WorldWideScience

Sample records for s-102 pumping instrumentation

  1. Acceptance for Beneficial Use Pumping Instrumentation and Control Skid ''M''

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This document is a Final Acceptance for Beneficial Use (ABU) for the readiness of Pumping Instrumentation and Control (PIC) skid ''M''. All the testing and documentation for PIC skid ''M'' is completed and the skid is ready for use in the field for pumping of tank U-102

  2. Work plan, AP-102 mixer pump removal and pump replacement

    International Nuclear Information System (INIS)

    Jimenez, R.F.

    1994-01-01

    The objective of this work plan is to plan the steps and estimate the costs required to remove the failed AP-102 mixer pump, and to plan and estimate the cost of the necessary design and specification work required to order a new, but modified, mixer pump including the pump and pump pit energy absorbing design. The main hardware required for the removal of the mixer is as follows: a flexible receiver and blast shield; a metal container for the pulled mixer pump; and a trailer and strongback to haul and manipulate the container. Additionally: a gamma scanning device will be needed to detect the radioactivity emanating from the mixer as it is pulled from the tank; a water spray system will be required to remove tank waste from the surface of the mixer as it is pulled from the AP-102 tank; and a lifting yoke to lift the mixer from the pump pit (the SY-101 Mixer Lifting Yoke will be used). A ''green house'' will have to be erected over the AP-102 pump pit and an experienced Hoisting and Rigging crew must be assembled and trained in mixer pump removal methods before the actual removal is undertaken

  3. Packaging design criteria, transfer and disposal of 102-AP mixer pump

    International Nuclear Information System (INIS)

    Carlstrom, R.F.

    1994-01-01

    A mixer pump installed in storage tank 241-AP-102 (102-AP) has failed. This pump is referred to as the 102-AP mixer pump (APMP). The APMP will be removed from 102-AP 1 and a new pump will be installed. The main purpose of the Packaging Design Criteria (PDC) is to establish criteria necessary to design and fabricate a shipping container for the transfer and storage of the APMP from 102-AP. The PDC will be used as a guide to develop a Safety Evaluation for Packaging (SEP)

  4. Supporting design information for portable exhauster installation at tanks S-109, SX-102/103, BY-105/106, S-101/102, and S-107

    International Nuclear Information System (INIS)

    Keller, C.M.

    1997-01-01

    This document provides supporting calculations and equipment dedication plans for portable exhausters and ductwork installed on tanks S-109, SX-102/103, BY-105/106, S-101/102, and S-107. The exhausters will ventilate the tanks during saltwell pumping to prevent the potential accumulation of flammable gases

  5. Operational Test Report (OTR) for U-102 Pumping and Instrumentation and Control (PIC) Skid

    Energy Technology Data Exchange (ETDEWEB)

    KOCH, M.R.

    2000-02-28

    Attached is the completed Operation Test Procedure (OTP-200-004, Rev. A-19 and Rev. A-20). OTP includes a print out of the Programmable Logic Controller (PLC) Ladder Diagram. Ladder Diagram was designed for installation in the PLC used to monitor and control pumping activity for Tank Farm 241-U-102. The completed OTP and OTR are referenced in the IS PIC Skid Configuration Drawing (H-2-829998).

  6. PLC and DTAM Software Programs for Pumping Instrumentation and Control Skid N

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This document describe the software programs for the Programmable Logic Controller and the Datable Access Module for Pumping Instrumentation and Control skid ''N''. The Appendices contains copies of the printouts of these software programs. This document describes the software programs for the Allen-Bradley SLC 500 programmable logic controller (PLC) and the Allen-Bradley DTAM PLUS operator interface module used on Pumping Instrumentation and Control (PIC) skid ''N''. The software programs for the SLC 500 and DTAM Plus are based on the core programs provided by Allen-Bradley. The PLC and DTAM software programs on skid ''D'' for SX-104 are the baseline programs. These baselines have been tailored for U-farm skids. The skid ''N'' program for U-109 is similar to the skid ''M'' program for U-102. An Acceptance Test Procedure (ATP) and an Operational Test Procedure (OTP) verify that the software programs meet the specific requirements for U-109 pumping. This document represents the final PLC and DTAM programs for PIC skid ''N'' at U-109. These programs were printed out after the performance of the OTP. The OTP acts as the final qualification test for the software programs. Functional requirements and details of the PLC ladder logic are described in this document. The final programs entered into the PLC and DTAM Plus are included as Appendices to this document

  7. Performance evaluation of rotating pump jet mixing of radioactive wastes in Hanford Tanks 241-AP-102 and -104

    International Nuclear Information System (INIS)

    Onishi, Y.; Recknagle, K.P.

