [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States)
2016-09-21
We have been developing Kyoto's X-ray astronomy SOI pixel sensors, called “XRPIX”, aiming to extend the frontiers of X-ray astronomy with the wide-band imaging spectroscopy in the 0.5–40 keV band. A dead layer on the X-ray incident surface should ideally be as thin as possible to achieve a high sensitivity below 1 keV, and the depletion layer is required to be thick enough to detect 40 keV X-rays. Thus, we have started developing fully-depleted back-side illuminated (BI) types of XRPIXs. This paper reports on our first two BI devices and their X-ray evaluation (2.6–12 keV). The device named “XRPIX2b-FZ-LA” successfully reaches a full depletion with a thickness of 500 μm. On the other hand, it has a dead layer with a thickness of 1.1–1.5 μm and struggles to achieve the requirement of 1.0 μm. The other device named “XRPIX2b-CZ-PZ”, which is applied with a thin Si sensor-layer and an improved back-side process, is found to satisfy the requirement with its thickness of 0.9–1.0 μm, including Al optical blocking filter of 0.2 μm, although the Si sensor-layer is rather thin with 62 μm. We also describe in this paper the X-ray calibration system that we have built for the X-ray evaluation of XRPIXs.
Structure cristalline du composé Hg3-xSbx(S+Se2+xI2-x (x ≃ 0.1
Directory of Open Access Journals (Sweden)
Mohammed Kars
2016-03-01
Full Text Available Single crystals of the mercury chalcohalide Hg3-xSbx(S+Se2+xI2-x (x ≃ 0.1 (mercury antimony sulfide selenide iodide, were grown by a chemical transport reaction. The structure contains three independent A (Hg/Sb atoms; each atom is strongly covalently bonded with two X (Se/S atoms to form approximately linear X–A–X units. The X–A–X units link to form A4X4 rings, which are combined into infinite crankshaft-type bands running along the [100] direction. Four equatorial E (I/X = Se,S atoms at relatively long distances complete the distorted octahedral coordination of A (Hg/Sb. The crystal under investigation was twinned by non-merohedry with a refined twin domain fraction of 0.814 (6:0.186 (6. The structure is isotypic with Hg3Se2I2 [Beck & Hedderich (2000. J. Solid State Chem. 151, 73–76], but the current determination reveals a coupled substitution, with partial replacement of Hg+2 by Sb+3, balanced by the equivalent substitution of I−1 by S−2 and Se−2. Bond-valence calculations are consistent with this relative substitution model.
The TI-Nspire CAS: A Happy-Medium Mobile Device for Grades 8-16 Mathematics Classrooms
Zelkowski, Jeremy
2011-01-01
This article justifies classifying the TI-Nspire CAS Touchpad as a mobile device for grades 8-16 mathematics classrooms equipped with a Navigator system. The 2010 Horizon Report: K-12 indicates virtually every secondary school aged child has some sort of mobile device. Yet, many school policies ban the use of mobile devices, preventing students…
K X-Ray production cross sections for 40-180 keV protons
International Nuclear Information System (INIS)
Szegedi, S.; Hassan, M.F.
2002-01-01
In view of the importance of the X-ray production cross-section for the determination of element concentration in a given material, we have measured them experimentally for light elements Sc and Fe using proton beams of energy between 40 and 180 keV. The obtained K X-ray production cross-section is compared with the previous experimental results. The experimental K X-ray production cross-section for proton induced X-ray emission (PIXE) analysis, using low energy (200 keV) accelerator, have been improved
Structural features of spin-coated thin films of binary AsxS100−x chalcogenide glass system
International Nuclear Information System (INIS)
Cook, J.; Slang, S.; Golovchak, R.; Jain, H.; Vlcek, M.; Kovalskiy, A.
2015-01-01
Spin-coating technology offers a convenient method for fabricating photostable chalcogenide glass thin films that are especially attractive for applications in IR optics. In this paper we report the structure of spin-coated As x S 100−x (x = 30, 35, 40) thin films as determined using high resolution X-ray photoelectron spectroscopy (XPS) and Raman spectroscopy, especially in relation to composition (i.e. As/S ratio) and preparation process variables. It was observed that As atoms during preparation have a tendency to precipitate out in close to stoichiometric compositions. The mechanism of bonding between the inorganic matrix and organic residuals is discussed based on the experimental data. A weak interaction between S ions and amine-based clusters is proposed as the basis of structural organization of the organic–inorganic interface. - Highlights: • As–S spin-coated chalcogenide thin films with different As/S were fabricated. • XPS measurements support the cluster-like structure of spin-coated films. • As 2 O 3 was confirmed as the composition of precipitate formed during dissolution. • Lack of As–As bonds explains the observed photostability of the thin films
73.7 Tb/s (96x3x256-Gb/s) mode-division-multiplexed DP-16QAM transmission with inline MM-EDFA
Sleiffer, V.A.J.M.; Jung, Y.; Veljanovski, V.; Uden, van R.G.H.; Kuschnerov, M.; Kang, Q.; Grüner-Nielsen, L.; Sun, Y.; Richardson, D.J.; Alam, S.U.; Poletti, F.; Sahu, J.K.; Dhar, A.; Chen, H.; Inan, B.; Koonen, A.M.J.; Corbett, B.; Winfield, R.; Ellis, A.D.; Waardt, de H.
2012-01-01
We show transmission of a 73.7 Tb/s (96x3x256-Gb/s) DP-16QAM mode-division- multiplexed signal over 119km of few-mode fiber with inline multi-mode EDFA, using 6x6 MIMO digital signal processing. The total demonstrated net capacity is 57.6 Tb/s (SE 12 bits/s/Hz).
International Nuclear Information System (INIS)
Zhai, W.; Zhou, K.; Hu, L.; Wei, B.
2016-01-01
Highlights: • The increasing Sn content reduces the liquidus temperature. • High Sn content results in lower enthalpy of fusion by polynomial functions. • The thermal diffusivity drops from the solid toward the semi-solid state. • Undercoolability of alloys with primary Cu_2Sb phase is stronger than others. - Abstract: The liquidus and solidus temperatures, enthalpy of fusion, and the temperature dependence of thermal diffusivity for ternary Cu_6_0_−_xSn_xSb_4_0 alloys were systematically measured by DSC and laser flash methods. It is found that both the liquidus temperature and the enthalpy of fusion decrease with the rise of Sn content, and their relationships with alloy composition were established by polynomial functions. The thermal diffusivity usually drops from the solid toward the semi-solid state. The undercoolability of those liquid Cu_6_0_−_xSn_xSb_4_0 alloys with primary Cu_2Sb solid phase is stronger than the others with primary β(SnSb) intermetallic compound, and the increase of cooling rate facilitates further undercooling. Microstructural observation indicates that both of the primary Cu_2Sb and β(SnSb) intermetallic compounds in ternary Cu_6_0_−_xSn_xSb_4_0 alloys grow in faceted mode, and develop into coarse flakes and polygonal blocks.
Energy Technology Data Exchange (ETDEWEB)
Ubale, A.U., E-mail: ashokuu@yahoo.com [Nanostructured Thin Film Materials Laboratory, Department of Physics, Govt. Vidarbha Institute of Science and Humanities, Amravati 444604, Maharashtra (India); Bargal, A.N. [Nanostructured Thin Film Materials Laboratory, Department of Physics, Govt. Vidarbha Institute of Science and Humanities, Amravati 444604, Maharashtra (India)
2011-07-15
Highlights: {yields} Thin films of (NiS){sub x}(CdS){sub (1-x)} with variable composition (x = 1 to 0) were deposited onto glass substrates by the successive ionic layer adsorption and reaction (SILAR) method. {yields} The structural, surface morphological and electrical characterizations of the as deposited and annealed films were studied. {yields} The bandgap and activation energy of annealed (NiS){sub x}(CdS){sub (1-x)} film decrease with improvement in photosensitive nature. -- Abstract: Recently ternary semiconductor nanostructured composite materials have attracted the interest of researchers because of their photovoltaic applications. Thin films of (NiS){sub x}(CdS){sub (1-x)} with variable composition (x = 1-0) had been deposited onto glass substrates by the successive ionic layer adsorption and reaction (SILAR) method. As grown and annealed films were characterised by X-ray diffraction, scanning electron microscopy and EDAX to investigate structural and morphological properties. The (NiS){sub x}(CdS){sub (1-x)} films were polycrystalline in nature having mixed phase of rhombohedral and hexagonal crystal structure due to NiS and CdS respectively. The optical and electrical properties of (NiS){sub x}(CdS){sub (1-x)} thin films were studied to determine compsition dependent bandgap, activation energy and photconductivity. The bandgap and activation energy of annealed (NiS){sub x}(CdS){sub (1-x)} film decrease with improvement in photosensitive nature.
Examining the X-ray Properties of Lenticular Galaxies: Rollins S0 X-ray Sample (RS0X)
Fuse, Christopher R.; Malespina, Alysa
2017-01-01
Lenticular galaxies represent a complex morphology in which many questions remain. The S0 morphology possesses spiral galaxy attributes, such as a disk, while also displaying the luminosity and old stellar population indicative of an elliptical galaxy. The proposed formation mechanisms for lenticulars are also varied, with the absence of gas suggesting a faded spiral and the high masses and luminosities implying a merger formation. The star formation and high-energy emission from a sample of S0s will be used to better understand the properties and formation mechanisms of this unique subset of galaxies.We use the Chandra X-ray Observatory archives cycle 1 - 16 to identify a sample of seventeen lenticular galaxies residing in a variety of environments. Data was analyzed using the CIAO software to produce true color images, radial profiles of the halo gas, gas contours, as well as determine the X-ray luminosities of the point sources and gas.The X-ray gas temperature of the sample S0s varied over a narrow range between 0.61 and 0.96 keV, with one outlier, NGC 4382 at 2.0 keV. The X-ray luminosity of the halo gas varies by four dex. The gas temperatures and X-ray luminosities do not vary by environment, with the majority of sample S0s displaying values of typical elliptical galaxies. The S0 sample is X-ray under-luminous relative to the optical luminosity as compared to the sample of early-type galaxies of Ellis & O’Sullivan (2006).The halo gas exhibited some distinct morphological features, such as multiple X-ray peaks, which may indicate a merger event, and highly concentrated gas, suggesting limited gravitational disturbance. Isolated S0, NGC 4406, displays an asymmetric halo, which could be interpreted as gas stripping. An isolated lenticular experiencing gas redistribution due to gravitational perturbation or a cluster-like medium could be interpreted as NGC 4406 forming in a higher galactic density environment than the field.
Amorphous MoS{sub x} on CdS nanorods for highly efficient photocatalytic hydrogen evolution
Energy Technology Data Exchange (ETDEWEB)
Li, Xiaofang; Tang, Chaowan; Zheng, Qun; Shao, Yu; Li, Danzhen, E-mail: dzli@fzu.edu.cn
2017-02-15
Loading cocatalyst on semiconductors was crucially necessary for improving the photocatalytic hydrogen evolution. Amorphous MoS{sub x} as a novel and noble metal-free cocatalyst was loaded on CdS nanorods by a simple photodeposition method. Efficient hydrogen evolution with amount of 15 mmol h{sup −1} g{sup −1} was observed over the MoS{sub x} modified CdS nanorods, which was about 6 times higher than that by using Pt as cocatalyst. Meanwhile, with MoS{sub x} cocatalyst, the efficiency of CdS nanorods was superior to that of CdS nanoparticles and bulk CdS. No deactivation could be observed in the efficiency of MoS{sub x} modified CdS nanorods under irradiation for successive 10 h. Further experimental results indicated that the efficient electrons transfer, low overpotential of hydrogen evolution and active S atoms over the MoS{sub x} modified CdS nanorods were responsible for the higher efficiency. Our results provided guidance for synthesizing noble metal-free materials as cocatalyst for photocatalytic hydrogen evolution. - Graphical abstract: Photodeposition of amorphous MoS{sub x} on CdS nanorods for highly efficient photocatalytic hydrogen evolution. - Highlights: • Amorphous MoSx cocatalyst was loaded on CdS NRs by a simple photodeposition. • MoS{sub x}/CdS NRs exhibited 6 times higher hydrogen evolution efficiency than Pt/CdS NRs. • The hydrogen evolution of MoS{sub x}/CdS NRs linearly increased with prolonging time. • Lower overpotential and efficient electron transfer were observed over MoS{sub x}/CdS NRs.
International Nuclear Information System (INIS)
Hu Junqing; Deng Bin; Wang Chunrui; Tang Kaibin; Qian Yitai
2003-01-01
Mineral nanocrystalline Cu 3 BiS 3 and Pb 1-x Bi 2x/3 S (or Bi 0.22 Pb 0.89 S 1.22 ) have been prepared at low synthetic temperature of 100-150 deg. C by convenient hydrothermal decomposition process. X-ray powder diffraction, transmission electron microscopy, X-ray photoelectron spectra, and element analysis were used to characterize and measure the samples. The as-prepared Cu 3 BiS 3 sample consisted of whisker-like particles with an average size of 50x10 nm 2 and the Pb 1-x Bi 2x/3 S sample displayed aggregative particles with size in the range of 30-50 nm. Preliminary results showed that the prepared precursors, reaction temperature and time played a role in the formation of the final products. A possible reaction mechanism was also discussed briefly
Synthesis and Photocatalytic Activity of Zn x Cd 1–x S/TiO 2 ...
African Journals Online (AJOL)
Synthesis and Photocatalytic Activity of Zn x Cd 1–x S/TiO 2 Heterostructures ... South African Journal of Chemistry ... Whenthe molar ratio of S/Ti was 0.96, the ZnxCd1–xS/TiO2 hierarchical heterostructures exhibited enhanced visible light ...
Elevated-temperature tensile properties of three heats of commercially heat-treated Alloy 718
International Nuclear Information System (INIS)
Booker, M.K.; Booker, B.L.P.
1980-03-01
Three heats of commercially heat-treated alloy 718 were tensile tested over the temperature range from room temperature to 816 degree C and at nominal strain rates from 6.7 x 10 -6 to 6.7 x 10 -3 /s. We examined data for yield strength, ultimate tensile strength, uniform elongation, total elongation, and reduction in area and also inspected tensile stress-strain behavior. Yield and ultimate tensile strengths for commercially heat-treated alloy 718 decrease very gradually with temperature from room temperature up to about 600 degree C for a strain rate of 6.7 x 10 -5 /s or to about 700 degree C for a strain rate of 6.7 x 10 -4 /s. Above these temperatures the strength drops off fairly rapidly. Reduction in area and total elongation data show minimum around 700 degree C, with each ductility measure falling to 10% or less at the minimum. This minimum is more pranced and occurs at lower temperatures as strain rate decreases. Up to about 600 degree C the ductility is typically around 30%. As the temperature reaches 816 degree C the ductility again increases to perhaps 60%. The uniform elongation (plastic strain at peak load) decreases only slightly with temperature to about 500 degree C then drops off rapidly and monotonically with temperature, reaching values less than 1% at 816 degree C. At the highest test temperatures the load maximum may result, not from necking of the specimen, but from overaging of the precipitation-hardened microstructure. Stress-strain curves showed serrated deformations in the temperature range from 316 to 649 degree C, although they occur only for the faster strain rates at the supper end of this temperature range. The serrations can be quite large, involving load drops of perhaps 40 to 80 MPa. The serrations typically begin within the first 2% of deformation and continue until fracture, although exceptions were noted. 16 refs., 14 figs., 3 tabs
Foundations of the AdS5 x S5 superstring: I
International Nuclear Information System (INIS)
Arutyunov, Gleb; Frolov, Sergey
2009-01-01
We review the recent advances towards finding the spectrum of the AdS 5 x S 5 superstring. We thoroughly explain the theoretical techniques which should be useful for the ultimate solution of the spectral problem. In certain cases our exposition is original and cannot be found in the existing literature. The present part I deals with foundations of classical string theory in AdS 5 x S 5 , light-cone perturbative quantization and the derivation of the exact light-cone world-sheet scattering matrix
Energy Technology Data Exchange (ETDEWEB)
Saravanan, R. Sakthi Sudar, E-mail: rsakthiss@yahoo.com [Physics Research Centre, S.T. Hindu College, Nagercoil 629 002 (India); Mahadevan, C.K. [Physics Research Centre, S.T. Hindu College, Nagercoil 629 002 (India)
2012-11-15
Highlights: Black-Right-Pointing-Pointer High yield synthesis of Zn-Cd-S QDs. is achieved by solvothermal-microwave heating. Black-Right-Pointing-Pointer The samples are highly crystalline and the average particle size is {approx}3.5 nm. Black-Right-Pointing-Pointer High luminescent quantum yield and narrow emission spectral widths are obtained. Black-Right-Pointing-Pointer High conduction activation energy is observed in the case of Zn-Cd coexisting QDs. - Abstract: A series of wurtzite Zn{sub (1-x)}Cd{sub x}S (x = 0, 0.25, 0.5, 0.75 and 1) nanocrystals with average crystallite size of 1.98, 1.82, 1.80, 2.04 and 2.51 nm, respectively, have been synthesized by simple solvothermal microwave heating method. The photoluminescence yield is found to be higher in the case of alloyed nanocrystals (x = 0.25, 0.5, 0.75) as compared to ZnS (x = 0) and CdS (x = 1). The optical emission is tuned from blue (440 nm) to orange (575 nm) with the increase of Cd composition in Zn{sub (1-x)}Cd{sub x}S nanocrystal. The impedance analysis for Zn{sub (1-x)}Cd{sub x}S nanocrystals has been measured as a function of frequency and temperature. The real and imaginary part of complex impedance plots exhibit semicircle behavior in the complex plane. The AC activation energies of ZnS, Zn{sub 0.75}Cd{sub 0.25}S, Zn{sub 0.5}Cd{sub 0.5}S, Zn{sub 0.25}Cd{sub 0.75}S and CdS nanocrystals were calculated from electrical conductivity analysis and are found to be 0.188, 0.378, 0.456, 0.284 and 0.255 eV, respectively. The conductivity of the alloyed nanocrystals was higher than that of ZnS and CdS.
DEFF Research Database (Denmark)
Mizuno, T.; Kobayashi, T.; Takara, H.
2014-01-01
We demonstrate dense SDM transmission of 20-WDM multi-carrier PDM-32QAM signals over a 40-km 12-core x 3-mode fiber with 247.9-b/s/Hz spectral efficiency. Parallel MIMO equalization enables 21-ns DMD compensation with 61 TDE taps per subcarrier....
Nonlinear optical diagnostic of semimagnetic semiconductors Pb1-xYb xX (X = S, Se, Te)
International Nuclear Information System (INIS)
Nouneh, K.; Kityk, I.V.; Viennois, R.; Benet, S.; Charar, S.; Plucinski, K.J.
2007-01-01
Nonlinear optical measurements were performed to elucidate the influence of magnetic ions on the behavior of charge carriers in magnetic semiconductors-Pb 1-x Yb x X (X = S, Se, Te at x = 1-3%). It was shown that nonlinear optical methods could be used as sensitive tools for investigations of electron-phonon anharmonicity near low-temperature semiconductor-insulator phase transitions. There exists a difference between surface and bulk-like contributions to the nonlinear optical effects. It was shown that only low-temperature Two Photon Absorption (TPA) oscillator may be related to the number of the electron-phonon anharmonic modes responsible for the observed phase transformation. The explanation of the anomalous temperature dependences is given in accordance with dipole momentum's behaviors determined by low-temperature spin-spin interactions and by electron-phonon anharmonic interactions. We have discovered that low-temperature dependence of specific heat of Pb 1-x R x Te (R = Yb, Pr with x = 3% and 1.6%, respectively) exhibits a non-magnetic order caused by large electron-phonon contributions and structural disorder effects
Composition determination of CdS sub x Se sub 1-x mixed crystals by optical dispersion
Energy Technology Data Exchange (ETDEWEB)
Iliev, I; Dimov, T; Ribarov, D [Pedagogical High School, Schumen (Bulgaria); Lange, H [Akademie der Wissenschaften der DDR, Berlin (German Democratic Republic). Zentralinstitut fuer Elektronenphysik
1989-10-16
An optical dispersion method has been developed determining the CdS/CdSe ratio in CdS{sub x}Se{sub 1-x} mixed crystals from the relationship between position of the isotropic point (birefrigence becomes zero for a definite wavelength at the absorption edge) and chemical composition x. Birefrigence spectra and piezo-optic spectra of samples with x = 0.2, 0.6, and 0.875 give the spectral position of the isotropic point (ip). A curve of wavelength of ip versus x of CdS{sub x}Se{sub 1-x} is evaluated by the least-squares procedure and tested by X-ray fluorescence analysis.
Chetcuti, Wayne Jordan
2017-01-01
This work focuses on the results obtained from the ALICE muon spectrometer for the measurement of the elliptic flow of muons at forward rapidity in p–Pb collisions at 8.16 TeV. The muon triggered data sample that was used, gave the minimum-bias data sample, as well as sufficient statistics at intermediate and high $p_T$ . The correction for the non-uniform detector appearance was performed and the Generic Q-cumulant method for 2- and 4-particle correlations was applied to get the elliptic flow of inclusive muons. From the results of the elliptic flow, it was suggested that the observed hydrodynamic-like particle correlations at high multiplicity in small systems may come out from the same underlying physics mechanisms as that in heavy-ion collisions.
Performance of the PRAXyS X-ray polarimeter
Energy Technology Data Exchange (ETDEWEB)
Iwakiri, W.B., E-mail: wataru.iwakiri@riken.jp [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Black, J.K. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Rock Creek Scientific, 1400 East-West Hwy, Silver Spring, MD 20910 (United States); Cole, R. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Enoto, T. [The Hakubi Center for Advanced Research, Kyoto University, Kyoto 606-8302 (Japan); Department of Astronomy, Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Hayato, A. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Hill, J.E.; Jahoda, K. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Kaaret, P. [University of Iowa, Iowa City, IA 52242 (United States); Kitaguchi, T. [Department of Physical Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Kubota, M. [Department of Physics, Tokyo University of Science, 3-1 Kagurazaka, Shinjuku-ku, Tokyo 162-8601, Japan. (Japan); RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Marlowe, H.; McCurdy, R. [University of Iowa, Iowa City, IA 52242 (United States); Takeuchi, Y. [Department of Physics, Tokyo University of Science, 3-1 Kagurazaka, Shinjuku-ku, Tokyo 162-8601, Japan. (Japan); RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Tamagawa, T. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Department of Physics, Tokyo University of Science, 3-1 Kagurazaka, Shinjuku-ku, Tokyo 162-8601, Japan. (Japan)
2016-12-01
The performance of the Time Projection Chamber (TPC) polarimeter for the Polarimeter for Relativistic Astrophysical X-ray Sources (PRAXyS) Small Explorer was evaluated using polarized and unpolarized X-ray sources. The PRAXyS mission will enable exploration of the universe through X-ray polarimetry in the 2–10 keV energy band. We carried out performance tests of the polarimeter at the Brookhaven National Laboratory, National Synchrotron Light Source (BNL-NSLS) and at NASA's Goddard Space Flight Center. The polarimeter was tested with linearly polarized, monochromatic X-rays at 11 different energies between 2.5 and 8.0 keV. At maximum sensitivity, the measured modulation factors at 2.7, 4.5 and 8.0 keV are 27%, 43% and 59%, respectively and the measured angle of polarization is consistent with the expected value at all energies. Measurements with a broadband, unpolarized X-ray source placed a limit of less than 1% on false polarization in the PRAXyS polarimeter.
A worker attaches covers for the nose pitot boom before removing the unpiloted X-40 from the runway
2001-01-01
A worker attaches covers for the nose pitot boom before removing the unpiloted X-40 from the runway at Edwards Air Force Base, California, following its successful free-flight on March 14, 2001. The unpiloted X-40 is a risk-reduction vehicle for the X-37, which is intended to be a reusable space vehicle. NASA's Marshall Space Flight Center in Huntsville, Ala, manages the X-37 project. At Dryden, the X-40A underwent a series of ground and air tests to reduce possible risks to the larger X-37, including drop tests from a helicopter to check guidance and navigation systems planned for use in the X-37. The X-37 is designed to demonstrate technologies in the orbital and reentry environments for next-generation reusable launch vehicles that will increase both safety and reliability, while reducing launch costs from $10,000 per pound to $1,000 per pound. The X-37, carried into orbit by the Space Shuttle, is planned to fly two orbital missions to test reusable launch vehicle technologies.
The ATLAS collaboration
2017-01-01
The production of $D^{0}(\\overline{D^0})$ and $D^{*\\pm}$ mesons has been measured with the ATLAS detector in $p$+Pb collisions at $\\sqrt{s_{_\\mathrm{NN}}}=8.16~\\mathrm{TeV}$ with an integrated luminosity of $76.3\\mu b^{-1}$ taken in 2016. The $D$ meson production asymmetry between forward ($0 < y^* < 0.5$) and backward ($-0.5 < y^* < 0$) center-of-mass rapidities is studied, and no significant asymmetry is observed. Azimuthal correlations between inclusive $D^{*\\pm}$ and charged particles are also presented in intervals of event-wise charged-particle multiplicity. The second-order harmonic coefficients for inclusive $D^{*\\pm}$ and charged particles azimuthal correlation have been extracted using template fits.
Directory of Open Access Journals (Sweden)
Elodie Laine
2011-06-01
Full Text Available The type III receptor tyrosine kinase (RTK KIT plays a crucial role in the transmission of cellular signals through phosphorylation events that are associated with a switching of the protein conformation between inactive and active states. D816V KIT mutation is associated with various pathologies including mastocytosis and cancers. D816V-mutated KIT is constitutively active, and resistant to treatment with the anti-cancer drug Imatinib. To elucidate the activating molecular mechanism of this mutation, we applied a multi-approach procedure combining molecular dynamics (MD simulations, normal modes analysis (NMA and binding site prediction. Multiple 50-ns MD simulations of wild-type KIT and its mutant D816V were recorded using the inactive auto-inhibited structure of the protein, characteristic of type III RTKs. Computed free energy differences enabled us to quantify the impact of D816V on protein stability in the inactive state. We evidenced a local structural alteration of the activation loop (A-loop upon mutation, and a long-range structural re-organization of the juxta-membrane region (JMR followed by a weakening of the interaction network with the kinase domain. A thorough normal mode analysis of several MD conformations led to a plausible molecular rationale to propose that JMR is able to depart its auto-inhibitory position more easily in the mutant than in wild-type KIT and is thus able to promote kinase mutant dimerization without the need for extra-cellular ligand binding. Pocket detection at the surface of NMA-displaced conformations finally revealed that detachment of JMR from the kinase domain in the mutant was sufficient to open an access to the catalytic and substrate binding sites.
Coenen, Eva A.; Zwaan, C. Michel; Reinhardt, Dirk; Harrison, Christine J.; Haas, Oskar A.; de Haas, Valerie; Mihál, Vladimir; De Moerloose, Barbara; Jeison, Marta; Rubnitz, Jeffrey E.; Tomizawa, Daisuke; Johnston, Donna; Alonzo, Todd A.; Hasle, Henrik; Auvrignon, Anne; Dworzak, Michael; Pession, Andrea; van der Velden, Vincent H. J.; Swansbury, John; Wong, Kit-fai; Terui, Kiminori; Savasan, Sureyya; Winstanley, Mark; Vaitkeviciene, Goda; Zimmermann, Martin; Pieters, Rob; van den Heuvel-Eibrink, Marry M.
2013-01-01
In pediatric acute myeloid leukemia (AML), cytogenetic abnormalities are strong indicators of prognosis. Some recurrent cytogenetic abnormalities, such as t(8;16)(p11;p13), are so rare that collaborative studies are required to define their prognostic impact. We collected the clinical characteristics, morphology, and immunophenotypes of 62 pediatric AML patients with t(8;16)(p11;p13) from 18 countries participating in the International Berlin-Frankfurt-Münster (I-BFM) AML study group. We used the AML-BFM cohort diagnosed from 1995-2005 (n = 543) as a reference cohort. Median age of the pediatric t(8;16)(p11;p13) AML patients was significantly lower (1.2 years). The majority (97%) had M4-M5 French-American-British type, significantly different from the reference cohort. Erythrophagocytosis (70%), leukemia cutis (58%), and disseminated intravascular coagulation (39%) occurred frequently. Strikingly, spontaneous remissions occurred in 7 neonates with t(8;16)(p11;p13), of whom 3 remain in continuous remission. The 5-year overall survival of patients diagnosed after 1993 was 59%, similar to the reference cohort (P = .14). Gene expression profiles of t(8;16)(p11;p13) pediatric AML cases clustered close to, but distinct from, MLL-rearranged AML. Highly expressed genes included HOXA11, HOXA10, RET, PERP, and GGA2. In conclusion, pediatric t(8;16)(p11;p13) AML is a rare entity defined by a unique gene expression signature and distinct clinical features in whom spontaneous remissions occur in a subset of neonatal cases. PMID:23974201
Ab-initio calculations of Co-based diluted magnetic semiconductors Cd 1-xCoxX (X=S, Se, Te)
Saeed, Yasir; Nazir, Safdar; Shaukat, Ali; Reshak, A. H.
2010-01-01
Ab-initio calculations are performed to investigate the structural, electronic and magnetic properties of spin-polarized diluted magnetic semiconductors composed of IIVI compounds Cd1-xCoxX (X=S, Se, Te) at x=0.25. From the calculated results
First observation of $\\overline{B}^{0}_{s} \\to D^{*+}_{s2}X\\mu^{-}\\overline{\
Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Agari, M; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Amoraal, J; Anderson, J; Antunes Nobrega, R; Appleby, R B; Aquines Gutierrez, O; Arefyev, A; Arrabito, L; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Basiladze, S; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belous, K; Belyaev, I; Benayoun, M; Bencivenni, G; Bernet, R; Bettler, M-O; van Beuzekom, M; Bifani, S; Bizzeti, A; Björnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bochin, B; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bos, E; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brisbane, S; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Bursche, A; Buytaert, J; Cadeddu, S; Caicedo Carvajal, J M; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Cameron, W; Camilleri, L; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Charles, M; Charpentier, Ph; Cheng, J; Chiapolini, N; Chlopik, A; Christiansen, J; Ciambrone, P; Cid Vidal, X; Clark, P J; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Constantin, F; Conti, G; Contu, A; Coombes, M; Corti, G; Cowan, G A; Currie, R; D'Almagne, B; D'Ambrosio, C; D'Antone, I; Da Silva, W; Dané, E; David, P; De Bonis, I; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Degaudenzi, H; Deissenroth, M; Del Buono, L; Deplano, C; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Dima, M; Donleavy, S; Dornan, P; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Eames, C; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Eklund, L; d'Enterria, D G; Esperante Pereira, D; Estève, L; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Flegel, W; Fontanelli, F; Forty, R; Frank, M; Frei, C; Frosini, M; Fungueirino Pazos, J L; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garrido, L; Gaspar, C; Gassner, J; Gauvin, N; Gavillet, P; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gong, G; Gong, H; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Guzik, Z; Gys, T; Haefeli, G; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, P F; He, J; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicheur, A; Hicks, E; Hilke, H J; Hofmann, W; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Iakovenko, V; Iglesias Escudero, C; Ilgner, C; Ilten, P; Imong, J; Jacobsson, R; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kapusta, F; Karbach, T M; Kashchuk, A; Keaveney, J; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koblitz, S; Konoplyannikov, A; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kukulak, S; Kumar, R; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, R W; Lanfranchi, G; Langenbruch, C; Latham, T; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Lehner, F; Leroy, O; Lesiak, T; Li, L; Li, Y Y; Li Gioi, L; Libby, J; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Löchner, S; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Luisier, J; M'charek, B; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Maier, A; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martin Sanchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Matveev, V; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Mclean, C; Meissner, M; Merk, M; Merkel, J; Merkin, M; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M-N; Monteil, S; Moran, D; Morawski, P; Morris, J V; Moscicki, J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Murtas, F; Muryn, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nardulli, J; Nawrot, A; Nedos, M; Needham, M; Neufeld, N; Neustroev, P; Nicol, M; Nies, S; Niess, V; Nikitin, N; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Ostankov, A; Pal, B; Palacios, J; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pauna, E; Pauna, C; Pavel, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Pessina, G; Petrella, A; Petrolini, A; Pie Valls, B; Pietrzyk, B; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Pozzi, S; du Pree, T; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Raniuk, I; Raven, G; Redford, S; Reece, W; dos Reis, A C; Ricciardi, S; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Cobo, C; Rodriguez Perez, P; Rogers, G J; Romanovsky, V; Rouvinet, J; Ruf, T; Ruiz, H; Rusinov, V; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sambade Varela, A; Sannino, M; Santacesaria, R; Santinelli, R; Santovetti, E; Sapunov, M; Saputi, A; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schmelling, M; Schmidt, B; Schneider, O; Schneider, T; Schopper, A; Schune, M -H; Schwemmer, R; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Serra, N; Serrano, J; Shao, B; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Simioni, E; Skottowe, H P; Skwarnicki, T; Smale, N; Smith, A; Smith, A C; Sobczak, K; Soler, F J P; Solomin, A; Somogy, P; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spiridenkov, E; Spradlin, P; Srednicki, A; Stagni, F; Steiner, S; Steinkamp, O; Stenyakin, O; Stoica, S; Stone, S; Storaci, B; Straumann, U; Styles, N; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Talanov, V; Tarkovskiy, E; Teodorescu, E; Terrier, H; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Topp-Joergensen, S; Tran, M T; Traynor, S; Trunk, U; Tsaregorodtsev, A; Tuning, N; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Vervink, K; Viaud, B; Videau, I; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Voong, D; Vorobyev, A; Vorobyev, An; Voss, H; Wacker, K; Wandernoth, S; Wang, J; Ward, D R; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Yang, Z; Ybeles Smit, G; Young, R; Yushchenko, O; Zavertyaev, M; Zeng, M; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zverev, E
2011-01-01
Using data collected with the LHCb detector in proton-proton collisions at a centre-of-mass energy of 7 TeV, the semileptonic decays Bs -> Ds+ X mu nu and Bs -> D0 K+ X mu nu are detected. Two structures are observed in the D0 K+ mass spectrum at masses consistent with the known D^+_{s1}(2536) and $D^{*+}_{s2}(2573) mesons. The measured branching fractions relative to the total Bs semileptonic rate are B(Bs -> D_{s2}^{*+} X mu nu)/B(Bs -> X mu nu)= (3.3\\pm 1.0\\pm 0.4)%, and B(Bs -> D_{s1}^+ X munu)/B(Bs -> X mu nu)= (5.4\\pm 1.2\\pm 0.5)%, where the first uncertainty is statistical and the second is systematic. This is the first observation of the D_{s2}^{*+} state in Bs decays; we also measure its mass and width.
Energy Technology Data Exchange (ETDEWEB)
Wu Huaqiang, E-mail: wuhuaq@mail.ahnu.edu.cn; Yao Youzhi; Li Wenting; Zhu Lulu; Ni Na; Zhang Xiaojun [Anhui Normal University, Anhui Key Laboratory of Molecule-based Materials, College of Chemistry and Materials Science (China)
2011-05-15
The multi-walled carbon nanotubes (MWCNTs) wrapped with hexagonal wurtzite Zn{sub x}Cd{sub 1-x}S nanoparticles with a uniform and small diameter have been prepared to form Zn{sub x}Cd{sub 1-x}S-MWCNT heterostructures by microwave-assisted route using Zn(Ac){sub 2}, Cd(NO{sub 3}){sub 2}, and thioacetamide as the reactants{sub .} The heterostructures have been characterized by X-ray powder diffraction, scanning and transmission electron microscopy, high-resolution transmission electron microscopy, photoluminescence (PL) and PL excited lifetime. Despite the analogous size and configuration, the Zn{sub x}Cd{sub 1-x}S-MWCNT (x = 0, 0.2, 0.5, 0.8, 1) with different Zn concentration exhibit composition-dependent absorption properties in the visible zone. The PL peak positions of Zn{sub x}Cd{sub 1-x}S-MWCNT change gradually from ZnS-MWCNT to CdS-MWCNT. The Zn{sub x}Cd{sub 1-x}S-MWCNT shows different photocatalytic activity towards the photodegradation of fuchsin acid under visible light illumination, photocatalytic activity of the Zn{sub x}Cd{sub 1-x}S-MWCNT decreases gradually with the increase in the Zn concentration, the Zn{sub 0.2}Cd{sub 0.8}S-MWCNT possessed the best photocatalytic activity. After recycling thrice, the photocatalysts still have about 85% efficiency.
Last, B. F.; van Veldhuizen, A. M.
1996-01-01
The aim of this study was to test the hypothesis that being openly informed about the diagnosis and prognosis benefits the emotional well-being of children with cancer. A stratified sample of 56 children with cancer aged 8-16 years and their parents participated. The parents were interviewed about
Performance of the PRAXyS X-ray polarimeter
Iwakiri, W. B.; Black, J. K.; Cole, R.; Enoto, T.; Hayato, A.; Hill, J. E.; Jahoda, K.; Kaaret, P.; Kitaguchi, T.; Kubota, M.; Marlowe, H.; McCurdy, R.; Takeuchi, Y.; Tamagawa, T.
2016-12-01
The performance of the Time Projection Chamber (TPC) polarimeter for the Polarimeter for Relativistic Astrophysical X-ray Sources (PRAXyS) Small Explorer was evaluated using polarized and unpolarized X-ray sources. The PRAXyS mission will enable exploration of the universe through X-ray polarimetry in the 2-10 keV energy band. We carried out performance tests of the polarimeter at the Brookhaven National Laboratory, National Synchrotron Light Source (BNL-NSLS) and at NASA's Goddard Space Flight Center. The polarimeter was tested with linearly polarized, monochromatic X-rays at 11 different energies between 2.5 and 8.0 keV. At maximum sensitivity, the measured modulation factors at 2.7, 4.5 and 8.0 keV are 27%, 43% and 59%, respectively and the measured angle of polarization is consistent with the expected value at all energies. Measurements with a broadband, unpolarized X-ray source placed a limit of less than 1% on false polarization in the PRAXyS polarimeter.
Solanki, Rekha Garg; Rajaram, Poolla; Bajpai, P. K.
2018-05-01
This work is based on the growth, characterization and estimation of lattice strain and crystallite size in CdS nanoparticles by X-ray peak profile analysis. The CdS nanoparticles were synthesized by a non-aqueous solvothermal method and were characterized by powder X-ray diffraction (XRD), transmission electron microscopy (TEM), Raman and UV-visible spectroscopy. XRD confirms that the CdS nanoparticles have the hexagonal structure. The Williamson-Hall (W-H) method was used to study the X-ray peak profile analysis. The strain-size plot (SSP) was used to study the individual contributions of crystallite size and lattice strain from the X-rays peaks. The physical parameters such as strain, stress and energy density values were calculated using various models namely, isotropic strain model, anisotropic strain model and uniform deformation energy density model. The particle size was estimated from the TEM images to be in the range of 20-40 nm. The Raman spectrum shows the characteristic optical 1LO and 2LO vibrational modes of CdS. UV-visible absorption studies show that the band gap of the CdS nanoparticles is 2.48 eV. The results show that the crystallite size estimated from Scherrer's formula, W-H plots, SSP and the particle size calculated by TEM images are approximately similar.
Prompt and isolated photons in 8.16 TeV p+Pb collisions with ATLAS
Hill, Kurt Keys; The ATLAS collaboration
2018-01-01
The inclusive production cross-section for isolated, prompt photons in p+Pb collisions at √sNN = 8.16 TeV is studied with the ATLAS detector at the LHC using a data set with an integrated luminosity of 162 nb−1. The cross-section is measured as a function of photon transverse energy from 25 to 500 GeV and over nearly five units of pseudorapidity, including kinematic regions in both the downstream proton– and nucleus–going directions. Results are reported in the nucleon–nucleon center of mass collision frame. The nuclear modification factor RpPb is reported using a extrapolation, derived using NLO pQCD, of a previous measurement of photon production in pp collisions at 8 TeV. The cross-sections and RpPb values are compared to the results of a next-to-leading order perturbative QCD calculation and to the expectations based on a picture of the energy loss of partons incoming to the hard scattering. At large nucleus-going rapidity, the cross-section is suppressed due to the different up and down valence...
Energy Technology Data Exchange (ETDEWEB)
Lu, Tianyu; Gu, Han; Ge, Zhenhua; Zhang, Lei; Wang, Zhicheng; Fang, Yong; Han, Zhida; Qian, Bin; Jiang, Xuefan [Department of Physics, Changshu Institute of Technology, Changshu (China); Wu, Wangping [School of Mechanical Engineering, Changzhou University, Changzhou (China)
2017-02-15
In this paper, high-photosensitive CdS{sub 1-x}Se{sub x} films are synthesized by a two-step technique, which includes the chemical bath deposition of CdS films and a following selenization process. The structural, optical, and photoelectric properties of the CdS{sub 1-x}Se{sub x} films were investigated. With the substitution of selenium for sulfur atoms, grain sizes of the as-prepared CdS{sub 1-x}Se{sub x} films are effectively enlarged and reach the scales of the films thickness when the selenization temperature exceeds 450 C. With increasing the selenization temperature from 350 to 550 C, the band gaps of CdS{sub 1-x}Se{sub x} films gradually decrease from 2.37 to 1.82 eV. Under the co-action of the grain-size enlargement and band-gap decrease, the CdS{sub 1-x}Se{sub x} films fabricated at 450 C show very pronounced photosensitivity. Noteworthy, the ratio of photo to dark conductivity of the CdS{sub 1-x}Se{sub x} film selenized at 450 C reaches 1.1 x 10{sup 5}, suggesting a promising application potential in the photoelectric devices. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
DEFF Research Database (Denmark)
Kristensen, Thomas; Preiss, Birgitte; Broesby-Olsen, Sigurd
2012-01-01
Abstract The KIT D816V mutation is detected in the vast majority of adult cases of systemic mastocytosis (SM). The mutation is also frequently detected in core-binding factor acute myeloid leukemia (CBF-AML) defined by the presence of t(8;21)(q22;q22); RUNX1-RUNX1T1 or inv(16)(p13.1;q22)/t(16;16)(p...
Energy Technology Data Exchange (ETDEWEB)
Bodnar, I. V. [Belarusian State University of Informatics and Radioelectronics (Belarus); Rud, V. Yu., E-mail: rudvas.spb@gmail.com [St. Petersburg State Polytechnical University (Russian Federation); Rud, Yu. V. [Russian Academy of Sciences, Ioffe Physical Technical Institute (Russian Federation); Lozhkin, D. V. [Belarusian State University of Informatics and Radioelectronics (Belarus)
2011-07-15
Using directional crystallization of the melt of the (FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} alloy, homogeneous crystals of a similar atomic composition are grown over the entire range of compositions 1 {>=} x {>=} 0. It is established that the crystals of the continuous series of quaternary alloys in the range x = 0-1 crystallize in the spinel structure and lattice parameter a linearly depends on x. It is established that it is possible to obtain In(Al)/(FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} photosensitive structures. Room-temperature spectra of relative quantum efficiency of photoconversion of the In(Al)/(FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} structures fabricated for the first time are obtained. From the analysis of these spectra, activation energies of direct and indirect band-to-band transitions for the crystals of the (FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} alloys are determined and the dependence of these parameters on the composition of the position-disordered phases of mentioned alloys is discussed. It is concluded that the crystals of the (FeIn{sub 2}S{sub 4}){sub x}(MnIn{sub 2}S{sub 4}){sub 1-x} alloys can be used in broadband photoconverters of optical radiation.
The AdS5xS5 superstring worldsheet S matrix and crossing symmetry
International Nuclear Information System (INIS)
Janik, Romuald A.
2006-01-01
An S matrix satisfying the Yang-Baxter equation with symmetries relevant to the AdS 5 xS 5 superstring recently has been determined up to an unknown scalar factor. Such scalar factors are typically fixed using crossing relations; however, due to the lack of conventional relativistic invariance, in this case its determination remained an open problem. In this paper we propose an algebraic way to implement crossing relations for the AdS 5 xS 5 superstring worldsheet S matrix. We base our construction on a Hopf-algebraic formulation of crossing in terms of the antipode and introduce generalized rapidities living on the universal cover of the parameter space which is constructed through an auxillary, coupling-constant dependent, elliptic curve. We determine the crossing transformation and write functional equations for the scalar factor of the S matrix in the generalized rapidity plane
Magnetic and electrical properties of (FeIn2S4)1−x(CuIn5S8)x solid solutions
International Nuclear Information System (INIS)
Trukhanov, S.V.; Bodnar, I.V.; Zhafar, M.A.
2015-01-01
In this study, single crystals of FeIn 2 S 4 and CuIn 5 S 8 compounds, and (FeIn 2 S 4 ) 1−x (CuIn 5 S 8 ) x solid solutions were grown using the Bridgman method. The magnetic and electrical properties of the samples obtained were investigated at temperatures of 5–300 K and in a magnetic field range of 0–14 T. It was established that all of the solid solutions were paramagnets down to low temperatures of ~10 K. It was shown that the ground state of the magnetic phase of the samples was a spin glass state, where the freezing temperature increased monotonically with the increase in the concentration of Fe 2+ cations. All of the samples exhibited semiconductor characteristics in terms of electrical resistivity. The concentration-dependent critical magnetic temperatures, magnetic moment, and activation energy were plotted, which are probably explained by the magnetic state formation of the (FeIn 2 S 4 ) 1−x (CuIn 5 S 8 ) x solid solution single crystals based on the empirical Goodenough–Kanamori rules
Study of surfaces and interfaces in CdS-Cu2S and (Cd sub(x) Zn sub(1-x))S-Cu2S solar cells
International Nuclear Information System (INIS)
Dhere, N.G.; Dhere, R.G.; Bloss, W.H.; Schock, H.W.; Bauer, E.; Cyris, P.
1983-01-01
Auger microprobe was used for the analysis of interfaces and surfaces in several stages involved in the preparation of solar cells, in order to study the origin of adhesion problems and to study the formation of CdS-Cu 2 S barrier by the wet method. The detachment of the first CdS and (Cd sub(x) Zn sub(1-x))S films, during the dip process, was attributed to the contamination of Cr-Ag metallic substrates by existing chlorine from the environment next to the sea, due to long film stocking, by degasified species from the evaporating material and by the ejection of particles together with CdS vapour during deposition. The formation of conical mounds on the surface and of the CdS-Cu 2 S barrier at aproximatelly 3000 A depth in the dipped samples were observed. The migration of copper towards surface direction and the formation of a superficial thin layer of copper oxide after treatment in H 2 plasma and air heating, were also verified. (C.L.B.) [pt
Energy Technology Data Exchange (ETDEWEB)
Freitas Neto, Ernesto S; Dantas, Noelio O [Laboratorio de Novos Materiais Isolantes e Semicondutores (LNMIS), Instituto de Fisica, Universidade Federal de Uberlandia, CP 593, CEP 38400-902, Uberlandia, Minas Gerais (Brazil); Barbosa Neto, Newton M [Grupo de Espectroscopia de Materiais (GEM), Instituto de Fisica, Universidade Federal de Uberlandia, CP 593, CEP 38400-902, Uberlandia, Minas Gerais (Brazil); Guedes, Ilde [Departamento de Fisica, Universidade Federal do Ceara, Campus do Pici, CEP 60455-760, Fortaleza, Ceara (Brazil); Chen, Felipe, E-mail: ernestosfn@yahoo.com.br [Centro de Ciencias Naturais e Humanas, Universidade Federal do ABC, CEP 09210-170, Santo Andre, Sao Paulo (Brazil)
2011-03-11
Cd{sub 1-x}Mn{sub x}S nanocrystals (NCs) were successfully grown in a glass matrix and investigated by photoluminescence (PL), electron paramagnetic resonance (EPR) and magnetic force microscopy (MFM). We verified that the luminescent properties of these NCs can be controlled both by changing the x concentration and by thermal annealing of the samples. The EPR and PL data showed that the characteristic emission of Mn{sup 2+} ions ({sup 4}T{sub 1}-{sup 6}A{sub 1}) is only observed when this magnetic impurity is substitutionally incorporated in the Cd{sub 1-x}Mn{sub x}S NC core (site S{sub I}). Besides, it was observed that the emission ({sup 4}T{sub 1}-{sup 6}A{sub 1}) suppression, caused by the Mn{sup 2+} ion presence near the surface (site S{sub II}) of the Cd{sub 1-x}Mn{sub x}S NCs, is independent of the host material. The MFM images also confirmed the high quality of the Cd{sub 1-x}Mn{sub x}S NC samples, showing a uniform distribution of total magnetic moments in the nanoparticles.
Feng, Nan; Mi, Wenbo; Cheng, Yingchun; Guo, Zaibing; Schwingenschlö gl, Udo; Bai, Haili
2014-01-01
Using first-principles calculations, we have investigated the electronic structure and magnetic properties of Fe-X 6 clusters (X = S, C, N, O, and F) incorporated in 4 4 monolayer MoS 2, where a Mo atom is substituted by Fe and its nearest S atoms are substituted by C, N, O, and F. Single Fe and Fe-F 6 substituions make the system display half-metallic properties, Fe-C 6 and Fe-N 6 substitutions lead to a spin gapless semiconducting behavior, and Fe-O 6 doped monolayer MoS 2 is semiconducting. Magnetic moments of 1.93, 1.45, 3.18, 2.08, and 2.21...? B are obtained for X = S, C, N, O, and F, respectively. The different electronic and magnetic characters originate from hybridization between the X and Fe/Mo atoms. Our results suggest that cluster doping can be an efficient strategy for exploring two-dimensional diluted magnetic semiconductors.
Feng, Nan
2014-02-05
Using first-principles calculations, we have investigated the electronic structure and magnetic properties of Fe-X 6 clusters (X = S, C, N, O, and F) incorporated in 4 4 monolayer MoS 2, where a Mo atom is substituted by Fe and its nearest S atoms are substituted by C, N, O, and F. Single Fe and Fe-F 6 substituions make the system display half-metallic properties, Fe-C 6 and Fe-N 6 substitutions lead to a spin gapless semiconducting behavior, and Fe-O 6 doped monolayer MoS 2 is semiconducting. Magnetic moments of 1.93, 1.45, 3.18, 2.08, and 2.21...? B are obtained for X = S, C, N, O, and F, respectively. The different electronic and magnetic characters originate from hybridization between the X and Fe/Mo atoms. Our results suggest that cluster doping can be an efficient strategy for exploring two-dimensional diluted magnetic semiconductors.
Reaction π-p→X deg n, X deg → 2γ at momenta 15 and 40 GeV/c
International Nuclear Information System (INIS)
Apel, W.D.; Bertolucci, E; Donskov, S.V.
1974-01-01
The cross sections for reaction π - p→X deg n with X deg → 2γ decay have been measured at momenta 15 and 40 GeV/c. About 500 events have been detected. A hodoscope spectrometer with the computer on-line was used to detect photon pairs. t-dependence of differential cross section has been obtained similar to that of reaction π - p→eta deg n. From the ratio of differential cross section for X deg and eta deg production at t=0 an angle of the singlet-octet mixing of pseudoscalar mesons has been found to be equal to β=-19 deg
Investigation on spectroscopic parameters and molecular constants of BeS(X1Σ+) using MRCI theory
International Nuclear Information System (INIS)
Liu Hui; Xing Wei; Shi Deheng; Sun Jinfeng
2012-01-01
The potential energy curve (PEC) of BeS(X 1 Σ + ) molecule has been studied using MRCI approach with Davidson modification in conjunction with the cc-pV5Z basis set. Effects on the PECs by the core-valence correlation corrections and relativistic effects have been taken into account. The way to consider the relativistic effects is to use the second-order Douglas-Kroll Hamiltonian approximation. With the PEC including the core-valence correlation corrections and relativistic effects, the spectroscopic parameters of BeS(X 1 Σ + ) have been determined. These parameters are compared in detail with those of previous studies reported in the literature, and excellent agreement has been found between the available experimental data and the present ones. With the PEC corrected, the first 40 vibrational states for the non-rotating BeS are computed, and the vibrational level, inertial rotation and centrifugal distortion constants for each vibrational state are predicted. (authors)
Energy Technology Data Exchange (ETDEWEB)
Wachter, J B [Department of Chemistry, Michigan State University, East Lansing, MI 48824 (United States); Chrissafis, K [Department of Physics, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Petkov, V [Department of Physics, Central Michigan University, Mount Pleasant, MI 48859 (United States); Malliakas, C D [Department of Chemistry, Michigan State University, East Lansing, MI 48824 (United States); Bilc, D [Department of Physics, Central Michigan University, Mount Pleasant, MI 48859 (United States); Kyratsi, Th [Department of Chemistry, Michigan State University, East Lansing, MI 48824 (United States); Paraskevopoulos, K M [Department of Physics, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Mahanti, S D [Department of Physics, Michigan State University, East Lansing, MI 48824 (United States); Torbruegge, T [Institut fuer Physikalische Chemie, Westf. Wilhelms-Universitaet Muenster (Germany); Eckert, H [Institut fuer Physikalische Chemie, Westf. Wilhelms-Universitaet Muenster (Germany); Kanatzidis, M.G. [Department of Chemistry, Michigan State University, East Lansing, MI 48824 (United States)], E-mail: m-kanatzidis@northwestern.edu
2007-02-15
KSb{sub 5}S{sub 8} and its solid solution analogs with Rb and Tl were found to exhibit a reversible and tunable glass{sup {yields}}crystal{sup {yields}}glass phase transition. Selected members of this series were analyzed by differential scanning calorimetry to measure the effect of the substitution on the thermal properties. The solid solutions K{sub 1-} {sub x} Rb {sub x} Sb{sub 5}S{sub 8} exhibited clear deviations in melting and crystallization behavior and temperatures from the parent structure. The crystallization process of the glassy KSb{sub 5}S{sub 8} as a function of temperature could clearly be followed with Raman spectroscopy. The thermal conductivity of both glassy and crystalline KSb{sub 5}S{sub 8} at room temperature is {approx}0.40 W/m K, among the lowest known values for any dense solid-state material. Electronic band structure calculations carried out on KSb{sub 5}S{sub 8} and TlSb{sub 5}S{sub 8} show the presence of large indirect band-gaps and confirm the coexistence of covalent Sb-S bonding and predominantly ionic K(Tl)...S bonding. Pair distribution function analyses based on total X-ray scattering data on both crystalline and glassy K{sub 1-} {sub x} Rb {sub x} Sb{sub 5}S{sub 8} showed that the basic structure-defining unit is the same and it involves a distorted polyhedron of 'SbS{sub 7}' fragment of {approx}7 A diameter. The similarity of local structure between the glassy and crystalline phases accounts for the facile crystallization rate in this system. - Graphical abstract: The KSb{sub 5}S{sub 8} is a good example of a phase-change material with a mixed ionic/covalent bonding. The members of the K{sub 1-} {sub x} Rb {sub x} Sb{sub 5}S{sub 8} series exhibit phase-change properties with greater glass forming ability (GFA) than KSb{sub 5}S{sub 8}. The GFA increases with increasing Rb content. In this case, the random alloy disorder in the alkali metal sublattice seems to predominate over the increased degree of ionicity in going from K...S
Directory of Open Access Journals (Sweden)
Priscila Da Silva Figueiredo Celestino Gomes
Full Text Available The colony stimulating factor-1 receptor (CSF-1R and the stem cell factor receptor KIT, type III receptor tyrosine kinases (RTKs, are important mediators of signal transduction. The normal functions of these receptors can be compromised by gain-of-function mutations associated with different physiopatological impacts. Whereas KIT D816V/H mutation is a well-characterized oncogenic event and principal cause of systemic mastocytosis, the homologous CSF-1R D802V has not been identified in human cancers. The KIT D816V oncogenic mutation triggers resistance to the RTK inhibitor Imatinib used as first line treatment against chronic myeloid leukemia and gastrointestinal tumors. CSF-1R is also sensitive to Imatinib and this sensitivity is altered by mutation D802V. Previous in silico characterization of the D816V mutation in KIT evidenced that the mutation caused a structure reorganization of the juxtamembrane region (JMR and facilitated its departure from the kinase domain (KD. In this study, we showed that the equivalent CSF-1R D802V mutation does not promote such structural effects on the JMR despite of a reduction on some key H-bonds interactions controlling the JMR binding to the KD. In addition, this mutation disrupts the allosteric communication between two essential regulatory fragments of the receptors, the JMR and the A-loop. Nevertheless, the mutation-induced shift towards an active conformation observed in KIT D816V is not observed in CSF-1R D802V. The distinct impact of equivalent mutation in two homologous RTKs could be associated with the sequence difference between both receptors in the native form, particularly in the JMR region. A local mutation-induced perturbation on the A-loop structure observed in both receptors indicates the stabilization of an inactive non-inhibited form, which Imatinib cannot bind.
Da Silva Figueiredo Celestino Gomes, Priscila; Panel, Nicolas; Laine, Elodie; Pascutti, Pedro Geraldo; Solary, Eric; Tchertanov, Luba
2014-01-01
The colony stimulating factor-1 receptor (CSF-1R) and the stem cell factor receptor KIT, type III receptor tyrosine kinases (RTKs), are important mediators of signal transduction. The normal functions of these receptors can be compromised by gain-of-function mutations associated with different physiopatological impacts. Whereas KIT D816V/H mutation is a well-characterized oncogenic event and principal cause of systemic mastocytosis, the homologous CSF-1R D802V has not been identified in human cancers. The KIT D816V oncogenic mutation triggers resistance to the RTK inhibitor Imatinib used as first line treatment against chronic myeloid leukemia and gastrointestinal tumors. CSF-1R is also sensitive to Imatinib and this sensitivity is altered by mutation D802V. Previous in silico characterization of the D816V mutation in KIT evidenced that the mutation caused a structure reorganization of the juxtamembrane region (JMR) and facilitated its departure from the kinase domain (KD). In this study, we showed that the equivalent CSF-1R D802V mutation does not promote such structural effects on the JMR despite of a reduction on some key H-bonds interactions controlling the JMR binding to the KD. In addition, this mutation disrupts the allosteric communication between two essential regulatory fragments of the receptors, the JMR and the A-loop. Nevertheless, the mutation-induced shift towards an active conformation observed in KIT D816V is not observed in CSF-1R D802V. The distinct impact of equivalent mutation in two homologous RTKs could be associated with the sequence difference between both receptors in the native form, particularly in the JMR region. A local mutation-induced perturbation on the A-loop structure observed in both receptors indicates the stabilization of an inactive non-inhibited form, which Imatinib cannot bind. PMID:24828813
Energy Technology Data Exchange (ETDEWEB)
Xia, Mengling; Liu, Chao, E-mail: hite@whut.edu.cn; Han, Jianjun; Zhao, Xiujian
2017-06-15
CdS/Cd{sub 1−x}Zn{sub x}S sandwich-structured quantum dots (QDs) were precipitated in silicate glasses with high quantum efficiency up to 53%. The QDs were composed by a CdS core with a Cd{sub 1−x}Zn{sub x}S shell of about 1–3 nm in thickness through heat-treatment at 550 °C for 10 h. With the increased heat-treatment temperature, the intensity ratio between the intrinsic emission and the defects emission increased and the Stokes shift decreased from 84 to 4 meV, which was caused by both the increased size and passivated surface defects of the QDs.
Liu, Yan; Zhao, Yonggang; Li, Peisen; Zhang, Sen; Li, Dalai; Wu, Hao; Chen, Aitian; Xu, Yang; Han, X F; Li, Shiyan; Lin, Di; Luo, Haosu
2016-02-17
Electric-field control of magnetism in multiferroic heterostructures composed of Co40Fe40B20 (CoFeB) and (1-x)Pb(Mg1/3Nb2/3)O3-xPbTiO3 (PMN-xPT) with different ferroelectric phases via changing composition and temperature is explored. It is demonstrated that the nonvolatile looplike bipolar-electric-field-controlled magnetization, previously found in the CoFeB/PMN-xPT heterostructures with PMN-xPT in the rhombohedral (R) phase around the morphotropic phase boundary (MPB), also occurs for PMN-xPTs with both R phase (far away from MPB) and monoclinic (M) phase, suggesting that the phenomenon is the common feature of CoFeB/PMN-xPT multiferroic heterostructures for PMN-xPT with different phases. The magnitude of the effect changes with increasing temperature and volatile bipolar-electric-field-controlled magnetization with a butterflylike behavior occurs when the ferroelectric phase changes to the tetragonal phase (T). Moreover, for the R-phase sample with x = 0.18, an abrupt and giant increase of magnetization is observed at a characteristic temperature in the temperature dependence of magnetization curve. These results are discussed in terms of coupling between magnetism and ferroelectric domains including macro- and microdomains for different ferroelectric phases. This work is helpful for understanding the phenomena of electric-field control of magnetism in FM/FE multiferroic heterostructures and is also important for applications.
Creep rupture behavior of candidate materials for nuclear process heat applications
International Nuclear Information System (INIS)
Schubert, F.; te Heesen, E.; Bruch, U.; Cook, R.; Diehl, H.; Ennis, P.J.; Jakobeit, W.; Penkalla, H.J.; Ullrich, G.
1984-01-01
Creep and stress rupture properties are determined for the candidate materials to be used in hightemperature gas-cooled reactor (HTGR) components. The materials and test methods are briefly described based on experimental results of test durations of about20000 h. The medium creep strengths of the alloys Inconel-617, Hastelloy-X, Nimonic-86, Hastelloy-S, Manaurite-36X, IN-519, and Incoloy-800H are compared showing that Inconel-617 has the best creep rupture properties in the temperature range above 800 0 C. The rupture time of welded joints is in the lower range of the scatterband of the parent metal. The properties determined in different simulated HTGR atmospheres are within the scatterband of the properties obtained in air. Extrapolation methods are discussed and a modified minimum commitment method is favored
AgSb(S{sub x}Se{sub 1−x}){sub 2} thin films for solar cell applications
Energy Technology Data Exchange (ETDEWEB)
González, J.O. [Universidad Autónoma de Nuevo León, Facultad de Ingeniería Mecánica y Eléctrica, San Nicolás de los Garza, Nuevo León 66450, México (Mexico); Shaji, S.; Avellaneda, D. [Universidad Autónoma de Nuevo León, Facultad de Ingeniería Mecánica y Eléctrica, San Nicolás de los Garza, Nuevo León 66450, México (Mexico); Universidad Autónoma de Nuevo León-CIIDIT, Apodaca, Nuevo León, México (Mexico); Castillo, A.G.; Roy, T.K. Das [Universidad Autónoma de Nuevo León, Facultad de Ingeniería Mecánica y Eléctrica, San Nicolás de los Garza, Nuevo León 66450, México (Mexico); and others
2013-05-15
Highlights: ► AgSb(S{sub x}Se{sub 1−x}){sub 2} thin films were formed by heating Na{sub 2}SeSO{sub 3} dipped Sb{sub 2}S{sub 3}/Ag layers. ► S/Se ratio was varied by changing the dipping time in Na{sub 2}SeSO{sub 3} solution. ► Characterized the films using XRD, XPS, SEM, Optical and electrical measurements. ► Band gap engineering of 1−1.1 eV for x = 0.51 and 0.52 respectively. ► PV Glass/FTO/CdS/AgSb(S{sub x}Se{sub 1−x}){sub 2}/C were prepared showing V{sub oc} = 410 mV, J{sub sc} = 5.7 mA/cm{sup 2}. - Abstract: Silver antimony sulfoselenide (AgSb(S{sub x}Se{sub 1−x}){sub 2}) thin films were prepared by heating glass/Sb{sub 2}S{sub 3}/Ag layers after selenization using sodium selenosulphate solution. First, Sb{sub 2}S{sub 3} thin films were deposited on glass substrates from a chemical bath containing SbCl{sub 3} and Na{sub 2}S{sub 2}O{sub 3}. Then Ag thin films were thermally evaporated onto glass/Sb{sub 2}S{sub 3}, followed by selenization by dipping in an acidic solution of Na{sub 2}SeSO{sub 3}. The duration of selenium dipping was varied as 30 min and 2 h. The heating condition was at 350 °C for 1 h in vacuum. Analysis of X-ray diffraction pattern of the thin films formed after heating showed the formation of AgSb(S{sub x}Se{sub 1−x}){sub 2}. Morphology and elemental analysis were done by scanning electron microscopy and energy dispersive X-ray detection. Depth profile of composition of the thin films was performed by X-ray Photoelectron Spectroscopy. The spectral study showed the presence of Ag, Sb, S, and Se, and the corresponding binding energy analysis confirmed the formation of AgSb(S{sub x}Se{sub 1−x}){sub 2}. Photovoltaic structures (PV) were prepared using AgSb(S{sub x}Se{sub 1−x}){sub 2} thin films as absorber and CdS thin films as window layers on FTO coated glass substrates. The PV structures were heated at 60–80 °C in air for 1 h to improve ohmic contact. Analysis of J–V characteristics of the PV structures showed V
PILATUS: a two-dimensional X-ray detector for macromolecular crystallography
Eikenberry, E F; Huelsen, G; Toyokawa, H; Horisberger, R P; Schmitt, B; Schulze-Briese, C; Tomizaki, T
2003-01-01
A large quantum-limited area X-ray detector for protein crystallography is under development at the Swiss Light Source. The final detector will be 2kx2k pixels covering 40x40 cm sup 2. A three-module prototype with 1120x157 pixels covering an active area of 24.3x3.4 cm sup 2 has been tested. X-rays above 6 keV with peak count rates exceeding 5x10 sup 5 X-ray/pixel/s could be detected in single photon counting mode. Statistics of module production and results of threshold trimming are presented. To demonstrate the potential of this new detector, protein crystal data were collected at beamline 6S of the SLS.