    1998-07-01

    The purpose of this study was to confirm the adequacy of a single mixer pump to fully mix the wastes that will be stored in Tanks 241-AP-102 and -104. These Hanford double-shell tanks (DSTs) will be used as staging tanks to receive low-activity wastes from other Hanford storage tanks and, in turn, will supply the wastes to private waste vitrification facilities for eventual solidification. The TEMPEST computer code was applied to Tanks AP-102 and -104 to simulate waste mixing generated by the 60-ft/s rotating jets and to determine the effectiveness of the single rotating pump to mix the waste. TEMPEST simulates flow and mass/heat transport and chemical reactions (equilibrium and kinetic reactions) coupled together. Section 2 describes the pump jet mixing conditions the authors evaluated, the modeling cases, and their parameters. Section 3 reports model applications and assessment results. The summary and conclusions are presented in Section 4, and cited references are listed in Section 5

  8. Feasibility Study on Using Two Mixer Pumps for Tank 241-AY-102 Waste Mixing

    International Nuclear Information System (INIS)

    Onishi, Yasuo; Wells, Beric E.

    2004-01-01

    The current waste retrieval plan at Hanford calls for using two mixer pumps to mix the waste stored in double-shell Tank 214-AY-102. The objective of this evaluation was to determine whether two rotating 300-hp mixer pumps placed 22 ft (6.7 m) off-center in the tank could adequately mix the AY-102 waste. The tank currently contains high-level waste that is 248 inches (6.3 m) deep, comprising 62 inches (1.58 m) of sludge and 186 inches (4.72 m) of supernatant liquid (Galbraith and others 2002). Based on the available data, AY-102 waste properties were determined, including the densities of liquid and agglomerated settled solids and crystals, the volume fraction of settled solids, the solid particle size distribution, the liquid and slurry viscosities, and the yield stress in shear (shear strength) of the settled solids layer. To evaluate the likely and bounding cases of AY-102 waste mixing, sludge erosion modeling was performed with a median value of 1,090 Pa (likely condition) and a conservative (more difficult to erode) 97.5 percentile value of 2,230 Pa for shear strength. According to model predictions, the two rotating mixer pumps would erode 89% of the sludge with shear strength of 1,090 Pa. They would erode sludge up to 41 ft (12.5 m) away from the mixer pumps but would not mobilize the bottom 2.5 inches (0.06-m) of sludge or sludge in the areas next to the tank wall, more than 26 ft (7.9 m) away. Once the sludge is mobilized, the solids were predicted to be uniformly suspended within the tank within a 1-vol% concentration variation except those in few inches at the bottom. With shear strength of 2,230 Pa, the two pumps would erode 85% of the sludge, slightly less than the 1,090-Pa shear strength case. In this case, the pump jets would mobilize the sludge up to 38 ft (11.6 m), except the bottom 2.5 inches of sludge. The mixer pumps would also leave the sludge at the tank wall, which is 20 ft or more from the pumps. Similar to the 1,090 Pa case, the solids were

  9. Pump Jet Mixing and Pipeline Transfer Assessment for High-Activity Radioactive Wastes in Hanford Tank 241-AZ-102

    Energy Technology Data Exchange (ETDEWEB)

    Y Onishi; KP Recknagle; BE Wells

    2000-08-09

    The authors evaluated how well two 300-hp mixer pumps would mix solid and liquid radioactive wastes stored in Hanford double-shell Tank 241-AZ-102 (AZ-102) and confirmed the adequacy of a three-inch (7.6-cm) pipeline system to transfer the resulting mixed waste slurry to the AP Tank Farm and a planned waste treatment (vitrification) plant on the Hanford Site. Tank AZ-102 contains 854,000 gallons (3,230 m{sup 3}) of supernatant liquid and 95,000 gallons (360 m{sup 3}) of sludge made up of aging waste (or neutralized current acid waste). The study comprises three assessments: waste chemistry, pump jet mixing, and pipeline transfer. The waste chemical modeling assessment indicates that the sludge, consisting of the solids and interstitial solution, and the supernatant liquid are basically in an equilibrium condition. Thus, pump jet mixing would not cause much solids precipitation and dissolution, only 1.5% or less of the total AZ-102 sludge. The pump jet mixing modeling indicates that two 300-hp mixer pumps would mobilize up to about 23 ft (7.0 m) of the sludge nearest the pump but would not erode the waste within seven inches (0.18 m) of the tank bottom. This results in about half of the sludge being uniformly mixed in the tank and the other half being unmixed (not eroded) at the tank bottom.