Simultaneous iris and hinode/eis observations and modeling of the 2014 October 27 X2.0. class flare
Czech Academy of Sciences Publication Activity Database
Polito, V.; Reep, W.J.; Reeves, K.K.; Simoes, P.J.A.; Dudík, Jaroslav; Del Zanna, G.; Mason, H. E.; Golub, L.
2016-01-01
Roč. 816, č. 2 (2016), 89/1-89/20 ISSN 0004-637X Grant - others:The Royal Society /Newton Fellowship(GB) NFAluminiNF120818; EC(XE) 606862 Program:FP7 Institutional support: RVO:67985815 Keywords : Sun * chromosphere * flares Subject RIV: BN - Astronomy , Celestial Mechanics, Astrophysics Impact factor: 5.533, year: 2016
Electrical conductivity studies in (Ag3AsS3)x(As2S3)1-x superionic glasses and composites
Studenyak, I. P.; Neimet, Yu. Yu.; Kranjčec, M.; Solomon, A. M.; Orliukas, A. F.; Kežionis, A.; Kazakevičius, E.; Šalkus, T.
2014-01-01
Compositional, frequency, and temperature studies of impedance and electrical conductivity in (Ag3AsS3)x(As2S3)1-x superionic glasses and composites were performed. Frequency range from 10 Hz to 3 × 109 Hz and temperature interval 300-400 K were used for the measurements. Compositional dependences of electrical conductivity and activation energy are analyzed; the most substantial changes are observed with the transition from (Ag3AsS3)0.4(As2S3)0.6 glass to (Ag3AsS3)0.5(As2S3)0.5 composite. With increase of Ag3AsS3 content, the investigated materials are found to have crystalline inclusions and show the two-phase composite nature. Addition of Ag3AsS3 leads to the increase of electrical conductivity whereas the activation energy decreases.
Chen, Lianxi; Bin, Yuanhong; Zou, Wenqi; Wang, Xiaojian; Li, Wei
2017-02-01
In the present work, new magnesium (Mg) alloys (Mg-4Zn-0.6Zr-xSr, x=0, 0.4, 0.8, 1.2, 1.6wt%; ZK40xSr) were prepared and studied as potential biodegradable materials. The influence of strontium (Sr) addition on the properties of the new Mg alloys was investigated, which included microstructure, corrosion degradation, and the stress corrosion cracking (SCC) susceptibility. The average grain size of the ZK40Sr was approximately 100µm, which was significantly smaller than that of ZK40 alloy without Sr (402.3±40.2µm). The size of grain boundaries precipitates in the ZK40xSr alloys gradually increased with the increase of Sr content. The grain boundaries finally showed a continuously distribution and net-like shape. The degradation test showed that the average degradation rate of the ZK40xSr alloys increased with the increase of Sr addition. In the case of Mg-4Zn-0.6Zr, the degradation rate was 2.2mgcm -2 day -1 , which was lower than that of Mg-4Zn-0.6Zr-1.6Sr (4.93mgcm -2 day -1 ). When the ZK40xSr alloys were immersed in m-SBF, the rod-like Sr-contained hydroxyapatite (HA) substance was detected, which was known to enhance cell growth around bone implants. The fracture surfaces of the as-cast Mg-4Zn-0.6Zr-1.6Sr were shown intergranular stress corrosion cracking (IGSCC) patterns. The increase of SCC susceptibility of the higher Sr ZK40xSr alloys was attributed to the increase of micro-galvanic corrosion between the α-Mg and the grain boundaries precipitates. The SCC susceptibility values were ≈0.13 and ≈0.41 for the Mg-4Zn-0.6Zr-0.4Sr and the Mg-4Zn-0.6Zr-1.6Sr, respectively. Copyright © 2016 Elsevier Ltd. All rights reserved.
X-ray diffraction studies of the Tl(GaS{sub 2}){sub 1–x}(InSe{sub 2}){sub x} solid solutions
Energy Technology Data Exchange (ETDEWEB)
Sheleg, A. U.; Hurtavy, V. G., E-mail: hurtavy@physics.by; Chumak, V. A. [National Academy of Sciences of Belarus, Scientific-Practical Materials Research Center (Belarus); Mustafaeva, S. N.; Kerimova, E. M. [Azerbaijan National Academy of Sciences, Institute of Physics (Azerbaijan)
2016-07-15
The unit-cell parameters of crystals obtained in the Tl(GaS{sub 2}){sub 1–x}(InSe{sub 2}){sub x} system are measured by X-ray diffraction. The relationship between these parameters and composition is determined. It is shown that, with growing x, the a, b, and c parameters increase and the β angle decreases. Two types of solid solutions are found in the Tl(GaS{sub 2}){sub 1–x}(InSe{sub 2}){sub x} system: one is based on compound TlGaS{sub 2} with monoclinic structure and the other is based on TlInSe{sub 2} with tetragonal structure.
Purinergní P2X rodina a specifické vlastnosti P2X7 podtypu
Czech Academy of Sciences Publication Activity Database
Jindřichová, Marie; Zemková, Hana
2013-01-01
Roč. 62, č. 2 (2013), s. 40-46 ISSN 1210-6313 R&D Projects: GA ČR(CZ) GPP304/12/P371 Institutional support: RVO:67985823 Keywords : extracellular ATP * purinergic P2X family * P2X7 receptor * cell proliferation and apoptosis Subject RIV: ED - Physiology
Czech Academy of Sciences Publication Activity Database
Bednářová, Andrea; Hanna, M. E.; Rakshit, K.; O’Donnell, J. M.; Krishnan, N.
2017-01-01
Roč. 45, č. 6 (2017), s. 816-825 ISSN 0953-816X R&D Projects: GA MŠk(CZ) LH14047 Grant - others:GA JU(CZ) 038/2014/P Institutional support: RVO:60077344 Keywords : 4-hydroxynonenal * aging * circadian rhythms Subject RIV: ED - Physiology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 2.941, year: 2016 http://onlinelibrary.wiley.com/doi/10.1111/ejn.13525/pdf
Integrable systems from membranes on AdS4 x S7
International Nuclear Information System (INIS)
Bozhilov, P.
2008-01-01
We describe how Neumann and Neumann-Rosochatius type integrable systems, as well as the continuous limit of the SU(2) integrable spin chain, can be obtained from membranes on AdS 4 x S 7 background, in the framework of AdS/CFT correspondence. (Abstract Copyright [2008], Wiley Periodicals, Inc.)
Energy Technology Data Exchange (ETDEWEB)
An, Yuehua; Wu, Zhenping; Chu, Xulong; Guo, Daoyou; Guo, Xuncai [Beijing University of Posts and Telecommunications, Laboratory of Optoelectronics Materials and Devices, School of Science (China); Li, Linghong [The State University of New York at Potsdam, Physics Department (United States); Li, Peigang, E-mail: pgli@zstu.edu.cn [Zhejiang Sci-Tech University, Department of Physics, Center for Optoelectronics Materials and Devices (China); Tang, Hao [The University of Tennessee at Knoxville, Department of Chemistry (United States); Tang, Weihua, E-mail: whtang@bupt.edu.cn [Beijing University of Posts and Telecommunications, Laboratory of Optoelectronics Materials and Devices, School of Science (China)
2015-03-15
CdS{sub 1–x}Se{sub x} colloidal nanocrystals (NCs) were synthesized by colloidal chemistry route. Both lattice parameters and band structure were modulated by tuning the content of Se. As the Se content increases, the peak of UV–Visible absorbance spectrum of CdS{sub 1−x}Se{sub x} shifts toward longer wavelength direction, indicating the reduction of band gap. Devices with Au/CdS{sub 1−x}Se{sub x} NCs/Au structures have been fabricated by assembling the obtained CdS{sub 1−x}Se{sub x} NCs into Au microelectrodes via dielectrophoresis method. It is found that the rectifying polarities of the devices are strongly dependent on the content of Se. With the increasing Se content, the rectification polarity changes from backward to forward. This polarity tuning could be caused by the change of the relative height of the Fermi levels between CdS{sub 1−x}Se{sub x} and Au. The Se-content-dependent rectifying behavior may offer us an opportunity to design novel logical structure in NC-based nanoelectronics.
Spectrum and quantum symmetries of the AdS{sub 5} x S{sup 5} superstring
Energy Technology Data Exchange (ETDEWEB)
Heinze, Martin
2014-12-18
The initial AdS/CFT duality pair, the duality between N=4 SYM and the AdS{sub 5} x S{sup 5} superstring, appears to enjoy quantum integrability in the planar limit, which allowed to devise powerful methods ostensibly solving the spectral problem. However, quantization of the AdS{sub 5} x S{sup 5} superstring from first principles is still an open question and especially the spectrum of short string states has previously been derived only at leading order in large 't Hooft coupling. In this thesis we investigate possible routes to quantize short string states perturbatively beyond the leading order, where equally our aim is to gain better appreciation of the quantum symmetries at play. A prominent role is played by the lowest excited string states, dual to the Konishi supermultiplet, and we start by reviewing critically an asserted derivation of the Konishi anomalous dimension in the setup of pure spinor string theory. Next, we constrain ourselves to bosonic AdS{sub 5} x S{sup 5} String in static gauge, where we construct a so-called single-mode string solution, a generalization of the pulsating string allowing for unconstrained zero-modes. This solution shows classical integrability and invariance under the isometries SO(2,4) x SO(6) at the quantum level. Arguing heuristically about the effects of supersymmetry, we indeed recover the first non-trivial quantum correction to the Konishi anomalous dimension. We continue by implementing static gauge for the full AdS{sub 5} x S{sup 5} superstring and find elegant expressions for the Lagrangian density and the supercharges. We then constrain our interest to the superparticle and, using two different methods, find canonical coordinates at quadratic order in fermions. We conclude by exploring another quantization scheme: As the single-mode string is nothing but the SO(2,4) x SO(6) orbit of the pulsating string, we apply orbit method quantization to the particle and spinning string solutions in bosonic AdS{sub 3} x S
Indian Academy of Sciences (India)
DMSO Release. ATRi Release. Only EdU. Only ATRi. *. *. *. n.s. n.s. B. 0. 10. 20. 30. 40. 50. 60. 15 mins 20 mins 30 mins 40 mins 60 mins. % o. f p. R a d. 1. 7 p o s tiv e c e lls. HU + DMSO. HU + ATRi. *. *. *. *. n.s. 0. 0. 20. 30. 40. 50. 60. 70. 80. 2 h Treatment. 24 h Treatment γ. H. 2. A. X. P o s i t i v e. N u c l e i. HU+DMSO ...
Electro-optical properties of Cd1-xZnxS films and fabrication of Cd1-xZnxS/InP heterojunctions
International Nuclear Information System (INIS)
Pal, A.K.; Dhar, A.; Mondal, A.; Basak, R.L.; Chaudhuri, S.
1988-01-01
The authors describe Cd 1-x Zn x S films (0 ≤ x ≤ 0.2) characterized by electrical and optical measurements to obtain optimum deposition condition for device fabrication on p-type single crystal InP (Zn doped) with (100) orientation. The devices were studied by I-V, C-V and spectral response measurements
Das, Utsa; Pal, Partha P.
2017-08-01
ZnO1-x Te x ternary alloys have great potential to work as a photovoltaic (PV) absorber in solar cells. ZnO1-x S x is also a ZnO based alloy that have uses in solar cells. In this paper we report the comparative study of various parameters of ZnO1-x Te x and ZnO1-x S x for selecting it to be a competent material for solar cell applications. The parameters are mainly being calculated using the well-known VCA (virtual crystal approximation) and VBAC (Valence Band Anti-Crossing) model. It was certainly being analysed that the incorporation of Te atoms produces a high band gap lower than S atoms in the host ZnO material. The spin-orbit splitting energy value of ZnO1-x Te x was found to be higher than that of ZnO1-x S x . Beside this, the strain effects are also higher in ZnO1-x Te x than ZnO1-x S x . The remarkable notifying result which the paper is reporting is that at a higher percentage of Te atoms in ZnO1-x Te x , the spin-orbit splitting energy value rises above the band gap value, which signifies a very less internal carrier recombination that decreases the leakage current and increases the efficiency of the solar cell. Moreover, it also covers a wide wavelength range compared to ZnO1-x S x .
Energy Technology Data Exchange (ETDEWEB)
Chen Zhigang, E-mail: zgchen@dhu.edu.c [State Key Laboratory for Modification of Chemical Fibers and Polymer Materials, College of Materials Science and Engineering, Donghua University, Shanghai 201620 (China); Tian Qiwei; Song Yuelin [State Key Laboratory for Modification of Chemical Fibers and Polymer Materials, College of Materials Science and Engineering, Donghua University, Shanghai 201620 (China); Yang Jianmao [Research Center for Analysis and Measurement, Donghua University, Shanghai 201620 (China); Hu Junqing, E-mail: hu.junqing@dhu.edu.c [State Key Laboratory for Modification of Chemical Fibers and Polymer Materials, College of Materials Science and Engineering, Donghua University, Shanghai 201620 (China)
2010-09-17
We have reported a non-injection one-pot synthesis of the alloyed Zn{sub x}Cd{sub 1-x}S semiconductor nanocrystals (SNCs) with controlled shapes and compositions. This non-injection approach involves heating two molecular precursors (cadmium ethylxanthate and zinc ethylxanthate) as metal and S sources in organic solvents at 320 {sup o}C for 30 min, which results in the thermal decompositions of the molecular precursors to produce Zn{sub x}Cd{sub 1-x}S. The effects of solvents and compositions on the shapes and structures of Zn{sub x}Cd{sub 1-x}S SNCs have been investigated. The mixture solvent containing oleic acid, paraffin oil and oleylamine (such as a volume ratio: 1/2/1) results in the preparation of uniform Zn{sub x}Cd{sub 1-x}S nanoparticles with diameters of 7-13 nm, while pure oleylamine or the mixture of oleylamine and paraffin oil as the solvent leads to the formation of uniform Zn{sub x}Cd{sub 1-x}S nanorods. Monodisperse wurtzite Zn{sub x}Cd{sub 1-x}S nanorods with different compositions have been prepared in pure oleylamine, and no obvious effects of the compositions on their shapes are found. Their alloying nature is consistently confirmed by the results of high-resolution transmission electron microscopy (HRTEM), X-ray diffraction (XRD) and optical measurements. These alloyed Zn{sub x}Cd{sub 1-x}S nanorods exhibit composition-dependent absorption and emission properties, and therefore they can be promising candidates as emitting materials.
Photosensitive thin-film In/p-Pb{sub x}Sn{sub 1-x}S Schottky barriers: Fabrication and properties
Energy Technology Data Exchange (ETDEWEB)
Gremenok, V. F., E-mail: gremenok@ifttp.bas-net.by [Scientific-Practical Center of the National Academy of Sciences of Belarus State Scientific and Production Association (Belarus); Rud' , V. Yu., E-mail: rudvas.spb@gmail.com [St. Petersburg State Polytechnic University (Russian Federation); Rud' , Yu. V. [Russian Academy of Sciences, Ioffe Physical Technical Institute (Russian Federation); Bashkirov, S. A.; Ivanov, V. A. [Scientific-Practical Center of the National Academy of Sciences of Belarus State Scientific and Production Association (Belarus)
2011-08-15
Thin Pb{sub x}Sn{sub 1-x}S films are obtained by the 'hot-wall' method at substrate temperatures of 210-330 Degree-Sign C. The microstructure, composition, morphology, and electrical characteristics of films are investigated. On the basis of the obtained films, photosensitive In/p-Pb{sub x}Sn{sub 1-x}S Schottky barriers are fabricated for the first time. The photosensivity spectra of these structures are investigated, and the character of interband transitions and the band-gap values are determined from them. The conclusion is drawn that Pb{sub x}Sn{sub 1-x}S thin polycrystalline films may be used in solar-energy converters.
Band alignment at the Cu{sub 2}ZnSn(S{sub x}Se{sub 1-x}){sub 4}/CdS interface
Energy Technology Data Exchange (ETDEWEB)
Haight, Richard; Barkhouse, Aaron; Gunawan, Oki; Shin, Byungha; Copel, Matt; Hopstaken, Marinus; Mitzi, David B [IBM TJ Watson Research Center, P.O. Box 218, Yorktown Hts., New York 10598 (United States)
2011-06-20
Energy band alignments between CdS and Cu{sub 2}ZnSn(S{sub x}Se{sub 1-x}){sub 4} (CZTSSe) grown via solution-based and vacuum-based deposition routes were studied as a function of the [S]/[S+Se] ratio with femtosecond laser ultraviolet photoelectron spectroscopy, photoluminescence, medium energy ion scattering, and secondary ion mass spectrometry. Band bending in the underlying CZTSSe layer was measured via pump/probe photovoltage shifts of the photoelectron spectra and offsets were determined with photoemission under flat band conditions. Increasing the S content of the CZTSSe films produces a valence edge shift to higher binding energy and increases the CZTSSe band gap. In all cases, the CdS conduction band offsets were spikes.
Hard x-ray measurements of the hot-electron rings in EBT-S
International Nuclear Information System (INIS)
Hillis, D.L.
1982-06-01
A thorough understanding of the hot electron rings in ELMO Bumpy Torus-Scale (EBT-S) is essential to the bumpy torus concept of plasma production, since the rings provide bulk plasma stability. The hot electrons are produced via electron cyclotron resonant heating using a 28-GHz cw gyrotron, which has operated up to power levels of 200 kW. The parameters of the energetic electron rings are studied via hard x-ray measurement techniques and with diamagnetic pickup coils. The hard x-ray measurements have used collimated NaI(Tl) detectors to determine the electron temperature T/sub e/ and electron density n/sub e/ for the hot electron annulus. Typical values of T/sub e/ are 400 to 500 keV and of n/sub e/ 2 to 5 x 10 11 cm -3 . The total stored energy of a single energetic electron ring as measured by diamagnetic pickup loops approaches approx. 40 J and is in good agreement with that deduced from hard x-ray measurements. By combining the experimental measurements from hard x-rays and the diamagnetic loops, an estimate can be obtained for the volume of a single hot electron ring. The ring volume is determined to be approx. 2.2 litres, and this volume remains approximately constant over the T-mode operating regime. Finally, the power in the electrons scattered out of the ring is measured indirectly by measuring the x-ray radiation produced when those electrons strike the chamber walls. The variation of this radiation with increasing microwave power levels is found to be consistent with classical scattering estimates
Synthesis and Thermoelectric Properties in the 2D Ti1 ? x Nb x S3 Trichalcogenides
Misse, Patrick R. N.; Berthebaud, David; Lebedev, Oleg I.; Maignan, Antoine; Guilmeau, Emmanuel
2015-01-01
A solid solution of Ti1 ? x Nb x S3 composition (x = 0, 0.05, 0.07, 0.10) was synthesized by solid-liquid-vapor reaction followed by spark plasma sintering. The obtained compounds crystallize in the monoclinic ZrSe3 structure type. For the x = 0.07 sample, a mixture of both A and B variants of the MX3 structure is evidenced by transmission electron microscopy. This result contrasts with those of pristine TiS3, prepared within the same conditions, which crystallizes as a large majority of A va...
Czech Academy of Sciences Publication Activity Database
Klient, L.; Heinzel, Petr; Judge, P.; Krucker, S.
2016-01-01
Roč. 816, č. 2 (2016), 88/1-88/14 ISSN 0004-637X R&D Projects: GA ČR GAP209/12/1652 Grant - others:EC(XE) 606862 Program:FP7 Institutional support: RVO:67985815 Keywords : Sun flares * techniques * spectroscopic Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.533, year: 2016
Energy Technology Data Exchange (ETDEWEB)
Devi, V. Radhika [M.L.R. Institute of Technology, Affiliated to Jawaharlal Nehru Technological University, Dundigal, Hyderabad 500043 (India); Zabidi, Noriza Ahmad [Department of Physics, Centre for Defence Foundation Studies, National Defence University of Malaysia, Kem Sungai Besi, Kuala Lumpur 57000 (Malaysia); Shrivastava, Keshav N., E-mail: keshav1001@yahoo.com [School of Physics, University of Hyderabad, Hyderabad 50046 (India); Department of Physics, University of Malaya, Kuala Lumpur 50603 (Malaysia)
2013-09-16
We use the density-functional theory to make models of Si{sub x}S{sub y} and Si{sub x}Se{sub y} for the values of x,y = 1–6. The vibrational frequencies are calculated for each model. The stable clusters are selected on the basis of positive vibrational frequencies. In the case of Si{sub x}S{sub 1−x}, the values of the vibrational frequencies calculated from the first principles for Si{sub 2}S(triangular)cluster of atoms, 364.1 cm{sup −1} and 380.8 cm{sup −1}, agree with the experimentally measured values of 367 cm{sup −1} and 381 cm{sup −1}, indicating that Si{sub 2}S clusters occur in the glassy state of SiS. The calculated values of the vibrational frequencies of SiSe{sub 4} (pyramidal) which agree with the experimental Raman frequencies of glassy Si{sub x}Se{sub 1−x} are 114, 166 and 361 cm{sup −1}. The calculated values for Si{sub 2}Se{sub 4} (bipyramidal) which agree with the experimental data of Si{sub x}Se{sub 1−x} are 166 and 464 cm{sup −1}. In Si{sub 4}Se (pyramidal) the values 246 and 304 cm{sup −1} agree with the measured values. In Si{sub 4}Se{sub 2} (bipyramidal), the calculated values 162, 196 and 304 cm{sup −1} agree with the measured values. The calculated values of 473 cm{sup −1} for Si{sub 6}Se{sub 2} (bipyramidal) also agree with the experimentally measured values. We thus find that pyramidal structures are present in the amorphous Si{sub x}Se{sub 1−x} glassy state. - Highlights: • A first principles calculation is performed to calculate the vibrational frequencies. • The calculated frequencies of clusters agree with measured Raman values. • The structures, bond lengths and symmetries are determined. • The importance of Jahn–Teller effect in SiS and in SiSe is clearly seen. • The clusters of SiS and SiSe are found to stabilize in different symmetries.
SphinX: A Fast Solar Photometer in X-rays J. Sylwester , S. Kuzin ...
Indian Academy of Sciences (India)
NAS solar mission. SphinX (Solar Photometer in X-rays) will use PIN silicon detectors for high time resolution (0.01 s) measurements of the solar spectra of .... right panel of Fig. 2. In this NBF concept, three fluorescing targets illuminate a single. PIN detector. The fluorescence radiation is coming from three different pure ...
Energy Technology Data Exchange (ETDEWEB)
Walton, D. J.; Harrison, F. A.; Grefenstette, B. W.; Fuerst, F.; Madsen, K. K.; Rana, V.; Stern, D. [Space Radiation Laboratory, California Institute of Technology, Pasadena, CA 91125 (United States); Miller, J. M. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109-1042 (United States); Bachetti, M.; Barret, D.; Webb, N. [Universite de Toulouse, UPS-OMP, IRAP, Toulouse (France); Boggs, S. E.; Craig, W. W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, F. E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Fabian, A. C.; Parker, M. L. [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); Hailey, C. J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Ptak, A.; Zhang, W. W., E-mail: dwalton@srl.caltech.edu [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)
2014-09-20
We present results from the coordinated broadband X-ray observations of the extreme ultraluminous X-ray source Holmberg IX X-1 performed by NuSTAR, XMM-Newton, and Suzaku in late 2012. These observations provide the first high-quality spectra of Holmberg IX X-1 above 10 keV to date, extending the X-ray coverage of this remarkable source up to ∼30 keV. Broadband observations were undertaken at two epochs, between which Holmberg IX X-1 exhibited both flux and strong spectral variability, increasing in luminosity from L {sub X} = (1.90 ± 0.03) × 10{sup 40} erg s{sup –1} to L {sub X} = (3.35 ± 0.03) × 10{sup 40} erg s{sup –1}. Neither epoch exhibits a spectrum consistent with emission from the standard low/hard accretion state seen in Galactic black hole binaries, which would have been expected if Holmberg IX X-1 harbors a truly massive black hole accreting at substantially sub-Eddington accretion rates. The NuSTAR data confirm that the curvature observed previously in the 3-10 keV bandpass does represent a true spectral cutoff. During each epoch, the spectrum appears to be dominated by two optically thick thermal components, likely associated with an accretion disk. The spectrum also shows some evidence for a nonthermal tail at the highest energies, which may further support this scenario. The available data allow for either of the two thermal components to dominate the spectral evolution, although both scenarios require highly nonstandard behavior for thermal accretion disk emission.
Composition controlled spin polarization in Co{sub 1-x}Fe{sub x}S{sub 2} alloys
Energy Technology Data Exchange (ETDEWEB)
Leighton, C [Department of Chemical Engineering and Materials Science, University of Minnesota (United States); Manno, M [Department of Chemical Engineering and Materials Science, University of Minnesota (United States); Cady, A [Advanced Photon Source, Argonne National Laboratory (United States); Freeland, J W [Advanced Photon Source, Argonne National Laboratory (United States); Wang, L [Department of Chemical Engineering and Materials Science, University of Minnesota (United States); Umemoto, K [Department of Chemical Engineering and Materials Science, University of Minnesota (United States); Wentzcovitch, R M [Department of Chemical Engineering and Materials Science, University of Minnesota (United States); Chen, T Y [Department of Physics and Astronomy, Johns Hopkins University (United States); Chien, C L [Department of Physics and Astronomy, Johns Hopkins University (United States); Kuhns, P L [National High Magnetic Field Laboratory, Florida State University (United States); Hoch, M J R [National High Magnetic Field Laboratory, Florida State University (United States); Reyes, A P [National High Magnetic Field Laboratory, Florida State University (United States); Moulton, W G [National High Magnetic Field Laboratory, Florida State University (United States); Dahlberg, E D [School of Physics and Astronomy, University of Minnesota (United States); Checkelsky, J [Physics Department, Harvey Mudd College (United States); Eckert, J [Physics Department, Harvey Mudd College (United States)
2007-08-08
The transition metal (TM) chalcogenides of the form TMX{sub 2} (X = S or Se) have been studied for decades due to their interesting electronic and magnetic properties such as metamagnetism and metal-insulator transitions. In particular, the Co{sub 1-x}Fe{sub x}S{sub 2} alloys were the subject of investigation in the 1970s due to general interest in itinerant ferromagnetism. In recent years (2000-present) it has been shown, both by electronic structure calculations and detailed experimental investigations, that Co{sub 1-x}Fe{sub x}S{sub 2} is a model system for the investigation of highly spin polarized ferromagnetism. The radically different electronic properties of the two endpoint compounds (CoS{sub 2} is a narrow bandwidth ferromagnetic metal, while FeS{sub 2} is a diamagnetic semiconductor), in a system forming a substitutional solid solution allows for composition control of the Fermi level relative to the spin split bands, and therefore composition-controlled conduction electron spin polarization. In essence, the recent work has shown that the concept of 'band engineering' can be applied to half-metallic ferromagnets and that high spin polarization can be deliberately engineered. Experiments reveal tunability in both sign and magnitude of the spin polarization at the Fermi level, with maximum values obtained to date of 85% at low temperatures. In this paper we review the properties of Co{sub 1-x}Fe{sub x}S{sub 2} alloys, with an emphasis on properties of relevance to half-metallicity. Crystal structure, electronic structure, synthesis, magnetic properties, transport properties, direct probes of the spin polarization, and measurements of the total density of states at the Fermi level are all discussed. We conclude with a discussion of the factors that influence, or even limit, the spin polarization, along with a discussion of opportunities and problems for future investigation, particularly with regard to fundamental studies of spintronic devices.
CMS Collaboration
2018-01-01
The measurement of the elliptic flow of prompt $\\mathrm{J}\\hspace{-.08em}/\\hspace{-.14em}\\psi$ mesons in high-multiplicity pPb collisions is reported using a data sample collected by the CMS experiment, at a nucleon-nucleon center-of-mass energy $\\sqrt{s_{_{\\mathrm{NN}}}} = 8.16~\\mathrm{TeV}$. The $\\mathrm{J}\\hspace{-.08em}/\\hspace{-.14em}\\psi$ mesons are reconstructed using the dimuon channel with both muons detected in a forward rapidity region with either $-2.86 < y_{\\rm cm} < -1.86$ or $0.94 < y_{\\rm cm}< 1.94$. Significant and positive $v_2$ values are measured for the prompt $\\mathrm{J}\\hspace{-.08em}/\\hspace{-.14em}\\psi$ meson, as extracted from long-range two-particle correlations with charged hadrons, over the transverse momentum range of $2 < p_{\\mathrm{T}} < 8~\\mathrm{GeV}$. This measurement provides direct evidence for charm quark collectivity in a small collision system. By comparing the prompt $\\mathrm{J}\\hspace{-.08em}/\\hspace{-.14em}\\psi$ results with previous CMS measurement...
Electron mobility in few-layer MoxW1-xS2
International Nuclear Information System (INIS)
Chandrasekar, Hareesh; Nath, Digbijoy N
2015-01-01
Heterostructures of two-dimensional (2D) layered materials are increasingly being explored for electronics in order to potentially extend conventional transistor scaling and to exploit new device designs and architectures. Alloys form a key underpinning of any heterostructure device technology and therefore an understanding of their electronic properties is essential. In this paper, we study the intrinsic electron mobility in few-layer Mo x W 1−x S 2 as limited by various scattering mechanisms. The room temperature, energy-dependent scattering times corresponding to polar longitudinal optical (LO) phonon, alloy and background impurity scattering mechanisms are estimated based on the Born approximation to Fermi’s golden rule. The contribution of individual scattering rates is analyzed as a function of 2D electron density as well as of alloy composition in Mo x W 1−x S 2 . While impurity scattering limits the mobility for low carrier densities (<2–4×10 12 cm −2 ), LO polar phonon scattering is the dominant mechanism for high electron densities. Alloy scattering is found to play a non-negligible role for 0.5 < x < 0.7 in Mo x W 1−x S 2 . The LO phonon-limited and impurity-limited mobilities show opposing trends with respect to alloy mole fractions. The understanding of electron mobility in Mo x W 1−x S 2 presented here is expected to enable the design and realization of heterostructures and devices based on alloys of MoS 2 and WS 2 . (paper)
Photovoltaic performance of a Cd{sub 1−x}Mg{sub x}Te/CdS top-cell structure
Energy Technology Data Exchange (ETDEWEB)
Martinez, Omar S. [Instituto de Energías Renovables, Universidad Nacional Autónoma de México, Temixco, Morelos 62580 (Mexico); Centro del Cambio Global y la Sustentabilidad en el Sureste, Villahermosa, Tabasco 86080 (Mexico); Regalado-Pérez, E.; Mathews, N.R. [Instituto de Energías Renovables, Universidad Nacional Autónoma de México, Temixco, Morelos 62580 (Mexico); Morales, Erik R. [División Académica de Ingeniería y Arquitectura, Universidad Juárez Autónoma de Tabasco, Cunduacán, Tabasco 86690 (Mexico); Reyes-Coronado, David [Unidad Académica Playa del Carmen, Universidad de Quintana Roo, Playa del Carmen, Quintana Roo 77710 (Mexico); Galvez, Geovanni Hernández [Centro del Cambio Global y la Sustentabilidad en el Sureste, Villahermosa, Tabasco 86080 (Mexico); Mathew, Xavier, E-mail: xm@ier.unam.mx [Instituto de Energías Renovables, Universidad Nacional Autónoma de México, Temixco, Morelos 62580 (Mexico)
2015-05-01
In this paper we report the progress in developing a wide band gap alloy material based on CdTe to use as the top-cell absorber in tandem solar cells. High photovoltaic performance for a Cd{sub 1−x}Mg{sub x}Te/CdS top-cell was achieved by tuning the composition of the Cd{sub 1−x}Mg{sub x}Te film, and optimizing the device processing. We have carried out studies on the effect of vapor chloride treatment of the Cd{sub 1−x}Mg{sub x}Te/CdS device and the thermal annealing of the Cu/Au contacts on the opto-electronic properties of the device. With improved contact processing and post deposition treatments, we were able to achieve 9.3% efficiency for a 1.6 eV band gap top-cell; Cd{sub 1−x}Mg{sub x}Te/CdS on conductive glass substrate. - Highlights: • Cd{sub 1−x}Mg{sub x}Te films obtained by co-evaporation of CdTe and Mg • Band gap of Cd{sub 1−x}Mg{sub x}Te can be easily tuned by verifying x. • Band gap of Cd{sub 1−x}Mg{sub x}Te is stable only for short annealing durations. • Obtained efficiency of a Cd{sub 1−x}Mg{sub x}Te based device with a band gap of 1.6 eV is 9.3%.
X-ray diffraction and electron microscopy data for amyloid formation of Aβ40 and Aβ42
Directory of Open Access Journals (Sweden)
Olga M. Selivanova
2016-09-01
Full Text Available The data presented in this article are related to the research article entitled “One of the possible mechanisms of amyloid fibrils formation based on the sizes of primary and secondary folding nuclei of Aβ40 and Aβ42” (Dovidchenko et al., 2016 [1]. Aβ peptide is one of the most intensively studied amyloidogenic peptides. Despite the huge number of articles devoted to studying different fragments of Aβ peptide there are only several papers with correct kinetics data, also there are a few papers with X-ray data, especially for Aβ42. Our data present X-ray diffraction patterns both for Aβ40 and Aβ42 as well for Tris–HCl and wax. Moreover, our data provide kinetics of amyloid formation by recombinant Аβ40 and synthetic Аβ42 peptides by using electron microscopy.
Energy Technology Data Exchange (ETDEWEB)
Lei, Yun, E-mail: leiyun@whut.edu.cn; Chen, Feifei; Xu, Jun
2015-12-01
Graphical abstract: - Highlights: • Composition-tunable Zn{sub X}Cd{sub 1−X}S-graphene were prepared with a one-step solvothermal process by varying Zn/Cd ratios. • The diffraction peaks move to higher angle and UV–vis spectra present a progressive blue-shift with the increase of x value. • A more efficient separation of photo-induced carriers and a faster interfacial charge transfer occurs on graphene-Zn{sub 0.8}Cd{sub 0.2}S. - Abstract: Ternary Zn{sub X}Cd{sub 1−X}S particles were directly immobilized on graphene sheets by a facile solvothermal route with zinc acetate, cadmium acetate and thiourea as precursors, ethylene glycol as reaction solvent and graphene oxide as support. The value of x could be adjusted by controlling the molar ratio of Zn and Cd precursors. The products were characterized by X-ray diffraction, scanning electron microscope and ultraviolet–visible absorption. The photoelectric properties of the graphene-Zn{sub X}Cd{sub 1−X}S composites were investigated by transient photocurrent responses and electrochemical impedance spectra, and the results show that the obvious increase in the photocurrent density and decrease in electron-transfer resistance can be seen for graphene-Zn{sub 0.8}Cd{sub 0.2}S composites as compared to graphene-Zn{sub X}Cd{sub 1−X}S composites with other Zn/Cd ratios.
The Role of the S40 Gene Family in Leaf Senescence
Directory of Open Access Journals (Sweden)
Muhammad Jehanzeb
2017-10-01
Full Text Available Senescence affect different traits of plants, such as the ripening of fruit, number, quality and timing of seed maturation. While senescence is induced by age, growth hormones and different environmental stresses, a highly organized genetic mechanism related to substantial changes in gene expression regulates the process. Only a few genes associated to senescence have been identified in crop plants despite the vital significance of senescence for crop yield. The S40 gene family has been shown to play a role in leaf senescence. The barley HvS40 gene is one of the senescence marker genes which shows expression during age-dependent as well as dark-induced senescence. Like barley HvS40, the Arabidopsis AtS40-3 gene is also induced during natural senescence as well as in response to treatment with abscisic acid, salicylic acid, darkness and pathogen attack. It is speculated that rice OsS40 has a similar function in the leaf senescence of rice.
Directory of Open Access Journals (Sweden)
Tso-Hsiao Chen
Full Text Available The platelet-derived soluble CD40L (sCD40L release plays a critical role in the development of atherosclerosis. Nifedipine, a dihydropyridine-based L-type calcium channel blocker (CCB, has been reported to have an anti-atherosclerotic effect beyond its blood pressure-lowering effect, but the molecular mechanisms remain unclear. The present study was designed to investigate whether nifedipine affects sCD40L release from collagen-stimulated human platelets and to determine the potential role of peroxisome proliferator-activated receptor-β/-γ (PPAR-β/-γ. We found that treatment with nifedipine significantly inhibited the platelet surface CD40L expression and sCD40L release in response to collagen, while the inhibition was markedly reversed by blocking PPAR-β/-γ activity with specific antagonist such as GSK0660 and GW9662. Meanwhile, nifedipine also enhanced nitric oxide (NO and cyclic GMP formation in a PPAR-β/-γ-dependent manner. When the NO/cyclic GMP pathway was suppressed, nifedipine-mediated inhibition of sCD40L release was abolished significantly. Collagen-induced phosphorylation of p38MAPK, ERK1/2 and HSP27, matrix metalloproteinase-2 (MMP-2 expression/activity and reactive oxygen species (ROS formation were significantly inhibited by nifedipine, whereas these alterations were all attenuated by co-treatment with PPAR-β/-γ antagonists. Collectively, these results demonstrate that PPAR-β/-γ-dependent pathways contribute to nifedipine-mediated downregulation of CD40L/sCD40L signaling in activated platelets through regulation of NO/ p38MAPK/ERK1/2/HSP27/MMP-2 signalings and provide a novel mechanism regarding the anti-atherosclerotic effect of nifedipine.
Einstein X-ray observations of M101
International Nuclear Information System (INIS)
Trinchieri, G.; Fabbiano, G.; Romaine, S.
1990-01-01
The Einstein X-ray observations of the face-on spiral galaxy M101 are presented. The global X-ray luminosity L(x) of M101 is about 1.2 x 10 to the 40th ergs/s for D = 7.2 Mpc, consistent with the expected X-ray luminosity of normal spiral galaxies of its optical magnitude. The X-ray emission is mostly due to very luminous individual sources, with L(x) greater than 10 to the 38th ergs/s each, most likely very massive accreting binary systems. The data suggest a deficiency of sources in the luminosity range of L(x) from about 10 to the 37th to about 10 to the 38th ergs/s, which would indicate that the luminosity distribution of the X-ray sources in M101 might be different from that of M31 or M33. 35 refs
Einstein X-ray observations of M101
Trinchieri, G.; Fabbiano, G.; Romaine, S.
1990-01-01
The Einstein X-ray observations of the face-on spiral galaxy M101 are presented. The global X-ray luminosity L(x) of M101 is about 1.2 x 10 to the 40th ergs/s for D = 7.2 Mpc, consistent with the expected X-ray luminosity of normal spiral galaxies of its optical magnitude. The X-ray emission is mostly due to very luminous individual sources, with L(x) greater than 10 to the 38th ergs/s each, most likely very massive accreting binary systems. The data suggest a deficiency of sources in the luminosity range of L(x) from about 10 to the 37th to about 10 to the 38th ergs/s, which would indicate that the luminosity distribution of the X-ray sources in M101 might be different from that of M31 or M33.
International Nuclear Information System (INIS)
Litvinchuk, A.P.; Vitrikhovskii, N.I.
1983-01-01
Studies are presented of photoluminescence spectra of the quaternary ZnTe/sub 1-2x/S/sub x/Se/sub x/ alloy (x = 0.05, 0.10, and 0.20). The determination of the energy gap variation with composition at 85 K is given. The nonlinear variation of the energy gap E/sub g/ with composition for the quaternary ZnTe/sub 1-2x/S/sub x/Se/sub x/ alloy may be interpreted in the framework of the pseudopotential theory based on the nonlinear crystal field properties
xLPR Sim Editor 1.0 User's Guide
Energy Technology Data Exchange (ETDEWEB)
Mariner, Paul
2017-03-01
The United States Nuclear Regulatory Commission in cooperation with the Electric Power Research Institute contracted Sandia National Laboratories to develop the framework of a probabilistic fracture mechanics assessment code called xLPR ( Extremely Low Probability of Rupture) Version 2.0 . The purpose of xLPR is to evaluate degradation mechanisms in piping systems at nuclear power plants and to predict the probability of rupture. This report is a user's guide for xLPR Sim Editor 1.0 , a graphical user interface for creating and editing the xLPR Version 2.0 input file and for creating, editing, and using the xLPR Version 2.0 database files . The xLPR Sim Editor, provides a user - friendly way for users to change simulation options and input values, s elect input datasets from xLPR data bases, identify inputs needed for a simulation, and create and modify an input file for xLPR.
Kong, A. K. H.; Garcia, M. R.; Primini, F. A.; Murray, S. S.; McClintock, J. E.
2002-06-01
A bright X-ray transient was detected by Chandra on 2002 June 2 with a series of 5 HRC-I snapshots. The new source CXOU J004154.6+405648 (R.A.=00h41m54s.64, Dec.=+40d56m48s.0, +/- 1", J2000) is discovered at a luminosity (0.3-10 keV) of 1.5 x 1038 erg/s (assuming an absorbed power-law model with photon index = 2 and NH = 1021 cm-2 at a distance of 780 kpc).
78 FR 69177 - Ownership and Control Reports, Forms 102/102S, 40/40S, and 71
2013-11-18
... equally important regulatory challenges. Effective surveillance now requires automated analysis and... Form 102S ix. Consolidation Form Proposed by FIA x. Section 15(a) Factors C. Regulatory Flexibility Act... establish a comprehensive new regulatory framework for swaps and security-based swaps. The legislation was...
Electronic structure of ZrS{sub x}Se{sub 2-x} by density functional theory
Energy Technology Data Exchange (ETDEWEB)
Ghafari, Ailakbar; Moustafa, Mohamed; Janowitz, Christoph; Dwelk, Helmut; Manzke, Recardo [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Bouchani, Arash [Physics Department, Islamic Azad University, Kermanshah Branch (Iran, Islamic Republic of)
2011-07-01
The electronic properties of the ZrS{sub x}Se{sub 2-x} (x varies between zero and two) semiconductors have been calculated by density functional theory (using the Wien2K code) employing the full potential Hamiltonian within the Generalized Gradient Approximation (GGA) method. The results obtained for the end members of the series, i.e. ZrS{sub 2} and ZrSe{sub 2} reveal that the valence band maximum and conduction band minimum are located at {gamma} and between {gamma} and K respectively which is in agreement with our photoemission experimental data. Trends in the electronic structure for the whole substitution series are discussed.
Neumann and Neumann-Rosochatius integrable systems from membranes on AdS4 x S7
International Nuclear Information System (INIS)
Bozhilov, Plamen
2007-01-01
It is known that large class of classical string solutions in the type IIB AdS 5 x S 5 background is related to the Neumann and Neumann-Rosochatius integrable systems, including spiky strings and giant magnons. It is also interesting if these integrable systems can be associated with some membrane configurations in M-theory. We show here that this is indeed the case by presenting explicitly several types of membrane embedding in AdS 4 x S 7 with the searched properties
Evidence for the decay X(3872)→ψ(2S)γ
Energy Technology Data Exchange (ETDEWEB)
Aaij, R. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Adeva, B. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Adinolfi, M. [H.H. Wills Physics Laboratory, University of Bristol, Bristol (United Kingdom); Affolder, A. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); Ajaltouni, Z. [Clermont Université, Université Blaise Pascal, CNRS/IN2P3, LPC, Clermont-Ferrand (France); Albrecht, J. [Fakultät Physik, Technische Universität Dortmund, Dortmund (Germany); Alessio, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Alexander, M. [School of Physics and Astronomy, University of Glasgow, Glasgow (United Kingdom); Ali, S. [Nikhef National Institute for Subatomic Physics, Amsterdam (Netherlands); Alkhazov, G. [Petersburg Nuclear Physics Institute (PNPI), Gatchina (Russian Federation); Alvarez Cartelle, P. [Universidad de Santiago de Compostela, Santiago de Compostela (Spain); Alves, A.A. [Sezione INFN di Roma La Sapienza, Roma (Italy); European Organization for Nuclear Research (CERN), Geneva (Switzerland); Amato, S. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro (Brazil); Amerio, S. [Sezione INFN di Padova, Padova (Italy); Amhis, Y. [LAL, Université Paris-Sud, CNRS/IN2P3, Orsay (France); An, L. [Center for High Energy Physics, Tsinghua University, Beijing (China); Anderlini, L. [Sezione INFN di Firenze, Firenze (Italy); Anderson, J. [Physik-Institut, Universität Zürich, Zürich (Switzerland); Andreassen, R. [University of Cincinnati, Cincinnati, OH (United States); Andreotti, M. [Sezione INFN di Ferrara, Ferrara (Italy); and others
2014-09-15
Evidence for the decay mode X(3872)→ψ(2S)γ in B{sup +}→X(3872)K{sup +} decays is found with a significance of 4.4 standard deviations. The analysis is based on a data sample of proton–proton collisions, corresponding to an integrated luminosity of 3 fb{sup −1}, collected with the LHCb detector, at centre-of-mass energies of 7 and 8 TeV. The ratio of the branching fraction of the X(3872)→ψ(2S)γ decay to that of the X(3872)→J/ψγ decay is measured to be (B(X(3872)→ψ(2S)γ))/(B(X(3872)→J/ψγ)) =2.46±0.64±0.29, where the first uncertainty is statistical and the second is systematic. The measured value does not support a pure DD{sup ¯*} molecular interpretation of the X(3872) state.
Evidence for the decay $X(3872)\\rightarrow\\psi(2S)\\gamma$
Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Bauer, Thomas; Bay, Aurelio; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Callot, Olivier; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carranza-Mejia, Hector; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coca, Cornelia; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Esen, Sevda; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farry, Stephen; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gordon, Hamish; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hartmann, Thomas; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jezabek, Marek; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanciotti, Elisa; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Manzali, Matteo; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Molina Rodriguez, Josue; Monteil, Stephane; Moran, Dermot; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Muresan, Raluca; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Powell, Andrew; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Alexander; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Sabatino, Giovanni; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sapunov, Matvey; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Senderowska, Katarzyna; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spinella, Franco; Spradlin, Patrick; Stagni, Federico; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teodorescu, Eliza; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Webber, Adam Dane; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Feng; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander
2014-01-01
Evidence for the decay mode $X(3872)\\rightarrow\\psi(2S)\\gamma$ in $B^+\\rightarrow X(3872)K^+$ decays is found with a significance of 4.4 standard deviations. The analysis is based on a data sample of proton-proton collisions, corresponding to an integrated luminosity of 3fb$^{-1}$ collected with the LHCb detector, at centre-of-mass energies of 7 and 8TeV. The ratio of the branching fraction of the $X(3872)\\to\\psi(2S)\\gamma$ decay to that of the $X(3872)\\rightarrow J/\\psi \\gamma$ decay is measured to be $$ \\frac{Br(X(3872)\\rightarrow\\psi(2S)\\gamma)}{Br(X(3872)\\rightarrow J/\\psi\\gamma)} = 2.46\\pm0.64\\pm0.29, %\\pm0.06,$$ where the first uncertainty is statistical and the second is systematic. The measured value agrees with expectations for a pure charmonium interpretation of the $X(3872)$ state and a mixture of charmonium and molecular interpretations. However, it does not support a pure $D\\bar{D}^{*}$ molecular interpretation of the $X(3872)$state.
Cisco CCNA/CCENT Exam 640-802, 640-822, 640-816 Preparation Kit With Cisco Router Simulations
Liu, Dale
2009-01-01
Three exams, two certifications, one complete Cisco training solution for networking professionals! .. .. The CCNA exam is an entry-level IT certification from Cisco Systems for professionals installing and maintaining route and switched networks. The current exam material covers networking concepts along with new and updated content on network security fundamentals and the basics of wireless networking. .. .. This book can be used as a study guide for either track you choose to receive your CCNA – the single exam, 640-802 or the combined 640-822 and 640-816, and for the CCENT certification wh
CdCl{sub 2} treatment related diffusion phenomena in Cd{sub 1−x}Zn{sub x}S/CdTe solar cells
Energy Technology Data Exchange (ETDEWEB)
Kartopu, G., E-mail: giray.kartopu@glyndwr.ac.uk; Clayton, A. J.; Barrioz, V.; Lamb, D. A.; Irvine, S. J. C. [Centre for Solar Energy Research (CSER), Glyndŵr University, OpTIC, St. Asaph Business Park, St. Asaph LL17 0JD (United Kingdom); Taylor, A. A. [Physics Department, Durham University, Durham DH1 3LE (United Kingdom)
2014-03-14
Utilisation of wide bandgap Cd{sub 1−x}Zn{sub x}S alloys as an alternative to the CdS window layer is an attractive route to enhance the performance of CdTe thin film solar cells. For successful implementation, however, it is vital to control the composition and properties of Cd{sub 1−x}Zn{sub x}S through device fabrication processes involving the relatively high-temperature CdTe deposition and CdCl{sub 2} activation steps. In this study, cross-sectional scanning transmission electron microscopy and depth profiling methods were employed to investigate chemical and structural changes in CdTe/Cd{sub 1−x}Zn{sub x}S/CdS superstrate device structures deposited on an ITO/boro-aluminosilicate substrate. Comparison of three devices in different states of completion—fully processed (CdCl{sub 2} activated), annealed only (without CdCl{sub 2} activation), and a control (without CdCl{sub 2} activation or anneal)—revealed cation diffusion phenomena within the window layer, their effects closely coupled to the CdCl{sub 2} treatment. As a result, the initial Cd{sub 1−x}Zn{sub x}S/CdS bilayer structure was observed to unify into a single Cd{sub 1−x}Zn{sub x}S layer with an increased Cd/Zn atomic ratio; these changes defining the properties and performance of the Cd{sub 1−x}Zn{sub x}S/CdTe device.
International Nuclear Information System (INIS)
Rodriguez, Carlos Anibal; Sandoval-Paz, Myrna Guadalupe; Saavedra, Renato; De la Carrera, Francisco; Trejo-Cruz, Cuauhthemoc; Aragon, Luis E.; Sirena, Martin; Delplancke, Marie-Paule; Carrasco, Claudia
2016-01-01
Cd_1_-_xZn_xS thin films have been studied extensively as window layers for solar cell applications. However, a mismatch between the Cd_1_-_xZn_xS and copper-indium-gallium-selenide absorber layers increases with Zn film concentration, which reduces the device efficiency. In this work, Cd_1_-_xZn_xS thin films with low Zn concentrations were analyzed. The effect of the addition of different molar Zn concentrations to the reaction mixture on the growth mechanism of Cd_1_-_xZn_xS thin films and the influence of these mechanisms on structural, optical and morphological properties of the films has been studied. Cd_1_-_xZn_xS thin films were synthesized by chemical bath deposition using an ammonia-free alkaline solution. Microstructural analysis by X-ray diffraction showed that all deposited films grew with hexagonal structure and crystallite sizes decreased as the Zn concentration in the film increased. Optical measurements indicated a high optical transmission between 75% and 90% for wavelengths above the absorption edge. Band gap value increased from 2.48 eV to 2.62 eV, and the refractive index values for Cd_1_-_xZn_xS thin films decreased as the Zn increased. These changes in films and properties are related to a modification in growth mechanism of the Cd_1_-_xZn_xS thin films, with the influence of Zn(OH)_2 formation being more important as Zn in solution increases. (author)
Charge selective contact on ultra-thin In(OH)xS y/Pb(OH) xS y heterostructure prepared by SILAR
International Nuclear Information System (INIS)
Gavrilov, S.; Oja, I.; Lim, B.; Belaidi, A.; Bohne, W.; Strub, E.; Roehrich, J.; Lux-Steiner, M.-Ch.; Dittrich, Th.
2006-01-01
Ultra-thin In(OH) x S y /Pb(OH) x S y heterostructures were formed by the wet chemical SILAR (successive ion layer adsorption and reaction) technique. ERDA (elastic recoil detection analysis) was used for stoichiometry analysis. The heterocontacts were conditioned by joint annealing of the two layers at different low temperatures in air. The charge selectivity was demonstrated with various small area solar cell structures. The results are discussed on the base of formation of bonds between sulphide clusters and passivation of defects with hydrogen containing species in hydroxy-sulphides. (copyright 2006 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Sukkabot, Worasak
2018-05-01
A study of CdTe/CdX (X=S and Se)/ZnS core/shell/shell nanocrystals is carried out using atomistic tight-binding theory and the configuration interaction method to provide information for applications in bioimaging, biolabeling, display devices and near-infrared electronic instruments. The calculations yield the dependences of the internal and external passivated shells on the natural behaviours of CdTe/CdX (X=S and Se)/ZnS core/shell/shell nanocrystals. The reduction of the optical band gaps is observed with increasing numbers of monolayers in the external ZnS shell due to quantum confinement. Interestingly, the optical band gaps of CdTe/CdS/ZnS core/shell/shell nanocrystals are greater than those of CdTe/CdSe/ZnS core/shell/shell nanocrystals. In the presence of an external ZnS-coated shell, electron-hole wave function overlaps, oscillation strengths, ground-state exchange energies and Stokes shift are improved, whereas ground-state coulomb energies and fine-structure splitting are reduced. The oscillation strengths, Stokes shift and fine-structure splitting are reduced with the increase in external ZnS shell thickness. The oscillation strengths, Stokes shift and fine-structure splitting of CdTe/CdS/ZnS core/shell/shell nanocrystals are larger than those of CdTe/CdSe/ZnS core/shell/shell nanocrystals. Reduction of the atomistic electron-hole interactions is observed with increasing external ZnS shell size. The strong electron-hole interactions are more probed in CdTe/CdS/ZnS core/shell/shell nanocrystals than in CdTe/CdSe/ZnS core/shell/shell nanocrystals.
Energy Technology Data Exchange (ETDEWEB)
Wang, Jian, E-mail: wangjian@sxicc.ac.cn [State Key Laboratory of Coal Conversion, Institute of Coal Chemistry, Chinese Academy of Sciences, Taoyuan South Road 27, Taiyuan 030001, Shanxi (China); University of Chinese Academy of Sciences, Beijing 100039 (China); Yang, Pengju [State Key Laboratory of Coal Conversion, Institute of Coal Chemistry, Chinese Academy of Sciences, Taoyuan South Road 27, Taiyuan 030001, Shanxi (China); University of Chinese Academy of Sciences, Beijing 100039 (China); Zhao, Jianghong [State Key Laboratory of Coal Conversion, Institute of Coal Chemistry, Chinese Academy of Sciences, Taoyuan South Road 27, Taiyuan 030001, Shanxi (China); Zhu, Zhenping, E-mail: zpzhu@sxicc.ac.cn [State Key Laboratory of Coal Conversion, Institute of Coal Chemistry, Chinese Academy of Sciences, Taoyuan South Road 27, Taiyuan 030001, Shanxi (China)
2013-10-01
The photocatalytic activity of semiconductor is strongly dependent on the efficient separation of photogenerated electron–hole pairs. In the present work, the graphene-immobilized Cd{sub x}Zn{sub 1−x}S nanoparticles with a uniform and small diameter have been prepared by one-step solvothermal route. After dispersing Cd{sub x}Zn{sub 1−x}S on the graphene surface well, the composites of Cd{sub x}Zn{sub 1−x}S and graphenes show better photocatalytic activity than pure Cd{sub x}Zn{sub 1−x}S nanoparticles. And the issue of photocorrosion, a disadvantage of Cd{sub x}Zn{sub 1−x}S photocatalysts, has also been solved partly. The mechanisms on enhancement of photocatalytic activity were further investigated. Under visible light irradiation, photogenerated electrons of Cd{sub x}Zn{sub 1−x}S can be transferred into the graphene, and the electron and hole was effectively separated, leading to the photoactivity enhancement.
International Nuclear Information System (INIS)
Sharma, Sheetal; Verma, A.S.; Jindal, V.K.
2014-01-01
Graphical abstract: - Highlights: • FP-LAPW method has been used to compute the solid state properties of AgGaX 2 (X = S, Se, Te). • Electronic and optical properties reported with recently developed mBJ potential. • Thermal expansion, heat capacity, Debye temperature, entropy and Grüneisen parameter were evaluated. • Hardness was calculated for the first time at different temperature and pressure. - Abstract: We have performed ab initio calculations for the structural, electronic, optical, elastic and thermal properties of the silver gallium dichalcogenides (AgGaX 2 : X = S, Se, Te). In this study, we have used the accurate full potential linearized augmented plane wave (FP-LAPW) method to find the equilibrium structural parameters and to compute the six elastic constants (C 11 , C 12 , C 13 , C 33 , C 44 and C 66 ). We have reported electronic and optical properties with the recently developed density functional theory of Tran and Blaha, and this theory is used along with the Wu-Cohen generalized gradient approximation (WC-GGA) for the exchange-correlation potential. Furthermore, optical features such as dielectric functions, refractive indices, extinction coefficient, optical reflectivity, absorption coefficients and optical conductivities were calculated for photon energies up to 40 eV. The thermodynamical properties such as thermal expansion, heat capacity, debye temperature, entropy, Grüneisen parameter and bulk modulus were calculated employing the quasi-harmonic Debye model at different temperatures (0–900 K) and pressures (0–8 GPa) and the silent results were interpreted. Hardness of the materials was calculated for the first time at different temperatures and pressures
Energy Technology Data Exchange (ETDEWEB)
Lim, Edmund H.H.; Liew, Josephine Y.C.; Awang Kechik, M.M.; Halim, S.A.; Chen, S.K. [Universiti Putra Malaysia (UPM), Department of Physics, Faculty of Science, Serdang, Selangor (Malaysia); Tan, K.B. [Universiti Putra Malaysia (UPM), Department of Chemistry, Faculty of Science, Serdang, Selangor (Malaysia); Qi, X. [National Cheng Kung University, Department of Materials Science and Engineering, Tainan City (China)
2017-06-15
Polycrystalline samples with nominal composition FeTe{sub 1-x}S{sub x} (x = 0.00-0.30) were synthesized via solid state reaction method with intermittent grinding in argon gas flow. X-ray diffraction (XRD) patterns revealed the tetragonal structure (space group P4/nmm) of the samples with the presence of impurities Fe{sub 3}O{sub 4} and FeTe{sub 2}. By substitution with S, the a and c lattice parameters shrink probably due to the smaller ionic radius of S{sup 2-} compared to Te{sup 2-}. Scanning electron microscopy images showed that the samples developed plate-like grains with increasing S substitution. Substitution of Te with S suppresses the structural transition of the parent compound FeTe as shown by both the temperature dependence of resistance and magnetic moment measurements. All of the S-substituted samples showed a rapid drop of resistance at around 9-10 K but zero resistance down to 4 K was not observed. In addition, negative magnetic moment corresponds to diamagnetism was detected in the samples for x = 0.25 and 0.30 suggesting the coexistence of magnetic and superconducting phase in these samples. The magnetization hysteresis loops measured at room temperature showed ferromagnetic behavior for the pure and S substituted samples. However, the magnetization, rentivity and coercivity decreased with S content. (orig.)
40 Gb/s optical transmission systems
DEFF Research Database (Denmark)
Buxens Azcoaga, Alvaro Juan; Nielsen, Steen Krogh
2003-01-01
; chromatic dispersion, Polarization Mode Dispersion (PMD), Self Phase Modulation (SPM) and linear or non-linear crosstalk among others. Regarding chromatic dispersion, sufficient evidence is presented for the need in 40 Gb/s systems of either modulation formats that allow for higher tolerance than....... Using a 9 ps pulsed RZ Tx, transmission is achieved over a 400 km link consisting of 5 spans of 80 km standard-SMF with a Quality (Q) factor of 17.7 dB, while for NRZ it is reduced to 15 dB. In another experimental verification over 40 km spans of standard-SMF, we could achieve transmission over 6 spans...
Characteristics of CuIn{sub 1−x}Ga{sub x}S{sub 2} thin films synthesized by chemical spray pyrolysis
Energy Technology Data Exchange (ETDEWEB)
Ajili, Mejda, E-mail: ajili.mejda@yahoo.fr [Laboratoire de Physique de la Matière Condensée, Faculté des Sciences de Tunis, Tunis El Manar 2092 (Tunisia); Castagné, Michel [Institut d’Electronique du Sud, Université de Montpellier II, Sciences et Techniques du Languedoc, case courrier 083. Place Eugène BATAILLON, 34 095 Montpellier cedex 05 (France); Kamoun Turki, Najoua [Laboratoire de Physique de la Matière Condensée, Faculté des Sciences de Tunis, Tunis El Manar 2092 (Tunisia)
2014-06-01
CuIn{sub 1−x}Ga{sub x}S{sub 2} multi-component semiconductors thin films were prepared by chemical spray pyrolysis on glass substrates using different concentrations of gallium in the spray solutions (y=([Ga{sup 3+}]/[In{sup 3+}]) varying from 0 to 20 at% by a step of 5 at%). Samples were characterized using X-ray diffraction, Raman spectroscopy, Atomic Force Microscopy, photoluminescence spectroscopy, spectrophotometric and Hall effect measurements. The X-ray spectra reveal that the CuIn{sub 1−x}Ga{sub x}S{sub 2} thin films are of chalcopyrite crystalline phase with a highly (1 1 2) preferential orientation. The best crystallinity is obtained for 10 at% Ga incorporation since the maximum (1 1 2) peak intensity and grain size are obtained at this Ga incorporation rate. The level of the residual microstrain and dislocation network seems to be reduced respectively to the values 0.09% and 4×10{sup 8} lines mm{sup −2} for an optimum y=10 at% for which the crystallinity of CuIn{sub 1−x}Ga{sub x}S{sub 2} thin layers is the best one. Raman spectra indicate that the sprayed thin films are grown only with CH-ordering. Optical analysis by means of transmission T(λ) and reflection R(λ) measurements allow us to determine the direct band gap energy value which increases by increasing the Ga content and it is in the range 1.39–1.53 eV, indicating that CuIn{sub 1−x}Ga{sub x}S{sub 2} compound has an absorbing property favorable for applications in solar cell devices. Photoluminescence measurements are performed on CuIn{sub 1−x}Ga{sub x}S{sub 2} crystals and the analysis reveals that the emission is mainly due to donor–acceptor pair transitions. The film resistivity (ρ) and Hall mobility (μ) are strongly affected by Ga incorporation rate. The lowest resistivity (ρ=0.1 Ω cm) and maximum value of Hall mobility (μ=0.5 cm{sup 2} V{sup −1} s{sup −1}) are also obtained for the thin layers prepared with y=10 at%. Finally, we reported two new structures for CuInS
International Nuclear Information System (INIS)
Mueller, Carola J.; Schwarz, Ulrich; Doert, Thomas
2012-01-01
The polysulfides LnS_1_._9 and polyselenides LnSe_1_._9 of the lanthanide metals from gadolinium to thulium were prepared by high-pressure high-temperature synthesis. The compounds adopt the tetragonal CeSe_1_._9 structure type in space group P4_2/n (No. 86) with lattice parameters of 8.531 Aa ≤ a ≤ 8.654 Aa and 15.563 Aa ≤ c ≤ 15.763 Aa for the sulfides and 8.869 Aa ≤ a ≤ 9.076 Aa and 16.367 Aa ≤ c ≤ 16.611 Aa for the selenides. The atomic pattern consists of puckered double slabs [LnX]"+ and planar chalcogenide layers with ten possible chalcogen positions, of which eight are occupied by chalcogen atoms forming dinuclear X_2"2"- dianions, one by a single X"2"- ion and one remaining vacant. This resembles a √5 x √5 x 2 superstructure of the ZrSSi aristotype. Structural relationships to the aristotype and the related lanthanide polychalcogenides LnX_2_-_δ (Ln = La-Tm, X = S-Te, δ = 0 - 0.3) are discussed. The samples synthesized under high-pressure conditions (p > 1 GPa) decompose slowly under release of sulfur or selenium at ambient conditions. The crystal structure of a partially degraded thulium-polysulfide sample can be described as an incommensurate variant of the original TmS_1_._9 motif. Additionally, the isostructural ternary compound Gd(S_1_-_xSe_x)_1_._9 was synthesized and characterized by powder X-ray diffraction. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Energy Technology Data Exchange (ETDEWEB)
Sadekar, Harishchandra K [Thin Film and Nanotechnology Laboratory, Department of Physics, Dr. Babasaheb Ambedkar Marathwada University, Aurangabad 431004, Maharashtra (India); Department of Physics, Arts, Commerce and Science College, Sonai 414105, Maharashtra (India); Ghule, Anil Vithal [Department of Nanotechnology, Dr. Babasaheb Ambedkar Marathwada University, Aurangabad 431004, Maharashtra (India); Sharma, Ramphal [Thin Film and Nanotechnology Laboratory, Department of Physics, Dr. Babasaheb Ambedkar Marathwada University, Aurangabad 431004, Maharashtra (India)
2011-05-05
Highlights: > ZnS{sub 1-x}Se{sub x} (x = 0 to 1) thin films are successfully deposited on glass substrates by soft chemical route. > Structural, optical and electrical properties are studied. > Change in band gap, crystallite size and resistivity is noted with change in S:Se ratio. > Wide band gap material (ZnS{sub 1-x}Se{sub x}) is useful for photosensor and solar cell applications. > It utilizes whole visible light spectrum and is a best alternative to conventionally used toxic CdS. - Abstract: Thin films of nanostructured ZnS{sub 1-x}Se{sub x} with optimized growth parameters were prepared by soft chemical route on glass substrates. Ammonia free precursors were used at 80 deg. C constant bath temperature. The ratio of sulphur to selenium was changed continuously by changing the composition x (0-1), while atomic concentration of zinc was kept constant. Structure, composition and surface morphology of as-deposited films were characterized by X-ray diffraction (XRD), energy dispersive X-ray analysis (EDAX) and scanning electron microscopy (SEM), atomic force microscopy (AFM) respectively. XRD studies revealed that as-deposited films were nanostructured in nature with cubic zinc blended structure. It was further observed that the preferred orientations are along (1 1 1) plane and crystallite size decreased with increase in the value of x. SEM and AFM images revealed that films were uniform and pinhole free. The optical band gap (E{sub g}) was calculated from the observed transmittance spectra by Urbach method. It was found that the band gap varied linearly from 3.71 to 2.70 eV, as composition x varies 0-1. The electrical properties' study revealed that the decrease in resistivity and increase in photosensitivity, as composition x varied 0-1. The observed interesting properties of ZnS{sub 1-x}Se{sub x} thin films justified their significance in optoelectronic device fabrication and applications, and as an environment friendly alternative to the commonly used toxic
Yang, Jie; Yang, Ping
2012-09-01
CdSe/Cd(1-x) Zn(x)S core/shell quantum dots (QDs) were fabricated in 1-octadecene via a two step synthesis. CdSe cores were first prepared using CdO, trioctylphosphine (TOP) selenium, and stearic acid. Subsquently, a Cd(1-x) Zn(x)S shell coating was carried out using zinc acetate dihydrate, cadmium acetate dihydrate, TOPS, and hexadecylamine (HDA) starting materials in the friendly organic system under relatively low temperature. The absorption and photoluminescence (PL) spectra have a significant red shift after the coverage of Cd(1-x)Zn(x)S shell on CdSe cores. The X-ray diffraction analysis of samples confirmed the formation of core/shell structure. The PL quantum yields (QYs) of CdSe/Cd(1-x)Zn(x)S QDs were improved gradually with time at room temperature. This is ascribed to the surface passivation of HDA to the QDs during store. This phenomenon was confirmed by the Fourier transform infrared spectrum of samples. Namely, HDA does not capped on the surface of as-prepared QDs, in which a low PL QYs was observed (less than 10%). Being storing for certain time, HDA attached to the surface of the QDs, in which the PL QYs increased (up to 31%) and the full width at half maximum of PL spectra decreased. Moreover, the fluorescence decay curve of the core/shell QDs is closer to a biexponential decay profile and has a longer average PL lifetime. The variation of average PL lifetime also indicated the influence of HDA during store.
Gao, Wei; Li, Yongtao; Guo, Jianhua; Ni, Muxun; Liao, Ming; Mo, Haojie; Li, Jingbo
2018-05-10
Here we report ultrathin SnS1-xSex alloyed nanosheets synthesized via a narrow-gap physical vapour deposition approach. The SnS1-xSex alloy presents a uniform quadrangle shape with a lateral size of 5-80 μm and a thickness of several nanometers. Clear orthorhombic symmetries and unique in-plane anisotropic properties of the 2D alloyed nanosheets were found with the help of X-ray diffraction, high resolution transmission electron microscopy and polarized Raman spectroscopy. Moreover, 2D alloyed field-effect transistors were fabricated, exhibiting a unipolar p-type semiconductor behavior. This study also provided a lesson that the thickness of the alloyed channels played the major role in the current on/off ratio, and the high ratio of 2.10 × 102 measured from a large ultrathin SnS1-xSex device was two orders of magnitude larger than that of previously reported SnS, SnSe nanosheet based transistors because of the capacitance shielding effect. Obviously enhanced Raman peaks were also found in the thinner nanosheets. Furthermore, the ultrathin SnS0.5Se0.5 based photodetector showed a highest responsivity of 1.69 A W-1 and a short response time of 40 ms under illumination of a 532 nm laser from 405 to 808 nm. Simultaneously, the corresponding highest external quantum efficiency of 392% and detectivity of 3.96 × 104 Jones were also achieved. Hopefully, the narrow-gap synthesis technique provides us with an improved strategy to obtain large ultrathin 2D nanosheets which may tend to grow into thicker ones for stronger interlayer van der Waals forces, and the enhanced physical and (opto)electrical performances in the obtained ultrathin SnS1-xSex alloyed nanosheets prove their great potential in the future applications for versatile devices.
Energy Technology Data Exchange (ETDEWEB)
Sato, Kazuma; Takayanagi, Toshiyuki, E-mail: tako@mail.saitama-u.ac.jp
2014-08-17
Highlights: • Low-lying three potential energy surfaces for the HNS/HSN system are developed. • Quantum scattering calculations are performed for S + NH and N + SH reactions. • NS production mechanisms from S + NH and N + SH reactions are discussed. - Abstract: The lowest three adiabatic potential energy surfaces (1{sup 1}A′, 1{sup 1}A″ and 1{sup 3}A″) of the HNS molecular system have been developed using ab initio MRCI + Q-level electronic structure calculations with a complete-basis-set approach in order to understand the NS production mechanisms from the S({sup 3}P) + NH(X{sup 3}Σ) → NS(X{sup 2}Π) + H({sup 2}S) and N({sup 4}S) + SH(X{sup 2}Π) → NS(X{sup 2}Π) + H({sup 2}S) reactions. The results of time-independent quantum reactive scattering calculations show that the reactions proceed with the contribution of both direct and HNS/HSN complex-forming mechanisms on all the three potential energy surfaces. It is found that the reaction dynamics is not entirely statistical and cannot be described with a simple capture theory despite that the reactions are barrierless with large exoergicity.
X-ray photoelectron spectroscopy study on Ba1-xEuxTiO3
International Nuclear Information System (INIS)
Lu, D.-Y.; Sugano, Mikio; Sun Xiuyun; Su Wenhui
2005-01-01
X-ray photoelectron spectroscopy is employed to study inner-shell core-level binding energies Eu 4d, Ti 2p and O 1s, Ba 3d for new single-phase Ba 1-x Eu x TiO 3 (0.1 ≤ x ≤ 0.4) samples prepared by solid state reaction at 4.0 GPa and 1090 deg. C. The peak positions of binding energies determined by linear background subtraction and Gaussian fit are presented. XPS analysis indicates that the mixed-valent Eu 3+ /Eu 2+ ions at A-site and Ti 4+ /Ti 3+ ions at B-site coexisted in the Ba 1-x Eu x TiO 3 powder surface, and the amount of Eu 2+ ions is equal to Eu 3+ ions
Near infrared fluorescence and energy transfer in Ce/Nd Co-doped Ca{sub x}Sr{sub 1-x}S
Energy Technology Data Exchange (ETDEWEB)
Meng Jianxin, E-mail: tmjx@jnu.edu.c [Institute of Nanochemistry, Jinan University, Guangzhou 510632 (China); Department of Chemistry, Jinan University, Guangzhou 510632 (China); Wan Wenjiao; Fan Lili; Yang Chuangtao; Chen Qingqing [Department of Chemistry, Jinan University, Guangzhou 510632 (China); Cao Liwei; Man Shiqing [Institute of Nanochemistry, Jinan University, Guangzhou 510632 (China)
2011-01-15
Novel near infrared (NIR) phosphors Ca{sub x}Sr{sub 1-x}S:Ce{sup 3+},Nd{sup 3+} were synthesized by a solid state reaction. The NIR emission was realized through an efficient absorption by the allowed 4f-5d transition of Ce{sup 3+} and efficient energy transfer to Nd{sup 3+} via well-matched energy levels. Ce{sup 3+} and Nd{sup 3+} content in CaS/SrS was optimized. It was found that CaS:Ce{sup 3+},Nd{sup 3+} gave much stronger NIR emission than that of SrS:Ce{sup 3+},Nd{sup 3+}. Further studies on Ca{sub x}Sr{sub 1-x}S:Ce{sup 3+},Nd{sup 3+} indicated that both visible emission of Ce{sup 3+} and NIR emission of Nd{sup 3+} were observably affected by Ca/Sr ratio. The energy transfer efficiency, which can be estimated from fluorescence lifetime of Ce{sup 3+}, increased from 52% to 74% for the Ca{sub x}Sr{sub 1-x}S:Ce{sup 3+},Nd{sup 3+} (x=0 to 1) series, accompanied with a shift of maximal emission wavelength of Ce{sup 3+} from 482 to 505 nm. The results showed that overlap between emission spectrum of Ce{sup 3+} and excitation spectrum of Nd{sup 3+} plays an important role in the energy transfer efficiency, and Ce{sup 3+} emitting in green or blue-greenish region sensitized the Nd{sup 3+} NIR fluorescence emission more efficiently than that in blue region.
International Nuclear Information System (INIS)
Nkoma, J.S.; Ekosse, G.
1998-05-01
The X-ray Diffraction (XRD) technique is applied to study five samples of Cu-Ni orebodies, and it is shown that they contain chalcopyrite CuFeS 2 as the source of Cu, pentlandite (Fe,Ni) 9 S 8 as the source of Ni and pyrrhotite Fe 1-x S as a dominant compound. There are also other less dominant compounds such as bunsenite NiO, chalcocite Cu 2 S, penrosite (Ni, Cu)Se 2 and magnetite Fe 3 O 4 . Using the obtained XRD data, we obtain the lattice parameters for tetragonal chalcopyrite as a=b=5.3069A and c=10.3836A, cubic pentlandite as a=b=c=10.0487A, and hexagonal pyrrhotite as a=b=6.8820A and c=22.8037A. (author)
Dependence of photocatalytic activity of Zn.sub.x./sub.Cd.sub.1-x./sub.S quantum dot composition
Czech Academy of Sciences Publication Activity Database
Hospodková, Alice; Svoboda, L.; Praus, P.
2015-01-01
Roč. 36, č. 3 (2015), s. 328-335 ISSN 0253-9837 Institutional support: RVO:68378271 Keywords : quantum dot * Zn x Cd 1-x S * photocatalysis * quantum level Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.628, year: 2015
Transition to intermediate valence state and x-ray photoemission in Sm/sub 1-x/Gd/sub x/S
International Nuclear Information System (INIS)
Campagna, M.; Chui, S.T.; Wertheim, G.K.; Tosatti, E.
1976-01-01
We report a systematic x-ray photoemission study of the alloys Sm 1 /sub -//subx/Gd/subx/S for 0 2+ → Sm 3+ photoemission line shape using a model which has some similarities with the Jaccarino-Walker model for magnetic alloys. It assumes the existence of only two different kinds of Sm 2+ ions in Sm 1 /sub -//subx/Gd/subx/S for x approximately-less-than 16%. We discuss possible reasons for the fact that Gd does not show the usual clustering effects known to occur in many substitutional rare-earth alloys. Lattice-constant measurements for various substituents further illustrate the importance of electronic effects in the phase transition
Comeaux, James A; Jauchem, James R; Cox, D Duane; Crane, Carrie C; D'Andrea, John A
2013-07-01
Conducted energy weapons (CEWs) (including the Advanced TASER(®) X26 model produced by TASER International, Inc.) incapacitate individuals by causing muscle contractions. In this study using anesthetized swine, the potential incapacitating effect of primarily monophasic, 19-Hz voltage imposed by the commercial CEW was compared with the effect of voltages imposed by a laboratory device that created 40-Hz square waves. Forces of muscle contraction were measured with the use of strain gauges. Stimulation with 40-Hz square waves required less pulse energy than stimulation with the commercial CEW to produce similar muscle contraction. The square-pulse stimulation, at the higher repetition rate, caused a more complete tetanus at a lower energy. Use of such a simple shape of waveform may be used to make future nonlethal weapon devices more efficient. © 2013 American Academy of Forensic Sciences Published 2013. This article is a U.S. Government work and is in the public domain in the U.S.A.
4p-5s transitions in YVII, VIII, ZrVIII, IX, NbIX, X and MoX, XI
International Nuclear Information System (INIS)
Rahimullah, K.; Chaghtai, M.S.Z.; Khatoon, S.
1976-01-01
The spectra of Y VII, VIII, Zr VIII, IX, Nb X and Mo X, XI are studied for the first time and the 1971 analysis of Nb IX is improved. By analyses of the transitions 4s 2 4psup(k)-4s 2 4psup(k-1)5s all the levels of the configurations 4p 3 , 4p 2 5s, 4p 2 and 4p5s are established in the spectra concerned. (Auth.)
First-principles study of electronic properties of FeSe{sub 1-x}S{sub x} alloys
Energy Technology Data Exchange (ETDEWEB)
Kumar, Sandeep, E-mail: sandeep@phy.iitb.ac.in; Singh, Prabhakar P. [Department of Physics, Indian Institute of Technology-Bombay, Mumbai-400076 (India)
2016-05-06
We have studied the electronic and superconducting properties of FeSe{sub 1-x}S{sub x} (x = 0.0, 0.04) alloys by first-principles calculations using the Korringa-Kohn-Rostoker Atomic Sphere Approximation within the coherent potential approximation (KKR-ASA-CPA). The electronic structure calculations show the ground states of S-doped FeSe to be nonmagnetic. We present the results of our unpolarized calculations for these alloys in terms of density of states (DOS), band structures, Fermi surfaces and the superconducting transition temperature of FeSe and FeSe{sub 0.96}S{sub 0.04} alloys. We find that the substitution of S at Se site into FeSe exhibit the subtle changes in the electronic structure with respect to the parent FeSe. We have also estimated bare Sommerfeld constant (γ{sub b}), electron-phonon coupling constant (λ) and the superconducting transition temperature (T{sub c}) for these alloys, which were found to be in good agreement with experiments.
Low temperature gaseous nitriding of Ni based superalloys
DEFF Research Database (Denmark)
Eliasen, K. M.; Christiansen, Thomas Lundin; Somers, Marcel A. J.
2010-01-01
In the present work the nitriding response of selected Ni based superalloys at low temperatures is addressed. The alloys investigated are nimonic series nos. 80, 90, 95 and 100 and nichrome (Ni/Cr......In the present work the nitriding response of selected Ni based superalloys at low temperatures is addressed. The alloys investigated are nimonic series nos. 80, 90, 95 and 100 and nichrome (Ni/Cr...
Phase-contrast microtomography using an X-ray interferometer having a 40-μm analyzer
Momose, A.; Koyama, I.; Hamaishi, Y.; Yoshikawa, H.; Takeda, T.; Wu, J.; Itai, Y.; Takai, , K.; Uesugi, K.; Suzuki, Y.
2003-03-01
Phase-contrast X-ray tomographic experiment using a triple Laue-case (LLL) interferometer having a 40-μm lamella which was fabricated to improve spatial resolution, was carried out using undulator X-rays at SPring-8, Japan. Three-dimensional images mapping the refractive index were measured for various animal tissues. Comparing the images with those obtained in previous experiments using conventional LLL interferometers having a 1-mm lamella, improvement in the spatial resolution was demonstrated in that histological structures, such as hepatic lobules in liver and tubules in kidney, were revealed.
Energy Technology Data Exchange (ETDEWEB)
Shen Huaibin; Niu Jin Zhong; Xu Shasha; Zhou Changhua; Li Linsong [Key Laboratory for Special Functional Materials, Henan University, Kaifeng 475004 (China); Yuan Hang; Ma Lan, E-mail: malan@sz.tsinghua.edu.cn, E-mail: lsli@henu.edu.cn [Life Science Division, Graduate School at Shenzhen, Tsinghua University, Shenzhen 518055 (China)
2011-09-16
Highly photoluminescent (PL) reverse type-I ZnSe/CdSe nanocrystals (NCs) and ZnSe/CdSe/CdS/Cd{sub x}Zn{sub 1-x}S/ZnS core/multishell NCs were successfully synthesized by a phosphine-free method. By this low-cost, 'green' synthesis route, more than 10 g of high-quality ZnSe/CdSe/CdS/Cd{sub x}Zn{sub 1-x}S/ZnS NCs were synthesized in a large scale synthesis. After the overgrowth of a CdS/Cd{sub x}Zn{sub 1-x}S/ZnS multishell on ZnSe/CdSe cores, the PL quantum yields (QYs) increased from 28% to 75% along with the stability improvement. An amphiphilic oligomer was used as a surface coating agent to conduct a phase transfer experiment, core/multishell NCs were dissolved in water by such surface modification and the QYs were still kept above 70%. The as-prepared water dispersible ZnSe/CdSe/CdS/Cd{sub x}Zn{sub 1-x}S/ZnS core/multishell NCs not only have high fluorescence QYs but also are extremely stable in various physiological conditions. Furthermore, a biosensor system (lateral flow immunoassay system, LFIA) for the detection of human hepatitis B surface antigen (HBsAg) was developed by using this water-soluble core/multishell NCs as a fluorescent label and a nitrocellulose filter membrane for lateral flow. The result showed that such ZnSe/CdSe/CdS/Cd{sub x}Zn{sub 1-x}S/ZnS core/multishell NCs were excellent fluorescent labels to detect HBsAg. The sensitivity of HBsAg detection could reach as high as 0.05 ng ml{sup -1}.
International Nuclear Information System (INIS)
Savage, J.R.K.; Bhunya, S.P.
1980-01-01
The induction of chromosomal aberrations by 4.0 Gy of 250 kV X-rays in cell throughout S-phase has been investigated in untransformed diploid Syrian hamster fibroblasts. Using a method of subdividing S into catologically defined stages (on the basis of replication band patterns displayed after brome-deoxyuridine incorporation) it is shown that: (1) This dose does not perturb, measurable, the intracellular programme of synthesis at the chromosome band level, so that the cell classification criteria remain valid after radiation. (2) Mitotic delay and perturbation appears to be less for cells in very early S, but there is no evidence of a massive cell mixing of S cells. (3) S-phase is, in general, much less sensitive to aberration induction at all sub-phases than G 2 . (4) Both chromosome and chromatid-type aberrations are found in pre- S and S cells, but chromatid-types predominate in the latter at all sub-phases. (5) The frequency of chromatid-types, especially interchanges falls in eraly. (orig.)
Topological Phase Diagrams of Bulk and Monolayer TiS2−xTex
Zhu, Zhiyong
2013-02-12
With the use of ab initio calculations, the topological phase diagrams of bulk and monolayer TiS2−xTex are established. Whereas bulk TiS2−xTex shows two strong topological phases [1;(000)] and [1;(001)] for 0.44<x<0.56 and 0.56<x<1, respectively, the monolayer is topologically nontrivial for 0.48<x<0.80. Because in the latter doping range the topologically nontrivial nature survives down to a monolayer, TiS2−xTex is a unique system for studying topological phases in three and two dimensions simultaneously.
Topological Phase Diagrams of Bulk and Monolayer TiS2−xTex
Zhu, Zhiyong; Cheng, Yingchun; Schwingenschlö gl, Udo
2013-01-01
With the use of ab initio calculations, the topological phase diagrams of bulk and monolayer TiS2−xTex are established. Whereas bulk TiS2−xTex shows two strong topological phases [1;(000)] and [1;(001)] for 0.44<x<0.56 and 0.56<x<1, respectively, the monolayer is topologically nontrivial for 0.48<x<0.80. Because in the latter doping range the topologically nontrivial nature survives down to a monolayer, TiS2−xTex is a unique system for studying topological phases in three and two dimensions simultaneously.
Pickering, Michael A.; Taylor, Raymond L.; Goela, Jitendra S.; Desai, Hemant D.
1992-01-01
Subatmospheric pressure CVD processes have been developed to produce theoretically dense, highly pure, void-free and large area bulk materials, SiC, Si, ZnSe, ZnS and ZnS(x)Se(1-x). These materials are used for optical elements, such as mirrors, lenses and windows, over a wide spectral range from the VUV to the IR. We discuss the effect of CVD process conditions on the microstructure and properties of these materials, with emphasis on optical performance. In addition, we discuss the effect of chemical composition on the properties of the composite material ZnS(x)Se(1-x). We first present a general overview of the bulk CVD process and the relationship between process conditions, such as temperature, pressure, reactant gas concentration and growth rate, and the microstructure, morphology and properties of CVD-grown materials. Then we discuss specific results for CVD-grown SiC, Si, ZnSe, ZnS and ZnS(x)Se(1-x).
X-RAY DETECTION OF THE CLUSTER CONTAINING THE CEPHEID S MUS
Energy Technology Data Exchange (ETDEWEB)
Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan [Smithsonian Astrophysical Observatory, MS 4, 60 Garden Street, Cambridge, MA 02138 (United States); Guinan, Edward; Engle, Scott [Department of Astronomy and Astrophysics, Villanova University, 800 Lancaster Avenue, Villanova, PA 19085 (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Schaefer, Gail H., E-mail: nevans@cfa.harvard.edu [The CHARA Array of Georgia State University, Mount Wilson, CA 91023 (United States)
2014-04-20
The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J – K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator.
X-Ray Detection of the Cluster Containing the Cepheid S Mus
Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan
2014-04-01
The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J - K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator.
X-RAY DETECTION OF THE CLUSTER CONTAINING THE CEPHEID S MUS
International Nuclear Information System (INIS)
Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.
2014-01-01
The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J – K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator
Chen, Yu Ming; Li, Zhen; Lou, Xiong Wen David
2015-09-01
A simple and versatile method for general synthesis of uniform one-dimensional (1D) M(x)Co(3-x)S4 (M=Ni, Mn, Zn) hollow tubular structures (HTSs), using soft polymeric nanofibers as a template, is described. Fibrous core-shell polymer@M-Co acetate hydroxide precursors with a controllable molar ratio of M/Co are first prepared, followed by a sulfidation process to obtain core-shell polymer@M(x)Co(3-x)S4 composite nanofibers. The as-made M(x)Co(3-x)S4 HTSs have a high surface area and exhibit exceptional electrochemical performance as electrode materials for hybrid supercapacitors. For example, the MnCo2S4 HTS electrode can deliver specific capacitance of 1094 F g(-1) at 10 A g(-1), and the cycling stability is remarkable, with only about 6% loss over 20,000 cycles. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Magnetic and thermophysical properties of Gd(X)Mn(1-X)S solid solutions.
Aplesnin, S S; Romanova, O B; Gorev, M V; Velikanov, D A; Gamzatov, A G; Aliev, A M
2013-01-16
The structural, magnetic, and thermophysical properties of cation-substituted sulfides Gd(X)Mn(1-X)S (0.04 ≤ X ≤ 0.25) with the NaCl-type face-centered cubic lattice have been investigated. The range of existence of long-range antiferromagnetic order has been established. The anomalies observed in the temperature dependence of the specific heat correspond to the temperatures of the magnetic phase transition. The anomaly in the specific heat caused by electron transitions between the 4f levels and d band states has been observed. It has been found that the coefficient of thermal expansion decreases with increasing concentration of substituents in the magnetically ordered region and remains nearly invariable in the paramagnetic phase.
Samee, M. A.; Ahmmad, Shaikh Kareem; Taqiullah, Sair. Md.; Edukondalu, A.; Bale, Shashidhar; Rahman, Syed
So far only a handful of publications have been concerned with the study of the mixed alkali effect in borate glasses containing three types of alkali ions. In the present work, the mixed alkali effect (MAE) has been investigated in the glass system (40-x) K2O-x Li2O -10Na2O-50B2O3.(0≤x≤40 mol%) through density and modulated DSC studies. The density and glass transition temperature of the present glasses varies non-linearly exhibiting mixed alkali effect. We report the mixed alkali effect in the present glasses through optical properties. From the absorption edge studies, the various values of optical band gap (Eo) and Urbach energy (ΔE) have been evaluated. The values of Eo and ΔE show non-linear behavior with compositional parameter showing the mixed alkali effect. The band gap energy based average electronic polarizability of oxide ions αO2-(Eo), optical basicity A(Eo), and Yamashita-Kurosawa’s interaction parameter A(Eo) have been examined to check the correlations among them and bonding character. Based on good correlation among electronic polarizability of oxide ions, optical basicity and interaction parameter, the present K2O- Li2O-Na2O-B2O3 glasses are classified as normal ionic (basic) oxides.
International Nuclear Information System (INIS)
Feng Shi-Quan; Li Jun-Yu; Cheng Xin-Lu
2015-01-01
The structural, dielectric, lattice dynamical and thermodynamic properties of zinc-blende CdX (X=S, Se, Te) are studied by using a plane-wave pseudopotential method within the density-functional theory. Our calculated lattice constants and bulk modulus are compared with the published experimental and theoretical data. In addition, the Born effective charges, electronic dielectric tensors, phonon frequencies, and longitudinal optical-transverse optical splitting are calculated by the linear-response approach. Some of the characteristics of the phonon-dispersion curves for zinc-blende CdX (X=S, Se, Te) are summarized. What is more, based on the lattice dynamical properties, we investigate the thermodynamic properties of CdX (X=S, Se, Te) and analyze the temperature dependences of the Helmholtz free energy F, the internal energy E, the entropy S and the constant-volume specific heat C_v. The results show that the heat capacities for CdTe, CdSe, and CdS approach approximately to the Petit-Dulong limit 6R. (paper)
Shoubao, Gao; Guomeng, Chen; Yuzhi, Song; Qingtian, Meng; Qing, Xu
2018-01-01
In this work, the dynamics of reaction S(3P) + SH( X 2∏) → S2( X 3∑g -) + H(2S) has been investigated using quasi-classical trajectories method on a newly constructed accurate double many-body expansion potential energy surface of Song et al. [J. Phys. Chem. A 115, 5274 (2011)]. The integral cross section and the rate constant are obtained. Furthermore, the distribution reflecting vector correlation and the polarization-dependent differential cross section are investigated. The results show a decreasing behavior of the integral cross section as the increasing of the collision energy, and dominate complex forming mechanism at lower energies, as well as the stripping mechanism at higher energies. Those results indicate that the product S2 is sensitively affected by the collision energy.
77 FR 72252 - Airworthiness Directives; Reims Aviation S.A. Airplanes
2012-12-05
... material used in nose landing gear (NLG) attachment brackets which could lead to failure of the NLG bracket..., Kansas City, Missouri 64106. For information on the availability of this material at the FAA, call (816..., 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4119; fax: (816) 329-4090...
EXTraS discovery of a 1.2-s X-ray pulsar in M31
Esposito, P.; Israel, G.; Belfiore, A.; Novara, G.; Sidoli, L.; Rodriguez Castillo, G.; De Luca, A.; Tiengo, A.; Haberl, F.; Salvaterra, R.
2017-10-01
A systematic search for periodic signals in the XMM-Newton's EPIC archive carried out within the EXTraS project resulted in the discovery of a 1.2-s flux modulation in 3XMM J004301.4+413017. It is the first accreting neutron star in M31 for which the spin period has been detected. Besides this distinction, 3XMM J0043 proved to be an interesting system. Doppler shifts of the spin modulation revealed an orbital motion with period of 1.27 d and the analysis of optical data shows that, while the source is likely associated to a globular cluster, a counterpart with V ˜ 22 outside the cluster cannot be excluded. The emission of the pulsar appears rather hard (most data are described by a power law with photon index <1) and, assuming the distance to M31, the 0.3-10 keV luminosity was variable, from ˜3×10^{37} to 2×10^{38} erg/s. Based on this, we discuss two main possible scenarios for 3X J0043: a peculiar low-mass X-ray binary, perhaps similar to 4U 1822-37 or 4U 1626-67, or an intermediate-mass X-ray binary akin Her X-1.
Zhang, Wenjin; Zhou, Xinggui; Zhong, Xinhua
2012-03-19
Unlike Mn doped quantum dots (d-dots), the emission color of Cu dopant in Cu d-dots is dependent on the nature, size, and composition of host nanocrystals (NCs). The tunable Cu dopant emission has been achieved via tuning the particle size of host NCs in previous reports. In this paper, for the first time we doped Cu impurity in Zn(x)Cd(1-x)S alloyed NCs and tuned the dopant emission in the whole visible spectrum via variation of the stoichiometric ratio of Zn/Cd precursors in the host Zn(x)Cd(1-x)S alloyed NCs. A facile noninjection and low cost approach for the synthesis of Cu:Zn(x)Cd(1-x)S d-dots was reported. The optical properties and structure of the obtained Cu:Zn(x)Cd(1-x)S d-dots have been characterized by UV-vis spectroscopy, photoluminescence (PL) spectroscopy, transmission electron microscopy (TEM), and X-ray diffraction (XRD). The influences of various experimental variables, including Zn/Cd ratio, reaction temperature, and Cu dopant concentration, on the optical properties of Cu dopant emission have been systematically investigated. The as-prepared Cu:Zn(x)Cd(1-x)S d-dots did show PL emission but with quite low quantum yield (QY) (typically below 6%). With the deposition of ZnS shell around the Cu:Zn(x)Cd(1-x)S core NCs, the PL QY increased substantially with a maximum value of 65%. More importantly, the high PL QY can be preserved when the initial oil-soluble d-dots were transferred into aqueous media via ligand replacement by mercaptoundeconic acid. In addition, these d-dots have thermal stability up to 250 °C. © 2012 American Chemical Society
Czech Academy of Sciences Publication Activity Database
Babiloni, C.; Bareš, M.; Vecchio, F.; Brázdil, M.; Jurák, Pavel; Moretti, D. V.; Ubaldi, A.; Rossini, P. M.; Rektor, I.
2004-01-01
Roč. 19, č. 1 (2004), s. 1 - 11 ISSN 0953-816X Institutional research plan: CEZ:AV0Z2065902 Keywords : brain rhythms * CNV paradigm * stereo EEG Subject RIV: FH - Neurology Impact factor: 3.820, year: 2004
Stability of Cd_1_–_xZn_xO_yS_1_–_y Quaternary Alloys Assessed with First-Principles Calculations
International Nuclear Information System (INIS)
Varley, Joel B.; He, Xiaoqing; Rockett, Angus; Lordi, Vincenzo
2017-01-01
One route to decreasing the absorption in CdS buffer layers in Cu(In,Ga)Se_2 and Cu_2ZnSn(S,Se)_4 thin-film photovoltaics is by alloying. Here we use first-principles calculations based on hybrid functionals to assess the energetics and stability of quaternary Cd, Zn, O, and S (Cd_1_–_xZn_xO_yS_1_–_y) alloys within a regular solution model. Our results identify that full miscibility of most Cd_1_–_xZn_xO_yS_1_–_y compositions and even binaries like Zn(O,S) is outside typical photovoltaic processing conditions. Finally, the results suggest that the tendency for phase separation of the oxysulfides may drive the nucleation of other phases such as sulfates that have been increasingly observed in oxygenated CdS and ZnS.
International Nuclear Information System (INIS)
Diesener, H.; Helm, U.; Neumann-Cosel, P. von; Richter, A.; Schrieder, G.; Stascheck, A.; Stiller, A.; Carter, J.
2001-01-01
The 40 Ca(e,e'x; x=p,α) reaction has been measured in the giant resonance excitation region for E x ≅8-26 MeV. The present article is the first out of three describing the experiments and giving an overview of the results. Data were taken at four momentum transfers in the range q=0.26-0.66 fm -1 . Angular correlations for decay to the ground state and low-lying states of 39 K and 36 Ar could be extracted as a function of excitation energy in 40 Ca. Excitation energy spectra integrated over the particle emission angle were generated for the various resolved decay channels. Comparisons of the giant resonance cross-section distributions with results using other electromagnetic or hadronic probes have been made and good agreement is found in most cases
Electron-confinement studies on EBT-S using soft-x-ray techniques
International Nuclear Information System (INIS)
Hillis, D.L.; Haste, G.R.; Berry, L.A.
1982-08-01
Soft x-ray bremsstrahlung measurements have been performed on the ELMO Bumpy Torus (EBT-S) plasma to determine the electron temperature T/sub e/ and electron density n/sub e/ using a calibrated Si(Li) detector over a wide range of operating conditions. The purpose of this paper is to outline the necessary assumptions and essential x-ray techniques that are inherent in soft x-ray measurements in order to investigate the electron heating and confinement properties of EBT-S. In addition, by utilizing the electron density as determined by the soft x-ray measurements, the previous EBT-S confinement analyses have been extended. The steady-state plasma of EBT-S is heated by microwaves using a cw gyrotron that can operate up to power levels of 200 kW. From the soft x-ray measurements, both the electron temperature and density are found to increase at higher microwave power levels. For operation at microwave power levels of 200 kW, T/sub e/ approaches 1 keV while n/sub e/ approaches 1.2 x 10 12 cm -3 . In general, confinement properties are found to improve with increased microwave power. The data are compared with neoclassical transport scaling and the electron transport is found to be collisionless (nu/Ω < 1) as well as neoclassical
Energy Technology Data Exchange (ETDEWEB)
Choutri, H.; Ghebouli, M.A. [LMSE Laboratory, University of Bachir Ibrahimi, 34265 Bordj-Bou-Arréridj (Algeria); Ghebouli, B. [Laboratory of Surface and Interface Studies of Solid Materials, Department of Physics, Faculty of Science, Setif University 1, Setif 19000 (Algeria); Bouarissa, N., E-mail: n_bouarissa@yahoo.fr [Department of Physics, Faculty of Science, University of M' sila, 28000 M' sila (Algeria); Uçgun, E.; Ocak, H.Y. [Department of Physics, Faculty of Arts and Sciences, Dumlupinar University, Kutahya (Turkey)
2014-12-15
The structural, elastic, electronic and magnetic properties of the diluted magnetic semiconductors Mn{sub x}Ca{sub 1−x}S in the rock-salt phase have been investigated using first-principles calculations with both LDA and LDA + U functional. Features such as lattice constant, bulk modulus, elastic constants, spin-polarized band structure, total and local densities of states have been computed. We predict the values of the exchange constants and the band edge spin splitting of the valence and conduction bands. The hybridization between S-3p and Mn-3d produces small local magnetic moment on the nonmagnetic Ca and S sites. The ferromagnetism is induced due to the exchange splitting of S-3p and Mn-3d hybridized bands. The total magnetic moment per Mn of Mn{sub x}Ca{sub 1−x}S is 4.4μ{sub B} and 4.5μ{sub B} for LDA and LDA + U functional and is independent of the Mn concentration. The unfilled Mn-3d levels reduce the local magnetic moment of Mn from its free space charge value of 5μ{sub B}–4.4μ{sub B} and4.5μ{sub B} for LDA and LDA + U functional due to 3p–3d hybridization. - Highlights: • Fundamental properties of magnetic semiconductors Mn{sub x}Ca{sub 1−x}S. • Rock-salt phase of Mn{sub x}Ca{sub 1−x}S. • Magnetic properties of the diluted magnetic semiconductors Mn{sub x}Ca{sub 1−x}S. • The use of LDA + U functionals.
Development of socketed foundations for S3X5.7 posts.
2015-04-01
The objective of this study was to develop a socketed foundation for use with the S3x5.7 (S76x8.5) weak : post. The design focused on cylindrical, reinforced concrete foundations with a steel tube placed in the center for : use as the socket. The fou...
Study of half-metallic ferromagnetism and elastic properties of Cd{sub 1-x}Cr{sub x}Z (Z=S, Se)
Energy Technology Data Exchange (ETDEWEB)
Rani, Anita [Guru Nanak College for Girls, Sri Muktsar Sahib, Punjab (India); Kumar, Ranjan [Panjab University Chandigarh, Department of Physics, Chandigarh (India)
2016-12-15
We have studied the structural, electronic and magnetic properties of Cd{sub 1-x}Cr{sub x}S and Cd{sub 1-x}Cr{sub x}Se diluted magnetic semiconductors in zinc blende (B3) phase at x = 0.25, 0.125 and 0.0625. The calculations have been performed using DFT (density functional theory) as implemented in SIESTA code using LDA (local density approximation) as exchange-correlation (XC) potential. Study of band structures and DOS (density of states) shows HMF (half-metallic ferromagnetic) nature of Cd{sub 1-x}Cr{sub x}S and Cd{sub 1-x}Cr{sub x}Se alloys. The calculated values of s-d exchange constant Nα and p-d exchange constant Nβ show the magnetic behavior of these compounds. Moreover, both DMSs retain their half-metallic nature at 0.25, 0.125 and 0.0625 concentrations with 100% spin polarization at Fermi level (E{sub F}). Total magnetic moment of these compounds is due to 3d states of Cr atom and also existence of small induced magnetic moment on other non-magnetic atoms as well. HM robustness is also calculated as a function of lattice constants. (orig.)
Folded three-spin string solutions in AdS5 x S5
International Nuclear Information System (INIS)
Ryang Shijong
2004-01-01
We construct a spinning closed string solution in AdS 5 x S 5 which is folded in the radial direction and has two equal spins in AdS 5 and a spin in S 5 . The energy expression of the three-spin solution specified by the folding and winding numbers for the small S 5 spin shows a logarithmic behavior and a one-third power behavior of the large total AdS 5 spin, in the long string and in the short string located near the boundary of AdS 5 respectively. It exhibits the non-regular expansion in the 't Hooft coupling constant, while it takes the regular one when the S 5 spin becomes large. (author)
Evidence for the decay X -> psi(2S)gamma
Aaij, R.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Anderson, J.; Andreassen, R.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Balagura, V.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Bauer, Th.; Bay, A.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Benson, S.; Benton, J.; Berezhnoy, A.; Bernet, R.; Bettler, M. -O.; van Beuzekom, M.; Bien, A.; Bifani, S.; Bird, T.; Bizzeti, A.; Bjornstad, P. M.; Blake, T.; Blanc, F.; Blouw, J.; Blusk, S.; Bocci, V.; Bondar, A.; Bondar, N.; Bonivento, W.; Borghi, S.; Borgia, A.; Borsato, M.; Bowcock, T. J. V.; Bowen, E.; Bozzi, C.; Brambach, T.; van den Brand, J.; Bressieux, J.; Brett, D.; Britsch, M.; Britton, T.; Brook, N. H.; Brown, H.; Bursche, A.; Busetto, G.; Buytaert, J.; Cadeddu, S.; Calabrese, R.; Callot, O.; Calvi, M.; Calvo Gomez, M.; Camboni, A.; Campana, P.; Perez, D. Campora; Carbone, A.; Carboni, G.; Cardinale, R.; Cardini, A.; Carranza-Mejia, H.; Carson, L.; Carvalho Akiba, K.; Casse, G.; Cassina, L.; Garcia, L. Castillo; Cattaneo, M.; Cauet, Ch.; Cenci, R.; Charles, M.; Charpentier, Ph.; Cheung, S. -F.; Chiapolini, N.; Chrzaszcz, M.; Ciba, K.; Vidal, X. Cid; Ciezarek, G.; Clarke, P. E. L.; Clemencic, M.; Cliff, H. V.; Closier, J.; Coca, C.; Coco, V.; Cogan, J.; Cogneras, E.; Collins, P.; Comerma-Montells, A.; Contu, A.; Cook, A.; Coombes, M.; Coquereau, S.; Corti, G.; Corvo, M.; Counts, I.; Couturier, B.; Cowan, G. A.; Craik, D. C.; Cruz Torres, M.; Cunliffe, S.; Currie, R.; D'Ambrosio, C.; Dalseno, J.; David, P.; David, P. N. Y.; Davis, A.; De Bruyn, K.; De Capua, S.; De Cian, M.; De Miranda, J. M.; De Paula, L.; De Silva, W.; De Simone, P.; Decamp, D.; Deckenhoff, M.; Del Buono, L.; Deleage, N.; Derkach, D.; Deschamps, O.; Dettori, F.; Di Canto, A.; Dijkstra, H.; Donleavy, S.; Dordei, F.; Dorigo, M.; Dosil Suarez, A.; Dossett, D.; Dovbnya, A.; Dupertuis, F.; Durante, P.; Dzhelyadin, R.; Dziurda, A.; Dzyuba, A.; Easo, S.; Egede, U.; Egorychev, V.; Eidelman, S.; Eisenhardt, S.; Eitschberger, U.; Ekelhof, R.; Eklund, L.; El Rifai, I.; Elsasser, Ch.; Esen, S.; Evans, T.; Falabella, A.; Faerber, C.; Farinelli, C.; Farry, S.; Ferguson, D.; Fernandez Albor, V.; Ferreira Rodrigues, F.; Ferro-Luzzi, M.; Filippov, S.; Fiore, M.; Fiorini, M.; Firlej, M.; Fitzpatrick, C.; Fiutowski, T.; Fontana, M.; Fontanelli, F.; Forty, R.; Francisco, O.; Frank, M.; Frei, C.; Frosini, M.; Fu, J.; Furfaro, E.; Gallas Torreira, A.; Galli, D.; Gallorini, S.; Gambetta, S.; Gandelman, M.; Gandini, P.; Gao, Y.; Garofoli, J.; Tico, J. Garra; Garrido, L.; Gaspar, C.; Gauld, R.; Gavardi, L.; Gersabeck, E.; Gersabeck, M.; Gershon, T.; Ghez, Ph.; Gianelle, A.; Giani', S.; Gibson, V.; Giubega, L.; Gligorov, V. V.; Goebel, C.; Golubkov, D.; Golutvin, A.; Gomes, A.; Gordon, H.; Gotti, C.; Gandara, M. Grabalosa; Graciani Diaz, R.; Cardoso, L. A. Granado; Grauges, E.; Graziani, G.; Grecu, A.; Greening, E.; Gregson, S.; Griffith, P.; Grillo, L.; Gruenberg, O.; Gui, B.; Gushchin, E.; Guz, Yu.; Gys, T.; Hadjivasiliou, C.; Haefeli, G.; Haen, C.; Haines, S. C.; Hall, S.; Hamilton, B.; Hampson, T.; Han, X.; Hansmann-Menzemer, S.; Harnew, N.; Harnew, S. T.; Harrison, J.; Hartmann, T.; He, J.; Head, T.; Heijne, V.; Hennessy, K.; Henrard, P.; Henry, L.; Hernando Morata, J. A.; van Herwijnen, E.; Hess, M.; Hicheur, A.; Hill, D.; Hoballah, M.; Hombach, C.; Hulsbergen, W.; Hunt, P.; Hussain, N.; Hutchcroft, D.; Hynds, D.; Idzik, M.; Men, P.; Jacobsson, R.; Jaeger, A.; Jalocha, J.; Jans, E.; Jaton, P.; Jawahery, A.; Jezabek, M.; Jing, F.; John, M.; Johnson, D.; Jones, C. R.; Joram, C.; Jost, B.; Jurik, N.; Kaballo, M.; Kandybei, S.; Kanso, W.; Karacson, M.; Karbach, T. M.; Kelsey, M.; Kenyon, I. R.; Ketel, T.; Khanii, B.; Khurewathanakul, C.; Klaver, S.; Kochebina, O.; Kolpin, M.; Komarov, I.; Koopman, R. F.; Koppenburg, P.; Korolev, M.; Kozlinskiy, A.; Kravchuk, L.; Kreplin, K.; Kreps, M.; Krocker, G.; Krokovny, P.; Kruse, F.; Kucharczyk, M.; Kudryavtsev, V.; Kurek, K.; Kvaratskheliya, T.; La Thi, V. N.; Lacarrere, D.; Lafferty, G.; Lai, A.; Lambert, D.; Lambert, R. W.; Lanciotti, E.; Lanfranchi, G.; Langenbruch, C.; Langhans, B.; Latham, T.; Lazzeroni, C.; Le Gac, R.; van Leerdam, J.; Lees, J. -P.; Lefevre, R.; Leflat, A.; Lefrancois, J.; Leo, S.; Leroy, O.; Lesiak, T.; Leverington, B.; Li, Y.; Liles, M.; Lindner, R.; Linn, C.; Lionetto, F.; Liu, B.; Liu, G.; Lohn, S.; Longstaff, I.; Lopes, J. H.; Lopez-March, N.; Lowdon, P.; Lu, H.; Lucchesi, D.; Luo, H.; Lupato, A.; Luppi, E.; Lupton, O.; Machefert, F.; Machikhiliyan, I. V.; Maciuc, F.; Maev, O.; Malde, S.; Manca, G.; Mancinelli, G.; Manzali, M.; Maratas, J.; Marchand, J. F.; Marconi, U.; Main Benito, C.; Marino, P.; Maerki, R.; Marks, J.; Martellotti, G.; Martens, A.; Sanchez, A. Martin; Martinelli, M.; Santos, D. Martinez; Vidal, F. Martinez; Martins Tostes, D.; Massafferri, A.; Matey, R.; Mathe, Z.; Matteuzzi, C.; Mazurov, A.; McCann, M.; McCarthy, J.; Mcnab, A.; McNulty, R.; McSkelly, B.; Meadows, B.; Meier, F.; Meissner, M.; Merk, M.; Milanes, D. A.; Minard, M. -N.; Molina Rodriguez, J.; Montei, S.; Moran, D.; Morandin, M.; Morawski, P.; Morda, A.; Morello, M. J.; Moron, J.; Mountain, R.; Muheim, F.; Mueller, K.; Muresan, R.; Muster, B.; Naik, P.; Nakada, T.; Nandakumar, R.; Nasteva, I.; Needham, M.; Neri, N.; Neubert, S.; Neufeld, N.; Neuner, M.; Nguyen, A. D.; Nguyen, T. D.; Nguyen-Mau, C.; Nicol, M.; Niess, V.; Niet, R.; Nikitin, N.; Nikodem, T.; Novoselov, A.; Oblakowska-Mucha, A.; Obraztsov, V.; Oggero, S.; Ogilvy, S.; Okhrimenko, O.; Oldeman, R.; Onderwater, G.; Orlandea, M.; Otalora Goicochea, J. M.; Owen, P.; Oyanguren, A.; Pal, B. K.; Palano, A.; Palombo, F.; Palutan, M.; Panman, J.; Papanestis, A.; Pappagallo, M.; Parkes, C.; Parkinson, C. J.; Passaleva, G.; Patel, G. D.; Patel, M.; Patrignani, C.; Pazos Alvarez, A.; Pearce, A.; Pellegrino, A.; Altarelli, M. Pepe; Perazzini, S.; Perez Trigo, E.; Perret, P.; Perrin-Terrin, M.; Pescatore, L.; Pesen, E.; Petridis, K.; Petrolini, A.; Picatoste Olloqui, E.; Pietrzyk, B.; Pilar, T.; Pinci, D.; Pistone, A.; Playfer, S.; Plo Casasus, M.; Polci, F.; Poluektov, A.; Polyakov, I.; Polycarpo, E.; Popov, A.; Popov, D.; Popovici, B.; Potterat, C.; Powell, A.; Prisciandaro, J.; Pritchard, A.; Prouve, C.; Pugatch, V.; Navarro, A. Puig; Punzi, G.; Qian, W. W.; Rachwal, B.; Rademacker, J. H.; Rakotomiaramanana, B.; Rama, M.; Rangel, M. S.; Raniuk, I.; Rauschmayr, N.; Raven, G.; Reichert, S.; Reid, M. M.; dos Reis, A. C.; Ricciardi, S.; Richards, A.; Rinnert, K.; Rives Molina, V.; Romero, D. A. Roa; Robbe, P.; Rodrigues, A. B.; Rodrigues, E.; Perez, P. Rodriguez; Roiser, S.; Romanovsky, V.; Romero Vidal, A.; Rotondo, M.; Rouvinet, J.; Ruf, T.; Ruffini, F.; Ruiz, H.; Ruiz Valls, P.; Sabatino, G.; Saborido Silva, J. J.; Sagidova, N.; Sail, P.; Saitta, B.; Salustino Guimaraes, V.; Sanchez Mayordomo, C.; Sanmartin Sedes, B.; Santacesaria, R.; Santamarina Rios, C.; Santovetti, E.; Sapunov, M.; Sarti, A.; Satriano, C.; Satta, A.; Savrie, M.; Savrina, D.; Schiller, M.; Schindler, H.; Schlupp, M.; Schmelling, M.; Schmidt, B.; Schneider, O.; Schopper, A.; Schune, M. -H.; Schwemmer, R.; Sciascia, B.; Sciubba, A.; Seco, M.; Semennikov, A.; Senderowska, K.; Sepp, I.; Serra, N.; Serrano, J.; Sestini, L.; Seyfert, P.; Shapkin, M.; Shapoval, I.; Shcheglov, Y.; Shears, T.; Shekhtman, L.; Shevchenko, V.; Shires, A.; Coutinho, R. Silva; Simi, G.; Sirendi, M.; Skidmore, N.; Skwarnicki, T.; Smith, N. A.; Smith, E.; Smith, E.; Smith, J.; Smith, M.; Snoek, H.; Sokoloff, M. D.; Soler, F. J. P.; Soomro, F.; Souza, D.; Souza De Paula, B.; Spaan, B.; Sparkes, A.; Spinella, F.; Spradlin, P.; Stagni, F.; Stahl, S.; Steinkamp, O.; Stenyakin, O.; Stevenson, S.; Stoica, S.; Stone, S.; Storaci, B.; Stracka, S.; Straticiuc, M.; Straumann, U.; Stroili, R.; Subbiah, V. K.; Sun, L.; Sutcliffe, W.; Swientek, K.; Swientek, S.; Syropoulos, V.; Szczekowski, M.; Szczypka, P.; Szilard, D.; Szumlak, T.; T'Jampens, S.; Teklishyn, M.; Tellarini, G.; Teodorescu, E.; Teubert, F.; Thomas, C.; Thomas, E.; van Tilburg, J.; Tisserand, V.; Tobin, M.; Tolk, S.; Tomassetti, L.; Tonelli, D.; Topp-Joergensen, S.; Torr, N.; Tournefier, E.; Tourneur, S.; Tran, M. T.; Tresch, M.; Tsaregorodtsev, A.; Tsopelas, P.; Tuning, N.; Garcia, M. Ubeda; Ukleja, A.; Ustyuzhanin, A.; Uwer, U.; Vagnoni, V.; Valenti, G.; Vallier, A.; Gomez, R. Vazquez; Vazquez Regueiro, P.; Sierra, C. Vazquez; Vecchi, S.; Velthuis, J. J.; Veltri, M.; Veneziano, G.; Vesterinen, M.; Viaud, B.; Vieira, D.; Vieites Diaz, M.; Vilasis-Cardona, X.; Vollhardt, A.; Volyanskyy, D.; Voong, D.; Vorobyev, A.; Vorobyev, V.; Voss, C.; Voss, H.; de Vries, J. A.; Waldi, R.; Wallace, C.; Wallace, R.; Walsh, J.; Wandernoth, S.; Wang, J.; Ward, D. R.; Watson, N. K.; Webber, A. D.; Websdale, D.; Whitehead, M.; Wicht, J.; Wiedner, D.; Wilkinson, G.; Williams, M. P.; Williams, M.; Wilson, F. F.; Wimberley, J.; Wishahi, J.; Wislicki, W.; Witek, M.; Wormser, G.; Wotton, S. A.; Wright, S.; Wu, S.; Wyllie, K.; Xie, Y.; Xing, Z.; Xu, Z.; Yang, Z.; Yuan, X.; Yushchenko, O.; Zangoli, M.; Zavertyaev, M.; Zhang, F.; Zhang, L.; Zhang, W. C.; Zhang, Y.; Zhelezov, A.; Zhokhov, A.; Zhong, L.; Zvyagin, A.
Evidence for the decay mode X(3872) -> psi(2S)gamma in B+ -> X(3872)K+ decays is found with a significance of 4.4 standard deviations. The analysis is based on a data sample of proton proton collisions, corresponding to an integrated luminosity of 3 fb(-1), collected with the LHCb detector, at
Whole-body X-ray scanner, TCT-700S/SORREL
International Nuclear Information System (INIS)
Abe, Katsuhide; Seki, Yasuhiro
1989-01-01
Toshiba has already marketed the top-of-the-line TCT-900S whole-body X-ray CT scanner, a standard series comprising the TCT-600S and TCT-600, and a basic scanner, the TCT-300S. Now, a new model has recently been developed, the TCT-600XT, in response to market demand for further enhanced models. The main considerations in the development of the TCT-600XT were improvements in image quality and patient throughput in order to maximize practical utility. With regard to image quality, a spatial resolution of 0.4mm has been achieved through the use of high-speed data acquisition (300 views per second) and by the adoption of Toshiba's proprietary X-ray tube/detector array shifting mechanism. In respect of patient throughput, a scan cycle of 12 seconds has been realized by shortening waiting time through the utilization of a 2 MHU X-ray tube and by the development of a high-speed reconstruction unit. In addition to the above improvements, Toshiba has developed a new recordable voice and scan system to maximize operational flexibility. (author)
D meson production and long-range azimuthal correlation in 8.16 TeV p+Pb collisions with ATLAS
Hu, Qipeng; The ATLAS collaboration
2018-01-01
Measurements of prompt charm mesons ($D^0$ and $D^*$) productions and azimuthal correlations between inclusive $D^*$ and charged particles are presented in p+Pb collisions data at 8.16 TeV collected in 2016 by ATLAS. No significant production asymmetry between forward and backward and asymmetry is observed. A finite $2\\cos(2\\Delta\\phi)$ modulation for inclusive $D^*$ is observed with a $1\\sim2\\sigma$ significance, depending on multiplicity, broadly consistent with what have been observed for light hadrons and HF muons.
Room temperature ferromagnetism in Zn{sub 1-x}Co{sub x}S thin films with wurtzite structure
Energy Technology Data Exchange (ETDEWEB)
Patel, Shiv P., E-mail: shivpoojanbhola@gmail.com [Physics Department, University of Allahabad, Allahabad 211002 (India); Pivin, J.C. [CSNSM, IN2P3-CNRS, Batiment 108, F-91405 Orsay Campus (France); Chawla, A.K.; Chandra, Ramesh [Nanoscience Laboratory, IIC, Indian Institute of Technology, Roorkee 247667 (India); Kanjilal, D. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India); Kumar, Lokendra, E-mail: lkumarau@gmail.com [Physics Department, University of Allahabad, Allahabad 211002 (India)
2011-11-15
The magnetic properties of Zn{sub 1-x}Co{sub x}S (x=0.025 and 0.05) thin films grown on {alpha}-quartz substrates at different temperatures (T{sub S}) of 200, 400 and 600 deg. C by means of pulsed laser deposition are presented. The films are crystallized with wurtzite structure. Optical absorption and transmission electron microscopy measurements indicate that Co ions are substituted to Zn on tetrahedral sites. Their magnetic response is composed of ferromagnetic and paramagnetic components of which respective strengths depend on T{sub S} and Co concentration. This behavior is interpreted as due to fluctuations in the magnetic ordering, depending on grain size and site location in grain boundaries or in crystal cores. - Highlights: > Co doped ZnS thin films have been fabricated at different substrate temperatures. > Magnetization in the films changes with changing substrate temperature. > Substitution of Co on Zn sites gives room temperature intrinsic ferromagnetism. > Magnetization in the films is composed of ferromagnetic and paramagnetic components.
Interpretation of the Raman spectra of the glassy states of SixS1−x and SixSe1−x
International Nuclear Information System (INIS)
Devi, V. Radhika; Zabidi, Noriza Ahmad; Shrivastava, Keshav N.
2013-01-01
We use the density-functional theory to make models of Si x S y and Si x Se y for the values of x,y = 1–6. The vibrational frequencies are calculated for each model. The stable clusters are selected on the basis of positive vibrational frequencies. In the case of Si x S 1−x , the values of the vibrational frequencies calculated from the first principles for Si 2 S(triangular)cluster of atoms, 364.1 cm −1 and 380.8 cm −1 , agree with the experimentally measured values of 367 cm −1 and 381 cm −1 , indicating that Si 2 S clusters occur in the glassy state of SiS. The calculated values of the vibrational frequencies of SiSe 4 (pyramidal) which agree with the experimental Raman frequencies of glassy Si x Se 1−x are 114, 166 and 361 cm −1 . The calculated values for Si 2 Se 4 (bipyramidal) which agree with the experimental data of Si x Se 1−x are 166 and 464 cm −1 . In Si 4 Se (pyramidal) the values 246 and 304 cm −1 agree with the measured values. In Si 4 Se 2 (bipyramidal), the calculated values 162, 196 and 304 cm −1 agree with the measured values. The calculated values of 473 cm −1 for Si 6 Se 2 (bipyramidal) also agree with the experimentally measured values. We thus find that pyramidal structures are present in the amorphous Si x Se 1−x glassy state. - Highlights: • A first principles calculation is performed to calculate the vibrational frequencies. • The calculated frequencies of clusters agree with measured Raman values. • The structures, bond lengths and symmetries are determined. • The importance of Jahn–Teller effect in SiS and in SiSe is clearly seen. • The clusters of SiS and SiSe are found to stabilize in different symmetries
Gan, Liyong
2014-10-21
A combination of density functional theory, an empirical model, and Monte Carlo simulations is used to shed light on the evolution of the atomic distribution in the two-dimensional semiconducting transition metal dichalcogenide alloys Mo1−xWxX2 (X = S, Se, and Te) as a function of the W concentration and temperature. Both random and ordered phases are discovered and the origin of the phase transitions is clarified. While the empirical model predicts at x = 1/3 and 2/3 ordered alloys, Monte Carlo simulations suggest that they only exist at low temperature due to a small energetic preference of Mo-X-W over Mo-X-Mo and W-X-W interactions, explaining the experimental observation of random alloy Mo1−xWxS2. Negative formation energies point to a high miscibility. Tunability of the band edges and band gaps by alteration of the W concentration gives rise to a broad range of applications.
Gan, Liyong; Zhang, Qingyun; Zhao, Yu-Jun; Cheng, Yingchun; Schwingenschlö gl, Udo
2014-01-01
A combination of density functional theory, an empirical model, and Monte Carlo simulations is used to shed light on the evolution of the atomic distribution in the two-dimensional semiconducting transition metal dichalcogenide alloys Mo1−xWxX2 (X = S, Se, and Te) as a function of the W concentration and temperature. Both random and ordered phases are discovered and the origin of the phase transitions is clarified. While the empirical model predicts at x = 1/3 and 2/3 ordered alloys, Monte Carlo simulations suggest that they only exist at low temperature due to a small energetic preference of Mo-X-W over Mo-X-Mo and W-X-W interactions, explaining the experimental observation of random alloy Mo1−xWxS2. Negative formation energies point to a high miscibility. Tunability of the band edges and band gaps by alteration of the W concentration gives rise to a broad range of applications.
Three spin string configuration in γ-Deformed AdS5xS5 background
International Nuclear Information System (INIS)
Bobev, N.; Rashkov, R.; Dimov, H.
2006-01-01
The aim of this paper is to investigate semiclassical rotating string configurations in the recently found Lunin-Maldacena background. This background is conjectured to be dual to the Leigh-Strassler β-deformation of N = 4 SYM and therefore a good laboratory for tests of the AdS/CFT correspondence beyond the well explored AdS 5 xS 5 case. We consider different multispin configurations of rotating strings by allowing the strings to move in both the AdS 5 and the deformed S 5 part of the Lunin-Maldacena background. For all of these configurations we compute the string energy in terms of the angular momenta and the string winding numbers and thus provide the possibility of reproducing our results from a computation of the anomalous dimension of the corresponding dilatation operator. This can be achieved by means of the Bethe ansatz techniques for the relevant sectors of the corresponding Yang-Mills theory. We also compare our results to those for multispin rotating strings on AdS 5 xS 5 . (authors)
Energy Technology Data Exchange (ETDEWEB)
Murphy, M. W. [DESY (Deutsches Elektronen-Synchrotron), FS-PEX, Notkestrasse 85, 22607 Hamburg (Germany); Yiu, Y. M., E-mail: yyiu@uwo.ca; Sham, T. K. [Department of Chemistry, University of Western Ontario, London, ON N6A5B7 (Canada); Ward, M. J. [Cornell High Energy Synchrotron Source (CHESS), Cornell University, Ithaca, NY 14853 (United States); Liu, L. [Institute of Functional Nano and Soft Materials (FUNSOM) and Soochow University-Western University Center for Synchrotron Radiation Research, Soochow University, Suzhou, Jiangsu, 215123 (China); Hu, Y. [Canadian Light Source, University of Saskatchewan, Saskatoon, SK S7N2V3 (Canada); Zapien, J. A. [Center Of Super-Diamond and Advanced Films (COSDAF) and Department of Physics and Materials Science, City University of Hong Kong, Hong Kong SAR (China); Liu, Yingkai [Institute of Physics and Electronic Information, Yunnan Normal University, Kunming, Yunnan, 650500 (China)
2014-11-21
The electronic structure and optical properties of a series of iso-electronic and iso-structural CdS{sub x}Se{sub 1−x} solid solution nanostructures have been investigated using X-ray absorption near edge structure, extended X-ray absorption fine structure, and X-ray excited optical luminescence at various absorption edges of Cd, S, and Se. It is found that the system exhibits compositions, with variable local structure in-between that of CdS and CdSe accompanied by tunable optical band gap between that of CdS and CdSe. Theoretical calculation using density functional theory has been carried out to elucidate the observations. It is also found that luminescence induced by X-ray excitation shows new optical channels not observed previously with laser excitation. The implications of these observations are discussed.