  10. Pump Jet Mixing and Pipeline Transfer Assessment for High-Activity Radioactive Wastes in Hanford Tank 241-AZ-102

    International Nuclear Information System (INIS)

    Onishi, Y.; Recknagle, K.P.; Wells, B.E.

    2000-01-01

    The authors evaluated how well two 300-hp mixer pumps would mix solid and liquid radioactive wastes stored in Hanford double-shell Tank 241-AZ-102 (AZ-102) and confirmed the adequacy of a three-inch (7.6-cm) pipeline system to transfer the resulting mixed waste slurry to the AP Tank Farm and a planned waste treatment (vitrification) plant on the Hanford Site. Tank AZ-102 contains 854,000 gallons (3,230 m 3 ) of supernatant liquid and 95,000 gallons (360 m 3 ) of sludge made up of aging waste (or neutralized current acid waste). The study comprises three assessments: waste chemistry, pump jet mixing, and pipeline transfer. The waste chemical modeling assessment indicates that the sludge, consisting of the solids and interstitial solution, and the supernatant liquid are basically in an equilibrium condition. Thus, pump jet mixing would not cause much solids precipitation and dissolution, only 1.5% or less of the total AZ-102 sludge. The pump jet mixing modeling indicates that two 300-hp mixer pumps would mobilize up to about 23 ft (7.0 m) of the sludge nearest the pump but would not erode the waste within seven inches (0.18 m) of the tank bottom. This results in about half of the sludge being uniformly mixed in the tank and the other half being unmixed (not eroded) at the tank bottom

  11. Acceptance for Beneficial Use Pumping Instrumentation and Control Skid N

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This is a final Acceptance for Beneficial Use (ABU) for Pumping and Instrumentation Control (PIC) skid ''N''. PIC skid ''N'' is ready for pumping tank U-109. All the testing and documentation has been completed as required on the AE3U checklist. This AE3U covers only the readiness of the PIC skid ''N''. Other U-farm preparations including dilution tank fabrication, portable exhauster readiness, leak detection, valve pit preparation, and the Operation Control Station readiness are not part of this ABU. PIC skid ''N'' is a new skid fabricated and tested at Site Fabrication Services. The skid controls the jet pump and monitors various instruments associated with the pumping operation. This monitoring includes leak detection along the waste transfer route and flammable gases in the pump pit. This Acceptance for Beneficial Use documents that Pumping Instrumentation and Control (PIC) skid ''N'' is ready for field use. This document does not cover the field installation or operational testing

  12. Acceptance for Beneficial Use Pumping Instrumentation and Control Skid L

    International Nuclear Information System (INIS)

    KOCH, M.R.

    1999-01-01

    This is a final Acceptance for Beneficial Use (ABU) for Pumping and Instrumentation Control (PIC) skid ''L''. PIC skid ''L'' is ready for pumping tank U-105. All the testing and documentation has been completed as required on the ABU checklist. This ABU covers only the readiness of the PIC skid ''L''. Other U-farm preparations including dilution tank fabrication, portable exhauster readiness, leak detection, valve pit preparation, and the Operation Control Station readiness are not part of this ABU. PIC skid ''L'' is a new skid fabricated and tested at Site Fabrication Services. The skid controls the jet pump and monitors various instruments associated with the pumping operation. This monitoring includes leak detection along the waste transfer route and flammable gases in the pump pit

  13. Flexible receiver adapter and secondary bagger support frame analysis for 241AP102 mixer pump removal

    International Nuclear Information System (INIS)

    Axup, M.D.; Egger, J.

    1995-01-01

    As part of the Grout Process startup, the 241AP102 Mixer Pump, failed in 1993, is scheduled to be removed. A structural analysis was performed on two components to be used in the bagging process for the failed pump. The loading criteria was based on a worst case accident of the entire pump weight (including a 50% impact load) being applied over a small localized area. The results show that the design of each structure is adequate to protect against failure, i.e., yield

  14. Dropping of mixing pump in Tank 102-AP

    International Nuclear Information System (INIS)

    Jimenez, R.F.

    1995-01-01

    The purpose of this study is to examine dropping of the mixing pump in Tank 102-AP during its removal poses the risk of causing a leak in the tank bottom with attendant potential for public exposure from the leak. The purpose of this investigation is to examine the potential for causing such a leak (i.e., estimated frequency of leak occurrence); to qualitatively estimate leak magnitude if its is a credible event; and, finally to compare the worker hazard, in the installation of an impact limiter (should it be required), to that which the public might incur if a leak is manifest in the tank bottom. The ultimate goal of the study is, of course, to assess the need for installation of an impact limiter

  15. Functional design criteria 241-AP-102 Flexible Receiver System

    International Nuclear Information System (INIS)

    Roblyer, S.P.