Energy Technology Data Exchange (ETDEWEB)
Rodriguez, Carlos Anibal [Multidisciplinary Research Institute in Science and Technology, Ineergias, University of La Serena (Chile); Sandoval-Paz, Myrna Guadalupe; Saavedra, Renato; De la Carrera, Francisco [Department of Physics, Faculty of Physical and Mathematical Sciences, University of Concepcion (Chile); Trejo-Cruz, Cuauhthemoc [Department of Physics, Faculty of Sciences, University of Biobio, Concepcion (Chile); Aragon, Luis E.; Sirena, Martin [Centro Atomico Bariloche & Instituto Balseiro, CNEA & Univ. Nac. de Cuyo, Bariloche, Rio Negro (Argentina); Delplancke, Marie-Paule [4MAT, Universite Libre de Bruxelles, Brussels (Belgium); Carrasco, Claudia [Department of Materials Engineering, Faculty of Engineering, University of Concepcion (Chile)
2016-11-15
Cd{sub 1-x}Zn{sub x}S thin films have been studied extensively as window layers for solar cell applications. However, a mismatch between the Cd{sub 1-x}Zn{sub x}S and copper-indium-gallium-selenide absorber layers increases with Zn film concentration, which reduces the device efficiency. In this work, Cd{sub 1-x}Zn{sub x}S thin films with low Zn concentrations were analyzed. The effect of the addition of different molar Zn concentrations to the reaction mixture on the growth mechanism of Cd{sub 1-x}Zn{sub x}S thin films and the influence of these mechanisms on structural, optical and morphological properties of the films has been studied. Cd{sub 1-x}Zn{sub x}S thin films were synthesized by chemical bath deposition using an ammonia-free alkaline solution. Microstructural analysis by X-ray diffraction showed that all deposited films grew with hexagonal structure and crystallite sizes decreased as the Zn concentration in the film increased. Optical measurements indicated a high optical transmission between 75% and 90% for wavelengths above the absorption edge. Band gap value increased from 2.48 eV to 2.62 eV, and the refractive index values for Cd{sub 1-x}Zn{sub x}S thin films decreased as the Zn increased. These changes in films and properties are related to a modification in growth mechanism of the Cd{sub 1-x}Zn{sub x}S thin films, with the influence of Zn(OH){sub 2} formation being more important as Zn in solution increases. (author)
Looking for answers to L-type calcium channels in the ageing brain (Commentary on Zanos et al.)
Czech Academy of Sciences Publication Activity Database
Proft, Juliane; Weiss, Norbert
2015-01-01
Roč. 42, č. 8 (2015), s. 2496-2498 ISSN 0953-816X R&D Projects: GA ČR GA15-13556S; GA MŠk 7AMB15FR015 Institutional support: RVO:61388963 Keywords : rat basal forebrain * age * neurons Subject RIV: CE - Biochemistry Impact factor: 2.975, year: 2015
Polaronic transport and thermoelectricity in Fe1 -xCoxSb2S4 (x =0 , 0.1, and 0.2)
Liu, Yu; Kang, Chang-Jong; Stavitski, Eli; Du, Qianheng; Attenkofer, Klaus; Kotliar, G.; Petrovic, C.
2018-04-01
We report a study of Co-doped berthierite Fe1 -xCoxSb2S4 (x =0 , 0.1, and 0.2). The alloy series of Fe1 -xCoxSb2S4 crystallize in an orthorhombic structure with the Pnma space group, similar to FeSb2, and show semiconducting behavior. The large discrepancy between activation energy for conductivity, Eρ (146 ˜270 meV ), and thermopower, ES (47 ˜108 meV ), indicates the polaronic transport mechanism. Bulk magnetization and heat-capacity measurements of pure FeSb2S4 (x =0 ) exhibit a broad antiferromagnetic transition (TN=46 K ) followed by an additional weak transition (T*=50 K ). Transition temperatures (TN and T*) slightly decrease with increasing Co content x . This is also reflected in the thermal conductivity measurement, indicating strong spin-lattice coupling. Fe1 -xCoxSb2S4 shows relatively high value of thermopower (up to ˜624 μ V K-1 at 300 K) and thermal conductivity much lower when compared to FeSb2, a feature desired for potential applications based on FeSb2 materials.
C-X neutral spectra from ZT-40M
International Nuclear Information System (INIS)
Munson, C.; Carolan, P.G.; Bunting, C.A.
1988-01-01
A series of experiments have recently been completed on the ZT-40M Reversed Field Pinch at Los Alamos for which Neutral Charge Exchange (C-X) spectra have been measured using both the previously reported Time-of-Flight (TOF) system, and a 5 channel electrostatic Neutral Particle Analyzer (NPA). The experiments involved measurements of ion and electron temperatures for a variety of discharge conditions including scans of flat-top current levels, different values of the toroidal field reversal parameter (F = B phi (a)/ phi >), ramped current discharges, discharges with a movable graphite paddle limiter inserted into the edge of the plasma from above, and discharges with Deuterium pellet injection. Both the TOF and NPA systems view the plasma along chords from the outside midplane, and are separated by 60 0 toroidally. Core ion temperatures are obtained by examining the asymptotic tail of the neutral particle efflux spectrum. Detailed comparisons of the neutral particle spectra obtained with these two systems for the various operating conditions will be presented
Fragile X-associated tremor/ataxia syndrome: An under-recognised cause of tremor and ataxia.
Kalus, Sarah; King, John; Lui, Elaine; Gaillard, Frank
2016-01-01
Fragile X-associated tremor/ataxia syndrome (FXTAS) is a progressive degenerative movement disorder resulting from a fragile X "premutation", defined as 55-200 CGG repeats in the 5'-untranslated region of the FMR1 gene. The FMR1 premutation occurs in 1/800 males and 1/250 females, with FXTAS affecting 40-45% of male and 8-16% of female premutation carriers over the age of 50. FXTAS typically presents with kinetic tremor and cerebellar ataxia. FXTAS has a classical imaging profile which, in concert with clinical manifestations and genetic testing, participates vitally in its diagnosis. The revised FXTAS diagnostic criteria include two major radiological features. The "MCP sign", referring to T2 hyperintensity in the middle cerebellar peduncle, has long been considered the radiological hallmark of FXTAS. Recently included as a major radiological criterion in the diagnosis of FXTAS is T2 hyperintensity in the splenium of the corpus callosum. Other imaging features of FXTAS include T2 hyperintensities in the pons, insula and periventricular white matter as well as generalised brain and cerebellar atrophy. FXTAS is an under-recognised and misdiagnosed entity. In patients with unexplained tremor, ataxia and cognitive decline, the presence of middle cerebellar peduncle and/or corpus callosum splenium hyperintensity should raise suspicion of FXTAS. Diagnosis of FXTAS has important implications not only for the patient but also, through genetic counselling and testing, for future generations. Copyright © 2015 Elsevier Ltd. All rights reserved.
Eesti-X-keele sõnastik ja grammatika / Ülle Viks
Viks, Ülle
2008-01-01
Käsitletakse kakskeelsetes sõnaraamatutes grammatilise info esitamisega seotud probleeme. Lähemalt tutvustatakse Eesti-X-keele sõnastikku (universaalne leksikaal-grammatiline andmebaas, mis võimaldab genereerida suvalise kakskeelse sõnaraamatu elektroonilist põhja), tema kohta sõnastike tüpoloogias ja sellest tulenevaid nõudeid
X-RAY EMISSION FROM THE WOLF-RAYET BUBBLE S 308
International Nuclear Information System (INIS)
Toalá, J. A.; Guerrero, M. A.; Chu, Y.-H.; Gruendl, R. A.; Arthur, S. J.; Smith, R. C.; Snowden, S. L.
2012-01-01
The Wolf-Rayet (WR) bubble S 308 around the WR star HD 50896 is one of the only two WR bubbles known to possess X-ray emission. We present XMM-Newton observations of three fields of this WR bubble that, in conjunction with an existing observation of its northwest quadrant, map most of the nebula. The X-ray emission from S 308 displays a limb-brightened morphology, with a central cavity ∼22' in size and a shell thickness of ∼8'. This X-ray shell is confined by the optical shell of ionized material. The spectrum is dominated by the He-like triplets of N VI at 0.43 keV and O VII at 0.57 keV, and declines toward high energies, with a faint tail up to 1 keV. This spectrum can be described by a two-temperature optically thin plasma emission model (T 1 ∼ 1.1 × 10 6 K, T 2 ∼ 13 × 10 6 K), with a total X-ray luminosity ∼2 × 10 33 erg s –1 at the assumed distance of 1.5 kpc.
X-RAY EMISSION FROM THE WOLF-RAYET BUBBLE S 308
Energy Technology Data Exchange (ETDEWEB)
Toala, J. A.; Guerrero, M. A. [Instituto de Astrofisica de Andalucia, IAA-CSIC, Glorieta de la Astronomia s/n, 18008 Granada (Spain); Chu, Y.-H.; Gruendl, R. A. [Department of Astronomy, University of Illinois, 1002 West Green Street, Urbana, IL 61801 (United States); Arthur, S. J. [Centro de Radioastronomia y Astrofisica, Universidad Nacional Autonoma de Mexico, Campus Morelia, Apartado Postal 3-72, 58090, Morelia, Michoacan (Mexico); Smith, R. C. [NOAO/CTIO, 950 N. Cherry Avenue, Tucson, AZ 85719 (United States); Snowden, S. L., E-mail: toala@iaa.es [NASA Goddard Space Flight Center, Code 662, Greenbelt, MD 20771 (United States)
2012-08-10
The Wolf-Rayet (WR) bubble S 308 around the WR star HD 50896 is one of the only two WR bubbles known to possess X-ray emission. We present XMM-Newton observations of three fields of this WR bubble that, in conjunction with an existing observation of its northwest quadrant, map most of the nebula. The X-ray emission from S 308 displays a limb-brightened morphology, with a central cavity {approx}22' in size and a shell thickness of {approx}8'. This X-ray shell is confined by the optical shell of ionized material. The spectrum is dominated by the He-like triplets of N VI at 0.43 keV and O VII at 0.57 keV, and declines toward high energies, with a faint tail up to 1 keV. This spectrum can be described by a two-temperature optically thin plasma emission model (T{sub 1} {approx} 1.1 Multiplication-Sign 10{sup 6} K, T{sub 2} {approx} 13 Multiplication-Sign 10{sup 6} K), with a total X-ray luminosity {approx}2 Multiplication-Sign 10{sup 33} erg s{sup -1} at the assumed distance of 1.5 kpc.
Influence of CdCl{sub 2} activation treatment on ultra-thin Cd{sub 1−x}Zn{sub x}S/CdTe solar cells
Energy Technology Data Exchange (ETDEWEB)
Clayton, A.J., E-mail: a.clayton@glyndwr.ac.uk [Centre for Solar Energy Research, Glyndŵr University, OpTIC, St. Asaph LL17 0JD (United Kingdom); Baker, M.A.; Babar, S. [Faculty of Engineering & Physical Sciences, University of Surrey, Guildford GU2 7XH (United Kingdom); Gibson, P.N. [Institute for Health & Consumer Protection, Joint Research Centre, 21020 Ispra, VA (Italy); Irvine, S.J.C.; Kartopu, G.; Lamb, D.A.; Barrioz, V. [Centre for Solar Energy Research, Glyndŵr University, OpTIC, St. Asaph LL17 0JD (United Kingdom)
2015-09-01
Ultra-thin CdTe photovoltaic solar cells with an absorber thickness of 0.5 μm were produced by metal organic chemical vapour deposition onto indium tin oxide coated boroaluminosilicate glass. A wide band gap Cd{sub 1−x}Zn{sub x}S alloy window layer was employed to improve spectral response in the blue region of the solar spectrum. X-ray photoelectron spectroscopy, X-ray diffraction and scanning electron microscopy were used to monitor changes in the chemical composition and microstructure of the Cd{sub 1−x}Zn{sub x}S/CdTe solar cell after varying the post-deposition CdCl{sub 2} activation treatment time and annealing temperature. The CdCl{sub 2} treatment leached Zn from the Cd{sub 1−x}Zn{sub x}S layer causing a redshift in the spectral response onset of window absorption. S diffusion occurred across the Cd{sub 1−x}Zn{sub x}S/CdTe interface, which was more pronounced as the CdCl{sub 2} treatment was increased. A CdTe{sub 1−y}S{sub y} alloy was formed at the interface, which thickened with CdCl{sub 2} treatment time. Small concentrations of S (up to 2 at.%) were observed throughout the CdTe layer as the degree of CdCl{sub 2} treatment was increased. Greater S diffusion across the Cd{sub 1−x}Zn{sub x}S/CdTe interface caused the device open-circuit voltage (V{sub oc}) to increase. The higher V{sub oc} is attributed to enhanced strain relaxation and associated reduction of defects in the interface region as well as the increase in CdTe grain size. - Highlights: • Increased CdCl{sub 2} activation treatment resulted in loss of Zn from Cd{sub 1−x}Zn{sub x}S. • Sulphur diffusion into CdTe was enhanced with greater CdCl{sub 2} activation treatment. • Improvement to V{sub oc} correlated with increased sulphur diffusion into CdTe.
Pruzanski, Waldemar; Kopilov, Julia; Kuksis, Arnis
2016-01-01
Mitogenesis of Vascular Smooth Muscle Cells (VSMC) plays an important role in atherogenesis. Until recently, the effect of lipid subfractions has not been clarified. Secretory phospholipases A2 (sPLA2's) hydrolyse glycerophospholipids and release pro-inflammatory lyso-lipids, oxidized and non-oxidized fatty acids and isoprostanes. They localize in the vascular wall. We hypothesized that structurally similar sPLA2's may exert different impact on VSMC. The influence of sPLA2's, IIA, V, X, HDL, LDL, and hydrolysis products was tested on mitogenesis of VSMC, i.e., the early effect on the cell membrane phospholipids, and on PGE2 and LTB4 release, i.e., late effect of Cyclooxygenase and 5-lipooxygenase activity in VSMC. Mitogenesis was significantly enhanced by HDL and LDL, and by products of sPLA2 hydrolysis. Hydrolysis of HDL or LDL enhanced mitogenic activity in order V>X>IIA. The release of PGE2 was enhanced by group X sPLA2 and by HDL hydrolyzed by groups V and X. LDL and its hydrolysis products enhanced the release of PGE2 in order X>V>IIA. The release of LTB4 was markedly increased by LDL and HDL, and by hydrolytic products of group V and X, but not group IIA sPLA2. Our study demonstrates a diverse interaction of pro-inflammatory sPLA2's with HDL and LDL affecting both mitogenesis and eicosanoid release from VSMC, therefore potentially enhancing their pro-atherogenic activity. Copyright © 2015 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Isik, Mehmet, E-mail: mehmet.isik@atilim.edu.tr [Department of Electrical and Electronics Engineering, Atilim University, 06836, Ankara (Turkey); Gasanly, Nizami [Department of Physics, Middle East Technical University, 06800, Ankara (Turkey); Virtual International Scientific Research Centre, Baku State University, 1148, Baku (Azerbaijan)
2017-04-01
Transmission and reflection measurements on GaS{sub x}Se{sub 1−x} mixed crystals (0 ≤ x ≤ 1) were carried out in the 400–1000 nm spectral range. Band gap energies of the studied crystals were obtained using the derivative spectra of transmittance and reflectance. The compositional dependence of band gap energy revealed that as sulfur (selenium) composition is increased (decreased) in the mixed crystals, band gap energy increases quadratically from 1.99 eV (GaSe) to 2.55 eV (GaS). Spectral dependencies of refractive indices of the mixed crystals were plotted using the reflectance spectra. It was observed that refractive index decreases nearly in a linear behavior with increasing band gap energy for GaS{sub x}Se{sub 1−x} mixed crystals. Moreover, the composition ratio of the mixed crystals was obtained from the energy dispersive spectroscopy measurements. The atomic compositions of the studied crystals are well-matched with composition x increasing from 0 to 1 by intervals of 0.25. - Highlights: • Transmission and reflection experiments were performed on GaS{sub x}Se{sub 1−x} mixed crystals. • Derivative spectra of transmittance and reflectance were used for analyses. • Compositional dependence of band gap energy and refractive index were reported.
International Nuclear Information System (INIS)
Poestges, A.; Naoumidis, A.; Nickel, H.
1979-04-01
On three nickel-base-alloys (NIMONIC 80A, INCONNEL 617 and ALLOY 713LC), which are planned as materials for components of the primary cooling circuit of high-temperature reactors, studies for the determination of the oxidation behaviour under reactor relevant conditions were performed. The test conditions were fixed at an oxygen partial pressure of 10 -16 bars with a total pressure of 0,2 bars and a temperature of 1080 0 C. The use of the X-ray diffraction analysis on the oxidised samples of type NIMONIC 80A showed the corrosion products Cr 2 O 3 , TiO 2 and Cr 2 Ti 2 O 7 in the outer oxide coating as well as Al 2 O 3 in the inner oxide zone. The samples of the alloy type INCOEL 617 showed the oxides Cr 2 O 3 and Cr 2 Ti 2 O 7 in the outer oxide coating. Samples of the alloy ALLOY 713LC showed Cr 2 O 3 and CrNbO 4 in the outer oxide coating and Al 2 O 3 in the zone of inner oxidation. Sufficient detection certainty was only ascertained by investigating samples with plane surface. For both alloys first mentioned, it was possible to prove the validity of the paralinear relationship W = k x t -1 / 2 - a x t for the increase in weight for the explanation of the time law of the oxidation. For the non-destructive determination of the oxide coating thickness on the alloys samples, the X-ray fluorescence analysis gave reproducible results of good precision. (orig.) [de
Transfer matrix approach to electron transport in monolayer MoS2/MoO x heterostructures
Li, Gen
2018-05-01
Oxygen plasma treatment can introduce oxidation into monolayer MoS2 to transfer MoS2 into MoO x , causing the formation of MoS2/MoO x heterostructures. We find the MoS2/MoO x heterostructures have the similar geometry compared with GaAs/Ga1‑x Al x As semiconductor superlattice. Thus, We employ the established transfer matrix method to analyse the electron transport in the MoS2/MoO x heterostructures with double-well and step-well geometries. We also considere the coupling between transverse and longitudinal kinetic energy because the electron effective mass changes spatially in the MoS2/MoO x heterostructures. We find the resonant peaks show red shift with the increasing of transverse momentum, which is similar to the previous work studying the transverse-momentum-dependent transmission in GaAs/Ga1‑x Al x As double-barrier structure. We find electric field can enhance the magnitude of peaks and intensify the coupling between longitudinal and transverse momentums. Moreover, higher bias is applied to optimize resonant tunnelling condition to show negative differential effect can be observed in the MoS2/MoO x system.
Directory of Open Access Journals (Sweden)
José Luis Ramírez Castro
2000-03-01
Full Text Available One out of 400 to 500 living newborns show sex chromosome abnormalities. Usually, the clinic characteristics due to alteration of those chromosomes are less severe than those produced by autosomic imbalance. This tolerance of the developing fetus to the excess or deficit in the X chromosome material, may be due, at least in part, to the presence of compensatory mechanisms related with the inactivation or not of the genetic material. Turner’s syndrome is characterized by short stature, primary amenorrea, streak gonads and poor development of secondary sexual characteristics. At birth lymphedema of the dorsal surface of the hands and feet is common, but usually it disappears during lactation. Mental retardation is not a finding of this syndrome, however space-form perceptional deficits are described. All these manifestations of the syndrome have a close relation with the cytogenetic findings. The purpose of this paper is to describe the clinical manifestations and an uncommon X ring chromosome mosaicism in patients with Turner syndrome-like characteristics tended in the Medical Genetics Unit of the Medical School – Antioquia University. Clinical and cytogenetics aspects in these patients are discussed. Uno de cada 400 a 500 recién nacidos vivos presenta anormalidades de los cromosomas sexuales. En términos generales, las manifestaciones clínicas por dicha alteración son más leves que las producidas por imbalance autosómico. Posiblemente esta tolerancia del feto en desarrollo al exceso o deficiencia del material presente en el cromosoma X, se debe, por lo menos en parte, a la presencia de mecanismos compensadores mediante los cuales dicho material puede ser o no inactivado (1. Las mujeres con síndrome de Turner presentan baja estatura, amenorrea primaria, tórax amplio, poco desarrollo mamario y además ovarios rudimentarios. Al nacer se destaca el edema de manos y pies, el cual desaparece durante la lactancia. No existe un retardo
Energy Technology Data Exchange (ETDEWEB)
Alvarez-Serrano, I; Lopez, M L; Pico, C; RodrIguez, E; Veiga, M L [Departamento de Quimica Inorganica I, Facultad de Ciencias Quimicas, Universidad Complutense, 28040 Madrid (Spain); Cuello, G J [Institut Max von Laue-Paul Langevin (ILL), 38042 Grenoble Cedex 9 (France); Jimenez-Lopez, A; RodrIguez-Castellon, E [Departamento de Quimica Inorganica, CristalografIa y MineralogIa, Facultad de Ciencias, Universidad de Malaga, 29071 Malaga (Spain)], E-mail: marisal@quim.ucm.es
2008-10-07
Perovskite-type cobaltites LaCo{sub 1-x}Ti{sub x}O{sub 3} (0 {<=} x {<=} 0.5) synthesized by the liquid mix technique were characterized by x-ray diffraction, neutron diffraction, XPS, magnetic susceptibility and magnetization versus magnetic field measurements. Structural symmetry changes from rhombohedral (S.G. R 3-bar c) for 0.05 {<=} x {<=} 0.20 to orthorhombic (S.G. Pbnm) for 0.25 {<=} x {<=} 0.40. The bond distances dependence on the composition, x, has been analysed from x-ray and neutron diffraction data. Both the structural and the spectroscopic (from XPS) results suggest that Ti{sup 4+} substitution implies the stabilization of low-spin Co{sup III} ions and the evolution of magnetic moments in the paramagnetic zone is also coherent with this assumption. For small values of x both FM responses and the absence of saturation in the M versus H curves at 2 K are interpreted in terms of a magnetic frustration. For x > 0.25 the cobalt cations seem to stabilize as Co{sup III} (rather than Co{sup 3+}) coexisting with Co{sup 2+}. In these more substituted perovskites, AFM Co{sup 2+}-O-Co{sup 2+} interactions become predominant, leading to a well established AFM ordering for x = 0.4 and 0.5.
Temperature dependence of dark current of pSi-n(Si2)1-x(CdS)x structures
International Nuclear Information System (INIS)
Usmonov, Sh.N.
2007-01-01
Full text: The research of influence of isovalent impurity on electric and photo-electric properties of semiconductors where formative with semiconductor continuous solid solutions (CSS) of substitution presents both the fundamental and the applied application interest at the area of material science and photoelectrical properties of semiconductors. In the given work results of experimental researches (Si 2 ) 1-x (CdS) x epitaxial layers grown on c-Si substrates by a method liquid phase epitaxy are presented. The grown layers had thickness and ∼ 10 micron, n-type of conductivity with specific resistance 0,016 Ohm sm. Dependences of the dark current of pSi-n(Si 2 ) 1-x (CdS) x structures have been investigated at various values of a bias voltage. In experiment it was observed anomaly dependence of current. The current with arising of temperature begun monotonously aroused and reached some minimal value at temperature 100 C and then again starts to arise up to temperature 200 C. Arising of dark current is caused of the band-to-band thermal generation of electron-hole pairs. The voltage drop at the temperature 100 C is caused by the recharging of impurity atoms CdS. It is known, that width of the forbidden band of CdS Eg,CdS=2,48 eV more than Eg,Si=1,1 eV. Covalent bond of atoms CdS is stronger than Si-Si bond. However, when the molecule of CdS replaces two atoms of silicon in tetrahedral lattice of silicon the bonds of Cd-S become weak under influence of surrounding atoms of silicon. It causes to occurrence impurity level CdS located on Ei=1,2 eV below a valence band top of silicon. The generation of electron-hole pairs with participation of CdS impurities at the 100 C temperature is occurred under action thermal phonons. However, holes formed on impurity levels are localized and they will be recombination centers. Therefore drop of the dark current caused by dispersion of carriers on impurity centers. (authors)
Factorized tree-level scattering in AdS4 x CP3
International Nuclear Information System (INIS)
Kalousios, Chrysostomos; Vergu, C.; Volovich, Anastasia
2009-01-01
AdS 4 /CFT 3 duality relating IIA string theory on AdS 4 x CP 3 to N = 6 superconformal Chern-Simons theory provides an arena for studying aspects of integrability in a new potentially exactly solvable system. In this paper we explore the tree-level worldsheet scattering for strings on AdS 4 x CP 3 . We compute all bosonic four-, five- and six-point amplitudes in the gauge-fixed action and demonstrate the absence of particle production.
Radiation damage in SmS, SmSsub(1-x)Psub(x) and SmB6
International Nuclear Information System (INIS)
Morillo, J.; Bordier, G.; de Novion, C.H.; Senateur, J.P.; Jun, J.
1984-08-01
Large conductivity increases under 21 K electron or neutron irradiations are observed in SmS and SmSsub(1-x)Psub(x). It is shown that they are related to Sm defects. A possible mechanism is 4f electron delocalization around radiation defects. In SmB 6 , the low temperature resistivity increase desappears under 21 K irradiation. The thermal stability of the defects is also investigated up to room temperature
M = Mo, W; X = S, Se, Te) heterostructures
Zhang, Qingyun
2018-04-16
Using first-principles calculations, we investigate the electronic properties of the two-dimensional GaX/MX2 (M = Mo, W; X = S, Se, Te) heterostructures. Orbital hybridization between GaX and MX2 is found to result in Rashba splitting at the valence-band edge around the Γ point, which grows for increasing strength of the spin-orbit coupling in the p orbitals of the chalcogenide atoms. The location of the valence-band maximum in the Brillouin zone can be tuned by strain and application of an out-of-plane electric field. The coexistence of Rashba splitting (in-plane spin direction) and band splitting at the K and K′ valleys (out-of-plane spin direction) makes GaX/MX2 heterostructures interesting for spintronics and valleytronics. They are promising candidates for two-dimensional spin-field-effect transistors and spin-valley Hall effect devices. Our findings shed light on the spin-valley coupling in van der Waals heterostructures.
Energy Technology Data Exchange (ETDEWEB)
Carreón-Moncada, I. [Centro de Investigación y de Estudios Avanzados del IPN, Unidad Saltillo, Av. Industria Metalúrgica 1062, CP. 25900, Ramos Arizpe, Coah., México (Mexico); González, L.A., E-mail: luis.gonzalez@cinvestav.edu.mx [Centro de Investigación y de Estudios Avanzados del IPN, Unidad Saltillo, Av. Industria Metalúrgica 1062, CP. 25900, Ramos Arizpe, Coah., México (Mexico); Pech-Canul, M.I. [Centro de Investigación y de Estudios Avanzados del IPN, Unidad Saltillo, Av. Industria Metalúrgica 1062, CP. 25900, Ramos Arizpe, Coah., México (Mexico); Ramírez-Bon, R. [Centro de Investigación y de Estudios Avanzados del IPN, Unidad Querétaro, Apartado Postal 1-798, CP. 76001 Querétaro, Qro., México (Mexico)
2013-12-02
Cd{sub 1−x}Zn{sub x}S films with low Zn content were obtained on glass substrates by an ammonia-free chemical bath deposition process. Alkaline reaction solutions were prepared using cadmium chloride, zinc chloride, sodium citrate, thiourea and potassium hydroxide. As a result of varying the mixture ratio between Cd and Zn precursors, microstructural studies from X-ray diffraction reveal that the resulting films have hexagonal, wurzite type, crystalline structure with changes in the preferential growth orientation. Important changes on the surface morphology and thickness of the Cd{sub 1−x}Zn{sub x}S films were also observed as effects of adding Zn to the CdS lattice. Optical studies show that Cd{sub 1−x}Zn{sub x}S thin films with energy band gaps in the range from 2.48 to 2.65 eV were obtained. - Highlights: • Cd{sub 1−x}Zn{sub x}S layers were grown on glass by ammonia-free chemical bath deposition • Films with low Zn content were obtained using reaction solutions with pH11.5 • Zn addition produced changes on the orientation growth and morphology of the films • Cd{sub 1−x}Zn{sub x}S films have energy band gap values from 2.48 to 2.65 eV.
Superparticle and superstring in AdS3 x S3 Ramond--Ramond background in the light-cone gauge
International Nuclear Information System (INIS)
Metsaev, R. R.; Tseytlin, A. A.
2001-01-01
We discuss superparticle and superstring dynamics in AdS 3 x S 3 supported by R--R 3-form background using light-cone gauge approach. Starting with the superalgebra psu(1,1|2)(circle plus)psu (1,1|2) representing the basic symmetry of this background we find the light-cone superparticle Hamiltonian. We determine the harmonic decomposition of light-cone superfield describing fluctuations of type IIB supergravity fields expanded near AdS 3 x S 3 background and thus the corresponding Kaluza--Klein spectrum. We fix the fermionic and bosonic light-cone gauges in the covariant Green--Schwarz AdS 3 x S 3 superstring action and find the corresponding light-cone string Hamiltonian. We also obtain a realization of the generators of psu(1,1|2)(circle plus)psu (1,1|2) in terms of the superstring 2-d fields in the light-cone gauge
International Nuclear Information System (INIS)
Chung, Soon Cheol; Choi, Do Young; Lee, Beob Yi; Lee, Bong Soo; Eom, Jin Sup; Sohn, Jin Hun
2004-01-01
This study purposed to measure the standard volume of the cerebellum of normal Koreans who were in their 20s and 40s, and we also wished to find out the difference in the volume of the cerebellum according to gender and age. This study collected MR brain images from 118 people in their 20s (males: 58, females: 60) and 100 people in their 40s (males: 41, females: 59), for a total of 218 people. For each of sagittal, coronal and axial sections, the cerebellar part of the images was segmented using automatic and manual methods, and the volume was then measured. In order to observe differences according to gender and age and also to observe the interactive effect between gender and age, a two-way ANOVA test was performed using gender (2 levels) and age (2 levels) as independent variables. The average volume of the cerebellum of Koreans in their 20s was 133.74 (cm 3 ) and that of Koreans in their 40s was 121.83 (cm 3 ). The average volume of the cerebellum of male Koreans in their 20s and 40s was 134.55 (cm 3 ) and that of female Koreans was 123.06 (cm 3 ). The volume of the cerebellum was significantly larger in Koreans in their 20s than those volumes of the cerebellum of Koreans in their 40s, and the cerebellum volumes in male Koreans were larger than those of the Korean females. Moreover, the reduction of the volume of the cerebellum with age was significantly larger in male Koreans than in the Korean females. According to the results of measuring the volume of the cerebellum for normal Koreans in their 20s and 40s, the volume was significantly different according to gender and age, and the reduction of the volume of the cerebellum with age was significantly larger in men than in women
Energy Technology Data Exchange (ETDEWEB)
Chung, Soon Cheol; Choi, Do Young; Lee, Beob Yi; Lee, Bong Soo [College of Medicine, Konkuk Univ., Chungju (Korea, Republic of); Eom, Jin Sup [Chungbuk National Univ., Chungju (Korea, Republic of); Sohn, Jin Hun [Chungnam National Univ., Daejeon (Korea, Republic of)
2004-11-01
This study purposed to measure the standard volume of the cerebellum of normal Koreans who were in their 20s and 40s, and we also wished to find out the difference in the volume of the cerebellum according to gender and age. This study collected MR brain images from 118 people in their 20s (males: 58, females: 60) and 100 people in their 40s (males: 41, females: 59), for a total of 218 people. For each of sagittal, coronal and axial sections, the cerebellar part of the images was segmented using automatic and manual methods, and the volume was then measured. In order to observe differences according to gender and age and also to observe the interactive effect between gender and age, a two-way ANOVA test was performed using gender (2 levels) and age (2 levels) as independent variables. The average volume of the cerebellum of Koreans in their 20s was 133.74 (cm{sup 3}) and that of Koreans in their 40s was 121.83 (cm{sup 3}). The average volume of the cerebellum of male Koreans in their 20s and 40s was 134.55 (cm{sup 3}) and that of female Koreans was 123.06 (cm{sup 3}). The volume of the cerebellum was significantly larger in Koreans in their 20s than those volumes of the cerebellum of Koreans in their 40s, and the cerebellum volumes in male Koreans were larger than those of the Korean females. Moreover, the reduction of the volume of the cerebellum with age was significantly larger in male Koreans than in the Korean females. According to the results of measuring the volume of the cerebellum for normal Koreans in their 20s and 40s, the volume was significantly different according to gender and age, and the reduction of the volume of the cerebellum with age was significantly larger in men than in women.
A microcontroller application as X-ray machine's high voltage controller
International Nuclear Information System (INIS)
Wiranto Budi Santoso; Beny Syawaludin
2010-01-01
A micro controller application as x-ray machine's high voltage controller has been carried out. The purpose of this micro controller application is to give an accurate high voltage supply to the x-ray tube so that the x-ray machine could produce the result as expected. The micro controller based X-ray machine's high voltage controller receives an input voltage from the keypad. This input value is displayed in the LCD (Liquid Crystal Display) screen. Then micro controller uses this input data to drive a stepper motor. The stepper motor adjusts the high voltage auto transformer's output according to the input value. The micro controller is programmed using BASCOM-8051 compiler. The test results show that the stepper motor could rotate according to an input value (author)
Three Stage Maturity Model in SME’s towards Industry 4.0
Ganzarain, Jaione; Errasti, Nekane
2016-01-01
Purpose: To address the challenges regarding the concept of Industry 4.0 and the diversification methodology and based on the strategic guidance towards Industry 4.0, we propose a process model as a guiding framework for Industry 4.0 collaborative diversification vision, strategy and action building. In this paper we suggest a stage process model to guide and train companies to identify new opportunities for diversification within Industry 4.0. Systematically carrying out the s...
Determination of s(x) and anti s(x) from a global QCD analysis
Energy Technology Data Exchange (ETDEWEB)
Zomer, F
1999-10-01
A new global QCD analysis of DIS data is presented. The {nu}Fe and {nu}-bar Fe differential cross-section data are included to constrain the strange component of the nucleon sea. As a result we found a hard strangeness at high-x and some evidence for an asymmetry between xs(x) and xs-bar(x). (author)
International Nuclear Information System (INIS)
Lu Weiwei; Song Fuxiang; Zeng Liping; Lu Hongning
2012-01-01
The 40 K radioactive of' the pressed powder sample was determined by Epsilon 5 high-energy polarized energy dispersive X ray fluorescence (EDXRF) spectrometer. The correlation coefficient of the standard curve method was 0.9910, the precision was 2.98% and the relative deviation of the measurement standard samples was up to 6.40%, which showed that the precision and accuracy of the method were also good. Simultaneous measurement of seven soil samples using this method and γ-spectrometer were carried, the results of two analytical methods were compared using a paired t-test by SPSS program, which showed that there was no significant difference in the two sets of data, P>0.05. It indicated that EDXRF could be a potential simple method for analyzing 40 K radioactive in soil samples. (authors)
Energy Technology Data Exchange (ETDEWEB)
Dejene, F.B., E-mail: dejenebf@qwa.ufs.ac.za [Department of Physics, University of the Free State, (Qwa-Qwa campus), Private Bag X-13, Phuthaditjhaba 9866 (South Africa); Onani, M.O. [Chemistry Department, University of the Western Cape, Private Bag x17, Bellville 7535 (South Africa); Koao, L.F.; Wako, A.H.; Motloung, S.V.; Yihunie, M.T. [Department of Physics, University of the Free State, (Qwa-Qwa campus), Private Bag X-13, Phuthaditjhaba 9866 (South Africa)
2016-01-01
The undoped and Mn-doped ZnO{sub (1−x)}S{sub x} nano-powders were successfully synthesized by precipitation method without using any capping agent. Its structure, morphology, elemental analysis, optical and luminescence properties were determined by scanning electron microscopy (SEM), energy-dispersive X-ray spectroscopy (EDS), UV–vis spectroscopy (UV) and photoluminescence spectroscopy (PL). A typical SEM image of the un-doped ZnO{sub (1−x)}S{sub x} nanoparticles exhibit flake like structures that changes to nearly spherical particles with Mn-doping. The XRD of undoped and Mn doped ZnO{sub (1−x)}S{sub x} pattern reveals the formation of a product indexed to the hexagonal wurtzite phase of ZnS. The nanopowders have crystallite sizes estimated from XRD measurements were in the range of 10–20 nm. All the samples showed absorption maximum of ZnO{sub (1−x)}S{sub x} at 271 nm and high transmittance in UV and visible region, respectively. The undoped ZnO{sub (1−x)}S{sub x} nanoparticles show strong room-temperature photoluminescence with four emission bands centering at 338 nm, 384 nm, 448 nm and 705 nm that may originate to the impurity of ZnO{sub (1−x)}S{sub x}, existence of oxide related defects. The calculated bandgap of the nanocrystalline ZnO{sub (1−x)}S{sub x} showed a blue-shift with respect to the Mn-doping. The PL spectra of the Mn-doped samples exhibit a strong orange emission at around 594 nm attributed to the {sup 4}T{sub 1}–{sup 6}A{sub 1} transition of the Mn{sup 2+} ions.
Model and experimental investigation of frequency conversion in AgGaGexS2(1+x) (x = 0, 1) crystals
International Nuclear Information System (INIS)
Wang Tiejun; Kang Zhihui; Zhang Hongzhi; Feng Zhishu; Jiang Yun; Gao Jinyue; Andreev, Yury M; Lanskii, Gregory V; Shaiduko, Anna V
2007-01-01
Analysis of available and developed data on phase matching in AgGaGe x S 2(1+x) (x = 0, 1) crystals is carried out. Nanosecond AgGaS 2 type I optical parametric oscillator with a continuously tunable range 2.65-5.29 μm is demonstrated pumped by a Q-switched Nd : YAG laser. An output pulse energy of up to 0.56 mJ at 4 μm is recorded. Phase matching of second harmonic generation in both crystals is represented. Best sets of Sellmeier equations for two crystals are determined
Study of high momentum eta' production in B {yields} {eta}{prime} X{sub s}
Energy Technology Data Exchange (ETDEWEB)
Aubert, B
2004-01-05
The authors measure the branching fraction for the charmless semi-inclusive process B {yields} {eta}{prime} X{sub s}, where the {eta}{prime} meson has a momentum in the range 2.0 to 2.7 GeV/c in the {Upsilon}(4S) center-of-mass frame and X{sub s} represents a system comprising a kaon and zero to four pions. They find {Beta}(B {yields} {eta}{prime} X{sub s}) = (3.9 {+-} 0.8(stat) {+-} 0.5(syst) {+-} 0.8(model)) x 10{sup -4}. They also obtain the X{sub s} mass distribution and find that it tends to favor models predicting high masses.
Energy Technology Data Exchange (ETDEWEB)
Liang Xiaojuan [College of Chemistry and Materials Engineering, Wenzhou University, Wenzhou, Zhejiang Province 325035 (China); Institute of Materials and Technology, Dalian Maritime University, Dalian 116026 (China); Zhong Jiasong; Yang Fan; Hua Wei; Jin Huaidong [College of Chemistry and Materials Engineering, Wenzhou University, Wenzhou, Zhejiang Province 325035 (China); Liu Haitao, E-mail: lht@wzu.edu.cn [College of Chemistry and Materials Engineering, Wenzhou University, Wenzhou, Zhejiang Province 325035 (China); Sun Juncai [Institute of Materials and Technology, Dalian Maritime University, Dalian 116026 (China); Xiang Weidong, E-mail: weidongxiang@yahoo.com.cn [College of Chemistry and Materials Engineering, Wenzhou University, Wenzhou, Zhejiang Province 325035 (China)
2011-05-26
Highlights: > We report for the first time a small biomolecule-assisted route using L-cysteine as sulfur source and complexing agent to synthesis CuIn{sub 0.5}Ga{sub 0.5}S{sub 2} crystals. > The possible mechanisms leading to CuIn{sub 0.5}Ga{sub 0.5}S{sub 2} flowers consisting of nanoflakes were proposed. > In addition, the morphology, structure, and phase composition of the as-prepared CuIn{sub 0.5}Ga{sub 0.5}S{sub 2} products were investigated in detail by XRD, FESEM, EDS, XPS, TEM (HRTEM) and SAED. - Abstract: CuIn{sub 1-x}Ga{sub x}S{sub 2} (x = 0.5) flowers consisting of nanoflakes were successfully prepared by a biomolecule-assisted solvothermal route at 220 deg. C for 10 h, employing copper chloride, gallium chloride, indium chloride and L-cysteine as precursors. The biomolecule L-cysteine acting as sulfur source was found to play a very important role in the formation of the final product. The diameter of the CuIn{sub 0.5}Ga{sub 0.5}S{sub 2} flowers was 1-2 {mu}m, and the thickness of the flakes was about 15 nm. The obtained products were characterized by X-ray diffraction (XRD), energy dispersion spectroscopy (EDS), X-ray photoelectron spectroscopy (XPS), field-emission scanning electron microscopy (FESEM), transmission electron microscopy (TEM), high-resolution transmission electron microscopy (HRTEM), selected area electron diffraction spectroscopy (SAED), and UV-vis absorption spectroscopy. The influences of the reaction temperature, reaction time, sulfur source and the molar ratio of Cu-to-L-cysteine (reactants) on the formation of the target compound were investigated. The formation mechanism of the CuIn{sub 0.5}Ga{sub 0.5}S{sub 2} flowers consisting of flakes was discussed.
CdS_xTe_1_-_x ternary semiconductors band gaps calculation using ground state and GW approximations
International Nuclear Information System (INIS)
Kheloufi, Nawal; Bouzid, Abderrazak
2016-01-01
We present band gap calculations of zinc-blende ternary CdS_xTe_1_-_x semiconductors within the standard DFT and quasiparticle calculations employing pseudopotential method. The DFT, the local density approximation (LDA) and the Generalized Gradient Approximation (GGA) based calculations have given very poor results compared to experimental data. The quasiparticle calculations have been investigated via the one-shot GW approximation. The present paper discuses and confirms the effect of inclusion of the semicore states in the cadmium (Cd) pseudopotential. The obtained GW quasiparticle band gap using Cd"+"2"0 pseudopotential has been improved compared to the obtained results from the available pseudopotential without the treatment of semicore states. Our DFT and quasiparticle band gap results are discussed and compared to the available theoretical calculations and experimental data. - Graphical abstract: Band gaps improvement concerning the binary and ternary alloys using the GW approximation and Cd"2"0"+ pseudopotential with others levels of approximations (the LDA and GGA approximation employing the Cd"1"2"+ and the LDA within Cd"2"0"+ pseudopotential). - Highlights: • The direct Γ- Γ and indirect Γ- X and Γ- L bands gaps show a nonlinear behavior when S content is enhanced. • The quasiparticle band gap result for the investigated semiconductors is improved using the GW approximation. • All CdS_xTe_1_-_x compounds in all compositions range from 0 to 1 are direct band gap semiconductors.
Czech Academy of Sciences Publication Activity Database
Kubec, R.; Cody, R.B.; Dane, A.J.; Musah, R.A.; Schraml, Jan; Vattekkatte, A.; Block, E.
2010-01-01
Roč. 58, č. 2 (2010), s. 1121-1128 ISSN 0021-8561 R&D Projects: GA AV ČR IAA400720706 Grant - others:NSF(US) CHE-0744578 Institutional research plan: CEZ:AV0Z40720504 Keywords : allium siculum * nectaroscordum * allium cepa Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.816, year: 2010
Energy Technology Data Exchange (ETDEWEB)
Sanchez-Ramirez, E.A. [Escuela Superior de Ingeniería Química e Industrias Extractivas, Instituto Politécnico Nacional, CP 07738, México D.F. (Mexico); Hernandez-Perez, M.A., E-mail: mhernandezp0606@ipn.mx [Escuela Superior de Ingeniería Química e Industrias Extractivas, Instituto Politécnico Nacional, CP 07738, México D.F. (Mexico); Aguilar-Hernandez, J. [Escuela Superior de Física y Matemáticas, Instituto Politécnico Nacional, CP 07738, México D.F. (Mexico); Rangel-Salinas, E. [Escuela Superior de Ingeniería Química e Industrias Extractivas, Instituto Politécnico Nacional, CP 07738, México D.F. (Mexico)
2014-12-05
Highlights: • CdS1−xSe{sub x} films with tunable structural and optical properties were grown by CBD. • Thin films are composed by a solid solution of the CdS{sub 1−x}Se{sub x} ternary alloy. • Crystal size, band gap and photoluminescence signal, decrease with the composition. • Ternary alloys show hexagonal phase with preferential orientation on (0 0 2) plane. • Films with x ⩾ 0.5 show semi-spherical grains composed by nanoworms structures. - Abstract: CdS{sub 1−x}Se{sub x} thin films were deposited on Corning glass substrates at 75 °C by chemical bath deposition (CBD) varying the composition “x” from 0 to 1 at a constant deposition time of 120 min. The composition of the films was adjusted by modifying the concentration as well as the ratio of the precursors. The morphological, compositional, structural and optical properties of the films were analyzed using several techniques such as Scanning Electron Microscopy (SEM), Energy Dispersive Spectroscopy (EDS), X-ray Diffraction (XRD), UV–Vis Spectroscopy (UV–Vis) and Photoluminescence (PL). The films grow as layers following the ion by ion mechanism, the density of the films decreases with x. Films are constituted by clusters (100–600 nm in diameter) of semispherical particles with sizes fluctuating from 10 to 20 nm. For x ⩾ 0.5 the particles are well-arranged in a “worm-like” structure. All the films are polycrystalline, to x = 0 (CdS) the cubic phase is present, the increase of composition promotes the formation of hexagonal phase or a mixture of both cubic and hexagonal phases. Preferential orientation in the (1 0 0) or (0 0 2) plane is observed. The crystal size decreases from 20 to 6 nm when x is increased. The optical properties can be easily tuned by adjusting the composition. Optical absorption analysis shows that the band gap (E{sub g}) value shifts to red in function of x (from 2.47 to 1.99 eV). Photoluminescence signal changes as “x” varies showing a regular behavior
Czech Academy of Sciences Publication Activity Database
Šašek, Vladimír; Janda, Martin; Delage, E.; Puyaubert, J.; Guivarc'h, A.; Maseda, Encarnación López; Dobrev, Petre; Caius, J.; Valentová, O.; Burketová, Lenka; Zachowski, A.; Ruelland, E.
2014-01-01
Roč. 203, č. 3 (2014), s. 805-816 ISSN 0028-646X R&D Projects: GA ČR(CZ) GAP501/11/1654 Institutional support: RVO:61389030 Keywords : Arabidopsis * dwarf phenotype * hormone transduction Subject RIV: CE - Biochemistry Impact factor: 7.672, year: 2014
Energy Technology Data Exchange (ETDEWEB)
Jaquez, M.; Ting, M. [Materials Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States); Department of Mechanical Engineering, University of California, Berkeley, California 94720 (United States); Yu, K. M. [Materials Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States); Department of Physics and Materials Science, City University of Hong Kong, Kowloon (Hong Kong); Hettick, M.; Javey, A. [Department of Electrical Engineering and Computer Sciences, University of California, Berkeley, California 94720 (United States); Joint Center for Artificial Photosynthesis, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States); Sánchez-Royo, J. F. [ICMUV, Instituto de Ciencia de Materiales, Universitat de València, P.O. Box 22085, 46071 Valencia (Spain); Wełna, M. [Materials Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States); Department of Experimental Physics, Wrocław University of Technology, Wybrzeze Wyspianskiego 27, 50-370 Wrocław (Poland); Dubon, O. D. [Materials Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States); Department of Materials Science and Engineering, University of California, Berkeley, California 94720 (United States); Walukiewicz, W., E-mail: w-walukiewicz@lbl.gov [Materials Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States)
2015-12-07
Alloys from ZnO and ZnS have been synthesized by radio-frequency magnetron sputtering over the entire alloying range. The ZnO{sub 1−x}S{sub x} films are crystalline for all compositions. The optical absorption edge of these alloys decreases rapidly with small amount of added sulfur (x ∼ 0.02) and continues to red shift to a minimum of 2.6 eV at x = 0.45. At higher sulfur concentrations (x > 0.45), the absorption edge shows a continuous blue shift. The strong reduction in the band gap for O-rich alloys is the result of the upward shift of the valence-band edge with x as observed by x-ray photoelectron spectroscopy. As a result, the room temperature bandgap of ZnO{sub 1−x}S{sub x} alloys can be tuned from 3.7 eV to 2.6 eV. The observed large bowing in the composition dependence of the energy bandgap arises from the anticrossing interactions between (1) the valence-band of ZnO and the localized sulfur level at 0.30 eV above the ZnO valence-band maximum for O-rich alloys and (2) the conduction-band of ZnS and the localized oxygen level at 0.20 eV below the ZnS conduction band minimum for the S-rich alloys. The ability to tune the bandgap and knowledge of the location of the valence and conduction-band can be advantageous in applications, such as heterojunction solar cells, where band alignment is crucial.
Spiky strings on AdS3 x S3 with NS-NS flux
Banerjee, Aritra; Pradhan, Pabitra M.
2014-01-01
We study rigidly rotating strings in the background of AdS3 x S3 with Neveu-Schwarz (NS) fluxes. We find two interesting limiting cases corresponding to the known giant magnon and the new single spike solution of strings in the above background and write down the dispersion relations among various conserved charges. We use proper regularization to find the correct relations among them. We further study the circular and infinite spiky strings on AdS and study their properties.
Directory of Open Access Journals (Sweden)
Catalina Lopez-Saucedo
2015-01-01
Full Text Available Individuals with X-HIGM syndrome fail to express functional CD40 ligand; consequently they cannot mount effective protective antibody responses against pathogenic bacteria. We evaluated, compared, and characterized the humoral immune response of wild type (WT and C57-CD40L deficient (C57-CD40L−/− mice infected with Citrobacter rodentium. Basal serum isotype levels were similar for IgM and IgG3 among mice, while total IgG and IgG2b concentrations were significantly lower in C57-CD40L−/− mice compared with WT. Essentially IgG1 and IgG2c levels were detectable only in WT mice. C57-CD40L−/− animals, orally inoculated with 2×109 CFU, presented several clinical manifestations since the second week of infection and eventually died. In contrast at this time point no clinical manifestations were observed among C57-CD40L−/− mice infected with 1×107 CFU. Infection was subclinical in WT mice inoculated with either bacterial dose. The serum samples from infected mice (1×107 CFU, collected at day 14 after infection, had similar C. rodentium-specific IgM titres. Although C57-CD40L−/− animals had lower IgG and IgG2b titres than WT mice, C57-CD40L−/− mice sera displayed complement-mediated bactericidal activity against C. rodentium. C. rodentium-infected C57-CD40L−/− mice are capable of producing antibodies that are protective. C57-CD40L−/− mouse is a useful surrogate model of X-HIGM syndrome for studying immune responses elicited against pathogens.
Effect of sodium admixtures on properties of Cd1-xZnxS films prepared by pulverization
International Nuclear Information System (INIS)
Bajramov, A.I.; Dzhafarov, T.D.; Nadzhafov, Kh.I.; Novruzov, V.D.; Rzakuliev, N.A.
1992-01-01
A study was made on the effect of sodium additions, introduced during deposition, on structure, electric, optical and luminescence properties of Cd 1-x Zn x S films of fixed composition (x = 0.15), as well as on photoelectric properties of Cu 2 S/Cd 1-x Zn x S heterophotoelements, prepared on the basis of such films. It is shown that sodium introduction into composition of Cd 1-x Zn x S films leads to decrease of their specific resistance, growth of transparency in the region of optical transmission, increase of primary grain orientation along [101] axis
Magnetic properties and crystal field effects in TlLnX2 compounds (X=S, Se, Te)
International Nuclear Information System (INIS)
Duczmal, M.; Pawlak, L.
1997-01-01
Ternary thallium lanthanide chalcogenides TlLnX 2 (X=S, Se or Te) crystallize in the α-NaFeO 2 type of structure (R anti 3m). Each kind of the metal ions, surrounded by the distorted chalcogenide octahedra, forms separate layers. The TlX 6 octahedra are strongly elongated and the LnX 6 octahedra slightly shrunk along the threefold axis. The deformations of the coordination polyhedra and the cell volumes change regularly with the lanthanide ionic radii. The difference between the experimental and the calculated M-X distances increases on going from sulphides to tellurides, as a result of the growing covalent character of the bonds. The crystal field parameters were estimated from the high field magnetization (0-14 T) assuming trigonal distortion of the octahedral symmetry of LnX 6 polyhedra. The second-order crystal field parameters were found to correlate with the deformation of the lanthanide ions' environments. No magnetic transition was observed down to 4.2 K. (orig.)
Simplifying superstring and D-brane actions in AdS4 x CP3 superbackground
International Nuclear Information System (INIS)
Grassi, Pietro Antonio; Sorokin, Dmitri; Wulff, Linus
2009-01-01
By making an appropriate choice for gauge fixing kappa-symmetry we obtain a relatively simple form of the actions for a D = 11 superparticle in AdS 4 x S 7 /Z k , and for a D0-brane, fundamental string and D2-branes in the AdS 4 x CP 3 superbackground. They can be used to study various problems of string theory and the AdS 4 /CFT 3 correspondence, especially in regions of the theory which are not reachable by the OSp(6|4)/U(3) x SO(1,3) supercoset sigma-model. In particular, we present a simple form of the gauge-fixed superstring action in AdS 4 x CP 3 and briefly discuss issues of its T-dualization.
CYGNUS X-3: ITS LITTLE FRIEND’S COUNTERPART, THE DISTANCE TO CYGNUS X-3, AND OUTFLOWS/JETS
Energy Technology Data Exchange (ETDEWEB)
McCollough, M. L.; Dunham, M. M. [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Corrales, L., E-mail: mmccollough@cfa.harvard.edu [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States)
2016-10-20
Chandra observations have revealed a feature within 16″ of Cygnus X-3 that varied in phase with Cygnus X-3. This feature was shown to be a Bok globule that is along the line of sight to Cygnus X-3. We report on observations made with the Submillimeter Array to search for molecular emission from this globule, also known as Cygnus X-3's “Little Friend.” We have found a counterpart in both {sup 12}CO (2-1) and {sup 13}CO (2-1) emission. From the velocity shift of the molecular lines we are able to find two probable distances based on the Bayesian model of Milky Way kinematics of Reid et al. For the LF velocity of −47.5 km s{sup −1}, we find distances of 6.1 ± 0.6 kpc (62% probability) and 7.8 ± 0.6 kpc (38% probability). This yields distances to Cyg X-3 of 7.4 ± 1.1 kpc and 10.2 ± 1.2 kpc, respectively. Based on the probabilities entailed, we take 7.4 ± 1.1 kpc as the preferred distance to Cyg X-3. We also report the discovery of bipolar molecular outflow, suggesting that there is active star formation occurring within the Little Friend.
Energy Technology Data Exchange (ETDEWEB)
Jahagirdar, Anant H.; Dhere, Neelkanth G. [Florida Solar Energy Center, 1679 Clearlake Road, Cocoa, FL 32922 (United States)
2007-09-22
Photoelectrochemical (PEC) efficiency of a PEC cell constructed by series connecting two {proportional_to}0.43 cm{sup 2} size, 5.95% (AM1.5) efficient CuIn{sub 1-x}Ga{sub x}S{sub 2} (CIGS2) thin-film photovoltaic (PV) cells having transparent and conducting back contacts, outside the electrolyte, to RuS{sub 2} photoanode and platinum cathode, in the electrolyte, for oxygen and hydrogen generation by water splitting was 2.99%. PV electrolysis efficiency of a similar setup prepared using two CIGS2 PV cells having opaque Mo back contacts and highest achieved efficiency of 11.99% (AM1.5) connected to RuS{sub 2} and Pt electrodes was 8.78%. This significant result points a way toward attaining higher PEC efficiencies. (author)
D = 4 Yang-Mills correlators from NSR strings on AdS5 x S5
International Nuclear Information System (INIS)
Polyakov, D.
1999-07-01
In our previous work (hep-th/9812044) we have proposed the sigma-model action, conjectured to be the NSR analogue of superstring theory on AdS 5 x S 5 . This sigma-model is the NSR superstring action with potential term corresponding to the exotic 5-form vertex operator (branelike state). This 5-form potential plays the role of cosmological term, effectively curving the flat space-time geometry to that of AdS 5 x S 5 . In this paper we study this ansatz in more detail and provide the derivation of the correlators of the four-dimensional super Yang-Mills theory from the above mentioned sigma-model. In particular, we show that the correlation function of two dilaton vertex operators in such a model reproduces the well-known result for the two-point function in N = 4 four-dimensional super Yang-Mills theory. (author)
Energy Technology Data Exchange (ETDEWEB)
Mesquita, Alexandre, E-mail: mesquita@rc.unesp.br [Instituto de Geociências e Ciências Exatas, UNESP – Univ Estadual Paulista, Departamento de Física, Av. 24-a, 1515, Rio Claro, SP 13506-900 (Brazil); Institut de Chimie et des Materiaux Paris Est, CNRS and Université Paris Est Créteil, 2 Rue Henri Dunant, 94320 Thiais (France); Instituto de Física de São Carlos, Universidade de São Paulo, Av. Trabalhador São-Carlense, 400, São Carlos, SP (Brazil); Michalowicz, Alain, E-mail: michalov@u-pec.fr [Institut de Chimie et des Materiaux Paris Est, CNRS and Université Paris Est Créteil, 2 Rue Henri Dunant, 94320 Thiais (France); Moscovici, Jacques, E-mail: moscovic@u-pec.fr [Institut de Chimie et des Materiaux Paris Est, CNRS and Université Paris Est Créteil, 2 Rue Henri Dunant, 94320 Thiais (France); Pizani, Paulo Sergio, E-mail: pizani@df.ufscar.br [Departamento de Física, Universidade Federal de São Carlos, Rodovia Washington Luís, s/n, São Carlos, SP, 13565-905 (Brazil); Mastelaro, Valmor Roberto, E-mail: valmor@ifsc.usp.br [Instituto de Física de São Carlos, Universidade de São Paulo, Av. Trabalhador São-Carlense, 400, São Carlos, SP (Brazil)
2016-08-15
This paper reports on the structural characterization of Pb{sub 1−x}Ba{sub x}Zr{sub 0.40}Ti{sub 0.60}O{sub 3} (PBZT) ferroelectric ceramic compositions prepared by the conventional solid state reaction method. X-ray absorption spectroscopy (XAS) and Raman spectroscopy were used in the probing of the local structure of PBZT samples that exhibit a normal or relaxor ferroelectric behavior. They showed a considerable local disorder around Zr and Pb atoms in the samples of tetragonal or cubic long-range order symmetry. The intensity of the E(TO{sub 3}) mode in the Raman spectra of PBZT relaxor samples remains constant at temperatures lower than T{sub m}, which has proven the stabilization of the correlation process between nanodomains. - Graphical abstract: X-ray absorption measurements showed considerable local disorder around Zr and Pb atoms in the samples of tetragonal or cubic long-range order symmetry. The intensity of the E(TO{sub 3}) mode in the Raman spectra of PBZT relaxor samples remains constant at temperatures lower than T{sub m}, which has proven the stabilization of the correlation process between nanodomains. Display Omitted - Highlights: • Structural characterization of Pb{sub 1−x}Ba{sub x}Zr{sub 0.40}Ti{sub 0.60}O{sub 3} (PBZT) ferroelectric ceramic. • X-ray absorption and Raman spectroscopies were used to probe the structure of PBZT. • Dissymmetry of Zr and Pb sites was observed in samples long-range cubic symmetry. • Local disorder in all PBZT samples through the observation of Raman active modes.
International Nuclear Information System (INIS)
Nikolopoulos, D.; Valais, I.; Kandarakis, I.; Cavouras, D.; Linardatos, D.; Sianoudis, I.; Louizi, A.; Dimitropoulos, N.; Vattis, D.; Episkopakis, A.; Nomicos, C.; Panayiotakis, G.
2006-01-01
The purpose of the present study was to evaluate, under X-ray medical imaging conditions, the X-ray luminescence efficiency (XLE) and the optical quantum gain (OQG) of the Gd 2 SiO 5 :Ce scintillator in single crystal form, suitable for tomographic applications. Intrinsic physical properties and light emission characteristics of the Gd 2 SiO 5 :Ce scintillator, were also studied. Both experimental and Monte Carlo techniques were used. Various X-ray tube voltages (40-140 kV), currently employed in X-ray imaging applications, were used. XLE was found to vary slowly with X-ray tube voltage from (0.021±0.003) to (0.017±0.003). OQG varied from (317±18) to (466±23) light photons per incident X-ray. These values were adequately high for imaging applications using the particular energy range. Additionally, it was found by Monte Carlo simulations that for crystal thicknesses higher than 0.5 cm both XLE and OQG reached saturation levels, indicating that higher thickness crystals are of no practical use in X-ray medical imaging
International Nuclear Information System (INIS)
Haase, R.W.; Dirl, R.
1986-01-01
Explicit rank-dependent expressions have been obtained for some symmetric group (S/sub f/) 6j symbols and some S/sub f/containsS/sub f/ 1 x S/sub f/ 2 3jm symbols using Butler's recursion method. A key point in deriving these results is the use of the reduced notation introduced by Murnaghan to label irreps. Various symmetries of the 6j and 3jm symbols have been imposed. These include the complex conjugation, permutation, and transpose conjugation. We incorporate a new symmetry that arises from the occurrence of the two isomorphic direct product groups S/sub f/ 1 x S/sub f/ 2 and S/sub f/ 2 x S/sub f/ 1 as subgroups of S/sub f/. In relation to the tables of 6j and 3jm symbols presented, a discussion is given of the symmetric group-unitary group duality
Bischoff, Christian; Schuller, Katherine; Martin, Steve W
2014-04-03
The 0.5Na2S + 0.5[xGeS2 + (1 - x)PS5/2] mixed glass former (MGF) glass system exhibits a nonlinear and nonadditive negative change in the Na(+) ion conductivity as one glass former, PS5/2, is exchanged for the other, GeS2. This behavior, known as the mixed glass former effect (MGFE), is also manifest in a negative deviation from the linear interpolation of the glass transition temperatures (T(g)) of the binary end-member glasses, x = 0 and x = 1. Interestingly, the composition dependence of the densities of these ternary MGF glasses reveals a slightly positive MGFE deviation from a linear interpolation of the densities of the binary end-member glasses, x = 0 and x = 1. From our previous studies of the structures of these glasses using IR, Raman, and NMR spectroscopies, we find that a disproportionation reaction occurs between PS7/2(4-) and GeS3(2-) units into PS4(3-) and GeS5/2(1-) units. This disproportionation combined with the formation of Ge4S10(4-) anions from GeS5/2(1-) groups leads to the negative MGFE in T(g). A best-fit model of the T(g)s of these glasses was developed to quantify the amount of GeS5/2(1-) units that form Ge4S10(4-) molecular anions in the ternary glasses (∼ 5-10%). This refined structural model was used to develop a short-range structural model of the molar volumes, which shows that the slight densification of the ternary glasses is due to the improved packing efficiency of the germanium sulfide species.
Three-spin Strings on AdS_5 x S^5 from N=4 SYM
DEFF Research Database (Denmark)
Kristjansen, C.
2004-01-01
Using the integrable spin chain picture we study the one-loop anomalous dimension of certain single trace scalar operators of N=4 SYM expected to correspond to semi-classical string states on AdS_5 x S^5 with three large angular momenta (J_1,J_2,J_3) on S^5. In particular, we investigate the anal......Using the integrable spin chain picture we study the one-loop anomalous dimension of certain single trace scalar operators of N=4 SYM expected to correspond to semi-classical string states on AdS_5 x S^5 with three large angular momenta (J_1,J_2,J_3) on S^5. In particular, we investigate...... the analyticity structure encoded in the Bethe equations for various distributions of Bethe roots. In a certain region of the parameter space our operators reduce to the gauge theory duals of the folded string with two large angular momenta and in another region to the duals of the circular string with angular...... momentum assignment (J,J',J'), J>J'. In between we locate a critical line. We propose that the operators above the critical line are the gauge theory duals of the circular elliptic string with three different spins and support this by a perturbative calculation....