    1995-01-01

    A mixer pump was installed in the 1.07 m (42-in.) riser of the central pump pit of tank 241-AP-102 to mitigate potential fluid separation particle sedimentation by mixing the tank's contents. The mixer pump performed this function until failure. Its removal is now necessary to meet possible tank content removal commitments or other corrective actions. The proposed removal procedure requires a flexible receiver that will provide a barrier to contamination during removal and transfer of the pump to the mixer pump storage container. This document describes the functional design criteria of the flexible receiver. These criteria include the functional and performance requirements of the flexible receiver as a barrier to contamination during normal conditions and contingencies and the instrumentation requirements

  16. Two-color pump-probe laser spectroscopy instrument with picosecond time-resolved electronic delay and extended scan range

    Science.gov (United States)

    Yu, Anchi; Ye, Xiong; Ionascu, Dan; Cao, Wenxiang; Champion, Paul M.

    2005-11-01

    An electronically delayed two-color pump-probe instrument was developed using two synchronized laser systems. The instrument has picosecond time resolution and can perform scans over hundreds of nanoseconds without the beam divergence and walk-off effects that occur using standard spatial delay systems. A unique picosecond Ti :sapphire regenerative amplifier was also constructed without the need for pulse stretching and compressing optics. The picosecond regenerative amplifier has a broad wavelength tuning range, which suggests that it will make a significant contribution to two-color pump-probe experiments. To test this instrument we studied the rotational correlation relaxation of myoglobin (τr=8.2±0.5ns) in water as well as the geminate rebinding kinetics of oxygen to myoglobin (kg1=1.7×1011s-1, kg2=3.4×107s-1). The results are consistent with, and improve upon, previous studies.

  17. Wide Range Vacuum Pumps for the SAM Instrument on the MSL Curiosity Rover

    Science.gov (United States)

    Sorensen, Paul; Kline-Schoder, Robert; Farley, Rodger

    2014-01-01

    Creare Incorporated and NASA Goddard Space Flight Center developed and space qualified two wide range pumps (WRPs) that were included in the Sample Analysis at Mars (SAM) instrument. This instrument was subsequently integrated into the Mars Science Laboratory (MSL) "Curiosity Rover," launched aboard an Atlas V rocket in 2011, and landed on August 6, 2012, in the Gale Crater on Mars. The pumps have now operated for more than 18 months in the Gale Crater and have been evacuating the key components of the SAM instrument: a quadrupole mass spectrometer, a tunable laser spectrometer, and six gas chromatograph columns. In this paper, we describe the main design challenges and the ways in which they were solved. This includes the custom design of a miniaturized, high-speed motor to drive the turbo drag pump rotor, analysis of rotor dynamics for super critical operation, and bearing/lubricant design/selection.

  18. A pumped, two-phase flow heat transport system for orbiting instrument payloads

    Science.gov (United States)

    Fowle, A. A.

    1981-01-01

    A pumped two-phase (heat absorption/heat rejection) thermal transport system for orbiting instrument payloads is investigated. The thermofluid characteristics necessary for the system design are discussed. A preliminary design with a series arrangement of four instrument heat stations and six radiators in a single loop is described in detail, and the total mass is estimated to be 134 kg, with the radiators, instrument heat stations, and fluid reservoir accounting for approximately 86, 24, and 12 kg, respectively. The evaluation of preliminary test results shows that the system has potential advantages; however, further research is necessary in the areas of one-g and zero-g heat transfer coefficients/fluid regimes, fluid by-pass temperature control, and reliability of small pumps.

  19. PLC/DTAM Software Programs for Pumping Instrumentation and Control Skid ''L''

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This document describes the software programs for the Programmable Logic Controller and the Data Table Access Module for Pumping Instrumentation and Control skid ''L''. The Appendices contains copies of the printouts of these software programs

  20. Acceptance Test Procedure for New Pumping and Instrumentation Control Skid L

    International Nuclear Information System (INIS)

    KOCH, M.R.

    1999-01-01

    This Acceptance Test Procedure (ATP) provides for the inspection and testing of the new Pumping and Instrumentation Control (PIC) skid designed as ''L''. The ATP will be performed after the construction of the PIC skid in the shop

  1. Acceptance Test Procedure for New Pumping and Instrumentation Control Skid N

    International Nuclear Information System (INIS)

    KOCH, M.R.

    1999-01-01

    This Acceptance Test Procedure (ATP) provides for the inspection and testing of the new Pumping and Instrumentation Control (PIC) skid designed as ''N''. The ATP will be performed after the construction of the PIC skid in the shop

  2. Contingency plan for deployment of the void fraction instrument in Tank 241-AY-102

    International Nuclear Information System (INIS)

    CONNER, J.M.

    1999-01-01

    High-heat producing sludge from tank 241-C-106 will be sluiced and transferred to tank 241-AY-102 beginning in October 1998. Safety analyses have postulated that after retrieval, the waste in 241-AY-102 may generate and retain unsafe levels of flammable gases (Noorani 1998, Pasamebmetoglu etal. 1997). Unsafe levels of retained gas are not expected, but cannot be ruled out because of the large uncertainty in the gas generation and retention rates. The Tank Waste Remediation System Basis for Interim Operation (Noorani 1998) identifies the need for a contingency plan to add void fraction monitoring to tank 241-AY-102 within 2 weeks of the identification of flammable gas buildup that would warrant monitoring. The Tank 241-C-106 Waste Retrieval Sluicing System Process Control Plan (Carothers et al. 1998) committed to providing a contingency plan for deployment of the void fraction instrument (VFI) in tank 241-AY-102. The VFI determines the local void fraction of the waste by compressing a waste sample captured in a gas-tight test chamber. The sample chamber is mounted on the end of a 76-cm (2.5-ft) arm that can be rotated from vertical to horizontal when the instrument is deployed. Once in the waste, the arm can be positioned horizontally and rotated to sample in different areas below the riser. The VFI is deployed using a crane. The VFI has been deployed previously in 241-AW, 241-AN, and 241-SY tank farms, most recently in tank 241-SY-101 in June and July 1998. An additional test in tank 241-SY-101 is planned in September 1998. Operating instructions for the VFI are included in the Void Fraction Instrument Operation and Maintenance Manual (Pearce 1994)

  3. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid ''P''

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Procedure (ATP) provides for the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''P''. The ATP will be performed after the construction of the PIC skid in the fabrication shop

  4. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid W

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Procedure (ATP) provides for the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''W''. The ATP will be performed after the construction of the PIC skid in the fabrication shop

  5. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid V

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Procedure (ATP) provides for the inspection and testing of the new Pumping Instrumentation and Control. (PIC) skid designed as ''V''. The ATP will be performed after the construction of the PIC skid in the fabrication shop

  6. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid ''V''

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Procedure (ATP) provides for the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designated as ''V''. The ATP will be performed after the construction of the PIC skid in the fabrication shop

  7. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid ''Q''

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Procedure (ATP) provides for the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''Q''. The ATP will be performed after the construction of the PIC skid in the fabrication shop

  8. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid ''T''

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Procedure (ATP) provides for the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designated as ''T''. The ATP will be performed after the construction of the PIC skid in the fabrication shop

  9. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid T

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Procedure (ATP) provides for the inspection and testing Of the new Pumping Instrumentation and Control (PIC) skid designed as ''T''. The ATP will be performed after the construction of the PIC skid in the fabrication shop

  10. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid R

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Procedure (ATP) provides for the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''R''. The ATP will be performed after the construction of the PIC skid in the fabrication shop

  11. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid ''U''

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Procedure (ATP) provides for the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''U''. The ATP will be performed after the construction of the PIC skid in the fabrication shop

  12. PLC/DTAM Software Programs for Pumping Instrumentation and Control Skid L

    Energy Technology Data Exchange (ETDEWEB)

    KOCH, M.R.

    2000-01-03

    This document describes the software programs for the Programmable Logic Controller and the Data Table Access Module for Pumping Instrumentation and Control skid ''L''. The Appendices contains copies of the printouts of these software programs.