Chemical bath deposited Mg{sub x}Zn{sub 1−x}S(O) thin films and their photoluminescence properties
Energy Technology Data Exchange (ETDEWEB)
Inamdar, Akbar I.; Han, Jaeseok; Jo, Yongcheol; Kim, Jongmin; Pawar, S.M. [Division of Physics and Semiconductor Science, Dongguk University, Seoul 100-715 (Korea, Republic of); Yuldashev, Shavkat U. [Quantum-Functional Semiconductor Research Centre, Dongguk University, Seoul100-715 (Korea, Republic of); Kim, Hyungsang, E-mail: hskim@dongguk.edu [Division of Physics and Semiconductor Science, Dongguk University, Seoul 100-715 (Korea, Republic of); Im, Hyunsik, E-mail: hyunsik7@dongguk.edu [Division of Physics and Semiconductor Science, Dongguk University, Seoul 100-715 (Korea, Republic of)
2015-12-15
A zinc sulfide (ZnS) specimen was intentionally doped with transition metal (Mg-donor) elements using a chemical bath deposition (CBD) technique. Both the un-doped and the magnesium (Mg)-doped ZnS samples were confirmed to have hexagonal wurtzite ZnS crystal structure. The XRD patterns showed no characteristic peak for Mg indicating that the Mg{sup 2+} ions had been incorporated into ZnS(O) lattice sites. In contrast to un-doped samples, Mg doping resulted in changes in the morphological features of the spherical clusters which resulted in porous, spongy vermicular structures. The energy band gap of the Mg{sub x}Zn{sub 1−x}S(O) film was slightly larger than that for the ZnS(O) film. A photoluminescence study revealed that the emissions were near violet–blue–green in color. The emission characteristics consist of two components; emission in the near violet and in visible region. That is the first is between 4160 and 4400 Å and the second is at 5190 Å, and these are associated with the donor–acceptor transitions with sulfur vacancies as acceptors and the magnesium related defects (trap states) in the samples respectively. - Highlights: • Mg{sub x}Zn{sub 1−x}S(O) films are grown using a chemical bath deposition (CBD) technique. • Energy band widening and morphological changes are observed after Mg doping. • A PL study revealed that the emissions are near violet–blue–green in color. • The emissions are associated with the sulfur vacancies and Mg trap states.
Outburst of the 2 s Anomalous X-ray Pulsar 1E 1547.0-5408
Halpern, J. P.; Gotthelf, E. V.; Camilo, F.; Reynolds, J.; Ransom, S. M.
2008-01-01
Following our discovery of radio pulsations from the newly recognized anomalous X-ray pulsar (AXP) 1E 1547.0-5408, we initiated X-ray monitoring with the Swift X-ray telescope and obtained a single target-of-opportunity observation with the Newton X-ray Multi-Mirror Mission (XMM-Newton). In comparison with its historic minimum flux of 3 x 10(exp -l3)ergs/sq cm/s, the source was found to be in a record high state, f(sub x)(1-8 keV) = 5 x 10(exp -12)ergs/sq cm/s, or L(sub x) = 1.7 x 10(exp 35)(d/9 kpc )(sup 2)ergs/s, and declining by 25% in 1 month. Extrapolating the decay, we bound the total energy in this outburst to 1042 ergs pulsar, which may indicate a nearly aligned rotator. As also inferred from the transient behavior of XTE J18 10-197, the only other AXP known to emit in the radio, the magnetic field rearrangement responsible for this X-ray outburst of 1E 1547.0-5408 is probably the cause of its radio turn-on.
Energy Technology Data Exchange (ETDEWEB)
Ni, Wei-Shih [Institute of Photonics, National Changhua University of Education, Changhua 500, Taiwan (China); Lin, Yow-Jon, E-mail: rzr2390@yahoo.com.tw [Institute of Photonics, National Changhua University of Education, Changhua 500, Taiwan (China); Chang, Hsing-Cheng [Department of Automatic Control Engineering, Feng Chia University, Taichung 407, Taiwan (China); Liu, Chia-Jyi; Chen, Liang-Ru [Department of Physics, National Changhua University of Education, Changhua 500, Taiwan (China)
2015-12-15
This study determines the effect of Cu and S content on the structural, luminescence and electrical properties of sol–gel Zn{sub 1−x}Cu{sub x}S{sub y} films. The dependence of acceptors [interstitial sulfur (S{sub i})] and donors [sulfur vacancy (V{sub S})] on the film composition allows the hole concentration of Zn{sub 1−x}Cu{sub x}S{sub y} samples to be tuned. It is found that an increased Cu/Zn molar ratio leads to a reduced probability of the formation of V{sub S}, which increases the hole concentration. An increase in Cu/Zn and S/Zn molar ratios leads to a significantly increased probability of the formation of S{sub i} and a reduced probability of the formation of V{sub S}, which significantly increases the hole concentration. Clearly, compensation effects limit the hole concentration of Zn{sub 1−x}Cu{sub x}S{sub y} samples. The results show that S{sub i} is the origin of the p-type conductivity. It is also shown that a suitable choice of composition increases acceptor-like defect formation in Zn{sub 1−x}Cu{sub x}S{sub y}. - Highlights: • The effect of the composition on the hole concentration of Zn{sub 1−x}Cu{sub x}S{sub y} is studied. • A dependence of the optical property upon the film composition is found. • Compensation effects limit the hole concentration of Zn{sub 1−x}Cu{sub x}S{sub y} samples. • Interstitial sulfur is the origin of the p-type conductivity of Zn{sub 1−x}Cu{sub x}S{sub y}. • A suitable choice of the compositions promotes the formation of acceptors.
Li, Fangsen; Ding, Hao; Tang, Chenjia; Peng, Junping; Zhang, Qinghua; Zhang, Wenhao; Zhou, Guanyu; Zhang, Ding; Song, Can-Li; He, Ke; Ji, Shuaihua; Chen, Xi; Gu, Lin; Wang, Lili; Ma, Xu-Cun; Xue, Qi-Kun
2015-06-01
Recently discovered high-temperature superconductivity in single-unit-cell (UC) FeSe films on SrTi O3 (STO) substrate has stimulated tremendous research interest, both experimental and theoretical. Whether this scenario could be extended to other superconductors is vital in both identifying the enhanced superconductivity mechanism and further raising the critical transition temperature (Tc). Here we successfully prepared single-UC FeT e1 -xS ex(0.1 ≤x ≤0.6 ) films on STO substrates by molecular beam epitaxy and observed U -shaped superconducting gaps (Δ ) up to ˜16.5 meV , nearly ten times the gap value (Δ ˜1.7 meV ) of the optimally doped bulk FeT e0 .6S e0 .4 single crystal (Tc˜14.5 K ). No superconducting gap has been observed on the second UC and thicker FeT e1 -xS ex films at 5.7 K, indicating the important role of the interface. This interface-enhanced high-temperature superconductivity is further confirmed by ex situ transport measurements, which revealed an onset superconducting transition temperature above 40 K, nearly two times higher than that of the optimally doped bulk FeT e0 .6S e0 .4 single crystal. This work demonstrates that interface engineering is a feasible way to discover alternative superconductors with higher Tc.
International Nuclear Information System (INIS)
Pervukhina, N.V.; Borisov, S.V.; Magarill, S.A.; Naumov, D.Yu.; Vasil'ev, V.I.; Nenashev, B.G.
2004-01-01
Structural studies of synthetic analog of mineral grechishchevite Hg 3 S 2 Br 1.00 Cl 0.50 I 0.50 were conducted, the mineral crystal structure was refined, the results of the studies being analyzed. For chalcogenhalides Hg 3 X 2 Hal 2 (X=S, Se, Te; Hal=Cl, Br, I) inventory was taken of intergrowing isolated and infinite, i.e. continuous, layered and carcass, covalently bonded Hg-X-radicals into pseudocubical matrix from halide ions [ru
Sukkabot, Worasak; Pinsook, Udomsilp
2017-01-01
Using the atomistic tight-binding theory (TB) and a configuration interaction description (CI), we numerically compute the excitonic splitting of CdX(X = Se, S and Te)/ZnS core/shell nanocrystals with the objective to explain how types of the core materials and growth shell thickness can provide the detailed manipulation of the dark-dark (DD), dark-bright (DB) and bright-bright (BB) excitonic splitting, beneficial for the active application of quantum information. To analyze the splitting of the excitonic states, the optical band gaps, ground-state wave function overlaps and atomistic electron-hole interactions tend to be numerically demonstrated. Based on the atomistic computations, the single-particle and excitonic gaps are mainly reduced with the increasing ZnS shell thickness owing to the quantum confinement. In the range of the higher to lower energies, the order of the single-particle gaps is CdSe/ZnS, CdS/ZnS and CdTe/ZnS core/shell nanocrystals, while one of the excitonic gaps is CdS/ZnS, CdSe/ZnS and CdTe/ZnS core/shell nanocrystals because of the atomistic electron-hole interaction. The strongest electron-hole interactions are mainly observed in CdSe/ZnS core/shell nanocrystals. In addition, the computational results underline that the energies of the dark-dark (DD), dark-bright (DB) and bright-bright (BB) excitonic splitting are generally reduced with the increasing ZnS growth shell thickness as described by the trend of the electron-hole exchange interaction. The high-to-low splitting of the excitonic states is demonstrated in CdSe/ZnS, CdTe/ZnS and CdS/ZnS core/shell nanocrystals because of the fashion in the electron-hole exchange interaction and overlaps of the electron-hole wave functions. As the resulting calculations, it is expected that CdS/ZnS core/shell nanocrystals are the best candidates to be the source of entangled photons. Finally, the comprehensive information on the excitonic splitting can enable the use of suitable core
Energy Technology Data Exchange (ETDEWEB)
Liang, Qingshuang, E-mail: lqs671@163.com [Jilin University, State Key Laboratory of Inorganic Synthesis and Preparative Chemistry, College of Chemistry (China)
2016-06-15
In this work, we show that compositionally controlled Cu{sub 2}(Sn{sub 1–x}Ge{sub x})S{sub 3} nanocrystals can be successfully synthesized by the hot-injection method through careful tuning the Ge/(Sn+Ge) precursor ratio. The band gaps of the resultant nanocrystals are demonstrated to be linearly tuned from 1.45 to 2.33 eV by adjusting the composition parameter x of the Ge/(Sn+Ge) ratio from 0.0 to 1.0. The crystalline structures of the resultant NCs have been studied by the X-ray diffraction (XRD), high-resolution transmission electron microscopy (HRTEM), select area electron diffraction (SAED), and Raman spectroscopy. A ligand exchange procedure is further performed to replace the native ligands on the surface of the NCs with sulfur ions. The photoresponsive behavior indicates the potential use of as-prepared Cu{sub 2}(Sn{sub 1–x}Ge{sub x})S{sub 3} nanocrystals in solar energy conversion systems. The synthesis of compositionally controlled Cu{sub 2}(Sn{sub 1–x}Ge{sub x})S{sub 3} nanocrystals reported herein provides a way for probing the effect of Ge inclusion in the Cu-Sn-S system thin films.
Foronda, Humberto M.
2017-06-19
Coherent InxAl1−xN (x = 0.15 to x = 0.28) films were grown by metalorganic chemical vapor deposition on GaN templates to investigate if the films obey Vegard’s Law by comparing the film stress-thickness product from wafer curvature before and after InxAl1−xN deposition. The In composition and film thickness were verified using atom probe tomography and high resolution X-ray diffraction, respectively. Ex-situ curvature measurements were performed to analyze the curvature before and after the InxAl1−xN deposition. At ∼In0.18Al0.82N, no change in curvature was observed following InAlN deposition; confirming that films of this composition are latticed matched to GaN, obeying Vegard’s law. The relaxed a0- and c0- lattice parameters of InxAl1−xN were experimentally determined and in agreement with lattice parameters predicted by Vegard’s law.
Foronda, Humberto M.; Mazumder, Baishakhi; Young, Erin C.; Laurent, Matthew A.; Li, Youli; DenBaars, Steven P.; Speck, James S.
2017-01-01
Coherent InxAl1−xN (x = 0.15 to x = 0.28) films were grown by metalorganic chemical vapor deposition on GaN templates to investigate if the films obey Vegard’s Law by comparing the film stress-thickness product from wafer curvature before and after InxAl1−xN deposition. The In composition and film thickness were verified using atom probe tomography and high resolution X-ray diffraction, respectively. Ex-situ curvature measurements were performed to analyze the curvature before and after the InxAl1−xN deposition. At ∼In0.18Al0.82N, no change in curvature was observed following InAlN deposition; confirming that films of this composition are latticed matched to GaN, obeying Vegard’s law. The relaxed a0- and c0- lattice parameters of InxAl1−xN were experimentally determined and in agreement with lattice parameters predicted by Vegard’s law.
Use of exp(iS[x]) in the sum over histories
International Nuclear Information System (INIS)
Anderson, A.
1994-01-01
The use of tsumexp(iS[x]) is the generic form for a sum over histories in configuration space is discussed critically and placed in its proper context. The standard derivation of the sum over paths by discretizing the paths is reviewed, and it is shown that the form tsumexp(iS[x]) is justified only for Schroedinger-type systems which are at most second order in the momenta. Extending this derivation to the relativistic free particle, the causal Green's function is expressed as a sum over timelike paths, and the Feynman Green's function is expressed both as a sum over paths which only go one way in time and as a sum over paths which move forward and backward in time. The weighting of the paths is shown not to be exp(iS[x]) is any of these cases. The role of the inner product and the operator ordering of the wave equation in defining the sum over histories is discussed
Ravula, Sudhir; Zhang, Chi; Essner, Jeremy B; Robertson, J David; Lin, Jian; Baker, Gary A
2017-03-08
Layered transition metal dichalcogenides (TMDs) have attracted increased attention due to their enhanced hydrogen evolution reaction (HER) performance. More specifically, ternary TMD nanohybrids, such as MoS 2(1-x) Se 2x or bimetallic sulfides, have arisen as promising electrocatalysts compared to MoS 2 and MoSe 2 due to their electronic, morphologic, and size tunabilities. Herein, we report the successful synthesis of few-layered MoS 2 /rGO, SnS 2 /rGO, and (MoS 2 ) x (SnO 2 ) 1-x /rGO nanohybrids anchored on reduced graphene oxide (rGO) through a facile hydrothermal reaction in the presence of ionic liquids as stabilizing, delayering agents. Spectroscopic and microscopic techniques (electron microscopy, X-ray diffraction, Raman spectroscopy, neutron activation analysis, and UV-vis spectrophotometry) are used to validate the hierarchical properties, phase identity, and the smooth compositional tunability of the (MoS 2 ) x (SnO 2 ) 1-x /rGO nanohybrids. Linear sweep voltammetry measurements reveal that incorporation of Sn into the ternary nanohybrids (as a discrete SnO 2 phase) greatly reduces the overpotential by 90-130 mV relative to the MoS 2 electrocatalyst. Significantly, the (MoS 2 ) 0.6 (SnO 2 ) 0.4 /rGO nanohybrid displays superior catalytic performance over MoS 2 alone, exhibiting a low overpotential (η 10 ) of 263 ± 5 mV and a small Tafel slope of 50.8 mV dec -1 . The hybrid catalyst shows high stability for the HER in acidic solutions, with negligible activity loss after 1000 cycles. The hierarchical structures and large surface areas possessing exposed, active edge sites make few-layered (MoS 2 ) x (SnO 2 ) 1-x /rGO nanohybrids promising nonprecious metal electrocatalysts for the HER.
Dimensional stability of some Fe-Ni-Cr alloys used in nuclear power generation
International Nuclear Information System (INIS)
Marucco, A.; Nath, B.
1983-01-01
The dimensional stability of four materials used in the nuclear power industry, viz Nimonic PE16, 20Cr-25Ni steel, Alloy 600 and Inconel 690, have been studied using X-ray diffractometry, electrical resistivity and thin foil microscopic techniques. Appreciable reductions in lattice parameters of these alloys occur on exposure to temperatures of 823 deg K and below. An order-disorder transformation has been found to be responsible for the observed behaviour. The transformation kinetics, associated microstructural changes and the implications for the usage of these materials are discussed. (author)
Editorial: X-chromosome-linked Kallmann's syndrome: Pathology at the molecular level
Energy Technology Data Exchange (ETDEWEB)
Prager, D.; Braunstein, G.D. (Cedars-Sinai Medical Center, Los Angeles, CA (United States))
1993-04-01
Kallmann's syndrome or olfactogenital dysplasia refers to a disorder characterized by hypogonadotropic hypogonadism and anosmia or hyposmia which can occur sporadically or in a familial setting. Originally described in 1856, the first familial cases were reported by Kallmann et al., in 1944. Based on segregation analysis of multiple families, three modes of transmission have been documented: X-linked, autosomal dominant with variable penetrance, and autosomal recessive. Kallmann's syndrome occurs in less than 1 in 10,000 male births, with a 5-fold excess of affected males to females, suggesting that the X-linked form is the most frequent. By genetic linkage analysis the X-linked form of Kallmann's syndrome was localized to Xp22.3. This was confirmed by the description of patients with contiguous gene syndromes due to deletions of various portions of the distal short arm of the X-chromosome. Such patients present with complex phenotypes characterized by a combination of Kallmann's syndrome with X-linked icthyosis due to steroid sulfatase deficiency, chondrodysplasia punctata, short stature, and mental retardation. DNA analysis has identified and mapped the genes responsible for these disorders. 10 refs., 1 fig., 1 tab.
Energy Technology Data Exchange (ETDEWEB)
Clayton, A.J., E-mail: Andrew.J.Clayton@Swansea.ac.uk [Centre for Solar Energy Research, College of Engineering, Swansea University, OpTIC, St. Asaph, LL17 0JD (United Kingdom); Baker, M.A.; Babar, S.; Grilli, R. [The Surface Analysis Laboratory, Department of Mechanical Engineering Sciences, University of Surrey, Guildford, GU2 7XH (United Kingdom); Gibson, P.N. [Institute for Health and Consumer Protection, Joint Research Centre of the European Commission, 21027, Ispra, VA (Italy); Kartopu, G.; Lamb, D.A. [Centre for Solar Energy Research, College of Engineering, Swansea University, OpTIC, St. Asaph, LL17 0JD (United Kingdom); Barrioz, V. [Engineering and Environment, Department of Physics and Electrical Engineering, Northumbria University, Newcastle, NE1 8ST (United Kingdom); Irvine, S.J.C. [Centre for Solar Energy Research, College of Engineering, Swansea University, OpTIC, St. Asaph, LL17 0JD (United Kingdom)
2017-05-01
Ultra-thin CdTe:As/Cd{sub 1-x}Zn{sub x}S photovoltaic solar cells with an absorber thickness of 0.5 μm were deposited by metal-organic chemical vapour deposition on indium tin oxide coated boro-aluminosilicate substrates. The Zn precursor concentration was varied to compensate for Zn leaching effects after CdCl{sub 2} activation treatment. Analysis of the solar cell composition and structure by X-ray photoelectron spectroscopy depth profiling and X-ray diffraction showed that higher concentrations of Zn in the Cd{sub 1-x}Zn{sub x}S window layer resulted in suppression of S diffusion across the CdTe/Cd{sub 1-x}Zn{sub x}S interface after CdCl{sub 2} activation treatment. Excessive Zn content in the Cd{sub 1-x}Zn{sub x}S alloy preserved the spectral response in the blue region of the solar spectrum, but increased series resistance for the solar cells. A modest increase in the Zn content of the Cd{sub 1-x}Zn{sub x}S alloy together with a post-deposition air anneal resulted in an improved blue response and an enhanced open circuit voltage and fill factor. This device yielded a mean efficiency of 8.3% over 8 cells (0.25 cm{sup 2} cell area) and best cell efficiency of 8.8%. - Highlights: • CdCl{sub 2} anneal treatment resulted in S diffusing to the back contact. • High Zn levels created mixed cubic/hexagonal structure at the p-n junction. • Increased Zn in Cd{sub 1-x}Zn{sub x}S supressed S diffusion into CdTe. • Device V{sub oc} was enhanced overall with an additional back surface air anneal.
Hard x ray observations of Vela X-1 and A0535+26 with HEXE: Discovery of cyclotron lines
Kendziorra, E.; Mony, B.; Kretschmar, P.; Maisack, M.; Staubert, R.; Doebereiner, S.; Englhauser, J.; Pietsch, W.; Reppin, C.; Truemper, J.
1992-01-01
The X ray pulsars Vela X-1 (4U 0900-40) and A0535+26) were observed with the High Energy X ray Experiment (HEXE) onboard the Mir space station at energies above 20 keV. The pulse profiles of Vela X-1 (P = 283.22 s for JD 244 7486) and A0535+26 (P = 103.27 s for JD 244 7626) were measured up to at least 100 keV. The time averaged pulse profiles of the two sources both show a clear double peak structure with an asymmetric main pulse and a more symmetric secondary pulse. The spectrum of the main pulse is significantly harder than that of the secondary. Pulse phase resolved spectra show absorption features at 54 keV and possibly 27 keV for Vela X-1 and around 100 keV for A0535+26. If these features are interpreted as second and first harmonic (fundamental) cyclotron absorption lines, lower limits are derived of 2.6 x 10(exp 12) and 4.3 x 10(exp 12) Gauss for the magnetic fields of the neutron stars in Vela X-1 and A0535+26, respectively.
Energy Technology Data Exchange (ETDEWEB)
Ahmed, M.A., E-mail: moala1947@yahoo.com [Materials Science Lab (1), Physics Dept., Faculty of Science, Cairo Univ., Giza (Egypt); Bishay, Samiha T. [Phys. Dept., Faculty of Girls for Art, Science and Education, Ain Shams Univ., Cairo (Egypt); El-dek, S.I.; Omar, G. [Materials Science Lab (1), Physics Dept., Faculty of Science, Cairo Univ., Giza (Egypt)
2011-01-21
Research highlights: We aimed to merge the advantages of both Ni and Mn ferrites and to profit from the existence of Mg in small constant ratio to assure the large magnetization of the ferrite under investigation. To achieve such goals one have to investigate the effect of Ni substitution on the structural and electrical properties of Mn-Mg ferrite of the chemical formula Ni{sub x}Mn{sub 0.8-x}Mg{sub 0.2}Fe{sub 2}O{sub 4}; 0 {<=} x {<=} 0.40 prepared by conventional ceramic technique. - Abstract: Ni{sub x}Mn{sub 0.8-x}Mg{sub 0.2}Fe{sub 2}O{sub 4}; 0.0{<=} x {<=}0.40 was prepared by standard ceramic technique, presintering was carried out at 900 deg. C and final sintering at 1200 deg. C with heating/cooling rate 4 deg. C/min. X-ray diffraction analyses assured the formation of the samples in a single phase spinel cubic structure. The calculated crystal size was obtained in the range of 75-130 nm. A slight increase in the theoretical density and decrease in the porosity was obtained with increasing the nickel content. This result was discussed based on the difference in the atomic masses between Ni (58.71) and Mn (54.938). IR spectral analyses show four bands of the spinel ferrite for all the samples. The conductivity and dielectric loss factor give nearly continuous decrease with increasing Ni-content. This was discussed as the result of the significant role of the multivalent cations, such as iron, nickel, manganese, in the conduction mechanism. Anomalous behavior was obtained for the sample with x = 0.20 as highest dielectric constant, highest dielectric loss and highest conductivity. This anomalous behavior was explained due to the existence of two divalent cations on B-sites with the same ratio, namely, Mg{sup 2+} and Ni{sup 2+}.
A 12-bit 40 MS/s pipelined ADC with over 80 dB SFDR
Energy Technology Data Exchange (ETDEWEB)
Wei Qi; Yin Xiumei; Han Dandan; Yang Huazhong, E-mail: q-wei05@mails.tsinghua.edu.c [Department of Electronic Engineering, Tsinghua University, Beijing 100084 (China)
2010-02-15
This paper describes a 12-bit 40 MS/s calibration-free pipelined analog-to-digital converter (ADC), which is optimized for high spurious free dynamic range (SFDR) performance and low power dissipation. With a 4.9 MHz sine wave input, the prototype ADC implemented in a 0.18-{mu}m 1P6M CMOS process shows measured differential nonlinearity and integral nonlinearity within 0.78 and 1.32 least significant bits at the 12-bit level without any trimming or calibration. The ADC, with a total die area of 3.1 x 2.1 mm{sup 2}, demonstrates a maximum signal-to-noise distortion ratio (SNDR) and SFDR of 66.32 and 83.38 dB, respectively, at a 4.9 MHz analog input and a power consumption of 102 mW from a 1.8 V supply. (semiconductor integrated circuits)
Energy Technology Data Exchange (ETDEWEB)
Abouhaswa, A.S., E-mail: aliabohaswa@hotmail.com [Institute of Natural Sciences, Ural Federal University, 620083, Ekaterinburg (Russian Federation); Merentsov, A.I. [Institute of Natural Sciences, Ural Federal University, 620083, Ekaterinburg (Russian Federation); Baranov, N.V. [Institute of Natural Sciences, Ural Federal University, 620083, Ekaterinburg (Russian Federation); M.N. Miheev Institute of Metal Physics, Ural Branch of RAS, 620990, Ekaterinburg (Russian Federation)
2016-08-15
Highlights: • The Fe{sub 1.02}Se{sub 0.5}Te{sub 0.5−x}S{sub x} and Fe{sub 1.02}Se{sub 0.4}Te{sub 0.6−x}S{sub x} samples have been synthesized. • The S for Te substitution results in a small expansion of the crystal lattice of the PbO-type phase. • This expansion is attributed to changes in the phase relation and chemical composition of phases. • There is a correlation between the changes of T{sub c} and lattice parameters of the PbO-type phase. - Abstract: Two series of the Fe{sub 1.02}Se{sub 0.5}Te{sub 0.5–x}S{sub x} (I) and Fe{sub 1.02}Se{sub 0.4}Te{sub 0.6–x}S{sub x} (II) samples with the sulfur for tellurium substitution and with the invariable Se concentrations have been synthesized and studied by means of X-ray diffraction, scanning electron microscopy, electrical resistivity and magnetic susceptibility measurements. The superconducting PbO-type phase is found to persists in the first series up to x = 0.4 and in the second one up to x = 0.5. Despite the lower ionic radius of sulfur in comparison with tellurium the replacement of tellurium by sulfur does not lead to contraction of the unit cell volume of the superconducting phase in both I and II series with ternary mixture of chalcogens. Variations of the lattice parameters caused by the S for Te substitution in the Fe{sub 1.02}Se{sub 0.5}Te{sub 0.5–x}S{sub x} and Fe{sub 1.02}Se{sub 0.4}Te{sub 0.6–x}S{sub x} samples are found to be less pronounced than that reported for the Fe{sub 1.02}Te{sub 0.5}Se{sub 0.5-x}S{sub x} system and are accompanied by lowering of the critical temperature. The behavior of the lattice parameters and critical temperature of Fe(S,Se,Te) materials with the ternary mixture of chalcogens at substitutions is ascribed to the changes in the volume fraction and chemical compositions of the coexisting tetragonal and hexagonal phases.
Kesharwani, Manoj K; Manna, Debashree; Sylvetsky, Nitai; Martin, Jan M L
2018-03-01
We have re-evaluated the X40×10 benchmark for halogen bonding using conventional and explicitly correlated coupled cluster methods. For the aromatic dimers at small separation, improved CCSD(T)-MP2 "high-level corrections" (HLCs) cause substantial reductions in the dissociation energy. For the bromine and iodine species, (n-1)d subvalence correlation increases dissociation energies and turns out to be more important for noncovalent interactions than is generally realized; (n-1)sp subvalence correlation is much less important. The (n-1)d subvalence term is dominated by core-valence correlation; with the smaller cc-pVDZ-F12-PP and cc-pVTZ-F12-PP basis sets, basis set convergence for the core-core contribution becomes sufficiently erratic that it may compromise results overall. The two factors conspire to generate discrepancies of up to 0.9 kcal/mol (0.16 kcal/mol RMS) between the original X40×10 data and the present revision.
Photovoltaic performance of a Cd1−xMgxTe/CdS top-cell structure
International Nuclear Information System (INIS)
Martinez, Omar S.; Regalado-Pérez, E.; Mathews, N.R.; Morales, Erik R.; Reyes-Coronado, David; Galvez, Geovanni Hernández; Mathew, Xavier
2015-01-01
In this paper we report the progress in developing a wide band gap alloy material based on CdTe to use as the top-cell absorber in tandem solar cells. High photovoltaic performance for a Cd 1−x Mg x Te/CdS top-cell was achieved by tuning the composition of the Cd 1−x Mg x Te film, and optimizing the device processing. We have carried out studies on the effect of vapor chloride treatment of the Cd 1−x Mg x Te/CdS device and the thermal annealing of the Cu/Au contacts on the opto-electronic properties of the device. With improved contact processing and post deposition treatments, we were able to achieve 9.3% efficiency for a 1.6 eV band gap top-cell; Cd 1−x Mg x Te/CdS on conductive glass substrate. - Highlights: • Cd 1−x Mg x Te films obtained by co-evaporation of CdTe and Mg • Band gap of Cd 1−x Mg x Te can be easily tuned by verifying x. • Band gap of Cd 1−x Mg x Te is stable only for short annealing durations. • Obtained efficiency of a Cd 1−x Mg x Te based device with a band gap of 1.6 eV is 9.3%
2010-07-01
... 40 Protection of Environment 19 2010-07-01 2010-07-01 false Sampling Plans for Selective Enforcement Auditing of Heavy-Duty Engines and Light-Duty Trucks X Appendix X to Part 86 Protection of... Plans for Selective Enforcement Auditing of Heavy-Duty Engines and Light-Duty Trucks Table 1—Sampling...
Energy Technology Data Exchange (ETDEWEB)
Ibraheam, A.S.; Voon, C.H.; Foo, K.L.; Azizah, N. [University Malaysia Perlis, Institute of Nano Electronic Engineering, Kangar, Perlis (Malaysia); Al-Douri, Y. [University of Sidi-Bel-Abbes, Physics Department, Faculty of Science, Sidi Bel-Abbes (Algeria); Gopinath, S.C.B. [University Malaysia Perlis, Institute of Nano Electronic Engineering, Kangar, Perlis (Malaysia); Universiti Malaysia Perlis, School of Bioprocess Engineering, Arau, Perlis (Malaysia); Ameri, M. [Universite Djilali Liabes de Sidi Bel-Abbes, Laboratoire Physico-Chimie des Materiaux Avances (LPCMA), Sidi Bel-Abbes (Algeria); Ibrahim, Sattar S. [University of Anbar, Chemisty Department, College of Science, Al Rumadi (Iraq)
2017-03-15
A sensing plate of extended Cu{sub 2}Zn{sub 1-x}Cd{sub x}SnS{sub 4} quinternary alloy nanostructures, fabricated on an oxidized silicon substrate by the sol-gel method, is reported in this paper. The fabricated device was characterized and analyzed via field emission-scanning electron microscopy, X-ray diffraction (XRD), and photoluminescence (PL). The XRD peaks shifted towards the lower angle side alongside increasing concentration of cadmium. The average diameter of the Cu{sub 2}Zn{sub 1-x}Cd{sub x}SnS{sub 4} quinternary alloy nanostructures falls between 21.55 and 43.12 nm, while the shift of the PL bandgap was from 1.81 eV (x = 0) to 1.72 eV (x = 1). The resulting Cu{sub 2}Zn{sub 1-x}Cd{sub x}SnS{sub 4} quinternary alloy nanostructures components were functionalized with oligonucleotides probe DNA molecules and interacted with the target, exhibiting good sensing capabilities due to its large surface-to-volume ratio. The fabrication, immobilization, and hybridization processes were analyzed via representative current-voltage (I-V) plots. Its electrical profile shows that the device is capable to distinguish biomolecules. Its high performance was evident from the linear relationship between the probe DNA from cervical cancer and the target DNA, showing its applicability for medical applications. (orig.)
Neutron and X-ray small angle scattering (S.A.S.) study of the amorphous alloy Tbsub(.25)Cusub(.75)
International Nuclear Information System (INIS)
Boucher, B.
1980-07-01
The magnetic properties of amorphous alloys REsub(x) Msub(x-1) (R.E.=heavy rare earths, M=Cu, Ag, Au) have been widely studied. They are of the speromagnetic type for x>=0.33 and are mictomagnetic for x -12 cm). Also the atomic volume of Terbium (approximately 33 A 3 ) is almost three times that of Copper (11.8 A 3 ) and Cu is less absorbant than Ag or Au. Tb alloys exhibit high magnetic ordering temperatures and important moments in contrast to the majority of other alloys of the same family. One inconvenience with Terbium, however, is the large (X-ray) fluorescence (lambda Cu). In order to confirm some interpretations of S.A.S., we were obliged to determine some physical parameters such as the density and porosity and to examine the sample with microscope. These results are also given here
Observation of X(3872) production in $pp$ collisions at $\\sqrt{s}=7$ TeV
Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Constantin, F; Contu, A; Cook, A; Coombes, M; Corti, G; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Estève, L; Falabella, A; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koppenburg, P; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Nedos, M; Needham, M; Neufeld, N; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrella, A; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, A C; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Topp-Joergensen, S; Torr, N; Tournefier, E; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Voss, H; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zverev, E; Zvyagin, A
2012-01-01
Using 34.7 pb$^{-1}$ of data collected with the LHCb detector, the inclusive production of the $X(3872)$ meson in $pp$ collisions at $\\sqrt{s}=7$ TeV is observed for the first time. Candidates are selected in the $X(3872) \\to J/\\psi \\pi^+ \\pi^-$ decay mode, and used to measure \\begin{align*} \\sigma(pp\\to X(3872)+{\\rm anything}) \\, \\mathcal{B}(X(3872) \\to J/\\psi&\\pi^+\\pi^-) = \\\\ & 4.7 \\pm 1.1 \\,{\\rm (stat)} \\pm 0.7 \\,{\\rm (syst)} {\\rm nb} \\,, \\end{align*} where $\\sigma(pp\\to X(3872)+{\\rm anything})$ is the inclusive production cross-section of $X(3872)$ mesons with rapidity in the range $2.5-4.5$ and transverse momentum in the range $5-20$ GeV/$c$. In addition the masses of both the $X(3872)$ and $\\psi(2S)$ mesons, reconstructed in the $ J/\\psi \\pi^+ \\pi^-$ final state, are measured to be \\begin{eqnarray*} m_{X(3872)} &=& 3871.95 \\pm 0.48 \\,({\\rm stat}) \\pm 0.12 \\,({\\rm syst}){\\rm MeV/}c^2 ~\\mbox{and} \\\\ m_{\\psi(2S)} &=& 3686.12\\pm 0.06 \\,({\\rm stat}) \\pm 0.10 \\,({\\rm syst}){\\rm M...
Discovery of Periodic Dips in the Brightest Hard X-Ray Source of M31 with EXTraS
Marelli, Martino; Tiengo, Andrea; De Luca, Andrea; Salvetti, David; Saronni, Luca; Sidoli, Lara; Paizis, Adamantia; Salvaterra, Ruben; Belfiore, Andrea; Israel, Gianluca; Haberl, Frank; D’Agostino, Daniele
2017-12-01
We performed a search for eclipsing and dipping sources in the archive of the EXTraS project—a systematic characterization of the temporal behavior of XMM-Newton point sources. We discovered dips in the X-ray light curve of 3XMM J004232.1+411314, which has been recently associated with the hard X-ray source dominating the emission of M31. A systematic analysis of XMM-Newton observations revealed 13 dips in 40 observations (total exposure time of ∼0.8 Ms). Among them, four observations show two dips, separated by ∼4.01 hr. Dip depths and durations are variable. The dips occur only during low-luminosity states ({L}0.2{--12}< 1× {10}38 erg s‑1), while the source reaches {L}0.2{--12}∼ 2.8× {10}38 erg s‑1. We propose that this system is a new dipping low-mass X-ray binary in M31 seen at high inclination (60°–80°) the observed dipping periodicity is the orbital period of the system. A blue HST source within the Chandra error circle is the most likely optical counterpart of the accretion disk. The high luminosity of the system makes it the most luminous (not ULX) dipper known to date.
Wang, Xinwei; Tian, Hongwei; Cui, Xiaoqiang; Zheng, Weitao; Liu, Yichun
2014-09-14
We successfully synthesized mesoporous Zn(x)Cd(1-x)S/reduced graphene oxide (Z(x)CSG) hybrid materials as photocatalysts using a facile one-pot hydrothermal reaction, in which graphene oxide (GO) was easily reduced (RGO), and simultaneously Zn(x)Cd(1-x)S (Z(x)CS) nanoparticles (NPs) with a mesoporous structure were uniformly dispersed on the RGO sheets. By well tuning the band gap from 3.42 to 2.21 eV by changing the molar ratio of Zn/Cd (or Zn content), Z(x)CSG with an optimal zinc content has been found to have a significant absorption in the visible light (VL) region. In addition, under VL irradiation (λ > 420 nm), Z(x)CSG also showed zinc content-dependent photocatalytic efficiencies for the degradation of methylene blue (MB). Our findings are that, among Z(x)CSG, Z(0.4)CSG displayed not only a superior photodegradation efficiency of MB (98%), but also good removal efficiency of total organic carbon (TOC) (67%). Furthermore, Z(0.4)CSG had a high photocatalytic stability, and could be used repeatedly. The enhanced photocatalytic activity for Z(0.4)CSG could be attributed to a synergistic effect between mesoporous Z(x)CS NPs and RGO, including the optimal band gap and the moderate conduction band position for ZxCS (compared to CdS), efficient separation and transfer ability of photogenerated electron/hole pairs in the presence of RGO sheets, and relatively high surface area for both mesoporous Z(x)CS NPs and RGO.
X-ray and neutron techniques for nanomaterials characterization
2016-01-01
Fifth volume of a 40 volume series on nanoscience and nanotechnology, edited by the renowned scientist Challa S.S.R. Kumar. This handbook gives a comprehensive overview about X-ray and Neutron Techniques for Nanomaterials Characterization. Modern applications and state-of-the-art techniques are covered and make this volume an essential reading for research scientists in academia and industry.
Preparation of CuIn1-xGaxS2 (x = 0.5) flowers consisting of nanoflakes via a solvothermal method
International Nuclear Information System (INIS)
Liang Xiaojuan; Zhong Jiasong; Yang Fan; Hua Wei; Jin Huaidong; Liu Haitao; Sun Juncai; Xiang Weidong
2011-01-01
Highlights: → We report for the first time a small biomolecule-assisted route using L-cysteine as sulfur source and complexing agent to synthesis CuIn 0.5 Ga 0.5 S 2 crystals. → The possible mechanisms leading to CuIn 0.5 Ga 0.5 S 2 flowers consisting of nanoflakes were proposed. → In addition, the morphology, structure, and phase composition of the as-prepared CuIn 0.5 Ga 0.5 S 2 products were investigated in detail by XRD, FESEM, EDS, XPS, TEM (HRTEM) and SAED. - Abstract: CuIn 1-x Ga x S 2 (x = 0.5) flowers consisting of nanoflakes were successfully prepared by a biomolecule-assisted solvothermal route at 220 deg. C for 10 h, employing copper chloride, gallium chloride, indium chloride and L-cysteine as precursors. The biomolecule L-cysteine acting as sulfur source was found to play a very important role in the formation of the final product. The diameter of the CuIn 0.5 Ga 0.5 S 2 flowers was 1-2 μm, and the thickness of the flakes was about 15 nm. The obtained products were characterized by X-ray diffraction (XRD), energy dispersion spectroscopy (EDS), X-ray photoelectron spectroscopy (XPS), field-emission scanning electron microscopy (FESEM), transmission electron microscopy (TEM), high-resolution transmission electron microscopy (HRTEM), selected area electron diffraction spectroscopy (SAED), and UV-vis absorption spectroscopy. The influences of the reaction temperature, reaction time, sulfur source and the molar ratio of Cu-to-L-cysteine (reactants) on the formation of the target compound were investigated. The formation mechanism of the CuIn 0.5 Ga 0.5 S 2 flowers consisting of flakes was discussed.
Effect of composition on SILAR deposited CdxZn1-xS thin films
Ashith V., K.; Gowrish Rao, K.
2018-04-01
In the group of II-VI compound semiconductor, cadmium zinc sulphide (CdxZn1-xS) thin films have broad application in photovoltaic, optoelectronic devices etc. For heterojunction aspects, CdxZn1-xS thin film can be used as heterojunction partner for CdTe as the absorber layer. In this work, CdZnS thin films prepared on glass substrates by Successive Ion Layer Adsorption and Reaction (SILAR) method by varying the composition. The XRD patterns of deposited films showed polycrystalline with the hexagonal phase. The crystallite size of the films was estimated from W-H plot. The bond length of the film varied w.r.to the composition of the CdxZn1-xS films. The urbach energy of the films was calcualted from absorbance data.
International Nuclear Information System (INIS)
Alkire, R.W.; Vergamini, P.J.; Larson, A.C.; Morosin, B.
1984-01-01
Room-temperature (293 K) single-crystal structure determinations of the isostructural materials Tl 3 PSe 4 and Tl 3 AsS 4 were performed at the Los Alamos National Laboratory Pulsed Neutron Facility. For Tl 3 PSe 4 : Msub(r) = 959.92, Pcmn, a = 9.276 (1), b = 11.036 (2), c = 9.058 (1) A, V = 927.27 A 3 , Z = 4, Dsub(m) = 6.87 (2), Dsub(x) = 6.876 Mg m -3 , lambdasub(neutron) = 0.5 → 5.2 A, F(000) = 252.5 fm. For Tl 3 AsS 4 : Msub(r) = 816.29, Pcmn, a = 9.084 (3), b = 10.877 (3), c = 8.877 (3) A, V = 877.11 A 3 , Z = 4, Dsub(m) = 6.18 (2), Dsub(x) = 6.181 Mg m -3 , lambdasub(neutron) = 0.5 → 5.2 A, F(000) = 177.2 fm. For Tl 3 PSe 4 (Tl 3 AsS 4 ), 1929 (1013) reflections were measured with I > 3sigma(I) and refined by full-matrix least squares to R(F) = 0.061 (0.063). Results on atomic refinement from this study represent an order of magnitude increase in precision over previous single-crystal X-ray structural work using Mo Kα radiation. The PSe 4 3- (AsS 4 3- ) groups have essentially tetrahedral configurations and one Tl + ion shows large anisotropic thermal motion which is structure related. (Auth.)
Metastable phases freezing from melts of reciprocal systems PbX + CdI2=CdX + PbI2 (X=S, Se, Te)
International Nuclear Information System (INIS)
Odin, I.N.; Chukichev, M.V.
2001-01-01
The transformations in the mutual PbX + CdI 2 =CdX + PbI 2 (X=S, Se, Te) systems leading to the crystallization of metastable polytypical modifications of lead iodide in metastable ternary compounds are studied for the first time. Microstructural and X-ray diffraction analyses were conducted. Their phase diagrams were constructed. The luminescence properties of the stable and metastable modifications of the lead iodide and the metastable compound Pb 4 SeI 6 were investigated. The lines 504 and 512 nm are noted in the 2H-PbI 2 cathodoluminescence spectra. The close lines - 508 and 516 nm provide for the 6R-PbI 2 modification. The metastable compound Pb 4 SeI 6 is characterized by the 769 and 868 nm lines [ru
Kataoka, Nobuyuki; Cincotti, Gabriella; Wada, Naoya; Kitayama, Ken-ichi
2011-12-12
We have developed a new 8-chip, 320 Gchip/s encoder/decoder with eight input/output ports, that can be used in 40-Gb/s PON networks. The device has been to multiplex four asynchronous 40 Gb/s users, using DPSK modulation. The transmission over 50 km has been successfully demonstrated for the first time. © 2011 Optical Society of America
International Nuclear Information System (INIS)
Oesterberg, R.; Garrett, A.
1977-01-01
The 5-S RNA (A) and the L 18 protein (B) from Escherichia coli ribosomes form one single AB complex in the concentration ranges supposed to prevail in vivo; at concentrations of L 18 higher than 40 mM there is some indication for a minor species, most probably an AB 2 species. This is indicated from the X-ray scattering titration data of the 5-S RNA/L 18 system recorded at 21 0 C in ribosomal reconstitution buffer. As a result of the 1 : 1 complex formation, there is a relatively small but defined increase in the radius of gyration from 3.61 to 3.85 nm. This result as well as the experimental scattering curve can be explained by models where it is assumed that the elongated L 18 model is quite far from the electron density centre and where protein L 18 interacts with one or both of the minor arms of the supposed Y-shaped 5-S RNA molecule. (orig.) [de
Energy Technology Data Exchange (ETDEWEB)
Xue, Cong; Li, Jianmin; Wang, Yaguang; Jiang, Guoshun; Weifeng, Liu, E-mail: liuwf@ustc.edu.cn; Zhu, Changfei, E-mail: cfzhu@ustc.edu.cn
2016-10-15
Highlights: • The CBD precipitates were utilized to fabricate the CZTS/CZTSSe solar cells. • A solvent mixture of ethanol and ammonium hydroxide was used to form SnS-Cu2O-ZnS slurry. • Formation of CZTS/CZTSSe with good crystalline quality confirmed by XRD and Raman spectra. • CZTS and CZTSSe thin film solar cells obtained the best PCE of 1.99% and 2.95%, respectively. - Abstract: In this paper, Cu{sub 2}ZnSn(S{sub x}Se{sub 1−x}){sub 4} precursor films were produced by doctor blade process from SnS-Cu{sub 2}O-ZnS slurry. To prepare the slurry, SnS, ZnS and Cu{sub 2}O precipitates, which are outgrowths of stacked layer ZnS/Cu/SnS by CBD (chemical bath deposition)-annealing route, were dissolved in the mixture solvent of ethanol and NH{sub 3}·H{sub 2}O. Synthesized precursor films were then annealed at different conditions. The post-annealed films were characterized by means of scanning electron microscopy (SEM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), Raman measurements and UV–vis–NIR spectroscopy. SEM studies reveal that the rough and relatively compact absorber thin films are obtained via the sulfidation and sulfidation-selenization processes. X-ray diffraction and Raman spectrum results verify that the obtained films are composed of Cu{sub 2}ZnSnS{sub 4} and Cu{sub 2}ZnSnSe{sub 4} phases, which have high absorbance in visible range and direct band gap energy of 1.01–1.47 eV. The best devices yield total area power conversion efficiency of 1.99% and 2.95% corresponding to Cu{sub 2}ZnSnS{sub 4} and Cu{sub 2}ZnSn(S{sub x}Se{sub 1−x}){sub 4} thin film solar cells under AM1.5 illumination without any anti-reflection layer.
A model independent determination of the B{yields}X{sub s}{gamma} decay rate
Energy Technology Data Exchange (ETDEWEB)
Bernlochner, Florian U. [Victoria Univ., BC (Canada); Lacker, Heiko [Humboldt-Universitaet, Berlin (Germany); Ligeti, Zoltan [California Univ., Berkeley, CA (United States). Ernest Orlando Lawrence Berkeley National Laboratory; Stewart, Iain W. [Massachusetts Institute of Technology, Cambridge, MA (United States). Center for Theoretical Physics; Tackmann, Frank J.; Tackmann, Kerstin [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)
2013-03-15
The goal of the SIMBA collaboration is to provide a global fit to the available measurements of inclusive B{yields}X{sub s}{gamma} and B{yields}X{sub u}l{nu} decays. By performing a global fit one is able to simultaneously determine the relevant normalizations, i.e. the total B{yields}X{sub s}{gamma} rate and the CKM-matrix element vertical stroke Vub vertical stroke, together with the required hadronic parameters, most importantly the b-quark mass and the b-quark distribution function in the B-meson, called the shape function. In this talk, the current status on the model-independent determination of the shape function and vertical stroke C{sub 7}{sup incl}V{sub tb}V{sub ts}{sup *} vertical stroke, which parametrizes the total B{yields}X{sub s}{gamma} rate, from a global fit to the available B{yields}X{sub s}{gamma} measurements from Babar and Belle is presented. In particular, the theoretical uncertainties originating from variations of the different factorization scales are evaluated.
A facile synthesis of Zn(x)Cd(1-x)S/CNTs nanocomposite photocatalyst for H2 production.
Wang, Lei; Yao, Zhongping; Jia, Fangzhou; Chen, Bin; Jiang, Zhaohua
2013-07-21
The sulfide solid solution has become a promising and important visible-light-responsive photocatalyst for hydrogen production nowadays. Zn(x)Cd(1-x)S/CNT nanocomposites were synthesized to improve the dispersion, adjust the energy band gap, and enhance the separation of the photogenerated electrons and holes. The as-prepared photocatalysts were characterized by scanning electron-microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and UV-visible diffuse reflectance spectra (UV-visible), respectively. And the effects of CNTs on structure, composition and optical absorption property of the sulfide solid solutions were investigated along with their inherent relationships. For Zn0.83Cd0.17S/CNTs, sulfide solid solution is assembled along the CNTs orderly, with a diameter of 100 nm or so. XPS analysis shows that there is bonding effect between the solid solutions and the CNTs due to the strong adsorption of Zn(2+) and Cd(2+) on the surface of CNTs. There are two obvious absorption edges for Zn0.83Cd0.17S/CNTs, corresponding to two kinds of sulfide solid solutions with different molar ratios of Zn/Cd. The hybridization of solid solutions with CNTs makes the absorption spectrum red shift. The photocatalytic property was evaluated by splitting Na2S + Na2SO3 solution into H2, and the highest rate of H2 evolution of 6.03 mmol h(-1) g(-1) was achieved over Zn0.83Cd0.17S/CNTs. The high activity of photocatalytic H2 production is attributed to the following factors: (1) the optimum band gap and a moderate position of the conduction band (which needs to match the irradiation spectrum of the Xe lamp best), (2) the efficient separation of photogenerated electrons and holes by hybridization, and (3) the improvement of the dispersion of nanocomposites by assembling along the CNTs as well.
The atomic structure of Fe100-xCux nanoalloys: X-ray absorption analysis
International Nuclear Information System (INIS)
Kravtsova, A.N.; Yalovega, G.E.; Soldatov, A.V.; Yan, W.S.; Wei, S.Q.
2009-01-01
The local atomic structure of Fe 100-x Cu x nanoalloys (x = 0, 10, 20, 40, 60, 70, 80 and 100%) has been investigated by X-ray absorption near edge structure (XANES) analysis. Local environment around copper and iron atoms in Fe 100-x Cu x has been studied by comparing the experimental XANES with corresponding theoretical spectra calculated for several structural models. It has been established that the most probable structure of the Fe 100-x Cu x nanoalloys for a low concentration of copper (x = 10-20%) is a homogenous bcc structure, for a high copper concentration (x = 60-80%)-a homogenous fcc structure, while at an intermediate copper concentration (about 40%) the nanoalloys have an inhomogeneous structure consisting of clusters of fcc solid solution (90%) and of clusters of bcc solid solution (10%)
Energy Technology Data Exchange (ETDEWEB)
Kheloufi, Nawal; Bouzid, Abderrazak, E-mail: a_bouzid34@hotmail.com
2016-06-25
We present band gap calculations of zinc-blende ternary CdS{sub x}Te{sub 1-x} semiconductors within the standard DFT and quasiparticle calculations employing pseudopotential method. The DFT, the local density approximation (LDA) and the Generalized Gradient Approximation (GGA) based calculations have given very poor results compared to experimental data. The quasiparticle calculations have been investigated via the one-shot GW approximation. The present paper discuses and confirms the effect of inclusion of the semicore states in the cadmium (Cd) pseudopotential. The obtained GW quasiparticle band gap using Cd{sup +20} pseudopotential has been improved compared to the obtained results from the available pseudopotential without the treatment of semicore states. Our DFT and quasiparticle band gap results are discussed and compared to the available theoretical calculations and experimental data. - Graphical abstract: Band gaps improvement concerning the binary and ternary alloys using the GW approximation and Cd{sup 20+} pseudopotential with others levels of approximations (the LDA and GGA approximation employing the Cd{sup 12+} and the LDA within Cd{sup 20+} pseudopotential). - Highlights: • The direct Γ- Γ and indirect Γ- X and Γ- L bands gaps show a nonlinear behavior when S content is enhanced. • The quasiparticle band gap result for the investigated semiconductors is improved using the GW approximation. • All CdS{sub x}Te{sub 1-x} compounds in all compositions range from 0 to 1 are direct band gap semiconductors.
The Growth of Interest in Astronomical X-Ray Polarimetry
Directory of Open Access Journals (Sweden)
Frédéric Marin
2018-03-01
Full Text Available Astronomical X-ray polarimetry was first explored in the end of the 1960s by pioneering rocket instruments. The craze arising from the first discoveries of stellar and supernova remnant X-ray polarization led to the addition of X-ray polarimeters to early satellites. Unfortunately, the inadequacy of the diffraction and scattering technologies required to measure polarization with respect to the constraints driven by X-ray mirrors and detectors, coupled with long integration times, slowed down the field for almost 40 years. Thanks to the development of new, highly sensitive, compact X-ray polarimeters in the beginning of the 2000s, observing astronomical X-ray polarization has become feasible, and scientists are now ready to explore our high-energy sky thanks to modern X-ray polarimeters. In the forthcoming years, several X-ray missions (rockets, balloons, and satellites will create new observational opportunities. Interest in astronomical X-ray polarimetry field has thus been renewed, and this paper presents for the first time a quantitative assessment, all based on scientific literature, of the growth of this interest.
Optoelectronic Properties of X-Doped (X = O, S, Te) Photovoltaic CSe with Puckered Structure.
Zhang, Qiang; Xin, Tianyuan; Lu, Xiaoke; Wang, Yuexia
2018-03-16
We exploited novel two-dimensional (2D) carbon selenide (CSe) with a structure analogous to phosphorene, and probed its electronics and optoelectronics. Calculating phonon spectra using the density functional perturbation theory (DFPT) method indicated that 2D CSe possesses dynamic stability, which made it possible to tune and equip CSe with outstanding properties by way of X-doping (X = O, S, Te), i.e., X substituting Se atoms. Then systematic investigation on the structural, electronic, and optical properties of pristine and X-doped monolayer CSe was carried out using the density functional theory (DFT) method. It was found that the bonding feature of C-X is intimately associated with the electronegativity and radius of the doping atoms, which leads to diverse electronic and optical properties for doping different group VI elements. All the systems possess direct gaps, except for O-doping. Substituting O for Se atoms in monolayer CSe brings about a transition from a direct Γ-Γ band gap to an indirect Γ-Y band gap. Moreover, the value of the band gap decreases with increased doping concentration and radius of doping atoms. A red shift in absorption spectra occurs toward the visible range of radiation after doping, and the red-shift phenomenon becomes more obvious with increased radius and concentration of doping atoms. The results can be useful for filtering doping atoms according to their radius or electronegativity in order to tailor optical spectra efficiently.
Optoelectronic Properties of X-Doped (X = O, S, Te Photovoltaic CSe with Puckered Structure
Directory of Open Access Journals (Sweden)
Qiang Zhang
2018-03-01
Full Text Available We exploited novel two-dimensional (2D carbon selenide (CSe with a structure analogous to phosphorene, and probed its electronics and optoelectronics. Calculating phonon spectra using the density functional perturbation theory (DFPT method indicated that 2D CSe possesses dynamic stability, which made it possible to tune and equip CSe with outstanding properties by way of X-doping (X = O, S, Te, i.e., X substituting Se atoms. Then systematic investigation on the structural, electronic, and optical properties of pristine and X-doped monolayer CSe was carried out using the density functional theory (DFT method. It was found that the bonding feature of C-X is intimately associated with the electronegativity and radius of the doping atoms, which leads to diverse electronic and optical properties for doping different group VI elements. All the systems possess direct gaps, except for O-doping. Substituting O for Se atoms in monolayer CSe brings about a transition from a direct Γ-Γ band gap to an indirect Γ-Y band gap. Moreover, the value of the band gap decreases with increased doping concentration and radius of doping atoms. A red shift in absorption spectra occurs toward the visible range of radiation after doping, and the red-shift phenomenon becomes more obvious with increased radius and concentration of doping atoms. The results can be useful for filtering doping atoms according to their radius or electronegativity in order to tailor optical spectra efficiently.
Pratt & Whitney Advanced Ducted Propulsor (ADP) Engine Test in 40x80ft w.t.: Engineers Peter
1993-01-01
Pratt & Whitney Advanced Ducted Propulsor (ADP) Engine Test in 40x80ft w.t.: Engineers Peter Zell (left) and Dr Clifton Horne (right) are shown preparing a laser light sheet for a flow visualization test. Shown standing in the nacelle of the ADP is John Girvin, senior test engineer for Pratt & Whitney.
Tuning the energy band gap of ternary alloyed Cd1-xPbxS quantum dots for photovoltaic applications
Badawi, Ali
2016-02-01
Tuning the energy band gap of ternary alloyed Cd1-xPbxS (x: 0, 0.33, 0.5, 0.67 and 1) quantum dots (QDs) for photovoltaic applications is studied. Alloyed Cd1-xPbxS QDs were adsorbed onto TiO2 nanoparticles (NPs) using ssuccessive ionic layer adsorption and reaction (SILAR) methode. EDX measurements ensure the success adsorption of alloyed Cd1-xPbxS QDs onto the TiO2 electrode. At 100 mW/cm2 (AM 1.5) sun illumination, the photovoltaic performance of alloyed Cd1-xPbxS QDs sensitized solar cells (QDSSCs) was measured. The maximum values of Jsc (1.92 mA/cm2) and η (0.36%) for the alloyed Cd1-xPbxS QDSSCs were obtained when the molar ratio of Cd/Pb is 0.33/0.67. the open circuit voltage (Voc) is equal 0.61 ± 0.01 V for all alloyed Cd1-xPbxS QDSSCs. The electron back recombination rates decrease considerably for alloyed Cd1-xPbxS QDSSCs as x value increases, peaking at 0.67. The electron lifetime (τ) for Cd0.33Pb0.67S QDSSCs is one order of magnitude larger than that of the other alloyed Cd1-xPbxS QDSSCs with different x value. Under ON-OFF cycles to solar illumination, the open circuit voltage decay measurements show the high sensitivity and reproducibility of alloyed Cd1-xPbxS QDSSCs.
SL(2, Z) invariant rotating (m, n) strings in AdS_3 x S"3 with mixed flux
International Nuclear Information System (INIS)
Barik, M.S.P.; Panigrahi, Kamal L.; Khouchen, Malak; Kluson, Josef
2017-01-01
We study rigidly rotating and pulsating (m, n) strings in AdS_3 x S"3 with mixed three form flux. The AdS_3 x S"3 background with mixed three form flux is obtained in the near horizon limit of SL(2, Z)-transformed solution, corresponding to the bound state of NS5-branes and fundamental strings. We study the probe (m, n)-string in this background by solving the manifest SL(2, Z)-covariant form of the action. We find the dyonic giant magnon and single spike solutions corresponding to the equations of motion of a probe string in this background and find various relationships among the conserved charges. We further study a class of pulsating (m, n) string in AdS_3 with mixed three form flux. (orig.)
Zhang, Qingyun; Schwingenschlögl, Udo
2018-04-01
Using first-principles calculations, we investigate the electronic properties of the two-dimensional Ga X /MX 2 (M = Mo, W; X = S, Se, Te) heterostructures. Orbital hybridization between Ga X and MX 2 is found to result in Rashba splitting at the valence-band edge around the Γ point, which grows for increasing strength of the spin-orbit coupling in the p orbitals of the chalcogenide atoms. The location of the valence-band maximum in the Brillouin zone can be tuned by strain and application of an out-of-plane electric field. The coexistence of Rashba splitting (in-plane spin direction) and band splitting at the K and K' valleys (out-of-plane spin direction) makes Ga X /MX 2 heterostructures interesting for spintronics and valleytronics. They are promising candidates for two-dimensional spin-field-effect transistors and spin-valley Hall effect devices. Our findings shed light on the spin-valley coupling in van der Waals heterostructures.
Wang, Shufen; Yuan, Jiuchuang; Li, Huixing; Chen, Maodu
2017-08-02
In order to study the dynamics of the reaction H( 2 S) + NaH(X 1 Σ + ) → Na( 2 S) + H 2 (X 1 Σ g + ), a new potential energy surface (PES) for the ground state of the NaH 2 system is constructed based on 35 730 ab initio energy points. Using basis sets of quadruple zeta quality, multireference configuration interaction calculations with Davidson correction were carried out to obtain the ab initio energy points. The neural network method is used to fit the PES, and the root mean square error is very small (0.00639 eV). The bond lengths, dissociation energies, zero-point energies and spectroscopic constants of H 2 (X 1 Σ g + ) and NaH(X 1 Σ + ) obtained on the new NaH 2 PES are in good agreement with the experiment data. On the new PES, the reactant coordinate-based time-dependent wave packet method is applied to study the reaction dynamics of H( 2 S) + NaH(X 1 Σ + ) → Na( 2 S) + H 2 (X 1 Σ g + ), and the reaction probabilities, integral cross-sections (ICSs) and differential cross-sections (DCSs) are obtained. There is no threshold in the reaction due to the absence of an energy barrier on the minimum energy path. When the collision energy increases, the ICSs decrease from a high value at low collision energy. The DCS results show that the angular distribution of the product molecules tends to the forward direction. Compared with the LiH 2 system, the NaH 2 system has a larger mass and the PES has a larger well at the H-NaH configuration, which leads to a higher ICS value in the H( 2 S) + NaH(X 1 Σ + ) → Na( 2 S) + H 2 (X 1 Σ g + ) reaction. Because the H( 2 S) + NaH(X 1 Σ + ) → Na( 2 S) + H 2 (X 1 Σ g + ) reaction releases more energy, the product molecules can be excited to a higher vibrational state.
Directory of Open Access Journals (Sweden)
Dahua Ren
2017-09-01
Full Text Available Ab initio calculations of lattice constants, lattice stabilities of ZnX (X=O, S, Se, Te at different electronic temperatures (Te have been performed using generalized gradient approximation (GGA pseudopotential method within the density functional theory (DFT. The calculated phonon frequencies of ZnX at Te = 0 eV accord well with the experimental and other theoretical values. Firstly, it is indicated that the lattice constants of ZnX increase and all the phonon frequencies reduce as Te increases. Additionally, the transverse-acoustic phonon frequencies of ZnX are imaginary with the elevation of Te, namely the lattices of ZnX become unstable under ultrafast intense laser irradiation. Moreover, the transverse optical mode-longitudinal optical mode (LO-TO splitting degree of ZnX (X=S, Se, Te gradually decreases as the electronic temperature increases, mainly due to the reason that the electronic excitation weakens the strength ionicity of ionic crystal ZnX under intense laser irradiation. However, the LO-TO splitting degree of ZnO firstly increases and then decreases with the increase of electronic temperature. After that, it can be helpful for understanding the mechanism of ultrafast intense laser induced semiconductors damage.
$X_{b}$ Search and Measurement of the $Y(1)$, $(2S)$ and $Y(3S)$ Polarization
Energy Technology Data Exchange (ETDEWEB)
Marino, Claudia [Karlsruhe Inst. of Technology (KIT) (Germany)
2009-10-30
There are two studies presented in this analysis. The rst one is the measurement of the Υ(1S), Υ(2S) and Υ(3S) polarization in two orthogonal frames: the helicity and the Collins-Soper frame. The second is the search for a possible bottom counterpart of the X(3872) which would show up as a narrow resonance in the Υ(1S)π+ π- nal state.
Low temperature features of the local structure of Sm1-xYxS
International Nuclear Information System (INIS)
Menushenkov, A. P.; Chernikov, R. V.; Sidorov, V. V.; Klementiev, K. V.; Alekseev, P. A.; Rybina, A. V.