  13. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid ''P''

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Test Plan provides a test method to dedicate the leak detection relays used on the new Pumping Instrumentation and Control (PIC) skids. The new skids are fabricated on-site. The leak detection system is a safety class system per the Authorization Basis

  14. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid Q

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Test Plan provides a test method to dedicate the leak detection relays used on the new Pumping Instrumentation and Control (PIC) skids. The new skids are fabricated on-site. The leak detection system is a safety class system per the Authorization Basis

  15. PLC and DTAM Software Programs for Pumping Instrumentation and Control Skid P

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This document describe the software programs for the Programmable Logic Controller and the Datable Access Module for Pumping Instrumentation and Control skid ''P''. The Appendices contains copies of the printouts of these software programs

  16. Hydraulic optimization of 'S' characteristics of the pump-turbine for Xianju pumped storage plant

    International Nuclear Information System (INIS)

    Liu, W C; Zheng, J S; Cheng, J; Shi, Q H

    2012-01-01

    The pump-turbine with a rated power capacity of 375MW each at Xianju pumped storage plant is the most powerful one under construction in China. In order to avoid the instability near no-load conditions, the hydraulic design of the pump-turbine has been optimized to improving the 'S' characteristic in the development of the model pump-turbine. This paper presents the cause of 'S' characteristic of a pump-turbine by CFD simulation of the internal flow. Based on the CFD analysis, the hydraulic design optimization of the pump-turbine was carried out to eliminate the 'S' characteristics of the machine at Xianju pumped storage plant and a big step for removing the 'S' characteristic of a pump-turbine has been obtained. The model test results demonstrate that the pump-turbine designed for Xianju pumped storage plant can smoothly operate near no-load conditions without an addition of misaligned guide vanes.

  17. PLC and DTAM Software Programs for Pumping Instrumentation and Control Skid ''M''

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This document describes the software programs for the Programmable Logic Controller and the Data Table Access Module for Pumping Instrumentation and Control skid ''M''. The Appendices contains copies of the printouts of these software programs

  18. PLC and DTAM Software Programs for Pumping Instrumentation and Control Skid M

    Energy Technology Data Exchange (ETDEWEB)

    KOCH, M.R.

    2000-02-14

    This document describes the software programs for the Programmable Logic Controller and the Data Table Access Module for Pumping Instrumentation and Control skid ''M''. The Appendices contains copies of the printouts of these software programs.

  19. Acceptance Test Procedure for New Pumping and Instrumentation Control Skid M

    International Nuclear Information System (INIS)

    KOCH, M.R.

    1999-01-01

    This Acceptance Test Procedure (ATP) verifies proper construction per the design drawings and tests for proper functioning of the Pumping and Instrumentation Control (PIC) skid ''M''. The Scope section lists the systems and functions to be checked. This ATP will be performed at the Site Fabrication Service's (SFS) shop upon completion of construction of the PIC skid

  20. Acceptance Test Procedure for New Pumping Instrumentation and Control Skid ''V''

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Procedure (ATP) verifies proper construction per the design drawings and tests for proper functioning of the Pumping Instrumentation and Control (PIC) skid ''V''. The scope section lists the systems and functions to be checked. This ATP will be performed at the Site Fabrication Services (SFS) shop upon completion of the construction of the PIC skid

  1. Test Report for Acceptance Test Procedure for Pumping Instrumentation and Control Skid ''P''

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Report (ATR) provides the test results for the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''P''. The ATR summaries the results and provides a copy of the ATP and inspections in the Appendix

  2. Test Report for Acceptance Test Procedure for Pumping Instrumentation and Control Skid Q

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This Acceptance Test Report (ATR) provides the test results for the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''Q''. The ATR summaries the results and provides a copy of the ATP and inspections in the Appendix

  3. Removal of mixing pump in tank 102-AP -- pump drop onto central pit

    International Nuclear Information System (INIS)

    Jimenez, R.F.

    1995-01-01

    The mixing pump, if dropped in the pump pit following its removal from the tank, is incapable of compromising the tank structure either locally or in a structural displacement mode to an extent which might allow dispersion of the contents. A drop from 10 ft above the pit floor (considered the maximum credible height) of a pump which is considered perfectly rigid does not approach the required perforation velocity. The velocity required to perforate requires a drop height which is physically impossible to attain with existing cranes. An analysis of the location of the deposition of the strain energy required to match the pump's impact kinetic energy, the results of which are shown in Table 2, verifies that there is no credible chance for compromise of the tank roof by such a drop

  4. Reactor recirculation pump test loop

    International Nuclear Information System (INIS)

    Taka, Shusei; Kato, Hiroyuki

    1979-01-01

    A test loop for a reactor primary loop recirculation pumps (PLR pumps) has been constructed at Ebara's Haneda Plant in preparation for production of PLR pumps under license from Byron Jackson Pump Division of Borg-Warner Corporation. This loop can simulate operating conditions for test PLR pumps with 130 per cent of the capacity of pumps for a 1100 MWe BWR plant. A main loop, primary cooling system, water demineralizer, secondary cooling system, instrumentation and control equipment and an electric power supply system make up the test loop. This article describes the test loop itself and test results of two PLR pumps for Fukushima No. 2 N.P.S. Unit 1 and one main circulation pump for HAZ Demonstration Test Facility. (author)

  5. 78 FR 69177 - Ownership and Control Reports, Forms 102/102S, 40/40S, and 71

    Science.gov (United States)

    2013-11-18

    ... equally important regulatory challenges. Effective surveillance now requires automated analysis and... Form 102S ix. Consolidation Form Proposed by FIA x. Section 15(a) Factors C. Regulatory Flexibility Act... establish a comprehensive new regulatory framework for swaps and security-based swaps. The legislation was...

  6. 20 CFR 220.102 - Non-severe impairment(s), defined.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Non-severe impairment(s), defined. 220.102 Section 220.102 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT... these include— (1) Physical functions such as walking, standing, sitting, lifting, pushing, pulling...

  7. Test Report for Acceptance Test Procedure for Pumping Instrumentation and Control Skid N

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    This is a Test Report for Acceptance Test Procedure (ATP) RPP-5489. This test report provides the results of the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''N''. The ATP was successfully completed. A copy of the completed ATP is in the Appendix of this document

  8. Test Report for Acceptance Test Procedure for Pumping Instrumentation and Control Skid M

    International Nuclear Information System (INIS)

    KOCH, M.R.

    1999-01-01

    This is a Test Report for Acceptance Test Procedure (ATP) RPP-5073. This test report provides the results of the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''M''. The ATP was successfully completed. A copy of the completed ATP is in the Appendix of this document

  9. Test Report for Acceptance Test Procedure for Pumping Instrumentation and Control Skid L

    International Nuclear Information System (INIS)

    KOCH, M.R.

    1999-01-01

    This is a Test Report for Acceptance Test Procedure (ATP) RPP-5055. This test report provides the results of the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''L''. The ATP was successfully completed. A copy of the completed ATP is in the Appendix of this document

  10. Test Report for Acceptance Test Procedure for Pumping Instrumentation and Control Skid L

    Energy Technology Data Exchange (ETDEWEB)

    KOCH, M.R.

    1999-11-09

    This is a Test Report for Acceptance Test Procedure (ATP) RPP-5055. This test report provides the results of the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''L''. The ATP was successfully completed. A copy of the completed ATP is in the Appendix of this document.

  11. Test Report for Acceptance Test Procedure for Pumping Instrumentation and Control Skid M

    Energy Technology Data Exchange (ETDEWEB)

    KOCH, M.R.

    1999-12-13

    This is a Test Report for Acceptance Test Procedure (ATP) RPP-5073. This test report provides the results of the inspection and testing of the new Pumping Instrumentation and Control (PIC) skid designed as ''M''. The ATP was successfully completed. A copy of the completed ATP is in the Appendix of this document.

  12. Effects of pollution in River Krishni on hand pump water quality

    Directory of Open Access Journals (Sweden)

    K. Dhakyanaika

    2010-01-01

    Full Text Available River Krishni is highly polluted. The investigation was “to study the effect of pollution in River Krishni on the quality ofgroundwater abstracted through shallow and deep hand pumps placed in the close vicinity of River Krishni”. One suchaffected Village Chanedna Maal was selected for the study. Water samples were analyzed in terms of physical, chemicaland bacteriological water quality parameters. Range of values of conductivity (1040–2770 μS/cm, TOC (27.79–1365.1mg/L, UV absorbance at 254 nm (0.281–10.34 cm-1, color (1510–5200 CU, and COD (15.82–1062 mg/L indicatedpresence of significant amount of pollution / organics in the river water, total coliform (16x102–46x106 MPN/100mLand fecal coliform (16x102–24x106 MPN/100mL. In case of deeper India Mark-II hand pumps conductivity was foundto range from 443–755 μS/cm, TOC (0.226–9.284 mg/L, UV absorbance (0.0–0.118 cm-1, colour (0.0–119 CU, COD(9.0–113 mg/L and MPN (0.0–93x101/100m L. While in case of shallower hand pumps conductivity (441–1609 μS/cm, TOC (0.015–68.82 mg/L, UV absorbance (0.0–1.094 cm-1, colour (4.0–560 CU, COD (9.72–163 mg/L and MPN(0.0–15x102/100mL. Hand pumps abstracting water from shallow and deep unconfined aquifers have been found to deliverpolluted water in terms of color, organics and coliform bacteria. As the hand pumps are the only source of water supply inVillage Chandena Maal, pollution of the groundwater has adversely affected the day to day life of its 3000 residents.

  13. Internal pump monitoring device

    International Nuclear Information System (INIS)

    Kurosaki, Toshikazu.