2007-01-01
The particular features of the local electronic and local crystal structures of the mixed-valence compound Sm 1-x Y x S are studied by the XAFS spectroscopy methods in the temperature range 20-300 K for the yttrium concentration x = 0.17, 0.25, 0.33, and 0.45. The temperature behavior of the valence of Sm, as well as of the lengths and the Debye-Waller factors of the bonds Sm-S, Sm-Sm(Y), Y-S, and Y-Sm(Y), has been determined. The violation of the Vegard law has been observed. A model for the estimation of the energy width of the 4f level and of its position with respect to the Fermi level is proposed
Weighted oscillator strengths and lifetimes for the S IX and S X spectra
International Nuclear Information System (INIS)
Borges, F.O.; Cavalcanti, G.H.; Trigueiros, A.G.
2003-01-01
The weighted oscillator strengths (gf) and the lifetimes presented in this work were carried out in a multi configuration Hartree-Fock relativistic (HFR) approach. In this calculation, the electrostatic parameters were optimized by a least-squares procedure, in order to improve the adjustment to experimental energy levels. This method produces gf-values that are in better agreement with intensity observations and lifetime values that are closer to the experimental ones. In this work, we presented all the experimentally known electric dipole S IX and S X spectral lines
X-Pinch soft x-ray source for microlithography
International Nuclear Information System (INIS)
Glidden, S.C.; Hammer, D.A.; Kalantar, D.H.; Qi, N.
1993-01-01
The x-pinch soft x-ray source is described for application in submicron resolution lithography. Experiments have been performed to characterize the radiation emitted from magnesium wire x-pinch plasmas using an 80 ns, ≤500 kA pulse. Yields of 14.2 J averaged over three independent calibrated diagnostics at 445 kA have been measured in magnesium K-shell radiation (predominantly 8.4 angstrom to 9.4 angstrom or 1.5 keV to 1.3 keV) from a submillimeter source, with as little as 5-10% of the yield below the 6.74 angstrom silicon absorption edge. A new ≤700 kA, 100 ns pulser being used for x-pinch physics experiments is described. The design of a 40 pulse per second pulsed power system and wire loading mechanism for exposing a resist in 1 second at a distance 40 cm is presented
José Luis Ramírez Castro; Nora Elena Durango Calle; Juan Carlos Herrera Patiño; Gloria C. Ramírez Gaviria
2000-01-01
One out of 400 to 500 living newborns show sex chromosome abnormalities. Usually, the clinic characteristics due to alteration of those chromosomes are less severe than those produced by autosomic imbalance. This tolerance of the developing fetus to the excess or deficit in the X chromosome material, may be due, at least in part, to the presence of compensatory mechanisms related with the inactivation or not of the genetic material. Turner’s syndrome is characterized by short stature, primary...
Supersymmetric AdS{sub 2} x Σ{sub 2} solutions from tri-sasakian truncation
Energy Technology Data Exchange (ETDEWEB)
Karndumri, Parinya [Chulalongkorn University, String Theory and Supergravity Group, Department of Physics, Faculty of Science, Bangkok (Thailand)
2017-10-15
A class of AdS{sub 2} x Σ{sub 2}, with Σ{sub 2} being a two-sphere or a hyperbolic space, solutions within four-dimensional N = 4 gauged supergravity coupled to three-vector multiplets with dyonic gauging is identified. The gauged supergravity has a non-semisimple SO(3) x (T{sup 3}, T{sup 3}) gauge group and can be obtained from a consistent truncation of 11-dimensional supergravity on a tri-sasakian manifold. The maximally symmetric vacua contain AdS{sub 4} geometries with N = 1, 3 supersymmetry corresponding to N = 1 and N = 3 superconformal field theories (SCFTs) in three dimensions. We find supersymmetric solutions of the form AdS{sub 2} x Σ{sub 2} preserving two supercharges. These solutions describe twisted compactifications of the dual N = 1 and N = 3 SCFTs and should arise as near horizon geometries of dyonic black holes in asymptotically AdS{sub 4} space-time. Most solutions AdS{sub 2} x Σ{sub 2} geometries with known M-theory origin. (orig.)
Fuchs, Gabriele; Petrov, Alexey N; Marceau, Caleb D; Popov, Lauren M; Chen, Jin; O'Leary, Seán E; Wang, Richard; Carette, Jan E; Sarnow, Peter; Puglisi, Joseph D
2015-01-13
Translation initiation can occur by multiple pathways. To delineate these pathways by single-molecule methods, fluorescently labeled ribosomal subunits are required. Here, we labeled human 40S ribosomal subunits with a fluorescent SNAP-tag at ribosomal protein eS25 (RPS25). The resulting ribosomal subunits could be specifically labeled in living cells and in vitro. Using single-molecule Förster resonance energy transfer (FRET) between RPS25 and domain II of the hepatitis C virus (HCV) internal ribosome entry site (IRES), we measured the rates of 40S subunit arrival to the HCV IRES. Our data support a single-step model of HCV IRES recruitment to 40S subunits, irreversible on the initiation time scale. We furthermore demonstrated that after binding, the 40S:HCV IRES complex is conformationally dynamic, undergoing slow large-scale rearrangements. Addition of translation extracts suppresses these fluctuations, funneling the complex into a single conformation on the 80S assembly pathway. These findings show that 40S:HCV IRES complex formation is accompanied by dynamic conformational rearrangements that may be modulated by initiation factors.
Reduced extracellular space in the brain of tenascin-R- and HNK-1-sulphotransferase deficient mice
Czech Academy of Sciences Publication Activity Database
Syková, Eva; Voříšek, Ivan; Mazel, Tomáš; Antonova, Tatiana; Schachner, M.
2005-01-01
Roč. 22, č. 8 (2005), s. 1873-1880 ISSN 0953-816X R&D Projects: GA ČR(CZ) GA309/04/0753; GA MŠk(CZ) 1M0538 Institutional research plan: CEZ:AV0Z50390512 Keywords : diffusion * extracellular matrix Subject RIV: FH - Neurology Impact factor: 3.949, year: 2005
Czech Academy of Sciences Publication Activity Database
Noristani, H. N.; Olabarria, M.; Verkhratsky, Alexei; Rodríguez Arellano, Jose Julio
2010-01-01
Roč. 32, č. 1 (2010), s. 71-79 ISSN 0953-816X R&D Projects: GA ČR GA309/09/1696; GA ČR GA305/08/1384 Institutional research plan: CEZ:AV0Z50390703 Keywords : Alzheimer's disease * hippocampus * plasticity Subject RIV: FH - Neurology Impact factor: 3.658, year: 2010
Czech Academy of Sciences Publication Activity Database
Kubová, Hana; Mareš, Pavel; Suchomelová, Lucie; Brožek, Gustav; Druga, Rastislav; Pitkanen, A.
2004-01-01
Roč. 19, č. 12 (2004), s. 3255-3265 ISSN 0953-816X R&D Projects: GA MZd NF6474; GA ČR GA309/01/0285 Institutional research plan: CEZ:AV0Z5011922 Keywords : epilepsy * elevated plus-maze * Morris water-maze Subject RIV: FH - Neurology Impact factor: 3.820, year: 2004
Investigation of inclusive processes π-A → π-X and πsup(-)A → Psub(backwards)X at 40 GeV/c
International Nuclear Information System (INIS)
Abrosimov, A.T.
1984-01-01
The study of the inclusive processe is peformed for nuclear targets: C, Al, Cu, Pb t 40 GeV/c. Inclusive spectra of negative pions are obtained in the region 0.1 - A → Psub(backward)X is studied in the 0.3-1 GeV/c region of secondary protons. Invariant cross sections of proton flying out in the back hemisphere are measured for the 120 deg - 175 deg angle interval. The A-dependece of the invariant cross section for this process is discussed
International Nuclear Information System (INIS)
Wells, R.P.
1985-11-01
Stress and deflection of the grid rails of the existing, Lawrence Berkeley Laboratory (LBL) designed, 10 x 40 cm Long Pulse (neutral beam) Accelerator (40LPA) and the expanded 12 x 48 cm version, Common Long Pulse Source (CLPS), have been computed for a series of assumed heat load distributions. The combined stress from self-constraint of thermal expansion and rail holder reaction forces has been calculated. A simplification of the gradient grid rail holder was analyzed and was found to work as well or better than the original 40LPA design under the most probable operating conditions. Heat flux non-uniformity over the rail surface for both accelerator designs was estimated from 40LPA grid calorimetry data for arc and beam extraction operation. The extrapolated total heat load per rail for the CLPS was less than the 1.2 kW value used in this analysis. Under worst case assumptions, the maximum equivalent stress in any of the molybdenum grid rails was less than 20% of yield. For the anticipated heat load distribution on the gradient grid, the predicted deflection of the grid rail meets the 0.0457 mm position tolerance except under extremely non-uniform heat loads
International Nuclear Information System (INIS)
Wells, R.P.
1986-01-01
Stress and deflection of the grid rails of the existing, Lawrence Berkeley Laboratory (LBL) designed, 10 x 40 cm Long Pulse (neutral beam) Accelerator (40LPA) and the expanded 12 x 48 cm version, Common Long Pulse Source (CLPS), have been computed for a series of assumed heat load distributions. The combined stress from self-constraint of thermal expansion and rail holder reaction forces has been calculated. A simplification of the gradient grid rail holder was analyzed and was found to work as well or better than the original 40LPA design under the most probable operating conditions. Heat flux non-uniformity over the rail surface for both accelerator designs was estimated from 40LPA grid calorimetry data for arc and beam extraction operation. The extrapolated total heat load per rail for the CLPS was less than the 1.2 kW value used in this analysis. Under worst case assumptions, the maximum equivalent stress in any of the molybdenum grid rails was less than 20% of yield. For the anticipated heat load distribution on the gradient grid, the predicted deflection of the grid rail meets the 0.0457 mm position tolerant except under extremely non-uniform heat loads
Energy Technology Data Exchange (ETDEWEB)
Tagiyev, B.G. [Institute of Physics of Azerbaijan National Academy of Sciences, 131 H.Javid ave., Baku Az-1143 (Azerbaijan); Tagiyev, O.B. [Institute of Physics of Azerbaijan National Academy of Sciences, 131 H.Javid ave., Baku Az-1143 (Azerbaijan); Baku Branch of M.V. Lomonosov Moscow State University, Baku AZ-1143 (Azerbaijan); Mammadov, A.I. [Institute of Physics of Azerbaijan National Academy of Sciences, 131 H.Javid ave., Baku Az-1143 (Azerbaijan); Quang, Vu Xuan [Institute of Research and Development, Duy Tan University, 550000 Da Nang (Viet Nam); Naghiyev, T.G., E-mail: tural@nagiyev.net [Institute of Physics of Azerbaijan National Academy of Sciences, 131 H.Javid ave., Baku Az-1143 (Azerbaijan); Jabarov, S.H. [Institute of Physics of Azerbaijan National Academy of Sciences, 131 H.Javid ave., Baku Az-1143 (Azerbaijan); Bayerisches Geoinstitute, University Bayreuth, d-95440 Bayreuth (Germany); Leonenya, M.S.; Yablonskii, G.P. [Institute of Physics of National Academy Sciences of Belarus, 220072 Minsk (Belarus); Dang, N.T. [Institute of Research and Development, Duy Tan University, 550000 Da Nang (Viet Nam)
2015-12-01
The structural and luminescence properties of chalcogenide semiconductor Ca{sub x}Ba{sub 1−x}Ga{sub 2}S{sub 4} solid solutions (x=0.1–0.9) doped with 7 at% of Eu{sup 2+} ions were studied at room temperature. It was found, that the crystal structure of Ca{sub x}Ba{sub 1−x}Ga{sub 2}S{sub 4} solid solutions varies with the amount of Ca{sup 2+} cations and phase transition from cubic to orthorhombic takes place with increase of x value. Ca{sub x}Ba{sub 1−x}Ga{sub 2}S{sub 4}:Eu{sup 2+} solid solutions exhibit intense photoluminescence in cyan to yellow spectral region depending on x due to 5d→4f electron–dipole transitions in Eu{sup 2+} ions. The peak position of the emission band shifts from 506 nm for x=0.1 to 555 nm for x=0.9 and the full width at half maximum of the emission band varies from 62 nm to 72 nm depending on the symmetry of the crystal lattice. The PL excitation spectrum of Ca{sub x}Ba{sub 1−x}Ga{sub 2}S{sub 4}:Eu{sup 2+} covers the range at half maximum from 310 nm to 480 nm for x=0.1 and to 520 nm for x=0.9. It was shown that long-wavelength shift is caused by influence of the growing crystal field strength on Eu{sup 2+} ions.
Preparation and characterization of Keggin-type heteropolysalts, CoxPMo12O40 (x = 0–1.5
Directory of Open Access Journals (Sweden)
Mazari T.
2013-09-01
Full Text Available Polyoxometalates (POMs, based transition-metal oxide clusters, have received much attention in various fields such as catalysis, photochemistry, nonlinear optics, biology and medicine [1]. Their physico-chemical, acidic and oxidative properties can be adjusted according with the nature of constituent elements [2]. In the field of catalysis, the most studied POMs are those with the Keggin. They were tested in wide variety of reactions in homogeneous and heterogeneous phases. In the redox processes, the nature of counter- cation in the [PMo12O40]3− system can play a significant role. Thus, it has been shown that using Fe(III, vanadyl(VO2+, antimony (Sb3+ or cobalt (Co2+ counter-cation develop a more favourable distribution of both reduced Mo(V and oxidized Mo(VI sites [3]. In the present work we report the synthesis and characterization using several techniques of Keggin-type heteropolysalts of composition H3−2xCoxPMo12O40(x = 0 − 1.5 denoted as CoxPMo12.
Quantum mechanically guided design of Co43Fe20Ta5.5X31.5 (X=B, Si, P, S) metallic glasses
International Nuclear Information System (INIS)
Hostert, C; Music, D; Schneider, J M; Bednarcik, J; Keckes, J
2012-01-01
A systematic ab initio molecular dynamics study was carried out to identify valence electron concentration and size induced changes on structure, elastic and magnetic properties for Co 43 Fe 20 Ta 5.5 X 31.5 (X=B, Si, P, S). Short range order, charge transfer and the bonding nature are analyzed by means of density of states, Bader decomposition and pair distribution function analysis. A clear trend of a decrease in density and bulk modulus as well as a weaker cohesion was observed as the valence electron concentration is increased by replacing B with Si and further with P and S. These changes may be understood based on increased interatomic distances, variations in coordination numbers and the electronic structure changes; as the valence electron concentration of X is increased the X bonding becomes more ionic, which disrupts the overall metallic interactions, leading to lower cohesion and stiffness. The highest magnetic moments for the transition metals are identified for X=S, despite the fact that the presence of X generally reduces the magnetic moment of Co. Furthermore, this study reveals an extended diagonal relationship between B and P within these amorphous alloys. Based on quantum mechanical data we identify composition induced changes in short range order, charge transfer and bonding nature and link them to density, elasticity and magnetism. The interplay between transition metal d band filling and s-d hybridization was identified to be a key materials design criterion. (paper)
Finite size giant magnons in the SU(2) x SU(2) sector of AdS4 x CP3
International Nuclear Information System (INIS)
Lukowski, Tomasz; Sax, Olof Ohlsson
2008-01-01
We use the algebraic curve and Luescher's μ-term to calculate the leading order finite size corrections to the dispersion relation of giant magnons in the SU(2) x SU(2) sector of AdS 4 x CP 3 . We consider a single magnon as well as one magnon in each SU(2). In addition the algebraic curve computation is generalized to give the leading order correction for an arbitrary multi-magnon state in the SU(2) x SU(2) sector.
Energy Technology Data Exchange (ETDEWEB)
Huang, Meina; Yu, Jianhua; Deng, Changshun [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Huang, Yingheng [School of Materials Science and Engineering, Guangxi University, Nanning 530004 (China); Fan, Minguang, E-mail: fanmg@gxu.edu.cn [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Guangxi Key Laboratory Petrochemical Resource Processing and Process Intensification Technology, Nanning 530004 (China); Li, Bin; Tong, Zhangfa; Zhang, Feiyue [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Dong, Lihui, E-mail: donglihui2005@126.com [School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China)
2016-03-01
Graphical abstract: - Highlights: • 3D nanospherical Cd{sub x}Zn{sub 1−x}S/graphene was synthesized via solvothermal method. • Performance evaluation was carried out under visible light irradiation. • Samples show excellent photocatalytic activities and photocorrosion resistance. • A possible photocatalytic and anti-corrosion mechanism is proposed. • The structural effects of 3D nanosphere explain excellent performance. - Abstract: Herein, a series of Cd{sub x}Zn{sub 1−x}S and sulfide/graphene photocatalysts with 3D nanospherical framework have been successfully fabricated by one-pot solvothermal method for the first time. The morphology and structure of samples were confirmed by X-ray diffraction (XRD), field-emission scanning electron microscopy (FESEM), high-resolution transmission electron microscopy (HRTEM), energy-dispersive X-ray (EDX) spectrometry, N{sub 2} adsorption, Fourier transform infrared spectroscopy (FT-IR), X-ray photoelectron spectroscopy (XPS) and ultraviolet–visible diffuse reflectance spectroscopy (UV–vis DRS). The as-prepared samples exhibit excellent photocatalytic activities and photocorrosion resistance in the degradation of dyes under visible light. The Cd{sub 0.5}Zn{sub 0.5}S/rGO sample shows the most efficient in the photodegradation of methyl orange (MO). It takes about 30 min for degradation completely. The enhanced photocatalytic activity is mainly attributed to the slow photon enhancement of the 3D structure, and the heterojunction between the 3D nanospherical Cd{sub 0.5}Zn{sub 0.5}S solid solutions and a high quality 2D rGO support, which can greatly promote the separation of light-induced electrons and holes. Moreover, the large S{sub BET} and extended light absorption range also play an important role for improving the photocatalytic activity. The high photocatalytic stability is due to the successful inhibition of the photocorrosion of Cd{sub 0.5}Zn{sub 0.5}S/rGO by forming heterojunction between CdS and ZnS
International Nuclear Information System (INIS)
Diesener, H.; Helm, U.; Huck, V.; Neumann-Cosel, P. von; Rangacharyulu, C.; Richter, A.; Schrieder, G.; Stascheck, A.; Strauch, S.; Ryckebusch, J.; Carter, J.
2001-01-01
The present article is the second out of three on a study of the 40 Ca(e,e'x) reaction discussing the multipole decomposition of the measured cross sections and the analysis of angular correlations. The decomposition of the strongly overlapping E0, E1 and E2 giant resonance strengths using the (e,e'x; x=p,α) reaction in 40 Ca is discussed for excitation energies between 10 and about 21 MeV. Two extraction methods are presented based on the variation of the form factors for the different multipoles. The resulting B(E1) strength distribution is in good agreement with (γ,x) photoabsorption data. The summed B(E2) and B(E0) strength is highly fragmented and spread out over the energy region investigated. Microscopic continuum RPA calculations including the coupling of the basic particle-hole states to the low-lying surface vibrations are capable of reproducing the strength distributions quite accurately. Exhaustion of the energy-weighted sum rules (EWSR) for the various decay channels is presented. A complete decomposition of E0, E1 and E2 contributions in 40 Ca is possible for (e,e'α) angular correlations populating the 36 Ar ground state. Contrary to expectations, the form factors of isoscalar E0 and E2 strengths in the 40 Ca(e,e'α 0 ) reaction exhibit increasing differences towards smaller momentum transfers. Angular correlations for proton decay into low-lying states of 39 K are compared to a self-consistent continuum RPA calculation which allows a systematic description of the strong variations observed as a function of 40 Ca excitation energy and momentum transfer. The success implies that direct knock-out models of the 40 Ca(e,e'p) reaction are too simple. Furthermore, the shapes of the angular correlations seem to be determined largely by the final-state interaction, in particular by charge exchange reactions in the nuclear medium
Spin Dynamics in Highly Spin Polarized Co1-xFexS2
Hoch, Michael J. R.; Kuhns, Philip L.; Moulton, William G.; Reyes, Arneil P.; Lu, Jun; Wang, Lan; Leighton, Chris
2006-09-01
Highly spin polarized or half-metallic systems are of considerable current interest because of their potential for spin injection in spintronics applications. The ferromagnet (FM) CoS2 is close to being a half-metal. Recent theoretical and experimental work has shown that the alloys Co1-xFexS2 (0.07 < x < 0.9) are highly spin polarized at low temperatures. The Fe concentration may be used to tune the spin polarization. Using 59Co FM- NMR we have investigated the spin dynamics in this family of alloys and have obtained information on the evolution of the d-band density of states at the Fermi level with x in the range 0 to 0.3. The results are compared with available theoretical predictions.
Haenisch, B; Herms, S; Molderings, G J
2013-05-01
To circumvent the costly isolation procedure associated with tissue mast cells, human mast cell lines such as HMC-1 are employed in mastocytosis research, but their relation to mutated mast cells in systemic mastocytosis has not been investigated systematically. In the present study, we determined the transcriptome of HMC-1.2 cells and compared the expression data with those reported in the literature for normal human resting lung and tonsillar mast cells as well as leukocytes from peripheral blood and mononuclear cells from bone marrow aspirates of patients with D816 V-positive systemic mastocytosis. Our results suggest that HMC-1.2 cells are an appropriate model for the investigation of this variant of systemic mast cell activation disease. The data confirm previous suggestions that the pathologically increased activity of mast cells in patients with D816 V-positive systemic mastocytosis can be deduced from the detection of mutation-related changes in the gene expression profile in leukocytes from peripheral blood and in mononuclear cells from bone marrow aspirates. Thus, mutation-related changes of the expression profile can serve as surrogates (besides clustering of mast cells, expression of CD25, and increased release of tryptase) for the presence of the mutation D816 V in tyrosine kinase Kit in patients with systemic mastocytosis according to the WHO criteria. Whether this also holds true for systemic mast cell activation disease caused by other mutations in Kit or other mast cell activity-related genes is a subject for future studies.
Coherent 40 Gb/s SP-16QAM and 80 Gb/s PDM-16QAM in an Optimal Supercomputer Optical Switch Fabric
DEFF Research Database (Denmark)
Karinou, Fotini; Borkowski, Robert; Zibar, Darko
2013-01-01
We demonstrate, for the first time, the feasibility of using 40 Gb/s SP-16QAM and 80 Gb/s PDM-16QAM in an optimized cell switching supercomputer optical interconnect architecture based on semiconductor optical amplifiers as ON/OFF gates.......We demonstrate, for the first time, the feasibility of using 40 Gb/s SP-16QAM and 80 Gb/s PDM-16QAM in an optimized cell switching supercomputer optical interconnect architecture based on semiconductor optical amplifiers as ON/OFF gates....
International Nuclear Information System (INIS)
Langen, H.J.; Sengenberger, C.; Bielmeier, J.; Jocher, R.; Kohlhauser-Vollmuth, Ch.; Eschmann, M.
2014-01-01
It is difficult to acquire a chest X-ray of a crying infant at maximum inspiration. A computer program was developed for technician training. Method. Video clips of 3 babies were used and the moment of deepest inspiration was determined in the single-frame view. 12 technicians simulated chest radiographs at normal video speed by pushing a button. The computer program stopped the video and calculated the period of time to the optimal instant for a chest X-ray. Demonstration software can be tested at website online. Every technician simulated 10 chest X-rays for each of the 3 video clips. The technicians then spent 40 minutes practicing performing chest X-rays at optimal inspiration. The test was repeated after 5, 20, and 40 minutes of practice. Results. 6 participants showed a significant improvement after exercises (collective 1). Deviation from the optimal instant for taking an X-ray at inspiration decreased from 0.39 to 0.22 s after 40 min of practice. 6 technicians showed no significant improvement (collective 2). Deviation decreased from a low starting value of 0.25 s to 0.21 s. Conclusion. The tested computer program improves the ability of radiology technicians to take a chest X-ray at optimal inspiration in a crying child
77 FR 33127 - Airworthiness Directives; HPH s. r.o. Sailplanes
2012-06-05
... available in the AD docket shortly after receipt. FOR FURTHER INFORMATION CONTACT: Taylor Martin, Aerospace...: (816) 329-4138; fax: (816) 329-4090; email: taylor[email protected] . SUPPLEMENTARY INFORMATION: Comments... sailplane. (f) Actions and Compliance Unless already done, do the following actions in accordance with HPH...
78 FR 11978 - Airworthiness Directives; Reims Aviation S.A. Airplanes
2013-02-21
... used in nose landing gear (NLG) attachment brackets could lead to failure of the NLG bracket with... referenced service information at the FAA, Small Airplane Directorate, 901 Locust, Kansas City, Missouri..., Kansas City, Missouri 64106; telephone: (816) 329-4119; fax: (816) 329-4090; email: [email protected]..
78 FR 19088 - Airworthiness Directives; REIMS AVIATION S.A. Airplanes
2013-03-29
... the FAA, call (816) 329-4148. FOR FURTHER INFORMATION CONTACT: Albert Mercado, Aerospace Engineer, FAA...; fax: (816) 329-4090; email: albert.mercado@faa.gov . SUPPLEMENTARY INFORMATION: Discussion We issued a... procedures found in 14 CFR 39.19. Send information to ATTN: Albert Mercado, Aerospace Engineer, FAA, Small...
78 FR 275 - Airworthiness Directives; REIMS Aviation S.A. Airplanes
2013-01-03
... INFORMATION CONTACT: Albert Mercado, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room 301, Kansas City, Missouri 64106; telephone: (816) 329-4119; fax: (816) 329-4090; email: albert.mercado@faa... requested using the procedures found in 14 CFR 39.19. Send information to ATTN: Albert Mercado, Aerospace...
Effects of radiation pressure on the equipotential surfaces in X-ray binaries
Kondo, Y.; Mccluskey, G. E., Jr.; Gulden, S. L.
1976-01-01
Equipotential surfaces incorporating the effect of radiation pressure were computed for the X-ray binaries Cen X-3, Cyg X-1 = HDE 226868, Vela XR-1 = 3U 0900-40 = HD 77581, and 3U 1700-37 = HD 153919. The topology of the equipotential surfaces is significantly affected by radiation pressure. In particular, the so-called critical Roche (Jacobian) lobes, the traditional figure 8's, do not exist. The effects of these results on modeling X-ray binaries are discussed.
Effects of radiation pressure on the equipotential surfaces in x-ray binaries
International Nuclear Information System (INIS)
Kondo, Y.; McCluskey, G.E. Jr.; Gulden, S.L.
1976-01-01
Equipotential surfaces incorporating the effect of radiation pressure were computed for the x-ray binaries Cen X-3, Cyg X-1 = HDE 226868, Vela XR-1 = 3U 0900-40 = HD 77581, and 3U 1700-37 = HD 153919. The topology of the equipotential surfaces is significantly affected by radiation pressure. In particular, the so-called critical Roche (Jacobian) lobes, the traditional figure 8's, do not exist. The effects of these results on modeling x-ray binaries are discussed
Development of X-ray detector based on phototransistor
International Nuclear Information System (INIS)
Ramacos Fardela; Kusminarto
2014-01-01
X-ray interaction with matter can produce phenomenon of fluorescence that emits visible light. This phenomenon has been exploited to design an X-ray detector based on photo transistor by attaching a screen ZnS(Ag) on the surface of the photo transistor which is arranged in a Darlington circuit. Response of detector was done by collimating of X-rays beam from the X-ray generator tube Philips 2000 watts, 60 kV type PW 2215/20 NR 780 026 and measure the detector output voltage (V out ). Varying the current by 5, 10, 15, 20, 25, 30, 35 and 40 mA in the X-ray panel. The experimental results showed that the Darlington circuit can be applied to design the detector of X-ray based on phototransistor. The results show that there is a linear relationship between the change in the intensity of X-ray detectors with voltage output phototransistor when it was closed with fluorescence materials ZnS(Ag), the linearity coefficient was R 2 = 0.99. Sensitivity of detector was obtained to be 3.7 x 10 -2 mV per cpm. (author)
Energy Technology Data Exchange (ETDEWEB)
Manos, Manolis J; Kanatzidis, Mercouri G [Department of Chemistry, Northwestern University, Evanston, IL (United States); Petkov, Valeri G [Department of Physics, Central Michigan University, Mt. Pleasant, MI (United States)
2009-04-09
The H{sub 2x}Mn{sub x}Sn{sub 3-x}S{sub 6} (x = 0.11-0.25) is a new solid acid with a layered hydrogen metal sulfide (LHMS). It derives from K{sub 2x}Mn{sub x}Sn{sub 3-x}S{sub 6}(x=0.5-0.95) (KMS-1) upon treating it with highly acidic solutions. We demonstrate that LHMS-1 has enormous affinity for the very soft metal ions such as Hg{sup 2+} and Ag{sup +} which occurs via a rapid ion exchange process. The tremendous affinity of LHMS-1 for Hg{sup 2+} is reflected in very high distribution coefficient K{sub d}{sup Hg} values (>10{sup 6} mL g{sup -1}). The large affinity and selectivity of LHMS-1 for Hg{sup 2+} persists in a very wide pH range (from less than zero to nine) and even in the presence of highly concentrated HCl and HNO{sub 3} acids. LHMS-1 is significantly more selective for Hg{sup 2+} and Ag{sup +} than for the less soft cations Pb{sup 2+} and Cd{sup 2+}. The Hg{sup 2+} ions are immobilized in octahedral sites between the sulfide layers of the materials via Hg-S bonds as suggested by pair distribution function (PDF) analysis. LHMS-1 could decrease trace concentrations of Hg{sup 2+} (e.g. <100 ppb) to well below the acceptable limits for the drinking water in less than two min. Hg-laden LHMS-1 shows a remarkable hydrothermal stability and resistance in 6 M HCl solutions. LHMS-1 could be regenerated by treating Hg-loaded samples with 12 M HCl and re-used without loss of its initial exchange capacity. (Abstract Copyright [2009], Wiley Periodicals, Inc.)
The hard x-ray imager onboard IXO
Nakazawa, Kazuhiro; Takahashi, Tadayuki; Limousin, Olivier; Kokubun, Motohide; Watanabe, Shin; Laurent, Philippe; Arnaud, Monique; Tajima, Hiroyasu
2010-07-01
The Hard X-ray Imager (HXI) is one of the instruments onboard International X-ray Observatory (IXO), to be launched into orbit in 2020s. It covers the energy band of 10-40 keV, providing imaging-spectroscopy with a field of view of 8 x 8 arcmin2. The HXI is attached beneath the Wide Field Imager (WFI) covering 0.1-15 keV. Combined with the super-mirror coating on the mirror assembly, this configuration provides observation of X-ray source in wide energy band (0.1-40.0 keV) simultaneously, which is especially important for varying sources. The HXI sensor part consists of the semiconductor imaging spectrometer, using Si in the medium energy detector and CdTe in the high energy detector as its material, and an active shield covering its back to reduce background in orbit. The HXI technology is based on those of the Japanese-lead new generation X-ray observatory ASTRO-H, and partly from those developed for Simbol-X. Therefore, the technological development is in good progress. In the IXO mission, HXI will provide a major assets to identify the nature of the object by penetrating into thick absorbing materials and determined the inherent spectral shape in the energy band well above the structure around Fe-K lines and edges.
4s24p3--4s4p4 and 4s24p3--4s2fp25s transitions in Y VII, Zr VIII, Nb IX, and MoX
International Nuclear Information System (INIS)
Reader, J.; Acquista, N.
1981-01-01
Spectra of ionized Y, Zr, Nb, and Mo have been observed in sliding-spark and triggered-spark discharges on 10.7-m normal- and grazing-incidence spectrographs at the National Bureau of Standards in Washington, D. C. From these observations the 4s 2 4p 3 --4s4p 4 transitions in Y VII, Zr VIII, Nb IX, and Mo X have been identified. The 4s 2 4p 3 --4s 2 4p 2 5s transitions in Y VII-Mo X, previously identified by Rahimullah et al. [Phys. Scr. 14, 221--223 (1976); 18, 96--106 (1978)], have been confirmed. In Y VII the 4s 2 4p 3 --4s 2 4p 2 6s and 4s4p 4 --4p 5 transition also have been found. The parameters obtained from least-squares fits to the energy levels are compared with Hartree--Fock calculations. Preliminary values of the ionization energies have been determined as 110.02 +- 0.15 eV for Y VII, 133.7 +- 0.5 eV for Zr VIII, 159.2 +- 0.7 eV for Nb IX, and 186.4 +- 1.2 eV for Mo X
Buscaglia, Vincenzo; Tripathi, Saurabh; Petkov, Valeri; Dapiaggi, Monica; Deluca, Marco; Gajović, Andreja; Ren, Yang
2014-02-12
High-resolution x-ray diffraction (XRD), Raman spectroscopy and total scattering XRD coupled to atomic pair distribution function (PDF) analysis studies of the atomic-scale structure of archetypal BaZrxTi(1-x)O3 (x = 0.10, 0.20, 0.40) ceramics are presented over a wide temperature range (100-450 K). For x = 0.1 and 0.2 the results reveal, well above the Curie temperature, the presence of Ti-rich polar clusters which are precursors of a long-range ferroelectric order observed below TC. Polar nanoregions (PNRs) and relaxor behaviour are observed over the whole temperature range for x = 0.4. Irrespective of ceramic composition, the polar clusters are due to locally correlated off-centre displacement of Zr/Ti cations compatible with local rhombohedral symmetry. Formation of Zr-rich clusters is indicated by Raman spectroscopy for all compositions. Considering the isovalent substitution of Ti with Zr in BaZrxTi1-xO3, the mechanism of formation and growth of the PNRs is not due to charge ordering and random fields, but rather to a reduction of the local strain promoted by the large difference in ion size between Zr(4+) and Ti(4+). As a result, non-polar or weakly polar Zr-rich clusters and polar Ti-rich clusters are randomly distributed in a paraelectric lattice and the long-range ferroelectric order is disrupted with increasing Zr concentration.
Friction and wear measurements of sputtered MoS/sub x/ films amorphized by ion bombardment
International Nuclear Information System (INIS)
Mikkelsen, N.J.; Chevallier, J.; Soerensen, G.; Straede, C.A.
1988-01-01
The present study presents an experimental evidence for amorphization of rf sputtered MoS/sub x/ films by ion bombardment. Even at low doses (3 x 10 15 ions/cm 2 ) of 400 keV argon ions a complete amorphization was confirmed by x-ray diffraction analysis and transmission electron microscopy. As a result of the ion bombardment the film density increased 100% to almost the bulk value for MoS 2 . The friction coefficient for ion beam amorphized MoS/sub x/ was measured to be 0.04 in agreement with the values reported for crystalline films but disagreeing considerably with the friction coefficient of 0.4 previously reported for amorphous films
Light-cone gauge formulation for AdS4 x CP3
International Nuclear Information System (INIS)
Uvarov, D.V.
2011-01-01
We review the Type IIA superstring on the AdS 4 x CP 3 background in the k-symmetry light-cone gauge characterized by the choice of the lightlike directions from the D = 3 Minkowski boundary of AdS 4 both in the Lagrangian and Hamiltonian formulations
EXTraS: Exploring the X-ray Transient and variable Sky
De Luca, A.; Salvaterra, R.; Tiengo, A.; D'Agostino, D.; Watson, M.; Haberl, F.; Wilms, J.
2017-10-01
The EXTraS project extracted all temporal domain information buried in the whole database collected by the EPIC cameras onboard the XMM-Newton mission. This included a search and characterisation of variability, both periodic and aperiodic, in hundreds of thousands of sources spanning more than eight orders of magnitude in time scale and six orders of magnitude in flux, as well as a search for fast transients, missed by standard image analysis. Phenomenological classification of variable sources, based on X-ray and multiwavelength information, has also been performed. All results and products of EXTraS are made available to the scientific community through a web public data archive. A dedicated science gateway will allow scientists to apply EXTraS pipelines on new observations. EXTraS is the most comprehensive analysis of variability, on the largest ever sample of soft X-ray sources. The resulting archive and tools disclose an enormous scientific discovery space to the community, with applications ranging from the search for rare events to population studies, with impact on the study of virtually all astrophysical source classes. EXTraS, funded within the EU/FP7 framework, is carried out by a collaboration including INAF (Italy), IUSS (Italy), CNR/IMATI (Italy), University of Leicester (UK), MPE (Germany) and ECAP (Germany).
Energy Technology Data Exchange (ETDEWEB)
Pfisterer, F
1987-02-19
The performance of Cu/sub x/S-CdS thin film solar cells can be improved significantly by a secondary treatment of the Cu layer. The physical mechanisms underlying the aftertreatment process were investigated both experimentally and theoretically. A historical review is followed by an outline of the technology and theory of these solar cells (material properties, process engineering, photovoltaic properties) and a description of Cu aftertreatment and H glowing (experimental set-up, surface potential shift, electron beam scanning). Capacity measurements in this type of thin film cell are described (space charge profile, electrolytic decomposition, copper depletion between the contact web). Aftertreatment of the copper layer enhances the solar cell efficiency, stability, and productivity, makes the immersion process less tedious, and corrects the stoichiometry. (HWJ).
International Nuclear Information System (INIS)
Jasinski, J.; Wojtal, A.; Jeziorski, L.; Radecki, A.; Ucieklak, S.
2003-01-01
The article describes the problem of the thermal and mechanical activation of the surface of the X40Cr13 steel on the state of the ion and gas nitriding. in order to determine the nitriding influence and make the analysis of results, the steel was subjected to: soft annealing, hardening with subsequent tempering at T = 550 o C and also mechanical activation of the surface consisting in peripheral grinding with abrasive papers of the grain size 60, 360, 1000 and mechanical polishing. The main aim of this work was to establish the influence of different surface geometrical structure, depending on X40Cr13 steel structure, on the roughness profile after ion and gas nitriding. With regard to the above, the examinations of basic roughness parameters prior to and after thermochemical processes and the analysis of utilitarian usefulness of activations applied were carried out. (author)
Effect of auditory cortex lesions on the discrimination of frequency-modulated tones in rats
Czech Academy of Sciences Publication Activity Database
Rybalko, Natalia; Šuta, Daniel; Nwabueze-Ogbo, Fidel Chijoke; Syka, Josef
2006-01-01
Roč. 23, - (2006), s. 1614-1622 ISSN 0953-816X R&D Projects: GA ČR(CZ) GA309/04/1074; GA MZd(CZ) NR8113; GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50390512 Keywords : avoidance conditioning * lateralization Subject RIV: FH - Neurology Impact factor: 3.709, year: 2006
Czech Academy of Sciences Publication Activity Database
Beamer, E.; Otáhal, Jakub; Sills, G.J.; Thippeswamy, T.
2012-01-01
Roč. 36, č. 9 (2012), s. 3194-3203 ISSN 0953-816X R&D Projects: GA ČR(CZ) GAP303/10/0999 Institutional research plan: CEZ:AV0Z50110509 Institutional support: RVO:67985823 Keywords : aberrant sprouting * gliosis * nitric oxide * seizure * telemetry Subject RIV: FH - Neurology Impact factor: 3.753, year: 2012
Hard X-ray Flux from Low-Mass Stars in the Cygnus OB2 Association
Caramazza, M.; Drake, J. J.; Micela, G.; Flaccomio, E.
2009-05-01
We investigate the X-ray emission in the 20-40 keV band expected from the flaring low-mass stellar population in Cygnus OB2 assuming that the observed soft X-ray emission is due to a superposition of flares and that the ratio of hard X-ray to soft X-ray emission is described by a scaling found for solar flares by Isola and co-workers. We estimate a low-mass stellar hard X-ray flux in the 20-40 keV band in the range ~7×1031-7×1033 erg/s and speculate the limit of this values. Hard X-ray emission could lie at a level not much below the current observed flux upper limits for Cygnus OB2. Simbol-X, with its broad energy band (10-100 keV) and its sensitivity should be able to detect this emission and would provide insights into the hard X-ray production of flares on pre-main sequence stars.
Chowdhury, Towhid Hossain; Ferdaous, Mohammad Tanvirul; Wadi, Mohd. Aizat Abdul; Chelvanathan, Puvaneswaran; Amin, Nowshad; Islam, Ashraful; Kamaruddin, Nurhafiza; Zin, Muhammad Irsyamuddin M.; Ruslan, Mohd Hafidz; Sopian, Kamaruzzaman Bin; Akhtaruzzaman, Md.
2018-03-01
In this study we present a ternary alloy, Cd1-x Zn x S as an electron transport layer for a planar lead halide perovskite solar cell via numerical simulation with solar cell capacitance simulator (SCAPS) software. Performance dependence on molar composition variation in the Cd1-x Zn x S alloy was studied for the mixed perovskite CH3NH3PbI3-x Cl x absorber and spiro-OMeTAD hole transport material in a planar perovskite solar cell. Additionally, the defects on both Cd1-x Zn x S/CH3NH3PbI3-x Cl x and CH3NH3PbI3-x Cl x /spiro-OMeTAD interface were thoroughly investigated. Simultaneously, a thickness of 700 nm for CH3NH3PbI3-x Cl x absorber with 50-nm-thick Cd0.2Zn0.8S (x = 0.8) was optimized. Analysis of the numerical solutions via SCAPS provides a trend and pattern for Cd0.2Zn0.8S as an effective electron transport layer for planar perovskite solar cells with a yield efficiency up to 24.83%. The planar perovskite solar cell shows an open-circuit voltage of 1.224 V, short-circuit current density of 25.283 mA/cm2 and a fill factor of 80.22.
All-optical 40 Gbit/s compact integrated interferometric wavelength converter
DEFF Research Database (Denmark)
Jørgensen, Carsten; Danielsen, Søren Lykke; Hansen, Peter Bukhave
1997-01-01
An interferometric Michelson wavelength converter is presented that combines a speed-optimized semiconductor optical amplifier technology with the benefits of the integrated interferometer showing 40-Gbit/s wavelength conversion. The optimized wavelength converter demonstrates noninverted converted...
Superstring Theory on $AdS_{3} x G/H$ and Boundary N=3 Superconformal Symmetry
Argurio, R; Shomer, A; Argurio, Riccardo; Giveon, Amit; Shomer, Assaf
2000-01-01
Superstrings propagating on backgrounds of the form AdS_3 x G/H are studiedusing the coset CFT approach. We focus on seven dimensional cosets which have asemiclassical limit, and which give rise to N=3 superconformal symmetry in thedual CFT. This is realized for the two cases AdS_3 x SU(3)/U(1) and AdS_3 xSO(5)/SO(3), for which we present an explicit construction. We also providesufficient conditions on a CFT background to enable a similar construction, andcomment on the geometrical interpretation of our results.
Optical Response of Cu1-xZnxIr2S4 Due to Metal--Insulator Transition
International Nuclear Information System (INIS)
Chen, L.; Matsunami, M.; Nanba, T.; Cao, G.; Suzuki, H.; Isobe, M.; Matsumoto, T.
2003-01-01
The mother material CuIr 2 S 4 of the thiospinel system Cu 1-x Zn x Ir 2 S 4 undergoes a temperature-induced metal--insulator (Mi) transition. We report the temperature dependence of the optical reflection spectra of Cu 1-x Zn x Ir 2 S 4 (x ≤ 0.5) at the temperatures of 8-300 K in the energy regions of 0.005--30 eV in order to study the change in the electronic structure due to the Zn substitution for Cu. Zn substitution induced mainly the splitting of the hybridization band between the Ir-5d(t 2g ) and S-3 p states crossing the E F . Obtained optical conductivity (σ ) spectrum is discussed in relation to the change in the electronic structure close to the E F . (author)
Analysis of the photon spectrum in inclusive B --> X$_{s}\\gamma$ decays
Neubert, M
1994-01-01
Using a combination of the operator product and heavy quark expansions we resum the leading nonperturbative contributions to the inclusive photon spectrum in $B\\to X_s\\,\\gamma$ decays. The shape of the spectrum is determined by a structure function, which describes the distribution of the light-cone momentum fraction of the $b$-quark inside the $B$ meson. The moments of the spectrum are proportional to forward matrix elements of higher-dimension operators. As a byproduct, we obtain the bound $\\lambda_1<0$ for one of the fundamental parameters of the heavy quark effective theory. The integral over the $B\\to X_s\\,\\gamma$ structure function is related to the shape function that governs the fall-off of the lepton spectrum close to the endpoint in $B\\to X_u\\,\\ell\\,\\bar\
Portillo, Jose-Andres C; Lopez Corcino, Yalitza; Miao, Yanling; Tang, Jie; Sheibani, Nader; Kern, Timothy S; Dubyak, George R; Subauste, Carlos S
2017-02-01
Müller cells and macrophages/microglia are likely important for the development of diabetic retinopathy; however, the interplay between these cells in this disease is not well understood. An inflammatory process is linked to the onset of experimental diabetic retinopathy. CD40 deficiency impairs this process and prevents diabetic retinopathy. Using mice with CD40 expression restricted to Müller cells, we identified a mechanism by which Müller cells trigger proinflammatory cytokine expression in myeloid cells. During diabetes, mice with CD40 expressed in Müller cells upregulated retinal tumor necrosis factor-α (TNF-α), interleukin 1β (IL-1β), intracellular adhesion molecule 1 (ICAM-1), and nitric oxide synthase (NOS2), developed leukostasis and capillary degeneration. However, CD40 did not cause TNF-α or IL-1β secretion in Müller cells. TNF-α was not detected in Müller cells from diabetic mice with CD40 + Müller cells. Rather, TNF-α was upregulated in macrophages/microglia. CD40 ligation in Müller cells triggered phospholipase C-dependent ATP release that caused P2X 7 -dependent production of TNF-α and IL-1β by macrophages. P2X 7 -/- mice and mice treated with a P2X 7 inhibitor were protected from diabetes-induced TNF-α, IL-1β, ICAM-1, and NOS2 upregulation. Our studies indicate that CD40 in Müller cells is sufficient to upregulate retinal inflammatory markers and appears to promote experimental diabetic retinopathy and that Müller cells orchestrate inflammatory responses in myeloid cells through a CD40-ATP-P2X 7 pathway. © 2017 by the American Diabetes Association.
International Nuclear Information System (INIS)
Farag, A.A.M.; Abdel Rafea, M.; Roushdy, N.; El-Shazly, O.; El-Wahidy, E.F.
2015-01-01
Highlights: • Highly uniform and good adhesion of nanocrystalline Zn 1−x Cd x S films were synthesized. • Small magnitude of optical electronegativity was calculated. • Third-order nonlinear optical susceptibility and molar polarizability were considered. - Abstract: Low cost dip coating technique was successfully used to deposit highly uniform and good adhesive nanocrystalline Zn 1−x Cd x S (0 ⩽ x ⩽ 0.9) thin films. The surface morphology and crystalline structural characteristics of Zn 1−x Cd x S were achieved by using atomic force microscopy (AFM) and transmission electron microscopy (TEM), respectively. Transmission spectra show red shifting of absorption edge as the Cd content increased. The optical constants were accurately determined by using reflectance and transmittance spectra. The effect of Cd-content on refractive index, extinction index and other optical dispersion parameters were also investigated. The dispersion of the refractive index was discussed in terms of single oscillator model. In addition, the ratio of free carrier concentration to its effective mass was estimated. The calculated value of oscillator energy E o obeys the empirical relation (E o ≈ 2 E g ), obtained from single oscillator model. Small magnitude of optical electronegativity (χ ∗ ) for Zn 1−x Cd x S (0 ⩽ x ⩽ 0.9) thin films and relatively high refractive index can be attributed to covalent nature, in agreement with β value, obtained from dispersion energy analysis. Moreover, molar polarizability and third-order nonlinear optical susceptibility were also considered
Energy Technology Data Exchange (ETDEWEB)
Agawane, G.L., E-mail: agawaneganesh@gmail.com [Department of Materials Science and Engineering, Chonnam National University, Gwangju 500-757 (Korea, Republic of); Shin, Seung Wook [Department of Materials Science and Engineering, KAIST, Daejeon 305-701 (Korea, Republic of); Vanalakar, S.A. [Department of Materials Science and Engineering, Chonnam National University, Gwangju 500-757 (Korea, Republic of); Moholkar, A.V. [Electrochemical Mat. Lab., Department of Physics, Shivaji University, Kolhapur 416-004 (India); Gurav, K.V.; Suryawanshi, M.P. [Department of Materials Science and Engineering, Chonnam National University, Gwangju 500-757 (Korea, Republic of); Lee, Jeong Yong [Department of Materials Science and Engineering, KAIST, Daejeon 305-701 (Korea, Republic of); Yun, Jae Ho, E-mail: yunjh92@kier.re.kr [Photovoltaic Research Group, KIER, Jang-Dong, Yuseong-Gu, Daejeon 305-343 (Korea, Republic of); Kim, Jin Hyeok, E-mail: jinhyeok@chonnam.ac.kr [Department of Materials Science and Engineering, Chonnam National University, Gwangju 500-757 (Korea, Republic of)
2014-07-01
Highlights: • A simple, inexpensive, and non-toxic CBD route is used to deposit ZnS thin films. • The ZnS{sub x}Se{sub 1−x} thin films formation takes place via annealing of ZnS thin films in Se atmosphere. • S/(S + Se) ratio found to be temperature dependent and easy tuning of band gap has been done by Se atom deposition. - Abstract: An environmentally benign chemical bath deposition (CBD) route was employed to deposit zinc sulfide (ZnS) thin films. The CBD-ZnS thin films were further selenized in a furnace at various temperatures viz. 200, 300, 400, and 500 °C and the S/(S + Se) ratio was found to be dependent on the annealing temperature. The effects of S/(S + Se) ratio on the structural, compositional and optical properties of the ZnS{sub x}Se{sub 1−x} (ZnSSe) thin films were investigated. EDS analysis showed that the S/(S + Se) ratio decreased from 0.8 to 0.6 when the film annealing temperature increased from 200 to 500 °C. The field emission scanning electron microscopy and atomic force microscopy studies showed that all the films were uniform, pin hole free, smooth, and adhered well to the glass substrate. The X-ray diffraction study on the ZnSSe thin films showed the formation of the cubic phase, except for the unannealed ZnSSe thin film, which showed an amorphous phase. The X-ray photoelectron spectroscopy revealed Zn-S, Zn-Se, and insignificant Zn-OH bonds formation from the Zn 2p{sub 3/2}, S 2p, Se 3d{sub 5/2}, and O 1s atomic states, respectively. The ultraviolet–visible spectroscopy study showed ∼80% transmittance in the visible region for all the ZnSSe thin films having various absorption edges. The tuning of the band gap energy of the ZnSSe thin films was carried out by selenizing CBD-ZnS thin films, and as the S/(S + Se) ratio decreased from 0.8 to 0.6, the band gap energy decreased from 3.20 to 3.12 eV.
Effect of helium on creep and fatigue (MAT 11)
International Nuclear Information System (INIS)
Schroeder, H.
1991-03-01
This final report contains experimental results on mechanical properties (creep, fatigue, tensile) and microstructural investigations (SEM, TEM) of pre-implanted samples of steels or alloys. (AISI 316, AISI 316L, DIN 1.4970, JPCA 8206, DIN 1.4914; Incoloy 800H, Hastelloy X, DIN 1.4981, (Fe 0.49 Ni 0.51 ) 3 V, Fe17Ni17Cr, Fe15Ni15Cr, Nimonic PE 16, Ni8Si). Furthermore theoretical aspects and developed models and mechanisms for helium embrittlement are described. This report is presented in the form of an extended summary without figures. (MM)
Quantizing String Theory in AdS_5 X S^5: Beyond the pp-Wave
Callan, Jr., Curtis G.; Lee, Hok Kong; McLoughlin, Tristan; Schwarz, John H.; Swanson, Ian; Wu, Xinkai
2003-01-01
In a certain kinematic limit, where the effects of spacetime curvature (and other background fields) greatly simplify, the light-cone gauge world-sheet action for a type IIB superstring on AdS_5 x S^5 reduces to that of a free field theory. It has been conjectured by Berenstein, Maldacena, and Nastase that the energy spectrum of this string theory matches the dimensions of operators in the appropriately defined large R-charge large-N_c sector of N=4 supersymmetric Yang--Mills theory in four d...
S1 x S2 as a bag membrane and its Einstein-Weyl geometry
International Nuclear Information System (INIS)
Rosu, H.
1992-10-01
In the hybrid skyrmion in which an anti-de Sitter bag is embedded into the skyrmion configuration a S 1 x S 2 membrane is lying on the compactified spatial infinity of the bag. The connection between the quark degrees of freedom and the mesonic ones is made through the membrane. This 3-dimensional manifold is at the same time Weyl-Einstein space. We present what is known until the present time to people working in the differential geometry of these spaces. (author). 11 refs
Directory of Open Access Journals (Sweden)
Vijendra K. SINGH
2008-06-01
Full Text Available Amyloid beta-protein1-40 (AP40 is a low molecular weight peptide produced throughout life during normal cell metabolism and neurodegenerative diseases. Owing to its neurotrophic and neurotoxic effects, the present study was conducted to evaluate serum levels of AP40 in healthy subjects, autistic children and Alzheimer’s disease patients. Serum AP40 was measured by enzyme-linked immunosorbent assay (ELISA. AP40 was significantly higher in normal children compared to normal older controls, in normal children compared to autistic children, and in autistic children compared to Alzheimer’s patients (p value was less than 0.05 for all groups. This finding suggests an age-related decline of serum AP40 in normal aging, as well as in autism and Alzheimer’s disease. This decline may result from abnormal processing of amyloid beta-protein precursor (APP during normal aging and age-related diseases such as autism in children and Alzheimer’s disease in elderly. Possible explanations for this decline may include age-related increased interactions of AP40 with cytoskeletal proteins for brain tissue deposition, increased serine proteases for APP metabolism or hyperimmune reaction (antibodies to AP40 for removal of circulating AP40. To conclude, the AP40 metabolism declines with normal aging and in addition to its role in Alzheimer’s disease this protein might also be a contributing factor in autism.
Wong's equations and the small x effective action in QCD
Energy Technology Data Exchange (ETDEWEB)
Jalilian-Marian, Jamal; Jeon, Sangyong; Venugopalan, Raju
2000-07-13
We propose a new form for the small x effective action in QCD. This form of the effective action is motivated by Wong's equations for classical, colored particles in non-Abelian background fields. We show that the BFKL equation, which sums leading logarithms in x, is efficiently reproduced with this form of the action. We argue that this form of the action may be particularly useful in computing next-to-leading-order results in QCD at small x.
Kitô, Hijiri; Yanagi, Yousuke; Ishida, Shigeyuki; Oka, Kunihiko; Gotoh, Yoshito; Fujihisa, Hiroshi; Yoshida, Yoshiyuki; Iyo, Akira; Eisaki, Hiroshi
2014-07-01
We have synthesized a series of intermetallic ternary phosphide chalcogenide superconductors, AP2-xXx (A = Zr, Hf; X = S, Se), using the high-pressure synthesis technique. These materials have a PbFCl-type crystal structure (space group P4/nmm) when x is greater than 0.3. The superconducting transition temperature Tc changes systematically with x, yielding dome-like phase diagrams. The maximum Tc is achieved at approximately x = 0.7, at which point the Tc is 6.3 K for ZrP2-xSex (x = 0.75), 5.5 K for HfP2-xSex (x = 0.7), 5.0 K for ZrP2-xSx (x = 0.675), and 4.6 K for Hfp2-xSx (x = 0.5). They are typical type-II superconductors and the upper and lower critical fields are estimated to be 2.92 T at 0 K and 0.021 T at 2 K for ZrP2-xSex (x = 0.75), respectively.
X-ray study of CuGa sub x In sub 1-x Se sub 2 solid solutions
Energy Technology Data Exchange (ETDEWEB)
Suri, D.K.; Nagpal, K.C. (National Physical Lab., New Delhi (India). Materials Characterization Div.); Chadha, G.K. (Delhi Univ. (India). Dept. of Physics and Astrophysics)
1989-12-01
The semiconducting compound CuGa{sub x}In{sub 1-x}Se{sub 2} crystallizes in the chalcopyrite structure (space group Ianti 42d, Z=4). The X-ray powder data for x=1, 0.75, 0.6, 0.5, 0.4, 0.25 and 0.0 have been collected and it is found that the lattice parameters a and c and their ratio c/a vary linearly with x. Thus the composition of any chalcopyrite in the pseudo-binary system CuGaSe{sub 2} and CuInSe{sub 2} can be obtained from the accurate lattice parameters. The crystallite size determined from the (112) plane is minimum for x=0.50 ({proportional to}1000 A) and away from x=0.50 it increases. A value of u=0.240 (5) has been established for fixing, the Se-atom positions in the CuGa{sub 0.5}In{sub 0.5}Se{sub 2} solid solution. The JCPDS Diffraction File No. for CuInSe{sub 2} is 40-1487 and for CuGa{sub 0.5}In{sub 0.5}Se{sub 2} is 40-1488. (orig.).
E.A. Coenen (Eva); C.M. Zwaan (Christian Michel); D. Reinhardt (Dirk); C.J. Harrison (Christine); O.A. Haas (Oskar); V. de Haas (Valerie); V. Mihál (Vladimir); B. de Moerloose (Barbara); M. Jeison (Marta); J.E. Rubnitz (Jeffrey); D. Tomizawa (Daisuke); D. Johnston (Donna); T.A. Alonzo (Todd); H. Hasle (Henrik); A. Auvrignon (Anne); M.N. Dworzak (Michael); A. Pession (Andrea); V.H.J. van der Velden (Vincent); J. Swansbury (John); K.-F. Wong (Kit-Fai); N. Terui (Nobuhiko); S. Savasan (Sureyya); M. Winstanley (Mark); G. Vaitkeviciene (Goda); M. Zimmermann (Martin); R. Pieters (Rob); M.M. van den Heuvel-Eibrink (Marry)
2013-01-01
textabstractIn pediatric acute myeloid leukemia (AML), cytogenetic abnormalities are strong indicators of prognosis. Some recurrent cytogenetic abnormalities, such as t(8;16)(p11;p13), are so rare that collaborative studies are required to define their prognostic impact. We collected the clinical
Evaluation of undoped ZnS single crystal materials for x-ray imaging applications
Saleh, Muad; Lynn, Kelvin G.; McCloy, John S.
2017-05-01
ZnS-based materials have a long history of use as x-ray luminescent materials. ZnS was one of the first discovered scintillators and is reported to have one of the highest scintillator efficiencies. The use of ZnS for high energy luminescence has been thus far limited to thin powder screens, such as ZnS:Ag which is used for detecting alpha radiation, due to opacity to its scintillation light, primarily due to scattering. ZnS in bulk form (chemical vapor deposited, powder processed, and single crystal) has high transmission and low scattering compared to powder screens. In this paper, the performance of single crystalline ZnS is evaluated for low energy x-ray (PLE) of several undoped ZnS single crystals is compared to their Radioluminescence (RL) spectra. It was found that the ZnS emission wavelength varies on the excitation source energy.
José Luis Ramírez Castro; Nora Elena Durango Calle; Juan Carlos Herrera Patiño; Gloria C. Ramírez Gaviria
2000-01-01
Uno de cada 400 a 500 recién nacidos vivos presenta anormalidades de los cromosomas sexuales. En términos generales, las manifestaciones clínicas por dicha alteración son más leves que las producidas por imbalance autosómico. Posiblemente esta tolerancia del feto en desarrollo al exceso o deficiencia del material presente en el cromosoma X, se debe, por lo menos en parte, a la presencia de mecanismos compensadores mediante los cuales dicho material puede ser o no inactivado (1). Las mujeres c...
Energy Technology Data Exchange (ETDEWEB)
Rana, Vikram; Harrison, Fiona A.; Walton, Dominic J.; Furst, Felix; Grefenstette, Brian W.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Bachetti, Matteo; Barret, Didier; Webb, Natalie A. [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Miller, Jon M. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109-1042 (United States); Fabian, Andrew C. [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); Boggs, Steven E.; Craig, William W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn C. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Hailey, Charles J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Ptak, Andrew F.; Zhang, William W. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States)
2015-02-01
We present results for two ultraluminous X-ray sources (ULXs), IC 342 X-1 and IC 342 X-2, using two epochs of XMM-Newton and NuSTAR observations separated by ∼7 days. We observe little spectral or flux variability above 1 keV between epochs, with unabsorbed 0.3-30 keV luminosities being 1.04{sub −0.06}{sup +0.08}×10{sup 40} erg s{sup –1} for IC 342 X-1 and 7.40 ± 0.20 × 10{sup 39} erg s{sup –1} for IC 342 X-2, so that both were observed in a similar, luminous state. Both sources have a high absorbing column in excess of the Galactic value. Neither source has a spectrum consistent with a black hole binary in low/hard state, and both ULXs exhibit strong curvature in their broadband X-ray spectra. This curvature rules out models that invoke a simple reflection-dominated spectrum with a broadened iron line and no cutoff in the illuminating power-law continuum. X-ray spectrum of IC 342 X-1 can be characterized by a soft disk-like blackbody component at low energies and a cool, optically thick Comptonization continuum at high energies, but unique physical interpretation of the spectral components remains challenging. The broadband spectrum of IC 342 X-2 can be fit by either a hot (3.8 keV) accretion disk or a Comptonized continuum with no indication of a seed photon population. Although the seed photon component may be masked by soft excess emission unlikely to be associated with the binary system, combined with the high absorption column, it is more plausible that the broadband X-ray emission arises from a simple thin blackbody disk component. Secure identification of the origin of the spectral components in these sources will likely require broadband spectral variability studies.
Training Extract AFSC 791X0 Public Affairs.
1985-09-01
8217 C I 6 8o9 a Is- LI I I ffm cc I C.~ 11 N * 0- Q * .j I .0 L’ ) t.. Cn IC. C~ OU~ *IC - ~ ONcc N.U- 1 0r N a- I A u z a I . A .. I: n] -j 1.’ I I a... Acca r : 0 j4 &. a a 40’ 8. x . 09 a n u a i m W Z 15LW4 4 Sn. z 41 0 C. IS L" W. Sn) WL Sn J 0 V. w i Sn - &A ’~S CC 0 Ct 0: Sn w L. -4 04 0 S 4.0- 0
Energy Technology Data Exchange (ETDEWEB)
Bourlier, Yoan [Institut de Recherche sur les Composants logiciels et matériels pour l’Information et la Communication Avancée (IRCICA), CNRS USR 3380, Université Lille 1, 50 avenue Halley, 59655 Villeneuve d’Ascq CEDEX (France); Cristini Robbe, Odile [Institut de Recherche sur les Composants logiciels et matériels pour l’Information et la Communication Avancée (IRCICA), CNRS USR 3380, Université Lille 1, 50 avenue Halley, 59655 Villeneuve d’Ascq CEDEX (France); Laboratoire de Physique des Lasers, Atomes et Molécules (PhLAM), CNRS UMR 8523, Université Lille, 59655 Villeneuve d’Ascq CEDEX (France); Lethien, Christophe [Institut de Recherche sur les Composants logiciels et matériels pour l’Information et la Communication Avancée (IRCICA), CNRS USR 3380, Université Lille 1, 50 avenue Halley, 59655 Villeneuve d’Ascq CEDEX (France); Laboratoire de Physique des Lasers, Atomes et Molécules (PhLAM), CNRS UMR 8523, Université Lille, 59655 Villeneuve d’Ascq CEDEX (France); Institut d’Electronique, de Microélectronique et de Nanotechnologie (IEMN), CNRS UMR 8520, Avenue Poincaré, 59652 Villeneuve d’Ascq CEDEX (France); and others
2015-10-15
Highlights: • CuIn{sub (1−x)}Ga{sub x}S{sub 2} thin films were prepared by sol–gel process. • Evolution of lattice parameters is characteristic of a solid solution. • Optical band gap was found to be linearly dependent on the gallium rate. - Abstract: In this paper, we report the elaboration of Cu(In,Ga)S{sub 2} chalcopyrite thin films via a sol–gel process. To reach this aim, solutions containing copper, indium and gallium complexes were prepared. These solutions were thereafter spin-coated onto the soda lime glass substrates and calcined, leading to metallic oxides thin films. Expected chalcopyrite films were finally obtained by sulfurization of oxides layers using a sulfur atmosphere at 500 °C. The rate of gallium incorporation was studied both at the solutions synthesis step and at the thin films sulfurization process. Elemental and X-ray diffraction (XRD) analyses have shown the efficiency of monoethanolamine used as a complexing agent for the preparation of CuIn{sub (1−x)}Ga{sub x}S{sub 2} thin layers. Moreover, the replacement of diethanolamine by monoethanolamine has permitted the substitution of indium by isovalent gallium from x = 0 to x = 0.4 and prevented the precipitation of copper derivatives. XRD analyses of sulfurized thin films CuIn{sub (1−x)}Ga{sub x}S{sub 2,} clearly indicated that the increasing rate of gallium induced a shift of XRD peaks, revealing an evolution of the lattice parameter in the chalcopyrite structure. These results were confirmed by Raman analyses. Moreover, the optical band gap was also found to be linearly dependent upon the gallium rate incorporated within the thin films: it varies from 1.47 eV for x = 0 to 1.63 eV for x = 0.4.
Relation between stimulus and response in frog olfactory receptor neurons in vivo
Czech Academy of Sciences Publication Activity Database
Rospars, J. P.; Lánský, Petr; Duchamp, A.; Duchamp-Viret, P.
2003-01-01
Roč. 18, č. 5 (2003), s. 1135-1154 ISSN 0953-816X R&D Projects: GA ČR GA309/02/0168 Grant - others:CZ - FR(CZ) Projekt Barrande 972 SL; NATO(XX) LST CLG 976786 Institutional research plan: CEZ:AV0Z5011922 Keywords : intensity coding * olfaction Subject RIV: ED - Physiology Impact factor: 3.872, year: 2003
Using computational models to relate structural and functional brain connectivity
Czech Academy of Sciences Publication Activity Database
Hlinka, Jaroslav; Coombes, S.
2012-01-01
Roč. 36, č. 2 (2012), s. 2137-2145 ISSN 0953-816X R&D Projects: GA MŠk 7E08027 EU Projects: European Commission(XE) 200728 - BRAINSYNC Institutional research plan: CEZ:AV0Z10300504 Keywords : brain disease * computational modelling * functional connectivity * graph theory * structural connectivity Subject RIV: FH - Neurology Impact factor: 3.753, year: 2012
Moessbauer spectroscopy on amorphous Fe/sub x/Ni/sub 80-x/B20 after neutron irradiation
International Nuclear Information System (INIS)
Sitek, J.; Miglierini, M.
1985-01-01
Amorphous Fe/sub x/Ni/sub 80-x/B 20 glassy alloys (x = 40, 50, 60, and 70) irradiated with fast neutrons in a fluence range of 10 14 to 10 19 cm -2 were investigated by Moessbauer spectroscopy. There were some significant changes in the Moessbauer spectrum parameters of the 10 19 cm -2 irradiated samples except Fe 40 Ni 40 B 20 . This corresponds to a change in the direction of the easy axis of magnetization. The measurements show that the resistance of the Fe-Ni-B system against neutron irradiation improves with increasing Ni content up to a certain point
Fe induced optical limiting properties of Zn1-xFexS nanospheres
Vineeshkumar, T. V.; Raj, D. Rithesh; Prasanth, S.; Unnikrishnan, N. V.; Mahadevan Pillai, V. P.; Sudarasanakumar, C.
2018-02-01
Zn1-xFexS (x = 0.00, 0.01, 0.03, 0.05) nanospheres were synthesized by polyethylene glycol assisted hydrothermal method. XRD studies revealed that samples of all concentrations exhibited cubic structure with crystallite grain size 7-9 nm. TEM and SEM show the formation of nanospheres by dense aggregation of smaller particles. Increasing Zn/Fe ratio tune the band gap from 3.4 to 3.2 eV and also quenches the green luminescence. FTIR spectra reveal the presence of capping agent, intensity variation and shifting of LO and TO phonon modes confirm the presence of Fe ions. Nonlinear optical properties were measured using open and closed aperture z-scan techniques, employing frequency doubled 532 nm pumping sources which indicated reverse saturable absorption (RSA) process. The nonlinear optical coefficients are obtained by two photon absorption (2PA). Composition dependent nonlinear optical coefficients ;β;, nonlinear refractive index, third order susceptibility and optical limiting threshold were estimated. The sample shows good nonlinear absorption and enhancement of optical limiting behavior with increasing Fe volume fraction. Contribution of RSA on optical nonlinearity of Zn1-xFexS nanospheres are also investigated using three different input energies. Zn1-xFexS with comparatively small limiting threshold value is a promising candidate for optical power limiting applications.
USGS library for S-PLUS for Windows -- Release 4.0
Lorenz, David L.; Ahearn, Elizabeth A.; Carter, Janet M.; Cohn, Timothy A.; Danchuk, Wendy J.; Frey, Jeffrey W.; Helsel, Dennis R.; Lee, Kathy E.; Leeth, David C.; Martin, Jeffrey D.; McGuire, Virginia L.; Neitzert, Kathleen M.; Robertson, Dale M.; Slack, James R.; Starn, J. Jeffrey; Vecchia, Aldo V.; Wilkison, Donald H.; Williamson, Joyce E.
2011-01-01
Release 4.0 of the U.S. Geological Survey S-PLUS library supercedes release 2.1. It comprises functions, dialogs, and datasets used in the U.S. Geological Survey for the analysis of water-resources data. This version does not contain ESTREND, which was in version 2.1. See Release 2.1 for information and access to that version. This library requires Release 8.1 or later of S-PLUS for Windows. S-PLUS is a commercial statistical and graphical analysis software package produced by TIBCO corporation(http://www.tibco.com/). The USGS library is not supported by TIBCO or its technical support staff.
Influence of gamma radiation and impurity atoms on the photoconductivity of GeS single crystals
International Nuclear Information System (INIS)
Madatov, R.S.; Alekperov, A.S.
2013-01-01
Wide opportunities for using of layered semiconductors, particularly in optoelectronics have generated considerable interest to them. Recently it was created the unique device from GeS for the storage of solar energy. The investigated GeS 1 -xNd x S single crystals were grown by the Bridgman method. The samples were irradiated by gamma-quanta and was conducted to install 60Co at room temperature. Irradiation of p-GeS 1 -xNd x S single crystals by small doses of gamma rays increases the photoconductivity on 40%
Study of the ${X^\\pm(5568)}$ state with semileptonic decays of the ${B_s^0}$ meson
Energy Technology Data Exchange (ETDEWEB)
Abazov, Victor Mukhamedovich; et al.
2017-12-29
We present a study of the $X^\\pm(5568)$ using semileptonic decays of the $B_s^0$ meson using the full Run II integrated luminosity of 10.4 fb$^{-1}$ in proton-antiproton collisions at a center of mass energy of 1.96\\,TeV collected with the D0 detector at the Fermilab Tevatron Collider. We report evidence for a narrow structure, $X^\\pm(5568)$, in the decay sequence $X^\\pm(5568) \\to B_s^0 \\pi^\\pm$ where $B_s^0 \\rightarrow \\mu^\\mp D_s^\\pm \\, \\mathrm{X}$, $D_s^\\pm \\rightarrow \\phi \\pi^{\\pm}$ which is consistent with the previous measurement by the D0 collaboration in the hadronic decay mode, $X^\\pm(5568) \\to B^0_s \\pi^\\pm$ where $B^0_s \\to J/\\psi\\phi$. The mass and width of this state are measured using a combined fit of the hadronic and semileptonic data, yielding $m = 5566.9 ^{+3.2}_{-3.1} \\thinspace {\\rm (stat)} ^{+0.6}_{-1.2} {\\rm \\thinspace (syst)}$\\,MeV/$c^2$, $\\Gamma = 18.6 ^{+7.9}_{-6.1} {\\rm \\thinspace (stat)} ^{+3.5}_{-3.8} {\\rm \\thinspace (syst)} $\\,MeV/$c^2$ with a significance of 6.7$\\,\\sigma$.
Optoelectronic properties of transparent p-type semiconductor Cu{sub x}S thin films
Energy Technology Data Exchange (ETDEWEB)
Parreira, P.; Valente, J. [ICEMS, IST-UTL, Lisboa (Portugal); Lavareda, G. [Departamento de Fisica, IST-UTL, Lisboa (Portugal); Nunes, F.T. [Departamento de Ciencia dos Materiais, FCT-UNL, Caparica (Portugal); Amaral, A. [Departamento de Fisica, IST-UTL, Lisboa (Portugal); ICEMS, IST-UTL, Lisboa (Portugal); Carvalho, C.N. de [Departamento de Ciencia dos Materiais, FCT-UNL, Caparica (Portugal); ICEMS, IST-UTL, Lisboa (Portugal)
2010-07-15
Nowadays, among the available transparent semiconductors for device use, the great majority (if not all) have n-type conductivity. The fabrication of a transparent p-type semiconductor with good optoelectronic properties (comparable to those of n-type: InO{sub x}, ITO, ZnO{sub x} or FTO) would significantly broaden the application field of thin films. However, until now no material has yet presented all the required properties. Cu{sub 2}S is a p-type narrow-band-gap material with an average optical transmittance of about 60% in the visible range for 50 nm thick films. However, due to its high conductivity at room temperature, 10 nm in thickness seems to be appropriate for device use. Cu{sub 2}S thin films with 10 nm in thickness have an optical visible transmittance of about 85% rendering them as very good candidates for transparent p-type semiconductors. In this work Cu{sub x}S thin films were deposited on alkali-free (AF) glass by thermal evaporation. The objective was not only the determination of its optoelectronic properties but also the feasibility of an active layer in a p-type thin film transistor. In our Cu{sub x}S thin films, p-type high conductivity with a total visible transmittance of about 50% have been achieved. (Abstract Copyright [2010], Wiley Periodicals, Inc.)
Fischer, C.; Gocke, E.; Stege, U.; Schöllhorn, R.
1993-01-01
Systematic structural investigation have been performed on the formation of the ternary Chevrel phase system CuxMo6S8 by topotactic intercalation of copper into Mo6S8 via electron/ion transfer reactions. In high-temperature synthesis the homogeneity range of CuxMo6S8 formation corresponds to 1.8 ≤ x ≤ 3.66, while by galvanostatic or potentiostatic reduction of binary Mo6S8 at ambiet temperature in aqueous CuSO4 or aprotic CuCl/Ch3CN electrolyte the terminal rhombohedral phase Cu4Mo6S8 with the maximum number of electrons per Mo6 cluster can be obtained. The phase range 1 ≤ x ≤ 4 of CuxMo6S8 as obtained by galvanostatic reduction of Mo6S8 in aqueous CuSO4 electrolyte has been determined by in situ X-ray experiments. Warburg oxygen manometry has proved to be a new and powerful analytical tool for examination of the Cu content of ternary phase CuxMo6S8. Thermodiffractometry and 63 Cu NMR studies of Cu2Mo6S8 (high-temperature phase) reveal a phase-transition rhombohedral/triclinic in a broad temperature range between 285 and 200 K. Superconducting properties (temperature-dependent ac susceptibility) of high temperature and electrochemically prepared Cu phases are reported.
Kinetic Study on the CsXH3−X PW12O40/Fe-SiO2 Nanocatalyst for Biodiesel Production
Directory of Open Access Journals (Sweden)
Mostafa Feyzi
2013-01-01
Full Text Available The kinetic of the transesterification reaction over the CsXH3−XPW12O40/Fe-SiO2 catalyst prepared using sol-gel and impregnation procedures was investigated in different operational conditions. Experimental conditions were varied as follows: reaction temperature 323–333 K, methanol/oil molar ratio = 12/1, and the reaction time 0–240 min. The H3PW12O40 heteropolyacid has recently attracted significant attention due to its potential for application in the production of biodiesel, in either homogeneous or heterogeneous catalytic conditions. Although fatty acids esterification reaction has been known for some time, data is still scarce regarding kinetic and thermodynamic parameters, especially when catalyzed by nonconventional compounds such as H3PW12O40. Herein, a kinetic study utilizing Gc-Mas in situ allows for evaluating the effects of operation conditions on reaction rate and determining the activation energy along with thermodynamic constants including ΔG, ΔS, and ΔH. It indicated that the CsXH3−XPW12O40/Fe-SiO2 magnetic nanocatalyst can be easily recycled with a little loss by magnetic field and can maintain higher catalytic activity and higher recovery even after being used 5 times. Characterization of catalyst was carried out by using scanning electron microscopy (SEM, X-ray diffraction (XRD, Fourier transform-infrared spectroscopy (FT-IR, N2 adsorption-desorption measurements methods, thermal gravimetric analysis (TGA, and differential scanning calorimetry (DSC.
Czech Academy of Sciences Publication Activity Database
Olejníček, Jiří; Flannery, L.E.; Darveau, S.A.; Exstrom, C.L.; Kment, Štěpán; Ianno, N.J.; Soukup, R. J.
2011-01-01
Roč. 509, č. 41 (2011), s. 10020-10024 ISSN 0925-8388 Institutional research plan: CEZ:AV0Z10100522 Keywords : CuIn 1−x Al x S 2 * CIAS * chalcopyrites * Raman spectroscopy * solar cells Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.289, year: 2011 http://dx.doi.org/10.1016/j.jallcom.2011.08.016
Magnetic behaviour governed by Co spin transitions in LaCo1-xTixO3 (0 ≤ x ≤ 0.5) perovskite oxides
International Nuclear Information System (INIS)
Alvarez-Serrano, I; Lopez, M L; Pico, C; RodrIguez, E; Veiga, M L; Cuello, G J; Jimenez-Lopez, A; RodrIguez-Castellon, E
2008-01-01
Perovskite-type cobaltites LaCo 1-x Ti x O 3 (0 ≤ x ≤ 0.5) synthesized by the liquid mix technique were characterized by x-ray diffraction, neutron diffraction, XPS, magnetic susceptibility and magnetization versus magnetic field measurements. Structural symmetry changes from rhombohedral (S.G. R 3-bar c) for 0.05 ≤ x ≤ 0.20 to orthorhombic (S.G. Pbnm) for 0.25 ≤ x ≤ 0.40. The bond distances dependence on the composition, x, has been analysed from x-ray and neutron diffraction data. Both the structural and the spectroscopic (from XPS) results suggest that Ti 4+ substitution implies the stabilization of low-spin Co III ions and the evolution of magnetic moments in the paramagnetic zone is also coherent with this assumption. For small values of x both FM responses and the absence of saturation in the M versus H curves at 2 K are interpreted in terms of a magnetic frustration. For x > 0.25 the cobalt cations seem to stabilize as Co III (rather than Co 3+ ) coexisting with Co 2+ . In these more substituted perovskites, AFM Co 2+ -O-Co 2+ interactions become predominant, leading to a well established AFM ordering for x = 0.4 and 0.5
Bai, Tianyu
2014-01-01
A facile solution-phase route for the preparation of AgInSe2 nanocrystals was developed by using silver nitrate, indium stearate, and oleylamine-selenium (OAm-Se) as precursors. The evolution process of the AgInSe2 nanocrystals is discussed in detail and different reaction conditions all have a great impact on the growth and morphology of the nanocrystals. Alloyed AgIn(S1-xSex)2 nanocrystals with controlled composition across the entire range (0 ≤ x ≤ 1) was also successfully prepared by modulating the S/Se reactant mole ratio. X-ray diffraction (XRD), energy dispersive X-ray (EDX), X-ray photoelectron spectroscopy (XPS) and transmission electron microscopy (TEM) were used to confirm that the alloyed AgIn(S1-xSex)2 nanocrystals are homogeneous. The UV-vis absorption spectra revealed that the band gap energies of the alloyed AgIn(S1-xSex)2 nanocrystals could be continuously tuned by increasing the Se content. © The Royal Society of Chemistry 2014.
International Nuclear Information System (INIS)
Langner, A.; Sahu, D.; George, T.F.
1988-01-01
In the heavy-fermion superconductor U/sub 1-//sub x/Th/sub x/Be/sub 13/, superconducting states coexist for thorium concentrations 0 ≤ x ≤ 0.06. Assuming s-wave and d-wave symmetries for these states, we derive a Ginzburg-Landau free-energy expression which couples s- and d-wave states and is rotationally invariant, in contrast to the free-energy expression proposed by P. Kumar and P. Woelfle [Phys. Rev. Lett. 59, 1954 (1987)]. We discuss in detail the consequences that follow from our free-energy relation. In particular, we predict that in the above system there are two eigenfrequencies associated with the dynamics of phase oscillations (internal Josephson effect) which are characteristic of the s-wave and d-wave states
Voronin, V I; Berger, I F; Glazkov, V P; Kozlenko, D P; Savenko, B N; Tikhomirov, S V
2001-01-01
The structure of the ternary systems of the HgSe sub 1 sub - sub x S sub x mercury chalcogenides is studied at high pressures up to 35 kbar. It is established that by increase in the pressure in the HgSe sub 1 sub - sub x S sub x there takes place the transition from the sphalerite type cubic structure to the cinnabar type hexagonal structure, which is accompanied by the jump-like change in the elementary cell volume and interatomic distances. The parameters of the elementary cell and positional parameters of the Hg and Se/S for the hexagonal phase of high pressure are determined. The existence of the two-phase state in the area of the phase transformation is determined
Table-like magnetocaloric effect of Fe{sub 88−x}Nd{sub x}Cr{sub 8}B{sub 4} composite materials
Energy Technology Data Exchange (ETDEWEB)
Lai, J.W.; Zheng, Z.G.; Zhong, X.C. [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China); Franco, V. [Departamento Física de la Materia Condensada, ICMSE-CSIC, Universidad de Sevilla, P.O. Box 1065, 41080 Sevilla (Spain); Montemayor, R.; Liu, Z.W. [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China); Zeng, D.C., E-mail: medczeng@scut.edu.cn [School of Materials Science and Engineering, South China University of Technology, Guangzhou 510640 (China)
2015-09-15
The narrow working temperature range due to the sharp magnetic entropy change |ΔS{sub M}| peak and large thermal or magnetic hysteresis restricts the practical application of magnetocaloric materials. In this work, the table-like magnetocaloric effect (MCE) was obtained in the multilayer composite of Fe{sub 88−x}Nd{sub x}Cr{sub 8}B{sub 4} alloys with various Nd substitutions for Fe (x=5, 8, 10, 12, and 15), which were prepared by arc-melting followed by melt-spinning. The substation of Nd was found to enhance the glass-forming ability. For the alloys with Nd substitution from 5 at% to 15 at%, the Curie temperature (T{sub C}) ranged from 322 K to 350 K and the peak value of |ΔS{sub M}| remained almost constant, 3.4–3.5 J/(kg K) under an applied field of 0–5 T. The composite with various Nd contents was prepared by stocking the ribbons layer by layer. The |ΔS{sub M}| of the composite approached a nearly constant value of ∼3.2 J/(kg K) in a field change of 0–5 T in a wide temperature span over 40 K, resulting in large refrigerant capacity value of >408 J/kg. This |ΔS{sub M}| value was much larger than the previous reported Fe-based amorphous composite Fe{sub 78−x}Ce{sub x}Si{sub 4}Nb{sub 5}B{sub 12}Cu{sub 1}. This composite can be used as the working material in the Ericsson-cycle magnetic regenerative refrigerator around room temperature. - Highlights: • The T{sub C} ranges from 322 K to 350 K when increasing Nd substitution from 5 to 15 at%. • |ΔS{sub M}| remains relatively constant, about 3.4–3.5 J/(kg K) under H=0–5 T. • RC decreases from 93 to 78 J/kg in a field change of 1.5 T when Nd increasing. • Table-like MCE ,|ΔS{sub M}| ~3.2J/kg K under 0–5 T, appeared in the composite. • A wide working temperature range (40 K) and enhanced RC (>408J/kg) were obtained in the composite.
Uniqueness of the Fock representation of the Gowdy S1 x S2 and S3 models
International Nuclear Information System (INIS)
Cortez, Jeronimo; Marugan, Guillermo A Mena; Velhinho, Jose M
2008-01-01
After a suitable gauge fixing, the local gravitational degrees of freedom of the Gowdy S 1 x S 2 and S 3 cosmologies are encoded in an axisymmetric field on the sphere S 2 . Recently, it has been shown that a standard field parametrization of these reduced models admits no Fock quantization with a unitary dynamics. This lack of unitarity is surpassed by a convenient redefinition of the field and the choice of an adequate complex structure. The result is a Fock quantization where both the dynamics and the SO(3)-symmetries of the field equations are unitarily implemented. The present work proves that this Fock representation is in fact unique inasmuch as, up to equivalence, there exists no other possible choice of SO(3)-invariant complex structure leading to a unitary implementation of the time evolution
The threshold anomaly in the 32S + 40Ca interaction
International Nuclear Information System (INIS)
Bilwes, B.; Bilwes, R.; Diaz, J.; Ferrero, J.L.; Ruiz, J.A.
1988-01-01
Angular distributions for elastic scattering of 32 S by 40 Ca, inelastic scattering leading to the first 2 + state in 32 S and the first 3 - state in 40 Ca and one neutron stripping reactions have been measured at E lab = 90 and 110 MeV. Angular distributions for alpha stripping reactions have been measured at E lab = 90, 100 and 110 MeV. The data have been analyzed in terms of the double-folding model using the coupled-channel approximation for inelastic scattering. The energy dependence of the renormalization coefficient of the folding potential founded in a previous paper has been confirmed at these new energies and is consistent with the dispersion relation of Mahaux et al. 16,7 . The influence of the coupling of inelastic and transfer channels on the renormalization coefficient has been found to be important. The energy dependence of the potential diminishes with increasing coupling strength
Periodic light variations of young stars U X Orion and S U Auriga
International Nuclear Information System (INIS)
Minikulov, N.Kh.; Abdulloev, S.Kh.
2007-01-01
The light curves of young variable stars U X Orion and S U Auriga are created from archive data of Institute of Astrophysics of the Academy of Sciences of the Republic of Tajikistan and other sources. It is established that periodic light variations of young stars U X Orion and S U Auriga occurs to duration of 36.4 and 29.8 years, accordingly. It is supposed that such periodic light variations are connected with existence a planetary system around these stars
International Nuclear Information System (INIS)
Costantini, Jean-Marc.
1980-05-01
We have studied the influence of the chalcogen X on the bonding and on the magnetic and electrical properties of the oxychalcogenides Pu 2 O 2 X. These compounds are isostructural with hexagonal La 2 O 3 for X=O, S, Se and with tetragonal La 2 O 2 Te for X=Te. Comparison of Nd 2 O 2 X and Pu 2 O 2 X cell volumes showed that plutonium crystal radius decreases from Pu 2 O 3 through Pu 2 O 2 Te with increasing 5f electrons delocalization and 5f-np overlap. Superexchange interactions through O 2- and X 2- were thought to be responsible for the observed antiferromagnetic ordering. Neel temperatures increase from Pu 2 O 3 through Pu 2 O 2 Te showing that these interactions and subsequent 5f-np covalency are strengthened as chalcogen electronegativity decreases. Hexagonal Pu 2 O 3 is an insulator while the other compounds are semi-conductors with energy gaps around 0.6 eV which were interpreted as the separation between the 6d-7s conduction band and the np valence band. The localized 5f states were located just below the np band, partially overlapping it [fr
International Nuclear Information System (INIS)
Sadekar, Harishchandra K.; Ghule, Anil Vithal; Sharma, Ramphal
2011-01-01
Highlights: → ZnS 1-x Se x (x = 0 to 1) thin films are successfully deposited on glass substrates by soft chemical route. → Structural, optical and electrical properties are studied. → Change in band gap, crystallite size and resistivity is noted with change in S:Se ratio. → Wide band gap material (ZnS 1-x Se x ) is useful for photosensor and solar cell applications. → It utilizes whole visible light spectrum and is a best alternative to conventionally used toxic CdS. - Abstract: Thin films of nanostructured ZnS 1-x Se x with optimized growth parameters were prepared by soft chemical route on glass substrates. Ammonia free precursors were used at 80 deg. C constant bath temperature. The ratio of sulphur to selenium was changed continuously by changing the composition x (0-1), while atomic concentration of zinc was kept constant. Structure, composition and surface morphology of as-deposited films were characterized by X-ray diffraction (XRD), energy dispersive X-ray analysis (EDAX) and scanning electron microscopy (SEM), atomic force microscopy (AFM) respectively. XRD studies revealed that as-deposited films were nanostructured in nature with cubic zinc blended structure. It was further observed that the preferred orientations are along (1 1 1) plane and crystallite size decreased with increase in the value of x. SEM and AFM images revealed that films were uniform and pinhole free. The optical band gap (E g ) was calculated from the observed transmittance spectra by Urbach method. It was found that the band gap varied linearly from 3.71 to 2.70 eV, as composition x varies 0-1. The electrical properties' study revealed that the decrease in resistivity and increase in photosensitivity, as composition x varied 0-1. The observed interesting properties of ZnS 1-x Se x thin films justified their significance in optoelectronic device fabrication and applications, and as an environment friendly alternative to the commonly used toxic material such as CdS.
Electron confinement studies on the EBT-S Bumpy Torus Experiment using soft x-ray techniques
International Nuclear Information System (INIS)
Hillis, D.L.; Haste, G.R.; Berry, L.A.
1983-01-01
Soft x-ray bremsstrahlung measurements have been performed on the ELMO Bumpy Torus (EBT-S) plasma to determine the electron temperature T/sub e/ and electron density density n/sub e/ using a calibrated Si(Li) detector over a wide range of operating conditions. The purpose of this paper is to outline the necessary assumptions and essential x-ray techniques that are inherent in soft x-ray measurements in order to investigate the electron heating and confinement properties of EBT-S. In addition, by utilizing the electron density as determined by the soft x-ray measurements, the previous EBT-S confinement analyses have been extended. The steady-state plasma of EBT-S is heated by microwaves using a continuous wave (cw) gyrotron that can operate up to power levels of 200 kW. From the soft x-ray measurements, both the electron temperature and density are found to increase at higher microwave power levels. For operation at microwave power levels of 200 kW, T/sub e/ approaches 1 keV while n/sub e/ approaches 1.2 x 10 12 cm - 3 . In general, confinement properties are found to improve with increased microwave power. The data are compared with neoclassical transport scaling and the electron transport is found to be collisionless (#betta#/Ω<1) as well as neoclassical
International Nuclear Information System (INIS)
Lafond, A.; Guillot-Deudon, C.; Harel, S.; Mokrani, A.; Barreau, N.; Gall, S.; Kessler, J.
2007-01-01
The present work reports investigations on the new In 2 S 3 containing Cu and/or Na compounds, which are expected to be formed at the Cu(In,Ga)Se 2 /In 2 S 3 interface. The knowledge of these materials properties is very important in order to better understand the operation of the devices based on these junction partners. It has been observed that a solid solution Na x Cu 1-x In 5 S 8 exists from CuIn 5 S 8 (x = 0) to NaIn 5 S 8 (x = 1) with a spinel-like structure. The single crystal structure determination shows that indium, copper and sodium atoms are statistically distributed on the tetrahedral sites. XPS investigations on the CuIn 5 S 8 , Na 0.5 Cu 0.5 In 5 S 8 and NaIn 5 S 8 compounds combined with the band gap changes reported in a previous work show that these variations are mainly due to valence band maximum shift; it is moved downward when x increases from 0 to 1. These observations are confirmed by the electron structure calculations based on the density functional theory, which additionally demonstrate that the pure sodium compound has direct gap whereas the copper-containing compounds have indirect gaps
DEFF Research Database (Denmark)
Wei, J. L.; Eiselt, Nicklas; Griesser, Helmut
2016-01-01
We demonstrate the first known experiment of a real-time end-to-end 40-Gb/s PAM-4 system for next-generation access applications using 10-Gb/s class transmitters only. Based on the measurement of a real-time 40-Gb/s PAM system, low-cost upstream and downstream link power budgets are estimated. Up...
Huang, Shoushuang; Ma, Dui; Hu, ZhangJun; He, Qingquan; Zai, Jiantao; Chen, Dayong; Sun, Huai; Chen, Zhiwen; Qiao, Qiquan; Wu, Minghong; Qian, Xuefeng
2017-08-23
Platinum (Pt)-based alloys are considerably promising electrocatalysts for the reduction of I - /I 3 - and Co 2+ /Co 3+ redox couples in dye-sensitized solar cells (DSSCs). However, it is still challenging to minimize the dosage of Pt to achieve comparable or even higher catalytic efficiency. Here, by taking full advantages of the Mott-Schottky (M-S) effect at the metal-semiconductor interface, we successfully strategize a low-Pt-based M-S catalyst with enhanced electrocatalytic performance and stability for the large-scale application of DSSCs. The optimized M-S electrocatalyst of Ni 3 S 4 -Pt 2 X 1 (X = Fe, Ni) heteronanorods is constructed by rationally controlling the ratio of Pt to transition metal in the hybrids. It was found that the electrons transferred from Ni 3 S 4 to Pt 2 X 1 at their interface under the Mott-Schottky effect result in the concentration of electrons onto Pt 2 X 1 domains, which subsequently accelerates the regeneration of both I - /I 3 - and Co 2+ /Co 3+ redox shuttles in DSSCs. As a result, the DSSC with Ni 3 S 4 -Pt 2 Fe 1 manifests an impressive power conversion efficiency (PCE) of 8.79% and 5.56% for iodine and cobalt-based electrolyte under AM1.5G illumination, respectively. These PCEs are obviously superior over those with Ni 3 S 4 -Pt, PtFe, Ni 3 S 4 , and pristine Pt electrodes. The strategy reported here is able to be further expanded to fabricate other low-Pt-alloyed M-S catalysts for wider applications in the fields of photocatalysis, water splitting, and heterojunction solar cells.
Synthesis of Li(x)Na(2-x)Mn2S3 and LiNaMnS2 through redox-induced ion exchange reactions
International Nuclear Information System (INIS)
Luthy, Joshua A.; Goodman, Phillip L.; Martin, Benjamin R.
2009-01-01
Na 2 Mn 2 S 3 was oxidatively deintercalated using iodine in acetonitrile to yield Na 1.3 Mn 2 S 3 , with lattice constants nearly identical to that of the reactant. Lithium was then reductively intercalated into the oxidized product to yield Li 0.7 Na 1.3 Mn 2 S 3 . When heated, this metastable compound decomposed to form a new crystalline compound, LiNaMnS 2 , along with MnS and residual Na 2 Mn 2 S 3 . Single crystal X-ray diffraction structural analysis of LiNaMnS 2 revealed that this compound crystallizes in P-3m1 with cell parameters a=4.0479(6) A, c=6.7759(14) A, V=96.15(3) A 3 (Z=1, wR2=0.0367) in the NaLiCdS 2 structure-type. - Graphical abstract: Structure of LiNaMnS 2 . Li and Mn are statistically distributed in edge-shared tetrahedral environments linked into infinite planes. Sodium ions occupy interlayer sites
Structure of Se-rich As-Se glasses by high-resolution x-ray photoelectron spectroscopy
International Nuclear Information System (INIS)
Golovchak, R.; Kovalskiy, A.; Miller, A. C.; Jain, H.; Shpotyuk, O.
2007-01-01
To establish the validity of various proposed structural models, we have investigated the structure of the binary As x Se 100-x chalcogenide glass family (x≤40) by high-resolution x-ray photoelectron spectroscopy. From the composition dependence of the valence band, the contributions to the density of states from the 4p lone pair electrons of Se and the 4p bonding states and 4s electrons of Se and As are identified in the top part of the band. The analysis of Se 3d and As 3d core-level spectra supports the so-called chain crossing model for the atomic structure of Se-rich As x Se 100-x bulk glasses. The results also indicate small deviations (∼3-8%) from this model, especially for glass compositions with short Se chains (25 40 Se 60 and of Se-Se-Se fragments in a glass with composition x=30 is established
First-principles calculations of structural, electronic and optical properties of CdxZn1-xS alloys
Noor, Naveed Ahmed
2010-10-01
Structural, electronic and optical properties of ternary alloy system CdxZn1-xS have been studied using first-principles approach based on density functional theory. Electronic structure, density of states and energy band gap values for CdxZn1-xS are estimated in the range 0 ≤ x ≤ 1 using both the standard local density approximation (LDA) as well as the generalized gradient approximations (GGA) of Wu-Cohen (WC) for the exchange-correlation potential. It is observed that the direct band gap EgΓ-Γ of CdxZn1-xS decreases nonlinearly with the compositional parameter x, as observed experimentally. It is also found that Cd s and d, S p and Zn d states play a major role in determining the electronic properties of this alloy system. Furthermore, results for complex dielectric constant ε(ω), refractive index n(ω), normal-incidence reflectivity R(ω), absorption coefficient α(ω) and optical conductivity σ(ω) are also described in a wide range of the incident photon energy and compared with the existing experimental data. © 2010 Elsevier B.V. All rights reserved.
Superstrings on AdS4xCP3 from supergravity
International Nuclear Information System (INIS)
D'Auria, Riccardo; Trigiante, Mario; Fre, Pietro; Grassi, Pietro Antonio
2009-01-01
We derive from a general formulation of pure spinor string theory on type IIA backgrounds the specific form of the action for the AdS 4 xCP 3 background. We provide a complete geometrical characterization of the structure of the superfields involved in the action.
Staging structures of the intercalation compounds Ag/sub x/TiS2
International Nuclear Information System (INIS)
Bardhan, K.K.; Kirczenow, G.; Jackle, G.; Irwin, J.C.
1986-01-01
An extensive investigation of the structure, and in particular the staging, of powdered samples of the intercalation compounds Ag/sub x/TiS 2 (0 0 C. The (T,x) phase diagram contains three phases: a high-x (dense) stage-1 phase, a stage-disordered phase, which at low x or high temperatures appears to become a pure low-x (dilute) stage-1 phase, and a simple stage-2 phase. On the high-x side of its stability region the stage-2 phase undergoes an apparent first-order transition to the dense stage-1 phase, but on the high-temperature side it proceeds continuously, through stage-disordered states, to a dilute stage-1 phase. On the low-x side of the stage-2 region there is also a dilute stage-1 phase. At sufficiently high temperatures a novel coexistence of the two stage-1 phases is observed. This is the first time that the high-temperature stability limit of the stage-2 region has been probed in any intercalation compound. The results are compared with recent theoretical models
Mansur, Alexandra A. P.; Mansur, Herman S.; Caires, Anderson J.; Mansur, Rafael L.; Oliveira, Luiz C.
2017-07-01
Quantum dots (QDs) are colloidal semiconductor nanocrystals with unique properties that can be engineered by controlling the nanoparticle size and chemical composition by doping and alloying strategies. However, due to their potential toxicity, augmenting their biocompatibility is yet a challenge for expanding to several biomedical and environmentally friendly applications. Thus, the main goal of this study was to develop composition-tunable and biocompatible Zn x Cd1 - x S QDs using carboxymethylcellulose polysaccharide as direct capping ligand via green colloidal aqueous route at neutral pH and at room temperature for potential biomedical and environmental applications. The ternary alloyed QDs were extensively characterized using UV-vis spectroscopy, photoluminescence spectroscopy (PL), transmission electron microscopy (TEM), X-ray diffraction (XRD), electron energy loss spectroscopy (EELS), and X-ray photoelectrons spectroscopy (XPS). The results indicated that Zn x Cd(1 - x)S QDs were surface stabilized by carboxymethylcellulose biopolymer with spherical morphology for all composition of alloys and narrow sizes distributions ranging from 4 to 5 nm. The XRD results indicated that monophasic ternary alloyed Zn x Cd1 - x S nanocrystals were produced with homogenous composition of the core as evidenced by EELS and XPS analyses. In addition, the absorption and emission optical properties of Zn x Cd1 - x S QDs were red shifted with increasing the amount of Cd2+ in the alloyed nanocrystals, which have also increased the quantum yield compared to pure CdS and ZnS nanoparticles. These properties of alloyed nanomaterials were interpreted based on empirical model of Vegard's law and chemical bond model (CBM). As a proof of concept, these alloyed-QD conjugates were tested for biomedical and environmental applications. The results demonstrated that they were non-toxic and effective fluorophores for bioimaging live HEK293T cells (human embryonic kidney cells) using confocal
Understanding the internal structures of X(4140), X(4274), X(4500) and X(4700)
Energy Technology Data Exchange (ETDEWEB)
Chen, Hua-Xing; Cui, Er-Liang [Beihang University, School of Physics and Beijing Key Laboratory of Advanced Nuclear Materials and Physics, Beijing (China); Chen, Wei [University of Saskatchewan, Department of Physics and Engineering Physics, Saskatoon, Saskatchewan (Canada); Liu, Xiang [Lanzhou University, School of Physical Science and Technology, Lanzhou (China); Lanzhou University and Institute of Modern Physics of CAS, Research Center for Hadron and CSR Physics, Lanzhou (China); Zhu, Shi-Lin [Peking University, School of Physics and State Key Laboratory of Nuclear Physics and Technology, Beijing (China); Collaborative Innovation Center of Quantum Matter, Beijing (China); Peking University, Center of High Energy Physics, Beijing (China)
2017-03-15
We investigate the newly observed X(4500) and X(4700) based on the diquark-antidiquark configuration within the framework of QCD sum rules. Both of them may be interpreted as the D-wave cs anti c anti s tetraquark states of J{sup P} = 0{sup +}, but with opposite color structures, which is remarkably similar to the result obtained in Chen and Zhu (Phys Rev D 83:034010, 2011) that X(4140) and X(4274) can be both interpreted as the S-wave cs anti c anti s tetraquark states of J{sup P} = 1{sup +}, also with opposite color structures. However, the extracted masses and these suggested assignments to these X states do depend on these running quark masses where m{sub s}(2 GeV) = 95 ± 5 MeV and m{sub c}(m{sub c}) = 1.23 ± 0.09 GeV. As a byproduct, the masses of the hidden-bottom partner states of X(4500) and X(4700) are extracted to be both around 10.64 GeV, which can be searched for in the Υφ invariant mass distribution. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Kalinich, Donald A.; Sallaberry, Cedric M.; Mattie, Patrick D.
2010-12-01
For the U.S. Nuclear Regulatory Commission (NRC) Extremely Low Probability of Rupture (xLPR) pilot study, Sandia National Laboratories (SNL) was tasked to develop and evaluate a probabilistic framework using a commercial software package for Version 1.0 of the xLPR Code. Version 1.0 of the xLPR code is focused assessing the probability of rupture due to primary water stress corrosion cracking in dissimilar metal welds in pressurizer surge nozzles. Future versions of this framework will expand the capabilities to other cracking mechanisms, and other piping systems for both pressurized water reactors and boiling water reactors. The goal of the pilot study project is to plan the xLPR framework transition from Version 1.0 to Version 2.0; hence the initial Version 1.0 framework and code development will be used to define the requirements for Version 2.0. The software documented in this report has been developed and tested solely for this purpose. This framework and demonstration problem will be used to evaluate the commercial software's capabilities and applicability for use in creating the final version of the xLPR framework. This report details the design, system requirements, and the steps necessary to use the commercial-code based xLPR framework developed by SNL.
Energy Technology Data Exchange (ETDEWEB)
Vargas, R A; Chiba, R; Bonturim, E; Andreoli, M; Seo, E S.M., [Instituto de Pesquisas Energeticas e Nucleares (CCTM/IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Ciencia e Tecnologia de Materiais. Lab. de Insumos e Componentes
2009-07-01
Nowadays a material that is studied as cathode in intermediate temperature solid oxide fuel cells (ITSOFC) is the mixing oxide La{sub 0,60S}r{sub 0},{sub 40}Co{sub 0},{sub 20}Fe{sub 0},{sub 80}O{sub 3-{delta}} (LSCF), that possess pseudo-perovskite structure. The objective of this work is to present the physical, chemical and microstructural of LSCF powders characteristics, prepared by the citrate technique. The main analyses utilized were: X-ray diffraction, X-ray fluorescence spectroscopy, laser scattering granulometry, and scanning electron microscopy. The results show that the elimination of organic precursors is important for desired structure formation and that amount of this phase depends on cobalt content. Moreover, the chemical composition is next to stoichiometric calculated (x=0.40 and y=0.80) and the average sizes of particles are adjusted for ceramic suspensions preparation, contributing for the wet powder spraying step conformation. (author)
SERUM YKL-40 IS ASSOCIATED WITH BONE DISEASE IN MULTIPLE MYELOMA
DEFF Research Database (Denmark)
Mylin, Anne Kjærsgaard; Abildgaard, Niels; Johansen, Julia S.
2007-01-01
Introduction. The secreted glycoprotein YKL-40 (CHI3L1, HC gp-39) is a potential player in the tumor-host interactions affecting several aspects of multiple myeloma (MM) including bone destruction. Previous studies support a role for YKL-40 in remodelling of the extracellular matrix, in angiogen...... Introduction. The secreted glycoprotein YKL-40 (CHI3L1, HC gp-39) is a potential player in the tumor-host interactions affecting several aspects of multiple myeloma (MM) including bone destruction. Previous studies support a role for YKL-40 in remodelling of the extracellular matrix...... and followed for up to 30 months. Skeletal related events (SRE) were registered and subdivided in vertebral fractures and osteolytic events including non-vertebral fractures. Results. 57% of the patients had a S-YKL-40 elevated above the upper limit in an age specific 90 per cent reference range for healthy...... adults. Patients with elevated S-YKL-40 had a higher total X-ray score (p=0.005) and higher levels of S-CTX-MMP (p=0.003), U-PYD (p=0.004) and U-DPD (p=0.002), while U-NTX-1 and the markers of bone formation did not differ from the levels seen in patients with normal S-YKL-40. During follow-up 21...
Charge Fluctuations in the NdO1-xFxBiS2 Superconductors
Athauda, Anushika; Mizuguchi, Yoshikazu; Nagao, Masanori; Neuefeind, Joerg; Louca, Despina
2017-12-01
The local atomic structure of superconducting NdO1-xFxBiS2 (x = 0.2 and 0.4) is investigated using neutron diffraction and the pair density function analysis technique. In the non-superconducting x = 0.2 composition, ferrodistortive displacements of the pyramidal sulfur ions break the tetragonal symmetry and a superlattice structure emerges with peaks appearing at h + k odd reflections superimposed on the even reflections of the P4/nmm symmetry. In the superconducting x = 0.4 composition, similar ferrodistortive displacements are observed but with different magnitudes coupled with in-plane Bi distortions which are indicative of charge fluctuations.
Energy Technology Data Exchange (ETDEWEB)
Embaid, B.P., E-mail: pembaid@fisica.ciens.ucv.ve [Laboratorio de Magnetismo, Escuela de Fisica, Universidad Central de Venezuela, Apartado 47586, Los Chaguaramos, Caracas 1041-A (Venezuela, Bolivarian Republic of); Gonzalez-Jimenez, F. [Laboratorio de Magnetismo, Escuela de Fisica, Universidad Central de Venezuela, Apartado 47586, Los Chaguaramos, Caracas 1041-A (Venezuela, Bolivarian Republic of)
2013-03-15
Iron-vanadium sulfides of the monoclinic system Fe{sub x}V{sub 3-x}S{sub 4} (1.0{<=}x{<=}2.0) have been investigated by {sup 57}Fe Moessbauer Spectroscopy in the temperature range 30-300 K. Incommensurate spin density waves (SDW) have been found in this system. An alternative treatment of the spectra allows a direct measurement of the temperature evolution of condensate density of the SDW state which follows the Maki-Virosztek formula. For composition (x=1.0) the SDW condensate is unpinned while for compositions (x>1.0) the SDW condensate is pinned. Possible causes of the pinning-unpinning SDW will be discussed. - Highlights: Black-Right-Pointing-Pointer Fe{sub x}V{sub 3-x}S{sub 4}(1.0{<=}x{<=}2.0) system was investigated by {sup 57}Fe Moessbauer Spectroscopy. Black-Right-Pointing-Pointer Incommensurate spin density wave (SDW) has been found in this system. Black-Right-Pointing-Pointer We report the temperature evolution of the condensate density of SDW state. Black-Right-Pointing-Pointer For composition (x=1.0) the SDW is unpinned while for (x>1.0) is pinned.
International Nuclear Information System (INIS)
Choutri, H.; Ghebouli, M.A.; Ghebouli, B.; Bouarissa, N.; Uçgun, E.; Ocak, H.Y.
2014-01-01
The structural, elastic, electronic and magnetic properties of the diluted magnetic semiconductors Mn x Ca 1−x S in the rock-salt phase have been investigated using first-principles calculations with both LDA and LDA + U functional. Features such as lattice constant, bulk modulus, elastic constants, spin-polarized band structure, total and local densities of states have been computed. We predict the values of the exchange constants and the band edge spin splitting of the valence and conduction bands. The hybridization between S-3p and Mn-3d produces small local magnetic moment on the nonmagnetic Ca and S sites. The ferromagnetism is induced due to the exchange splitting of S-3p and Mn-3d hybridized bands. The total magnetic moment per Mn of Mn x Ca 1−x S is 4.4μ B and 4.5μ B for LDA and LDA + U functional and is independent of the Mn concentration. The unfilled Mn-3d levels reduce the local magnetic moment of Mn from its free space charge value of 5μ B –4.4μ B and4.5μ B for LDA and LDA + U functional due to 3p–3d hybridization. - Highlights: • Fundamental properties of magnetic semiconductors Mn x Ca 1−x S. • Rock-salt phase of Mn x Ca 1−x S. • Magnetic properties of the diluted magnetic semiconductors Mn x Ca 1−x S. • The use of LDA + U functionals
Energy Technology Data Exchange (ETDEWEB)
Rosiles-Perez, C. [Universidad de Guanajuato, Departamento de Quimica, Unidad Pueblito de Rocha, Campus Guanajuato, Cerro de la Venada s/n, Col. Pueblito de Rocha, CP 36040 Guanajuato (Mexico); Lambert, J. [CIATEC, A.C, Omega no. 201 Colonia: Industrial Delta, C.P. 37545 León, Guanajuato (Mexico); Alatorre-Ordaz, A., E-mail: alatorre@ugto.mx [Universidad de Guanajuato, Departamento de Quimica, Unidad Pueblito de Rocha, Campus Guanajuato, Cerro de la Venada s/n, Col. Pueblito de Rocha, CP 36040 Guanajuato (Mexico); Gutierrez, J.A. [Universidad de Guanajuato, Departamento de Quimica, Unidad Pueblito de Rocha, Campus Guanajuato, Cerro de la Venada s/n, Col. Pueblito de Rocha, CP 36040 Guanajuato (Mexico); López-Luke, T. [Centro de Investigaciones en Óptica, A.P. 1-948, León, Gto. 37160 (Mexico); Ramirez-Fuentes, R. [Universidad de Guanajuato, Departamento de Quimica, Unidad Pueblito de Rocha, Campus Guanajuato, Cerro de la Venada s/n, Col. Pueblito de Rocha, CP 36040 Guanajuato (Mexico); Kobayashi, T. [Department of Materials Science and Technology, Nagaoka University of Technology, Kamitomioka, Nagaoka 940-2188 (Japan)
2017-04-15
A series of colloidal quantum dots (QDs) of CdS, ZnS, and the ternary chalcogenide Cd{sub 1−x}Zn{sub x}S were synthesized by a nanoemulsion method, using a sonication probe as shearing power source. Quantum dots with diameters between 4 and 5 nm and cubic crystal structure were obtained and measured by HRTEM and XRD. In all cases, homogeneous solid solutions were obtained, as revealed by Vegard's Law, except with Cd{sub 0.39}Zn{sub 0.61}S. Optical properties of colloidal QDs were measured; the absorption edge is blue shifted, as the content of Zn increases, and showed a quantum confinement. Different emitted colors under UV light was observed, from dark brown with CdS to deep blue with ZnS. QDs of Cd{sub 0.39}Zn{sub 0.61}S show a white photoluminescence. Photoluminescence of the colloidal QDs is due to the combination of the direct band emissions and the trap emissions.
Compact scanning transmission x-ray microscope at the photon factory
International Nuclear Information System (INIS)
Takeichi, Yasuo; Inami, Nobuhito; Ono, Kanta; Suga, Hiroki; Takahashi, Yoshio
2016-01-01
We report the design and performance of a compact scanning transmission X-ray microscope developed at the Photon Factory. Piezo-driven linear stages are used as coarse stages of the microscope to realize excellent compactness, mobility, and vibrational and thermal stability. An X-ray beam with an intensity of ∼10 7 photons/s was focused to a diameter of ∼40 nm at the sample. At the soft X-ray undulator beamline used with the microscope, a wide range of photon energies (250–1600 eV) is available. The microscope has been used to research energy materials and in environmental sciences
First-principles calculations of structural, electronic and optical properties of CdxZn1-xS alloys
Noor, Naveed Ahmed; Ikram, Nazma; Ali, Sana Zulfiqar; Nazir, Safdar; Alay-E-Abbas, Syed Muhammad; Shaukat, Ali
2010-01-01
Structural, electronic and optical properties of ternary alloy system CdxZn1-xS have been studied using first-principles approach based on density functional theory. Electronic structure, density of states and energy band gap values for CdxZn1-xS
Energy Technology Data Exchange (ETDEWEB)
Hassanien, A.S., E-mail: a.s.hassanien@gmail.com [Engineering Mathematics and Physics Dept., Faculty of Engineering (Shoubra), Benha University (Egypt); Physics Department, Faculty of Science and Humanities in Ad-Dawadmi, Shaqra University, 11911 (Saudi Arabia); Akl, Alaa A. [Physics Department, Faculty of Science and Humanities in Ad-Dawadmi, Shaqra University, 11911 (Saudi Arabia)
2015-11-05
Non-crystalline thin films of chalcogenide Cd{sub 50}S{sub 50−x}Se{sub x} system (30 ≤ x ≤ 50) were obtained by thermal evaporation technique onto a pre-cleaned glass substrate at a vacuum of 8.2 × 10{sup −4} Pa. The deposition rate and film thickness were kept constant at about 8 nm/s and 200 nm, respectively. Amorphous/crystalline nature and chemical composition of films have been checked using X-ray diffraction and energy dispersive X-ray spectroscopy (EDX). Optical properties of thin films were investigated and studied using the corrected transmittance, T(λ) and corrected reflectance, R(λ) measurements. Obtained data reveal that, the indirect optical energy gap (E{sub g}) was decreased from 2.21 to 1.57 eV. On the contrary, Urbach energy (band tail width), E{sub U} was found to be increased from 0.29 to 0.45 eV. This behavior is believed to be associated with the increase of Se-content instead of S-content in the thin films of Cd{sub 50}S{sub 50−x}Se{sub x} system. Chemical bond approach model, CBA was used to analyze the obtained values of E{sub g} and E{sub U}. Optical density, skin depth, extinction coefficient, refractive index and optical conductivity of chalcogenide CdSSe thin films were discussed as functions of Se-content. Using Wemple-DiDomenico single oscillator model, the refractive index dispersion and energy parameters and their dependence on Se content were studied. - Highlights: • Amorphous thin films of thickness 200 nm of Cd{sub 50}S{sub 50−x}Se{sub x} (30 ≤ x ≤ 50) have prepared. • Optical properties, indirect optical energy gap and band tail width were studied. • Chemical bond approach, CBA was used to analyze the obtained values of E{sub g} and E{sub U}. • New data of dispersion refractive index parameters were investigated and discussed.
Aaboud, Morad; Abbott, Brad; Abdallah, Jalal; Abdinov, Ovsat; Abeloos, Baptiste; Aben, Rosemarie; AbouZeid, Ossama; Abraham, Nicola; Abramowicz, Halina; Abreu, Henso; Abreu, Ricardo; Abulaiti, Yiming; Acharya, Bobby Samir; Adachi, Shunsuke; Adamczyk, Leszek; Adams, David; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Affolder, Tony; Agatonovic-Jovin, Tatjana; Agricola, Johannes; Aguilar-Saavedra, Juan Antonio; Ahlen, Steven; Ahmadov, Faig; Aielli, Giulio; Akerstedt, Henrik; Åkesson, Torsten Paul Ake; Akimov, Andrei; Alberghi, Gian Luigi; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alexa, Calin; Alexander, Gideon; Alexopoulos, Theodoros; Alhroob, Muhammad; Ali, Babar; Aliev, Malik; Alimonti, Gianluca; Alison, John; Alkire, Steven Patrick; Allbrooke, Benedict; Allen, Benjamin William; Allport, Phillip; Aloisio, Alberto; Alonso, Alejandro; Alonso, Francisco; Alpigiani, Cristiano; Alshehri, Azzah Aziz; Alstaty, Mahmoud; Alvarez Gonzalez, Barbara; Άlvarez Piqueras, Damián; Alviggi, Mariagrazia; Amadio, Brian Thomas; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Amidei, Dante; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anders, John Kenneth; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Angelidakis, Stylianos; Angelozzi, Ivan; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antel, Claire; Antonelli, Mario; Antonov, Alexey; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Arabidze, Giorgi; Arai, Yasuo; Araque, Juan Pedro; Arce, Ayana; Arduh, Francisco Anuar; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Metin; Armbruster, Aaron James; Armitage, Lewis James; Arnaez, Olivier; Arnold, Hannah; Arratia, Miguel; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Artz, Sebastian; Asai, Shoji; Asbah, Nedaa; Ashkenazi, Adi; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Atkinson, Markus; Atlay, Naim Bora; Augsten, Kamil; Avolio, Giuseppe; Axen, Bradley; Ayoub, Mohamad Kassem; Azuelos, Georges; Baak, Max; Baas, Alessandra; Baca, Matthew John; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Baines, John; Baker, Oliver Keith; Baldin, Evgenii; Balek, Petr; Balestri, Thomas; Balli, Fabrice; Balunas, William Keaton; Banas, Elzbieta; Banerjee, Swagato; Bannoura, Arwa A E; Barak, Liron; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisits, Martin-Stefan; Barklow, Timothy; Barlow, Nick; Barnes, Sarah Louise; Barnett, Bruce; Barnett, Michael; Barnovska-Blenessy, Zuzana; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barranco Navarro, Laura; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Basalaev, Artem; Bassalat, Ahmed; Bates, Richard; Batista, Santiago Juan; Batley, Richard; Battaglia, Marco; Bauce, Matteo; Bauer, Florian; Bawa, Harinder Singh; Beacham, James; Beattie, Michael David; Beau, Tristan; Beauchemin, Pierre-Hugues; Bechtle, Philip; Beck, Hans~Peter; Becker, Kathrin; Becker, Maurice; Beckingham, Matthew; Becot, Cyril; Beddall, Andrew; Beddall, Ayda; Bednyakov, Vadim; Bedognetti, Matteo; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Janna Katharina; Belanger-Champagne, Camille; Bell, Andrew Stuart; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belotskiy, Konstantin; Beltramello, Olga; Belyaev, Nikita; Benary, Odette; Benchekroun, Driss; Bender, Michael; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez, Jose; Benjamin, Douglas; Bensinger, James; Bentvelsen, Stan; Beresford, Lydia; Beretta, Matteo; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Beringer, Jürg; Berlendis, Simon; Bernard, Nathan Rogers; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertoli, Gabriele; Bertolucci, Federico; Bertram, Iain Alexander; Bertsche, Carolyn; Bertsche, David; Besjes, Geert-Jan; Bessidskaia Bylund, Olga; Bessner, Martin Florian; Besson, Nathalie; Betancourt, Christopher; Bethani, Agni; Bethke, Siegfried; Bevan, Adrian John; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Biedermann, Dustin; Bielski, Rafal; Biesuz, Nicolo Vladi; Biglietti, Michela; Bilbao De Mendizabal, Javier; Billoud, Thomas Remy Victor; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Biondi, Silvia; Bisanz, Tobias; Bjergaard, David Martin; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blue, Andrew; Blum, Walter; Blumenschein, Ulrike; Blunier, Sylvain; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Bock, Christopher; Boehler, Michael; Boerner, Daniela; Bogaerts, Joannes Andreas; Bogavac, Danijela; Bogdanchikov, Alexander; Bohm, Christian; Boisvert, Veronique; Bokan, Petar; Bold, Tomasz; Boldyrev, Alexey; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Borisov, Anatoly; Borissov, Guennadi; Bortfeldt, Jonathan; Bortoletto, Daniela; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Bossio Sola, Jonathan David; Boudreau, Joseph; Bouffard, Julian; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Boutle, Sarah Kate; Boveia, Antonio; Boyd, James; Boyko, Igor; Bracinik, Juraj; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Breaden Madden, William Dmitri; Brendlinger, Kurt; Brennan, Amelia Jean; Brenner, Lydia; Brenner, Richard; Bressler, Shikma; Bristow, Timothy Michael; Britton, Dave; Britzger, Daniel; Brochu, Frederic; Brock, Ian; Brock, Raymond; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Broughton, James; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Bruni, Alessia; Bruni, Graziano; Bruni, Lucrezia Stella; Brunt, Benjamin; Bruschi, Marco; Bruscino, Nello; Bryant, Patrick; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Buchholz, Peter; Buckley, Andrew; Budagov, Ioulian; Buehrer, Felix; Bugge, Magnar Kopangen; Bulekov, Oleg; Bullock, Daniel; Burckhart, Helfried; Burdin, Sergey; Burgard, Carsten Daniel; Burghgrave, Blake; Burka, Klaudia; Burke, Stephen; Burmeister, Ingo; Burr, Jonathan Thomas Peter; Busato, Emmanuel; Büscher, Daniel; Büscher, Volker; Bussey, Peter; Butler, John; Buttar, Craig; Butterworth, Jonathan; Butti, Pierfrancesco; Buttinger, William; Buzatu, Adrian; Buzykaev, Aleksey; Cabrera Urbán, Susana; Caforio, Davide; Cairo, Valentina; Cakir, Orhan; Calace, Noemi; Calafiura, Paolo; Calandri, Alessandro; Calderini, Giovanni; Calfayan, Philippe; Callea, Giuseppe; Caloba, Luiz; Calvente Lopez, Sergio; Calvet, David; Calvet, Samuel; Calvet, Thomas Philippe; Camacho Toro, Reina; Camarda, Stefano; Camarri, Paolo; Cameron, David; Caminal Armadans, Roger; Camincher, Clement; Campana, Simone; Campanelli, Mario; Camplani, Alessandra; Campoverde, Angel; Canale, Vincenzo; Canepa, Anadi; Cano Bret, Marc; Cantero, Josu; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Carbone, Ryne Michael; Cardarelli, Roberto; Cardillo, Fabio; Carli, Ina; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Casolino, Mirkoantonio; Casper, David William; Castaneda-Miranda, Elizabeth; Castelijn, Remco; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Caudron, Julien; Cavaliere, Viviana; Cavallaro, Emanuele; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerda Alberich, Leonor; Cerio, Benjamin; Santiago Cerqueira, Augusto; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cerv, Matevz; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chan, Stephen Kam-wah; Chan, Yat Long; Chang, Philip; Chapman, John Derek; Charlton, Dave; Chatterjee, Avishek; Chau, Chav Chhiv; Chavez Barajas, Carlos Alberto; Che, Siinn; Cheatham, Susan; Chegwidden, Andrew; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Shenjian; Chen, Shion; Chen, Xin; Chen, Ye; Cheng, Hok Chuen; Cheng, Huajie; Cheng, Yangyang; Cheplakov, Alexander; Cheremushkina, Evgenia; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Chiarelli, Giorgio; Chiodini, Gabriele; Chisholm, Andrew; Chitan, Adrian; Chizhov, Mihail; Choi, Kyungeon; Chomont, Arthur Rene; Chouridou, Sofia; Chow, Bonnie Kar Bo; Christodoulou, Valentinos; Chromek-Burckhart, Doris; Chudoba, Jiri; Chuinard, Annabelle Julia; Chwastowski, Janusz; Chytka, Ladislav; Ciapetti, Guido; Ciftci, Abbas Kenan; Cinca, Diane; Cindro, Vladimir; Cioara, Irina Antonela; Ciocca, Claudia; Ciocio, Alessandra; Cirotto, Francesco; Citron, Zvi Hirsh; Citterio, Mauro; Ciubancan, Mihai; Clark, Allan G; Clark, Brian Lee; Clark, Michael; Clark, Philip James; Clarke, Robert; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Colasurdo, Luca; Cole, Brian; Colijn, Auke-Pieter; Collot, Johann; Colombo, Tommaso; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Connell, Simon Henry; Connelly, Ian; Consorti, Valerio; Constantinescu, Serban; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cormier, Kyle James Read; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Cottin, Giovanna; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Crawley, Samuel Joseph; Cree, Graham; Crépé-Renaudin, Sabine; Crescioli, Francesco; Cribbs, Wayne Allen; Crispin Ortuzar, Mireia; Cristinziani, Markus; Croft, Vince; Crosetti, Giovanni; Cueto, Ana; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cúth, Jakub; Czirr, Hendrik; Czodrowski, Patrick; D'amen, Gabriele; D'Auria, Saverio; D'Onofrio, Monica; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dado, Tomas; Dai, Tiesheng; Dale, Orjan; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Dandoy, Jeffrey Rogers; Dang, Nguyen Phuong; Daniells, Andrew Christopher; Dann, Nicholas Stuart; Danninger, Matthias; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darmora, Smita; Dassoulas, James; Dattagupta, Aparajita; Davey, Will; David, Claire; Davidek, Tomas; Davies, Merlin; Davison, Peter; Dawe, Edmund; Dawson, Ian; De, Kaushik; de Asmundis, Riccardo; De Benedetti, Abraham; De Castro, Stefano; De Cecco, Sandro; De Groot, Nicolo; de Jong, Paul; De la Torre, Hector; De Lorenzi, Francesco; De Maria, Antonio; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dedovich, Dmitri; Dehghanian, Nooshin; Deigaard, Ingrid; Del Gaudio, Michela; Del Peso, Jose; Del Prete, Tarcisio; Delgove, David; Deliot, Frederic; Delitzsch, Chris Malena; Dell'Acqua, Andrea; Dell'Asta, Lidia; Dell'Orso, Mauro; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; DeMarco, David; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Denisov, Sergey; Denysiuk, Denys; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deterre, Cecile; Dette, Karola; Deviveiros, Pier-Olivier; Dewhurst, Alastair; Dhaliwal, Saminder; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Clemente, William Kennedy; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Diaconu, Cristinel; Diamond, Miriam; Dias, Flavia; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Díez Cornell, Sergio; Dimitrievska, Aleksandra; Dingfelder, Jochen; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Djuvsland, Julia Isabell; Barros do Vale, Maria Aline; Dobos, Daniel; Dobre, Monica; Doglioni, Caterina; Dolejsi, Jiri; Dolezal, Zdenek; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dova, Maria-Teresa; Doyle, Tony; Drechsler, Eric; Dris, Manolis; Du, Yanyan; Duarte-Campderros, Jorge; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Dudder, Andreas Christian; Duffield, Emily Marie; Duflot, Laurent; Dührssen, Michael; Dumancic, Mirta; Dunford, Monica; Duran Yildiz, Hatice; Düren, Michael; Durglishvili, Archil; Duschinger, Dirk; Dutta, Baishali; Dyndal, Mateusz; Eckardt, Christoph; Ecker, Katharina Maria; Edgar, Ryan Christopher; Edwards, Nicholas Charles; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Ekelof, Tord; El Kacimi, Mohamed; Ellajosyula, Venugopal; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Elliot, Alison; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Ennis, Joseph Stanford; Erdmann, Johannes; Ereditato, Antonio; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Esposito, Bellisario; Etienvre, Anne-Isabelle; Etzion, Erez; Evans, Hal; Ezhilov, Alexey; Ezzi, Mohammed; Fabbri, Federica; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Falla, Rebecca Jane; Faltova, Jana; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farina, Christian; Farina, Edoardo Maria; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Faucci Giannelli, Michele; Favareto, Andrea; Fawcett, William James; Fayard, Louis; Fedin, Oleg; Fedorko, Wojciech; Feigl, Simon; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Feremenga, Last; Fernandez Martinez, Patricia; Fernandez Perez, Sonia; Ferrando, James; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiedler, Frank; Filipčič, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Adam; Fischer, Cora; Fischer, Julia; Fisher, Wade Cameron; Flaschel, Nils; Fleck, Ivor; Fleischmann, Philipp; Fletcher, Gareth Thomas; Fletcher, Rob Roy MacGregor; Flick, Tobias; Flores Castillo, Luis; Flowerdew, Michael; Forcolin, Giulio Tiziano; Formica, Andrea; Forti, Alessandra; Foster, Andrew Geoffrey; Fournier, Daniel; Fox, Harald; Fracchia, Silvia; Francavilla, Paolo; Franchini, Matteo; Francis, David; Franconi, Laura; Franklin, Melissa; Frate, Meghan; Fraternali, Marco; Freeborn, David; Fressard-Batraneanu, Silvia; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fusayasu, Takahiro; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gach, Grzegorz; Gadatsch, Stefan; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Louis Guillaume; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gao, Jun; Gao, Yanyan; Gao, Yongsheng; Garay Walls, Francisca; García, Carmen; García Navarro, José Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gascon Bravo, Alberto; Gasnikova, Ksenia; Gatti, Claudio; Gaudiello, Andrea; Gaudio, Gabriella; Gauthier, Lea; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Gecse, Zoltan; Gee, Norman; Geich-Gimbel, Christoph; Geisen, Marc; Geisler, Manuel Patrice; Gellerstedt, Karl; Gemme, Claudia; Genest, Marie-Hélène; Geng, Cong; Gentile, Simonetta; Gentsos, Christos; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghasemi, Sara; Ghneimat, Mazuza; Giacobbe, Benedetto; Giagu, Stefano; Giannetti, Paola; Gibbard, Bruce; Gibson, Stephen; Gignac, Matthew; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gilles, Geoffrey; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giorgi, Filippo Maria; Giorgi, Francesco Michelangelo; Giraud, Pierre-Francois; Giromini, Paolo; Giugni, Danilo; Giuli, Francesco; Giuliani, Claudia; Giulini, Maddalena; Gjelsten, Børge Kile; Gkaitatzis, Stamatios; Gkialas, Ioannis; Gkougkousis, Evangelos Leonidas; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glaysher, Paul; Glazov, Alexandre; Goblirsch-Kolb, Maximilian; Godlewski, Jan; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Giulia; Gonella, Laura; Gongadze, Alexi; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez-Sevilla, Sergio; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gössling, Claus; Gostkin, Mikhail Ivanovitch; Goudet, Christophe Raymond; Goujdami, Driss; Goussiou, Anna; Govender, Nicolin; Gozani, Eitan; Graber, Lars; Grabowska-Bold, Iwona; Gradin, Per Olov Joakim; Grafström, Per; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Sergio; Gratchev, Vadim; Gravila, Paul Mircea; Gray, Heather; Graziani, Enrico; Greenwood, Zeno Dixon; Grefe, Christian; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Grevtsov, Kirill; Griffiths, Justin; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grivaz, Jean-Francois; Groh, Sabrina; Grohs, Johannes Philipp; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Grout, Zara Jane; Guan, Liang; Guan, Wen; Guenther, Jaroslav; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Guo, Jun; Guo, Yicheng; Gupta, Ruchi; Gupta, Shaun; Gustavino, Giuliano; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haddad, Nacim; Hadef, Asma; Hageböck, Stephan; Hagihara, Mutsuto; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Haley, Joseph; Halladjian, Garabed; Hallewell, Gregory David; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamilton, Andrew; Hamity, Guillermo Nicolas; Hamnett, Phillip George; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Haney, Bijan; Hanke, Paul; Hanna, Remie; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Maike Christina; Hansen, Peter Henrik; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Hariri, Faten; Harkusha, Siarhei; Harrington, Robert; Harrison, Paul Fraser; Hartjes, Fred; Hartmann, Nikolai Marcel; Hasegawa, Makoto; Hasegawa, Yoji; Hasib, A; Hassani, Samira; Haug, Sigve; Hauser, Reiner; Hauswald, Lorenz; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hayakawa, Daiki; Hayden, Daniel; Hays, Chris; Hays, Jonathan Michael; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heim, Timon; Heinemann, Beate; Heinrich, Jochen Jens; Heinrich, Lukas; Heinz, Christian; Hejbal, Jiri; Helary, Louis; Hellman, Sten; Helsens, Clement; Henderson, James; Henderson, Robert; Heng, Yang; Henkelmann, Steffen; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Herbert, Geoffrey Henry; Herde, Hannah; Herget, Verena; Hernández Jiménez, Yesenia; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hetherly, Jeffrey Wayne; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, Ewan; Hill, John; Hiller, Karl Heinz; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hinman, Rachel Reisner; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoenig, Friedrich; Hohn, David; Holmes, Tova Ray; Homann, Michael; Honda, Takuya; Hong, Tae Min; Hooberman, Benjamin Henry; Hopkins, Walter; Horii, Yasuyuki; Horton, Arthur James; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howarth, James; Hoya, Joaquin; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hrynevich, Aliaksei; Hsu, Catherine; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Qipeng; Hu, Shuyang; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Huo, Peng; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Ideal, Emma; Idrissi, Zineb; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikeno, Masahiro; Ilchenko, Yuriy; Iliadis, Dimitrios; Ilic, Nikolina; Ince, Tayfun; Introzzi, Gianluca; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Ishijima, Naoki; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Ito, Fumiaki; Iturbe Ponce, Julia Mariana; Iuppa, Roberto; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jabbar, Samina; Jackson, Brett; Jackson, Paul; Jain, Vivek; Jakobi, Katharina Bianca; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jamin, David Olivier; Jana, Dilip; Jansky, Roland; Janssen, Jens; Janus, Michel; Jarlskog, Göran; Javadov, Namig; Javůrek, Tomáš; Jeanneau, Fabien; Jeanty, Laura; Jeng, Geng-yuan; Jennens, David; Jenni, Peter; Jeske, Carl; Jézéquel, Stéphane; Ji, Haoshuang; Jia, Jiangyong; Jiang, Hai; Jiang, Yi; Jiggins, Stephen; Jimenez Pena, Javier; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Jivan, Harshna; Johansson, Per; Johns, Kenneth; Johnson, William Joseph; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Sarah; Jones, Tim; Jongmanns, Jan; Jorge, Pedro; Jovicevic, Jelena; Ju, Xiangyang; Juste Rozas, Aurelio; Köhler, Markus Konrad; Kaczmarska, Anna; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kahn, Sebastien Jonathan; Kaji, Toshiaki; Kajomovitz, Enrique; Kalderon, Charles William; Kaluza, Adam; Kama, Sami; Kamenshchikov, Andrey; Kanaya, Naoko; Kaneti, Steven; Kanjir, Luka; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kaplan, Laser Seymour; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karamaoun, Andrew; Karastathis, Nikolaos; Kareem, Mohammad Jawad; Karentzos, Efstathios; Karnevskiy, Mikhail; Karpov, Sergey; Karpova, Zoya; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kasahara, Kota; Kashif, Lashkar; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Kato, Chikuma; Katre, Akshay; Katzy, Judith; Kawade, Kentaro; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazanin, Vassili; Keeler, Richard; Kehoe, Robert; Keller, John; Kempster, Jacob Julian; Keoshkerian, Houry; Kepka, Oldrich; Kerševan, Borut Paul; Kersten, Susanne; Keyes, Robert; Khader, Mazin; Khalil-zada, Farkhad; Khanov, Alexander; Kharlamov, Alexey; Kharlamova, Tatyana; Khoo, Teng Jian; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kido, Shogo; Kilby, Callum; Kim, Hee Yeun; Kim, Shinhong; Kim, Young-Kee; Kimura, Naoki; Kind, Oliver Maria; King, Barry; King, Matthew; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kiss, Florian; Kiuchi, Kenji; Kivernyk, Oleh; Kladiva, Eduard; Klein, Matthew Henry; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klioutchnikova, Tatiana; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Knapik, Joanna; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Aine; Kobayashi, Dai; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koehler, Nicolas Maximilian; Koffas, Thomas; Koffeman, Els; Koi, Tatsumi; Kolanoski, Hermann; Kolb, Mathis; Koletsou, Iro; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kondrashova, Nataliia; Köneke, Karsten; König, Adriaan; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Köpke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Kortner, Oliver; Kortner, Sandra; Kosek, Tomas; Kostyukhin, Vadim; Kotwal, Ashutosh; Kourkoumeli-Charalampidi, Athina; Kourkoumelis, Christine; Kouskoura, Vasiliki; Kowalewska, Anna Bozena; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozakai, Chihiro; Kozanecki, Witold; Kozhin, Anatoly; Kramarenko, Viktor; Kramberger, Gregor; Krasnopevtsev, Dimitriy; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kravchenko, Anton; Kretz, Moritz; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Peter; Krizka, Karol; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Krumnack, Nils; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kucuk, Hilal; Kuday, Sinan; Kuechler, Jan Thomas; Kuehn, Susanne; Kugel, Andreas; Kuger, Fabian; Kuhl, Andrew; Kuhl, Thorsten; Kukhtin, Victor; Kukla, Romain; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunigo, Takuto; Kupco, Alexander; Kurashige, Hisaya; Kurochkin, Yurii; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; Kwan, Tony; Kyriazopoulos, Dimitrios; La Rosa, Alessandro; La Rosa Navarro, Jose Luis; La Rotonda, Laura; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Lammers, Sabine; Lampl, Walter; Lançon, Eric; Landgraf, Ulrich; Landon, Murrough; Lanfermann, Marie Christine; Lang, Valerie Susanne; Lange, J örn Christian; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Lanza, Agostino; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Lasagni Manghi, Federico; Lassnig, Mario; Laurelli, Paolo; Lavrijsen, Wim; Law, Alexander; Laycock, Paul; Lazovich, Tomo; Lazzaroni, Massimo; Le, Brian; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Quilleuc, Eloi; LeBlanc, Matthew Edgar; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire Alexandra; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Benoit; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leight, William Axel; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Leney, Katharine; Lenz, Tatjana; Lenzi, Bruno; Leone, Robert; Leone, Sandra; Leonidopoulos, Christos; Leontsinis, Stefanos; Lerner, Giuseppe; Leroy, Claude; Lesage, Arthur; Lester, Christopher; Levchenko, Mikhail; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levy, Mark; Lewis, Dave; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Changqiao; Li, Haifeng; Li, Ho Ling; Li, Lei; Li, Liang; Li, Qi; Li, Shu; Li, Xingguo; Li, Yichen; Liang, Zhijun; Liberti, Barbara; Liblong, Aaron; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limosani, Antonio; Lin, Simon; Lin, Tai-Hua; Lindquist, Brian Edward; Lionti, Anthony Eric; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Hao; Liu, Hongbin; Liu, Jian; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanlin; Liu, Yanwen; Livan, Michele; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina Maria; Loch, Peter; Lockman, William; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loew, Kevin Michael; Loginov, Andrey; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Long, Brian Alexander; Long, Jonathan David; Long, Robin Eamonn; Longo, Luigi; Looper, Kristina Anne; López, Jorge Andrés; Lopez Mateos, David; Lopez Paredes, Brais; Lopez Paz, Ivan; Lopez Solis, Alvaro; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Lösel, Philipp Jonathan; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lu, Haonan; Lu, Nan; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Luedtke, Christian; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lundberg, Olof; Lund-Jensen, Bengt; Luzi, Pierre Marc; Lynn, David; Lysak, Roman; Lytken, Else; Lyubushkin, Vladimir; Ma, Hong; Ma, Lian Liang; Ma, Yanhui; Maccarrone, Giovanni; Macchiolo, Anna; Macdonald, Calum Michael; Maček, Boštjan; Machado Miguens, Joana; Madaffari, Daniele; Madar, Romain; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeda, Junpei; Maeland, Steffen; Maeno, Tadashi; Maevskiy, Artem; Magradze, Erekle; Mahlstedt, Joern; Maiani, Camilla; Maidantchik, Carmen; Maier, Andreas Alexander; Maier, Thomas; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Malone, Claire; Maltezos, Stavros; Malyukov, Sergei; Mamuzic, Judita; Mancini, Giada; Mandelli, Luciano; Mandić, Igor; Maneira, José; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany; Mann, Alexander; Manousos, Athanasios; Mansoulie, Bruno; Mansour, Jason Dhia; Mantifel, Rodger; Mantoani, Matteo; Manzoni, Stefano; Mapelli, Livio; Marceca, Gino; March, Luis; Marchiori, Giovanni; Marcisovsky, Michal; Marjanovic, Marija; Marley, Daniel; Marroquim, Fernando; Marsden, Stephen Philip; Marshall, Zach; Marti-Garcia, Salvador; Martin, Brian Thomas; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Mario; Martinez Outschoorn, Verena; Martin-Haugh, Stewart; Martoiu, Victor Sorin; Martyniuk, Alex; Marx, Marilyn; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massa, Lorenzo; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Mättig, Peter; Mattmann, Johannes; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazza, Simone Michele; Mc Fadden, Neil Christopher; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McClymont, Laurie; McDonald, Emily; Mcfayden, Josh; Mchedlidze, Gvantsa; McMahon, Steve; McPherson, Robert; Medinnis, Michael; Meehan, Samuel; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Melini, Davide; Mellado Garcia, Bruce Rafael; Melo, Matej; Meloni, Federico; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mergelmeyer, Sebastian; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Meyer Zu Theenhausen, Hanno; Miano, Fabrizio; Middleton, Robin; Miglioranzi, Silvia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Milesi, Marco; Milic, Adriana; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Minaenko, Andrey; Minami, Yuto; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Minegishi, Yuji; Ming, Yao; Mir, Lluisa-Maria; Mistry, Khilesh; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Miucci, Antonio; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Mlynarikova, Michaela; Moa, Torbjoern; Mochizuki, Kazuya; Mohapatra, Soumya; Molander, Simon; Moles-Valls, Regina; Monden, Ryutaro; Mondragon, Matthew Craig; Mönig, Klaus; Monk, James; Monnier, Emmanuel; Montalbano, Alyssa; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Morange, Nicolas; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Morgenstern, Stefanie; Mori, Daniel; Mori, Tatsuya; Morii, Masahiro; Morinaga, Masahiro; Morisbak, Vanja; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Mortensen, Simon Stark; Morvaj, Ljiljana; Mosidze, Maia; Moss, Josh; Motohashi, Kazuki; Mount, Richard; Mountricha, Eleni; Moyse, Edward; Muanza, Steve; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Ralph Soeren Peter; Mueller, Thibaut; Muenstermann, Daniel; Mullen, Paul; Mullier, Geoffrey; Munoz Sanchez, Francisca Javiela; Murillo Quijada, Javier Alberto; Murray, Bill; Musheghyan, Haykuhi; Muškinja, Miha; Myagkov, Alexey; Myska, Miroslav; Nachman, Benjamin Philip; Nackenhorst, Olaf; Nagai, Koichi; Nagai, Ryo; Nagano, Kunihiro; Nagasaka, Yasushi; Nagata, Kazuki; Nagel, Martin; Nagy, Elemer; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Naranjo Garcia, Roger Felipe; Narayan, Rohin; Narrias Villar, Daniel Isaac; Naryshkin, Iouri; Naumann, Thomas; Navarro, Gabriela; Nayyar, Ruchika; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Negri, Andrea; Negrini, Matteo; Nektarijevic, Snezana; Nellist, Clara; Nelson, Andrew; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neves, Ricardo; Nevski, Pavel; Newman, Paul; Nguyen, Duong Hai; Nguyen Manh, Tuan; Nickerson, Richard; Nicolaidou, Rosy; Nielsen, Jason; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolopoulos, Konstantinos; Nilsen, Jon Kerr; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nomachi, Masaharu; Nomidis, Ioannis; Nooney, Tamsin; Norberg, Scarlet; Nordberg, Markus; Norjoharuddeen, Nurfikri; Novgorodova, Olga; Nowak, Sebastian; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nurse, Emily; Nuti, Francesco; O'grady, Fionnbarr; O'Neil, Dugan; O'Rourke, Abigail Alexandra; O'Shea, Val; Oakham, Gerald; Oberlack, Horst; Obermann, Theresa; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Ochoa-Ricoux, Juan Pedro; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohman, Henrik; Oide, Hideyuki; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Oleiro Seabra, Luis Filipe; Olivares Pino, Sebastian Andres; Oliveira Damazio, Denis; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onogi, Kouta; Onyisi, Peter; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Owen, Mark; Owen, Rhys Edward; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Pacheco Rodriguez, Laura; Padilla Aranda, Cristobal; Pagáčová, Martina; Pagan Griso, Simone; Paganini, Michela; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palazzo, Serena; Palestini, Sandro; Palka, Marek; Pallin, Dominique; Panagiotopoulou, Evgenia; Pandini, Carlo Enrico; Panduro Vazquez, William; Pani, Priscilla; Panitkin, Sergey; Pantea, Dan; Paolozzi, Lorenzo; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Adam Jackson; Parker, Michael Andrew; Parker, Kerry Ann; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pascuzzi, Vincent; Pasqualucci, Enrico; Passaggio, Stefano; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Pater, Joleen; Pauly, Thilo; Pearce, James; Pearson, Benjamin; Pedersen, Lars Egholm; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Penc, Ondrej; Peng, Cong; Peng, Haiping; Penwell, John; Peralva, Bernardo; Perego, Marta Maria; Perepelitsa, Dennis; Perez Codina, Estel; Perini, Laura; Pernegger, Heinz; Perrella, Sabrina; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petroff, Pierre; Petrolo, Emilio; Petrov, Mariyan; Petrucci, Fabrizio; Pettersson, Nora Emilia; Peyaud, Alan; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Pickering, Mark Andrew; Piegaia, Ricardo; Pilcher, James; Pilkington, Andrew; Pin, Arnaud Willy J; Pinamonti, Michele; Pinfold, James; Pingel, Almut; Pires, Sylvestre; Pirumov, Hayk; Pitt, Michael; Plazak, Lukas; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Pluth, Daniel; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Polesello, Giacomo; Poley, Anne-luise; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Poppleton, Alan; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Pozo Astigarraga, Mikel Eukeni; Pralavorio, Pascal; Pranko, Aliaksandr; Prell, Soeren; Price, Darren; Price, Lawrence; Primavera, Margherita; Prince, Sebastien; Prokofiev, Kirill; Prokoshin, Fedor; Protopopescu, Serban; Proudfoot, James; Przybycien, Mariusz; Puddu, Daniele; Purohit, Milind; Puzo, Patrick; Qian, Jianming; Qin, Gang; Qin, Yang; Quadt, Arnulf; Quayle, William; Queitsch-Maitland, Michaela; Quilty, Donnchadha; Raddum, Silje; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Rados, Pere; Ragusa, Francesco; Rahal, Ghita; Raine, John Andrew; Rajagopalan, Srinivasan; Rammensee, Michael; Rangel-Smith, Camila; Ratti, Maria Giulia; Rauscher, Felix; Rave, Stefan; Ravenscroft, Thomas; Ravinovich, Ilia; Raymond, Michel; Read, Alexander Lincoln; Readioff, Nathan Peter; Reale, Marilea; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reed, Robert; Reeves, Kendall; Rehnisch, Laura; Reichert, Joseph; Reiss, Andreas; Rembser, Christoph; Ren, Huan; Rescigno, Marco; Resconi, Silvia; Rezanova, Olga; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Richter, Stefan; Richter-Was, Elzbieta; Ricken, Oliver; Ridel, Melissa; Rieck, Patrick; Riegel, Christian Johann; Rieger, Julia; Rifki, Othmane; Rijssenbeek, Michael; Rimoldi, Adele; Rimoldi, Marco; Rinaldi, Lorenzo; Ristić, Branislav; Ritsch, Elmar; Riu, Imma; Rizatdinova, Flera; Rizvi, Eram; Rizzi, Chiara; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Roda, Chiara; Rodina, Yulia; Rodriguez Perez, Andrea; Rodriguez Rodriguez, Daniel; Roe, Shaun; Rogan, Christopher Sean; Røhne, Ole; Romaniouk, Anatoli; Romano, Marino; Romano Saez, Silvestre Marino; Romero Adam, Elena; Rompotis, Nikolaos; Ronzani, Manfredi; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Peyton; Rosien, Nils-Arne; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Jonatan; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Russell, Heather; Rutherfoord, John; Ruthmann, Nils; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryu, Soo; Ryzhov, Andrey; Rzehorz, Gerhard Ferdinand; Saavedra, Aldo; Sabato, Gabriele; Sacerdoti, Sabrina; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Saha, Puja; Sahinsoy, Merve; Saimpert, Matthias; Saito, Tomoyuki; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Salazar Loyola, Javier Esteban; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sammel, Dirk; Sampsonidis, Dimitrios; Sánchez, Javier; Sanchez Martinez, Victoria; Sanchez Pineda, Arturo; Sandaker, Heidi; Sandbach, Ruth Laura; Sander, Heinz Georg; Sandhoff, Marisa; Sandoval, Carlos; Sankey, Dave; Sannino, Mario; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, João; Sarrazin, Bjorn; Sasaki, Osamu; Sato, Koji; Sauvan, Emmanuel; Savage, Graham; Savard, Pierre; Savic, Natascha; Sawyer, Craig; Sawyer, Lee; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Scarfone, Valerio; Schaarschmidt, Jana; Schacht, Peter; Schachtner, Balthasar Maria; Schaefer, Douglas; Schaefer, Leigh; Schaefer, Ralph; Schaeffer, Jan; Schaepe, Steffen; Schaetzel, Sebastian; Schäfer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Schiavi, Carlo; Schier, Sheena; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt-Sommerfeld, Korbinian Ralf; Schmieden, Kristof; Schmitt, Christian; Schmitt, Stefan; Schmitz, Simon; Schneider, Basil; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schopf, Elisabeth; Schott, Matthias; Schouwenberg, Jeroen; Schovancova, Jaroslava; Schramm, Steven; Schreyer, Manuel; Schuh, Natascha; Schulte, Alexandra; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwartzman, Ariel; Schwarz, Thomas Andrew; Schweiger, Hansdieter; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Sciolla, Gabriella; Scuri, Fabrizio; Scutti, Federico; Searcy, Jacob; Seema, Pienpen; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekhon, Karishma; Sekula, Stephen; Seliverstov, Dmitry; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Sessa, Marco; Seuster, Rolf; Severini, Horst; Sfiligoj, Tina; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shaikh, Nabila Wahab; Shan, Lianyou; Shang, Ruo-yu; Shank, James; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Shaw, Savanna Marie; Shcherbakova, Anna; Shehu, Ciwake Yusufu; Sherwood, Peter; Shi, Liaoshan; Shimizu, Shima; Shimmin, Chase Owen; Shimojima, Makoto; Shirabe, Shohei; Shiyakova, Mariya; Shmeleva, Alevtina; Shoaleh Saadi, Diane; Shochet, Mel; Shojaii, Seyed Ruhollah; Shope, David Richard; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Sicho, Petr; Sickles, Anne Marie; Sidebo, Per Edvin; Sidiropoulou, Ourania; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silva, José; Silverstein, Samuel; Simak, Vladislav; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simon, Dorian; Simon, Manuel; Sinervo, Pekka; Sinev, Nikolai; Sioli, Maximiliano; Siragusa, Giovanni; Sivoklokov, Serguei; Sjölin, Jörgen; Skinner, Malcolm Bruce; Skottowe, Hugh Philip; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Slawinska, Magdalena; Sliwa, Krzysztof; Slovak, Radim; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smiesko, Juraj; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Matthew; Smith, Russell; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snyder, Ian Michael; Snyder, Scott; Sobie, Randall; Socher, Felix; Soffer, Abner; Soh, Dart-yin; Sokhrannyi, Grygorii; Solans Sanchez, Carlos; Solar, Michael; Soldatov, Evgeny; Soldevila, Urmila; Solodkov, Alexander; Soloshenko, Alexei; Solovyanov, Oleg; Solovyev, Victor; Sommer, Philip; Son, Hyungsuk; Song, Hong Ye; Sood, Alexander; Sopczak, Andre; Sopko, Vit; Sorin, Veronica; Sosa, David; Sotiropoulou, Calliope Louisa; Soualah, Rachik; Soukharev, Andrey; South, David; Sowden, Benjamin; Spagnolo, Stefania; Spalla, Margherita; Spangenberg, Martin; Spanò, Francesco; Sperlich, Dennis; Spettel, Fabian; Spighi, Roberto; Spigo, Giancarlo; Spiller, Laurence Anthony; Spousta, Martin; St Denis, Richard Dante; Stabile, Alberto; Stamen, Rainer; Stamm, Soren; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Giordon; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Stärz, Steffen; Staszewski, Rafal; Steinberg, Peter; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoicea, Gabriel; Stolte, Philipp; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Stramaglia, Maria Elena; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Stroynowski, Ryszard; Strubig, Antonia; Stucci, Stefania Antonia; Stugu, Bjarne; Styles, Nicholas Adam; Su, Dong; Su, Jun; Suchek, Stanislav; Sugaya, Yorihito; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Siyuan; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Shota; Svatos, Michal; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Taccini, Cecilia; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takai, Helio; Takashima, Ryuichi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Masahiro; Tanaka, Reisaburo; Tanaka, Shuji; Tanioka, Ryo; Tannenwald, Benjamin Bordy; Tapia Araya, Sebastian; Tapprogge, Stefan; Tarem, Shlomit; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Aaron; Taylor, Geoffrey; Taylor, Pierre Thor Elliot; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira-Dias, Pedro; Temming, Kim Katrin; Temple, Darren; Ten Kate, Herman; Teng, Ping-Kun; Teoh, Jia Jian; Tepel, Fabian-Phillipp; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Theveneaux-Pelzer, Timothée; Thomas, Juergen; Thomas-Wilsker, Joshuha; Thompson, Emily; Thompson, Paul; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Tibbetts, Mark James; Ticse Torres, Royer Edson; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tipton, Paul; Tisserant, Sylvain; Todome, Kazuki; Todorov, Theodore; Todorova-Nova, Sharka; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tolley, Emma; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Tong, Baojia(Tony); Tornambe, Peter; Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Trefzger, Thomas; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Trischuk, William; Trocmé, Benjamin; Trofymov, Artur; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; Truong, Loan; Trzebinski, Maciej; Trzupek, Adam; Tseng, Jeffrey; Tsiareshka, Pavel; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsui, Ka Ming; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsuno, Soshi; Tsybychev, Dmitri; Tu, Yanjun; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turgeman, Daniel; Turra, Ruggero; Tuts, Michael; Tyndel, Mike; Ucchielli, Giulia; Ueda, Ikuo; Ughetto, Michael; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Unverdorben, Christopher; Urban, Jozef; Urquijo, Phillip; Urrejola, Pedro; Usai, Giulio; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valderanis, Chrysostomos; Valdes Santurio, Eduardo; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valls Ferrer, Juan Antonio; Van Den Wollenberg, Wouter; Van Der Deijl, Pieter; van der Graaf, Harry; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vanguri, Rami; Vaniachine, Alexandre; Vankov, Peter; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vasquez, Jared Gregory; Vasquez, Gerardo; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veeraraghavan, Venkatesh; Veloce, Laurelle Maria; Veloso, Filipe; Veneziano, Stefano; Ventura, Andrea; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigani, Luigi; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Vittori, Camilla; Vivarelli, Iacopo; Vlachos, Sotirios; Vlasak, Michal; Vogel, Marcelo; Vokac, Petr; Volpi, Guido; Volpi, Matteo; von der Schmitt, Hans; von Toerne, Eckhard; Vorobel, Vit; Vorobev, Konstantin; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Peter; Wagner, Wolfgang; Wahlberg, Hernan; Wahrmund, Sebastian; Wakabayashi, Jun; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wallangen, Veronica; Wang, Chao; Wang, Chao; Wang, Fuquan; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Tingting; Wang, Wenxiao; Wang, Xiaoxiao; Wanotayaroj, Chaowaroj; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Washbrook, Andrew; Watkins, Peter; Watson, Alan; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Weber, Stephen; Webster, Jordan S; Weidberg, Anthony; Weinert, Benjamin; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Michael David; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; Whallon, Nikola Lazar; Wharton, Andrew Mark; White, Andrew; White, Martin; White, Ryan; Whiteson, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wildauer, Andreas; Wilk, Fabian; Wilkens, Henric George; Williams, Hugh; Williams, Sarah; Willis, Christopher; Willocq, Stephane; Wilson, John; Wingerter-Seez, Isabelle; Winklmeier, Frank; Winston, Oliver James; Winter, Benedict Tobias; Wittgen, Matthias; Wittkowski, Josephine; Wolf, Tim Michael Heinz; Wolter, Marcin Wladyslaw; Wolters, Helmut; Worm, Steven D; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wu, Mengqing; Wu, Miles; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yamaguchi, Daiki; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Shimpei; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Yi; Yang, Zongchang; Yao, Weiming; Yap, Yee Chinn; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yeletskikh, Ivan; Yen, Andy L; Yildirim, Eda; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jiaming; Yu, Jie; Yuan, Li; Yuen, Stephanie P; Yusuff, Imran; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zakharchuk, Nataliia; Zalieckas, Justas; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zeng, Jian Cong; Zeng, Qi; Zengel, Keith; Zenin, Oleg; Ženiš, Tibor; Zerwas, Dirk; Zhang, Dongliang; Zhang, Fangzhou; Zhang, Guangyi; Zhang, Huijun; Zhang, Jinlong; Zhang, Lei; Zhang, Rui; Zhang, Ruiqi; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Xiandong; Zhao, Yongke; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Chen; Zhou, Lei; Zhou, Li; Zhou, Mingliang; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhukov, Konstantin; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Stephanie; Zinonos, Zinonas; Zinser, Markus; Ziolkowski, Michael; Živković, Lidija; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zwalinski, Lukasz
2017-01-26
Differential cross sections are presented for the prompt and non-prompt production of the hidden-charm states $X(3872)$ and $\\psi(2S)$, in the decay mode $J/\\psi \\pi^+\\pi^-$, measured using 11.4 fb$^{-1}$ of $pp$ collisions at $\\sqrt{s} = 8$ TeV by the ATLAS detector at the LHC. The ratio of cross-sections $X(3872)/\\psi(2S)$ is also given, separately for prompt and non-prompt components, as well as the non-prompt fractions of $X(3872)$ and $\\psi(2S)$. Assuming independent single effective lifetimes for non-prompt $X(3872)$ and $\\psi(2S)$ production gives $R_B = \\frac{\\mathcal{B}(B \\rightarrow X(3872)\\textrm{ + any}) \\mathcal{B}(X(3872) \\rightarrow J/\\psi\\pi^+\\pi^-)}{\\mathcal{B}(B \\rightarrow \\psi(2S)\\textrm{ + any}) \\mathcal{B}(\\psi(2S) \\rightarrow J/\\psi\\pi^+\\pi^-)} = (3.95 \\pm 0.32 \\mathrm{(stat)} \\pm 0.08\\mathrm{(sys)}) \\times 10^{-2}$, while separating short- and long-lived contributions, assuming that the short-lived component is due to $B_c$ decays, gives $R_B = (3.57 \\pm 0.33\\mathrm{(stat)} \\pm 0.11\\ma...
SL(2, Z) invariant rotating (m, n) strings in AdS{sub 3} x S{sup 3} with mixed flux
Energy Technology Data Exchange (ETDEWEB)
Barik, M.S.P.; Panigrahi, Kamal L. [Indian Institute of Technology Kharagpur, Department of Physics, Kharagpur (India); Khouchen, Malak; Kluson, Josef [Masaryk University, Department of Theoretical Physics and Astrophysics, Faculty of Science, Brno (Czech Republic)
2017-05-15
We study rigidly rotating and pulsating (m, n) strings in AdS{sub 3} x S{sup 3} with mixed three form flux. The AdS{sub 3} x S{sup 3} background with mixed three form flux is obtained in the near horizon limit of SL(2, Z)-transformed solution, corresponding to the bound state of NS5-branes and fundamental strings. We study the probe (m, n)-string in this background by solving the manifest SL(2, Z)-covariant form of the action. We find the dyonic giant magnon and single spike solutions corresponding to the equations of motion of a probe string in this background and find various relationships among the conserved charges. We further study a class of pulsating (m, n) string in AdS{sub 3} with mixed three form flux. (orig.)
Cravey, Robin L.; Tiemsin, Pacita I.
1997-01-01
This paper describes measurements which were performed on a sample of radome material in the Electromagnetic Properties Measurements Laboratory (EPML). The purpose of the measurements described in this paper was to determine the one-way transmission loss through the flat panel of radome material for a frequency range of 84 to 94 GHz, for varying incidence angles. The panel, which was manufactured by Norton Performance Plastics Corporation, was provided to the EPML by TRW. The size of the panel is 40 in x 36 in x 0.422 in and consists of a foam material with one side coated with a smooth white coating (this side will be referred to as the front side). The dielectric properties of the foam material from the inside of the panel were also determined at X-band (8.2-12.4 GHz). The W-band free space measurements are presented first, followed by the X-band dielectric properties measurements.
Czech Academy of Sciences Publication Activity Database
Sosniyenko, Serhiy; Hut, R.A.; Daan, S.; Sumová, Alena
2009-01-01
Roč. 30, č. 9 (2009), s. 1802-1814 ISSN 0953-816X R&D Projects: GA MŠk(CZ) LC554; GA ČR(CZ) GA309/08/0503 Grant - others:EC(XE) LSH-2004115-4-018741 Institutional research plan: CEZ:AV0Z50110509 Keywords : clock gene * suprachiasmatic nucleus * photoperiod Subject RIV: FH - Neuro logy Impact factor: 3.418, year: 2009
Czech Academy of Sciences Publication Activity Database
Máttéffyová, Adéla; Otáhal, Jakub; Tsenov, Grygoriy; Mareš, Pavel; Kubová, Hana
2006-01-01
Roč. 24, č. 2 (2006), s. 351-360 ISSN 0953-816X R&D Projects: GA ČR(CZ) GA305/06/0713; GA ČR(CZ) GD305/03/H148; GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : endothelin-1 * epilepsy * immature rats Subject RIV: ED - Physiology Impact factor: 3.709, year: 2006
Phase equilibria in TlX-Cd(Zn)X (X-S, Se, Te) systems
International Nuclear Information System (INIS)
Gusejnov, F.Kh.; Babanly, M.B.; Kuliev, A.A.
1982-01-01
The methods of DTA, RPA and measurement of the alloys microhardness have been used to investigate the phase equilibria in the TlX-Zn(Cd)X systems. It is established that the TlZn(Cd)X 2 compounds, the presence of which is mentioned in the literature earlier, do not form in these systems. The TlSe-Zn(Cd)Se systems apply to the simple eutectic type and characterized by digenerated eutectic near the TlSe. Thermodynamical analysis of the liquidus of the TlSe-CdSe and TlTe-Zn(Cd)Te systems in approximation of the regular solutions, taking into account the dissociation of tallium chalcogenides in liquid phase, is made
Characteristics of laser clad α-Ti/TiC+(Ti,W)C1-x/Ti2SC+TiS composite coatings on TA2 titanium alloy
Zhai, Yong-Jie; Liu, Xiu-Bo; Qiao, Shi-Jie; Wang, Ming-Di; Lu, Xiao-Long; Wang, Yong-Guang; Chen, Yao; Ying, Li-Xia
2017-03-01
TiC reinforced Ti matrix composite coating with Ti2SC/TiS lubricant phases in-situ synthesized were prepared on TA2 titanium alloy by laser cladding with different powder mixtures: 40%Ti-19.5%TiC-40.5%WS2, 40%Ti-25.2%TiC-34.8%WS2, 40%Ti-29.4%TiC-30.6%WS2 (wt%). The phase compositions, microstructure, microhardness and tribological behaviors and wear mechanisms of coatings were investigated systematically. Results indicate that the main phase compositions of three coatings are all continuous matrix α-Ti, reinforced phases of (Ti,W)C1-x and TiC, lubricant phases of Ti2SC and TiS. The microhardness of the three different coatings are 927.1 HV0.5, 1007.5 HV0.5 and 1052.3 HV0.5, respectively. Compared with the TA2 titanium alloy (approximately 180 HV0.5), the microhardness of coatings have been improved dramatically. The coefficients of friction and the wear rates of those coatings are 0.41 and 30.98×10-5 mm3 N-1 m-1, 0.30 and 18.92×10-5 mm3 N-1 m-1, 0.34 and 15.98×10-5 mm3 N-1 m-1, respectively. Comparatively speaking, the coating fabricated with the powder mixtures of 40%Ti-25.2%TiC-34.8%WS2 presents superior friction reduction and anti-wear properties and the main wear mechanisms of that are slight plastic deformation and adhesive wear.
International Nuclear Information System (INIS)
Qiao, Li-Na; Wang, H.C.; Shen, Y.; Lin, Yuan-Hua; Nan, Ce-Wen
2016-01-01
Nanostructured lead chalcogenides (PbX, X = Te, Se, S) were prepared via a simple hydrothermal method. The powder samples were characterized by XRD, SEM, SAED and DRS. Phase composition and microstructure analysis indicate that these samples are pure lead chalcogenides phases and have similar morphologies. These lead chalcogenides display efficient absorption in the UV-visible light range. The photocatalytic properties of lead chalcogenides nanoparticles were evaluated by the photodegradation of Congo red under UV-visible light irradiation in air atmosphere. The Congo red solution can be efficiently degraded under visible light in the presence of lead chalcogenides nanoparticles. The photocatalytic activities of lead chalcogenides generally increase with increasing their band gaps and shows no appreciable loss after repeated cycles. Our results may be useful for developing new photocatalyst systems responsive to visible light among narrow band gap semiconductors
40 Gbit/s NRZ Packet-Length Insensitive Header Extraction for Optical Label Switching Networks
DEFF Research Database (Denmark)
Seoane, Jorge; Kehayas, E; Avramopoulos, H.
2006-01-01
A simple method for 40 Gbit/s NRZ header extraction based on envelope detection for optical label switching networks is presented. The scheme is insensitive to packet length and spacing and can be single-chip integrated cost-effectively......A simple method for 40 Gbit/s NRZ header extraction based on envelope detection for optical label switching networks is presented. The scheme is insensitive to packet length and spacing and can be single-chip integrated cost-effectively...
INTEGRAL discovered a new hard X-ray source: IGRJ17511-3057
DEFF Research Database (Denmark)
Baldovin, C.; Kuulkers, E.; Ferrigno, C.
2009-01-01
with a significance of 14 sigma in the 20-40 keV energy band, and 7 sigma in the 40-80 keV energy band. The corresponding count rates in these bands are 4.2+/0.3 cts/s (28 mCrab) and 1.8+/-0.3 cts/s (25 mCrab), respectively. The source is also detected in the JEM-X mosaic in the three energy bands 3-7 keV, 7-11 ke......V, and 11-20 keV. The source flux is ~20 mCrab and the detection significance is 3 sigma in all bands. The best determined source position is RA: 267.811 DEC: -30.954 (J2000), with a 90% error radius of 2.0 arcmin. The combined IBIS/ISGRI and JEM-X spectrum in the 3-100 keV energy range is well described...... by a single power-law with photon index 2.0+/-0.2. The source flux is 5.7e-10 erg/cm2/s in the 3-20 keV energy band and 4.8e-10 erg/cm2/s in the 20-100 keV energy band....
An X-ray imager based on silicon microstrip detector and coded mask
International Nuclear Information System (INIS)
Del Monte, E.; Costa, E.; Di Persio, G.; Donnarumma, I.; Evangelista, Y.; Feroci, M.; Frutti, M.; Lapshov, I.; Lazzarotto, F.; Mastropietro, M.; Morelli, E.; Pacciani, L.; Porrovecchio, G.; Rapisarda, M.; Rubini, A.; Soffitta, P.; Tavani, M.; Argan, A.
2007-01-01
SuperAGILE is the X-ray monitor of AGILE, a satellite mission for gamma-ray astronomy, and it is the first X-ray imaging instrument based on the technology of the silicon microstrip detectors combined with a coded aperture imaging technique. The SuperAGILE detection plane is composed of four 1-D silicon microstrip detector modules, mechanically coupled to tungsten coded mask units. The detector strips are separately and individually connected to the input analogue channels of the front-end electronics, composed of low-noise and low-power consumption VLSI ASIC chips. SuperAGILE can produce 1-D images with 6 arcmin angular resolution and ∼2-3 arcmin localisation capability, for intense sources, in a field of view composed of two orthogonal areas of 107 deg. x 68 deg. The time resolution is 2 μs, the overall dead time is ∼5 μs and the electronic noise is ∼7.5 keV full-width at half-maximum. The resulting instrument is very compact (40x40x14 cm 3 ), light (10 kg) and has low power consumption (12 W). AGILE is a mission of the Agenzia Spaziale Italiana and its launch is planned in 2007 in a low equatorial Earth orbit. In this contribution we present SuperAGILE and discuss its performance and scientific objectives
Quantum effective potential in S1xR3
International Nuclear Information System (INIS)
Denardo, G.; Spallucci, E.; Doebner, H.D.
1981-07-01
The functional integral formulation of quantum field theory is applied to the study of the vacuum state in spacetimes with S 1 xR 3 topology. Such a global spacetime structure can be physically realized both in flat and in curved spacetime. In the first case one deals with finite temperature quantum field theories (if S 1 is time-like) or with field theories in a spacetime with a compact space dimension (if S 1 is spacelike). When curvature is present, a S 1 time-like dimension is induced by the Wick rotation whenever the metric is endowed with an event horizon, and this leads to the thermal nature of the vacuum in these cases. We shall take into account here only conformally flat spacetimes. Finally we discuss in some details the topological restoration of a spontaneously broken symmetry and the strictly related problem of the mass dynamical generation. (author)
Energy Technology Data Exchange (ETDEWEB)
Tsuchiya, Yuu, E-mail: tsuchiya.yuu1990@gmail.com; Ikeda, Shugo; Kobayashi, Hisao [University of Hyogo (Japan)
2016-12-15
We have investigated the physical properties of single-crystalline K{sub x}Fe{sub 2-y}S{sub 2} and K{sub x}Fe{sub 2-y}Se{sub 2} samples using {sup 57}Fe Mössbauer spectroscopy. The observed {sup 57}Fe Mössbauer spectra were reconstructed using a major antiferromagnetic ordered K{sub 2}Fe{sub 4}Se{sub 5} phase and a minor paramagnetic phase down to 5 K, despite being superconducting below 32.2 K in K{sub x}Fe{sub 2-y}Se{sub 2}. The analysis of {sup 57}Fe Mössbauer spectrum for K{sub x}Fe{sub 2-y}S{sub 2} at 290 K confirms the presence of a major antiferromagnetic ordered K{sub 2}Fe{sub 4}S{sub 5} phase and a minor paramagnetic phase in the K{sub x}Fe{sub 2-y}S{sub 2} single crystal. The derived hyperfine interaction parameters of the paramagnetic phase in K{sub x}Fe{sub 2-y}S{sub 2} suggest that the microstructure of this phase in K{sub x}Fe{sub 2-y}S{sub 2} is similar to that of the superconducting phase in K{sub x}Fe{sub 2-y}Se{sub 2} although the K{sub x}Fe{sub 2-y}S{sub 2} single crystals exhibit no superconductivity down to 5 K.
Miro V4.0: user's guide; Miro V4.0: guide utilisateur
Energy Technology Data Exchange (ETDEWEB)
Morice, O.; Ribeyre, X. [CEA/CESTA, Dept. des Lasers de Puissance, DLP, 33 - Le Barp (France); Donnat, Ph.; Porcher, Th.; Treimany, C. [CEA/CESTA, DCSA/MLS, 33 - Le Barp (France); Nassiet, D.; Gallice, G. [CEA/CESTA, DEV/SIS, 33 - Le Barp (France); Rivoire, V.; L' hullier, N. [CISI, 33 (France)
2000-07-01
This paper contains the user's guide of Miro software. This software is used for simulating propagation and amplification of laser beams in laser devices as Megajoule or NIF. The physical effects taken into account are essentially: saturated amplification, absorption, Kerr effect, frequency conversion, birefringence and aberrations. The models of propagation are either geometrical optics of parallel beams, or Fresnel diffraction and broadband pulse propagation. A graphic user interface has been included to allow interactive management of optical devices and results. A Unix environment with X-Window and Motif or a Windows 95, Windows 98 or Windows NT environment is required to run Miro. The User's guide gives a short insight of the software. (authors)
The study of 3s3p4 configuration in the P-Sequence, Co X III - Ni X IV, by laser-produced plasmas
International Nuclear Information System (INIS)
Borges, F.O.; Cavalcanti, G.H.; Farias, E.E.; Trigueiros, A.G.
2007-01-01
Wavelengths from radiation of plasmas produced by a Nd:YAG/glass laser focused on target of Co and Ni have been recorded photographically in the region 240-600 A with a 3m normal incidence spectrograph. For this sequence (Co X III and Ni X IV) we have identified 13 new lines belonging to the array 3s 2 3p 3 -3s3p 4 and derived 7 new levels for the 3s3p 4 configuration. The classification was established by comparison of the relative intensities for the lines along the isoelectronic sequence, extrapolation, and Hartree-Fock calculation. (author)
Alpha thalassaemia-mental retardation, X linked
Directory of Open Access Journals (Sweden)
Gibbons Richard
2006-05-01
Full Text Available Abstract X-linked alpha thalassaemia mental retardation (ATR-X syndrome in males is associated with profound developmental delay, facial dysmorphism, genital abnormalities and alpha thalassaemia. Female carriers are usually physically and intellectually normal. So far, 168 patients have been reported. Language is usually very limited. Seizures occur in about one third of the cases. While many patients are affectionate with their caregivers, some exhibit autistic-like behaviour. Patients present with facial hypotonia and a characteristic mouth. Genital abnormalities are observed in 80% of children and range from undescended testes to ambiguous genitalia. Alpha-thalassaemia is not always present. This syndrome is X-linked recessive and results from mutations in the ATRX gene. This gene encodes the widely expressed ATRX protein. ATRX mutations cause diverse changes in the pattern of DNA methylation at heterochromatic loci but it is not yet known whether this is responsible for the clinical phenotype. The diagnosis can be established by detection of alpha thalassaemia, identification of ATRX gene mutations, ATRX protein studies and X-inactivation studies. Genetic counselling can be offered to families. Management is multidisciplinary: young children must be carefully monitored for gastro-oesophageal reflux as it may cause death. A number of individuals with ATR-X are fit and well in their 30s and 40s.
Higher conserved charges and integrability for spinning strings in AdS5 x S5
International Nuclear Information System (INIS)
Engquist, Johan
2004-01-01
We demonstrate the existence of an infinite number of local commuting charges for classical solutions of the string sigma model on AdS 5 x S 5 associated with a certain circular three-spin solution spinning with large angular momenta in three orthogonal directions on the five-sphere. Using the AdS/CFT correspondence we find agreement to one-loop with the tower of conserved higher charges in planar N = 4 super Yang-Mills theory associated with the dual composite single-trace operator in the highest weight representation (J 1 ,J 2 ,J 2 ) of SO(6). The agreement can be explained by the presence of integrability on both sides of the duality. (author)
Cascadability of Silicon Microring Resonators for40-Gbit/s OOK and DPSK Optical Signals
DEFF Research Database (Denmark)
Ozolins, Oskars; An, Yi; Lali-Dastjerdi, Zohreh
2012-01-01
The cascadability of a single silicon micro-ring resonator for CSRZ-OOK and CSRZ-DPSK signals is experimentally demonstrated at 40 Gbit/s for the first time. Error-free performance is obtained for both modulation formats after 5 cascaded resonators.......The cascadability of a single silicon micro-ring resonator for CSRZ-OOK and CSRZ-DPSK signals is experimentally demonstrated at 40 Gbit/s for the first time. Error-free performance is obtained for both modulation formats after 5 cascaded resonators....
X-ray analysis in lung leptospira disease
International Nuclear Information System (INIS)
Deng Shiyong; Peng Shi; He Guoman
2006-01-01
Objective: To analysis the X-ray signs and subtype of the lung leptospira disease, and improve the undersdand, reduce the error diagnosis of this diseases. Methods: 40 cases of lung leptospira disease were evaluated about the check X-ray sings and clinical data, the check X-ray sings were dynamic observated and typed, and 40 cases had a diagnostic treatment. Results: There were various X-ray changes of lung leptospira disease. in 40 cases, 12 cases (30%) pulmonary marking, 21 cases (52%) little lesions, and 7 cases(18%) lager lesions, respectively. The patients who were correctly diagnosed made a recovery after effective treatment, the patients who were error diagnosed died because of multiple system organ damage. Conclusion: The check X-ray signs in lung leptospira disease have some characteristics. It may play an important role in improving this disease' diagnosis combining the dynamic observation of check X-ray sings with clinical data. (authors)
International Nuclear Information System (INIS)
Yu, Xin; Li-yun, Cao; Jian-feng, Huang; Jia, Liu; Jie, Fei; Chun-yan, Yao
2013-01-01
Highlights: ► The influence of the precursor solution molar ratio of S/Mn. ► The degree of orientation of the γ-MnS film decrease slightly with increasing the S/Mn from 2.0 to 4.0. ► Film quality is strongly affected by the initial nucleation. ► The absorption edge obviously shifts to a higher wavelength with the increase of the S/Mn molar ratio from 2.0 to 4.0. - Abstract: Well crystallized γ-MnS thin films were successfully synthesized at low temperature and short processing time via a novel microwave hydrothermal (M-H) process without any complexing agent by using manganese chloride and thioacetamide as source materials. The influence of different S/Mn molar ratio in the precursor solution on the phase compositions, morphologies and optical properties of the as-deposited films was investigated. The as-deposited γ-MnS thin films were characterized by means of X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), field emission scanning electron microscopy (FESEM) and ultraviolet–visible (UV–vis). Results show that the wurtzite phase γ-MnS thin films with good crystallization can be achieved when S/Mn molar ratio is controlled at 2.0–4.0. The deposited γ-MnS thin films exhibit (1 0 0) orientation growth with the thickness of 300–500 nm. With the increase of S/Mn molar ratio from 2.0 to 4.0, the orientation growth is weakened while the dense and uniform of the as-deposited γ-MnS thin films are obviously improved and the corresponding band gap of the thin films increase from 3.88 to 3.97 eV.
Energy Technology Data Exchange (ETDEWEB)
Fittschen, U.E.A. [Department of Chemistry, University of Hamburg, Martin-Luther-King-Platz 6, 20146 Hamburg (Germany)], E-mail: ursula.fittschen@chemie.uni-hamburg.de; Meirer, F. [Atominstitut, Vienna University of Technology, Stadionallee 2, 1020 Wien (Austria)], E-mail: fmeirer@ati.ac.at; Streli, C. [Atominstitut, Vienna University of Technology, Stadionallee 2, 1020 Wien (Austria)], E-mail: streli@ati.ac.at; Wobrauschek, P. [Atominstitut, Vienna University of Technology, Stadionallee 2, 1020 Wien (Austria)], E-mail: wobi@ati.ac.at; Thiele, J. [Department of Chemistry, University of Hamburg, Martin-Luther-King-Platz 6, 20146 Hamburg (Germany)], E-mail: Julian.Thiele@gmx.de; Falkenberg, G. [Hamburger Synchrotronstrahlungslabor at Deutsches Elektronen-Synchrotron DESY, Notkestr. 85, 22603 Hamburg (Germany)], E-mail: falkenbe@mail.desy.de; Pepponi, G. [ITC-irst, Via Sommarive 18, 38050 Povo (Trento) (Italy)], E-mail: pepponi@itc.it
2008-12-15
In this study a new procedure using Synchrotron total reflection X-ray fluorescence (SR-TXRF) to characterize elemental amounts in atmospheric aerosols down to particle sizes of 0.015 um is presented. The procedure was thoroughly evaluated regarding bounce off effects and blank values. Additionally the potential of total reflection X-ray fluorescence-X-ray absorption near edge structure (SR-TXRF-XANES) for speciation of FeII/III down to amounts of 34 pg in aerosols which were collected for 1 h is shown. The aerosols were collected in the city of Hamburg with a low pressure Berner impactor on Si carriers covered with silicone over time periods of 60 and 20 min each. The particles were collected in four and ten size fractions of 10.0-8.0 {mu}m, 8.0-2.0 {mu}m, 2.0-0.13 {mu}m 0.13-0.015 {mu}m (aerodynamic particle size) and 15-30 nm, 30-60 nm, 60-130 nm, 130-250 nm, 250-500 nm, 0.5-1 {mu}m, 1-2 {mu}m, 2-4 {mu}m, 4-8 {mu}m, 8-16 {mu}m. Prior to the sampling 'bounce off' effects on Silicone and Vaseline coated Si carriers were studied with total reflection X-ray fluorescence. According to the results silicone coated carriers were chosen for the analysis. Additionally, blank levels originating from the sampling device and the calibration procedure were studied. Blank levels of Fe corresponded to 1-10% of Fe in the aerosol samples. Blank levels stemming from the internal standard were found to be negligible. The results from the Synchroton radiation total reflection X-ray fluorescence analysis of the aerosols showed that 20 min of sampling time gave still enough sample material for elemental determination of most elements. For the determination of the oxidation state of Fe in the aerosols different Fe salts were prepared as a reference from suspensions in isopropanol. The results from the Fe K-edge Synchroton radiation total reflection X-ray fluorescence-X-ray absorption near-edge structure analysis of the aerosol samples showed that mainly Fe(III) was present in
International Nuclear Information System (INIS)
Fittschen, U.E.A.; Meirer, F.; Streli, C.; Wobrauschek, P.; Thiele, J.; Falkenberg, G.; Pepponi, G.
2008-01-01
In this study a new procedure using Synchrotron total reflection X-ray fluorescence (SR-TXRF) to characterize elemental amounts in atmospheric aerosols down to particle sizes of 0.015 um is presented. The procedure was thoroughly evaluated regarding bounce off effects and blank values. Additionally the potential of total reflection X-ray fluorescence-X-ray absorption near edge structure (SR-TXRF-XANES) for speciation of FeII/III down to amounts of 34 pg in aerosols which were collected for 1 h is shown. The aerosols were collected in the city of Hamburg with a low pressure Berner impactor on Si carriers covered with silicone over time periods of 60 and 20 min each. The particles were collected in four and ten size fractions of 10.0-8.0 μm, 8.0-2.0 μm, 2.0-0.13 μm 0.13-0.015 μm (aerodynamic particle size) and 15-30 nm, 30-60 nm, 60-130 nm, 130-250 nm, 250-500 nm, 0.5-1 μm, 1-2 μm, 2-4 μm, 4-8 μm, 8-16 μm. Prior to the sampling 'bounce off' effects on Silicone and Vaseline coated Si carriers were studied with total reflection X-ray fluorescence. According to the results silicone coated carriers were chosen for the analysis. Additionally, blank levels originating from the sampling device and the calibration procedure were studied. Blank levels of Fe corresponded to 1-10% of Fe in the aerosol samples. Blank levels stemming from the internal standard were found to be negligible. The results from the Synchroton radiation total reflection X-ray fluorescence analysis of the aerosols showed that 20 min of sampling time gave still enough sample material for elemental determination of most elements. For the determination of the oxidation state of Fe in the aerosols different Fe salts were prepared as a reference from suspensions in isopropanol. The results from the Fe K-edge Synchroton radiation total reflection X-ray fluorescence-X-ray absorption near-edge structure analysis of the aerosol samples showed that mainly Fe(III) was present in all particle size fractions
International Nuclear Information System (INIS)
Usuki, T.; Hosokawa, S.; Berar, J.-F.
2005-01-01
Anomalous X-ray scattering experiments on glassy superionic conductor (As 2 Se 3 ) 0.4 (CuI) 0.6 were performed at energies close to the As, Se, and Cu K edges using a new detecting system and a third-generation synchrotron radiation facility. The detecting system was composed of a graphite-crystal energy-analyzer and a NaI(Tl) detector on a 40-cm-long arm. The overall energy resolution was about 60 eV, which can discriminate the elastic signal from the fluorescence and Compton contributions, and a sufficient number of scattered X-ray photons were acquired within a reasonable data collection time. The differential structure factors, Δ i S(Q), were obtained from the detailed analyses, indicating that Δ As S(Q) and Δ Se S(Q) are similar to those of glassy As 2 Se 3 except at the prepeak position, and Δ Cu S(Q) that in liquid CuI. From these findings, it can be concluded that a pseudo-binary mixture of the As 2 Se 3 network matrix and CuI-related conduction pathways would be a good structural model for this superionic glass
Bibliography on Hot Isostatic Pressing (HIP) Technology
1992-11-01
Nimonic API, Rene’ 77 2. MA753, IN-853 7 3. C-103,WC-103 4. Alloy 454, PWA 1480 5. Mar- M250 , Maraging (250) 6. Rene 150, PA 101 (low C) 7. Inconel 718...Pressure Welding Parameters Bryant. W. A. Weld J 54 (12), 433-S-435-S, 1975 ( AD-DI02 316 Key Words: AISI 4340. MAR- M250 . AISI 1020, 9Ni-4Co steel. Inconel...creep rupture. hot corrosion, oxidation, grain size, thermomechanical treatment MAR- M250 1. Microstructures and Mechanical Properties of HIP
P.I.X.S.C.A.N.: a micro-CT scanner for small animal based on hybrid pixel detectors
International Nuclear Information System (INIS)
Khoury, R.
2008-03-01
Since more than a dozen years, efforts were led in the field of X-ray tomography for small animals, principally for the improvement of spatial resolution and the diminution of the absorbed dose. The C.P.P.M. developed the micro-CT P.I.X.S.C.A.N. based on the hybrid pixel detector X.P.A.D.2. In this context, my thesis work consists in studying the demonstrator P.I.X.S.C.A.N./X.P.A.D.2 and the contribution of the hybrid pixels in the imaging of small animals. A fast analytical simulation, FastSimu, was developed. An extrapolation of the performance of the demonstrator P.I.X.S.C.A.N, as well as the validation of the results obtained with the measured data, were led by means of the analytical simulator FastSimu. The demonstrator P.I.X.S.C.A.N./X.P.A.D.2 allowed to obtain reconstructed images with a rather good quality for a relatively weak absorbed dose. Its spatial resolution is degraded by the high number of defective pixels of the detector X.P.A.D.2. Beyond this study, a new version of the demonstrator P.I.X.S.C.A.N./X.P.A.D.2 is under construction. This latter, characterized by two and a half times smaller pixels and about no defective pixels will bring a considerable improvement on spatial resolution. (author)
Moessbauer spectroscopy on amorphous Fe/sub x/Ni/sub 80-x/B/sub 20/ after neutron irradiation
Energy Technology Data Exchange (ETDEWEB)
Sitek, J.; Miglierini, M. (Slovenska Vysoka Skola Technicka, Bratislava (Czechoslovakia))
1985-05-16
Amorphous Fe/sub x/Ni/sub 80-x/B/sub 20/ glassy alloys (x = 40, 50, 60, and 70) irradiated with fast neutrons in a fluence range of 10/sup 14/ to 10/sup 19/ cm/sup -2/ were investigated by Moessbauer spectroscopy. There were some significant changes in the Moessbauer spectrum parameters of the 10/sup 19/ cm/sup -2/ irradiated samples except Fe/sub 40/Ni/sub 40/B/sub 20/. This corresponds to a change in the direction of the easy axis of magnetization. The measurements show that the resistance of the Fe-Ni-B system against neutron irradiation improves with increasing Ni content up to a certain point.
40 Gb/s Pulse Generation Using Gain Switching of a Commercially Available Laser Module
DEFF Research Database (Denmark)
Nørregaard, Jesper; Hanberg, Jesper; Franck, Thorkild
1999-01-01
The laser module contains a single-mode, distributed feedback (DFB) laser diode. The epi-structure of the laser diode is grown by MOCVD as a multiple quantum well heterostructure. The DFB grating is defined by holography, and the laser diode is designed with a co-planar contact metallization...... time division multiplexing to generate a 40 Gb/s RZ pattern.The presentation will report on further details on the laser module including chirp characteristics, and show the eye diagrams taken at 10 and 40 Gb/s....
Mordvinova, Natalia; Vinokurov, Alexander; Kuznetsova, Tatiana; Lebedev, Oleg I; Dorofeev, Sergey
2017-01-24
Here we report a simple method for the creation of highly luminescent core-shell InP/ZnX (X = S, Se) quantum dots (QDs) on the basis of a phosphine synthetic route. In this method a Zn precursor was added to the reaction mixture at the beginning of the synthesis to form an In(Zn)P alloy structure, which promoted the formation of a ZnX shell. Core-shell InP/ZnX QDs exhibit highly intensive emission with a quantum yield over 50%. The proposed method is primarily important for practical applications. Advantages of this method compared to the widely used SILAR technique are discussed. We further demonstrate that the SILAR approach consisting of consequent addition of Zn and chalcogen precursors to pre-prepared non-doped InP colloidal nanoparticles is not quite suitable for shell growth without the addition of special activator agents or the use of very reactive precursors.
Measurements of Lα, Lβ X-ray production cross sections of Bi by 17-40 keV electron impact
International Nuclear Information System (INIS)
Wu, Y.; An, Z.; Duan, Y.M.; Liu, M.T.
2010-01-01
We present results of measurements of L α , L β X-ray production cross sections for the element Bi (Z = 83) by 17-40 keV electron impact. The target used in the experiment was prepared by evaporating the element Bi to the thick pure carbon substrate. The effects of multiple scattering of electrons when penetrating the target film, of electrons reflected from the thick pure carbon substrate and of bremsstrahlung photons produced by the impact of incident electrons on the target are corrected by means of Monte Carlo simulation. The experimental data, reported here for the first time in the energy region of 17-40 keV, are compared with the DWBA theory and the PWBA-C-Ex theory. They are in good agreement.
Long, Jinqiao; Wang, Tianman; Luo, Zhirong; Gao, Yong; Song, Baoling; Liang, Jing; Liao, Sen; Huang, Yingheng; Zhang, Huaxin
2017-08-01
A series of Na3Mo12PO40:xEu3+ phosphors have been successfully synthesized by a solid-state method, and characterized by powder x-ray diffraction (PXRD). The PXRD results confirm that the samples have crystal phases of Na3Mo12PO40. For PL spectra of Na3Mo12PO40:2.0Eu3+ excited by 394 and 465 nm, R (R is the peak area ratio of 5D0 → 7F2 to 5D0 → 7F1) is only 1.46 with an excitation of 394 nm, but increases to 3.03 with an excitation of 465 nm. Furthermore, a new enhancement of electric dipole transition is observed. Emission spectrum (PL) intensity at 617 nm excited by 465 nm is 1.95 times as high as the excitation spectrum (PLE) intensity at 465 nm. Thus, cooperative energy transfers from the magnetic dipole (MD) Eu3+ center to the electric dipole (ED) Eu3+ center when excited by 465 nm is demonstrated for the new fluorescent behavior.
Directory of Open Access Journals (Sweden)
Hye-Jin Kim, MSN, RN
2016-06-01
Conclusions: This study found that postpartum breastfeeding may play a significant role in reducing the risk of metabolic syndrome and also that childbearing is associated with a higher incidence of metabolic syndrome among women in their 30s. For women in their 40s, the risk of metabolic syndrome did not significantly differ depending on the breastfeeding experience. This study indicated that breastfeeding can be a way to reduce metabolic health burdens in women in their 30s.
Czech Academy of Sciences Publication Activity Database
Albrecht, Tomáš; Vinkler, Michal; Schnitzer, J.; Poláková, Radka; Munclinger, P.; Bryja, Josef
2009-01-01
Roč. 22, č. 10 (2009), s. 2020-2030 ISSN 1010-061X R&D Projects: GA ČR GA206/06/0851; GA AV ČR IAA600930608; GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : extra-pair paternity * sexual selection * variance in fitness * within-pair reproductive success Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.816, year: 2009