    1996-01-01

    In the present invention, a thermometer is disposed at the upper end of an internal pump casing of a coolant recycling system in a BWR type reactor to detect leakage of reactor water thereby ensuring the improvement of reliability of the internal pump. Namely, a thermometer is disposed, which can detect temperature elevation occurred when water in the internal pump leaked from a reactor pressure vessel passes through the gap between a stretch tube and an upper end of the pump casing. Signals from the thermometer are transmitted to a signal processing device by an instrumentation cable. The signal processing device generates an alarm when the temperature signal exceeds a predetermined value and announces that leakage of reactor water occurs in the internal pump. Since the present invention can detect the leakage of the reactor water in the pump casing in an early stage, it can contribute to the improvement of the safety and reliability of the internal pump. (I.S.)

  14. 5 CFR 847.102 - Regulatory structure.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Regulatory structure. 847.102 Section 847.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS... INSTRUMENTALITIES General Provisions § 847.102 Regulatory structure. (a)(1) Subpart A of this part contains...

  15. Tank 241-S-102, Core 232 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    STEEN, F.H.

    1998-11-04

    This document is the analytical laboratory report for tank 241-S-102 push mode core segments collected between March 5, 1998 and April 2, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-S-102 Retained Gas Sampler System Sampling and Analysis Plan (TSAP) (McCain, 1998), Letter of Instruction for Compatibility Analysis of Samples from Tank 241-S-102 (LOI) (Thompson, 1998) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Mulkey and Miller, 1998). The analytical results are included in the data summary table (Table 1).

  16. Tank SY-102 waste retrieval assessment: Rheological measurements and pump jet mixing simulations

    International Nuclear Information System (INIS)

    Onishi, Y.; Shekarriz, R.; Recknagle, K.P.

    1996-09-01

    Wastes stored in Hanford Tank 241-SY-102 are planned to be retrieved from that tank and transferred to 200 East Area through the new pipeline Replacement Cross Site Transfer System (RCSTS). Because the planned transfer of this waste will use the RCSTS, the slurry that results from the mobilization and retrieval operations must meet the applicable waste acceptance criteria for this system. This report describes results of the second phase (the detailed assessment) of the SY-102 waste retrieval study, which is a part of the efforts to establish a technical basis for mobilization of the slurry, waste retrieval, and slurry transport. Hanford Tank 241-SY-102 is located in the SY Tank Farm in the Hanford Site's 200 West Area. It was built in 1977 to serve as a feed tank for 242-S Evaporator/Crystallizer, receiving supernatant liquid from S, SX, T, and U tank farms. Since 1981, the primary sources of waste have been from 200 West Area facilities, e.g., T-Plant decontamination operations, Plutonium Finishing Plant operations, and the 222-S Laboratory. It is the only active-service double-shell tank (DST) in the 200 West Area and is used as the staging tank for cross-site transfers to 200 East Area DSTs. The tank currently stores approximately 470 kL (125 kgal) of sludge wastes from a variety of sources including the Plutonium Finishing Plant, T-Plant, and the 222-S Laboratory. In addition to the sludge, approximately twice this amount (about 930 kL) of dilute, noncomplexed waste forms a supernatant liquid layer above the sludge

  17. PLC/DTAM Software Programs for Pumping Instrumentation and Control Skid X

    International Nuclear Information System (INIS)

    HORNER, T.M.

    2001-01-01

    This document describes the software programs for the Allen-Bradley SLC 500 programmable logic controller (PLC) and the Allen-Bradley DTAM PLUS operator interface module used on Pumping Instrumentation and Control (PIC) skid ''X''. The software programs for the SLC 500 and DTAM Plus are based on the core programs provided by Allen-Bradley. The PLC and DTAM software programs on skid ''D'' for SX-104 are the baseline programs. These baselines will be tailored for each individual BY-farm skid. An Acceptance Test Procedure (ATP) and an Operational Test Procedure (OTP) verify that the software programs meet the specific requirements for BY-105 pumping. This document represents the final PLC and DTAM programs for PIC skid ''X'' at BY-105. These programs were printed out after the performance of the OTP. The OTP acts as the final qualification test for the software programs. Functional requirements and details of the PLC ladder logic are described in this document. The final programs entered into the PLC and DTAM Plus are included as Appendices to this document

  18. AWWA E102-17 submersible vertical turbine pumps

    CERN Document Server

    2017-01-01

    This standard describes minimum requirements for submersible vertical turbine pumps utilizing a discharge column pipe assembly, 5 hp or larger, used in water service, including materials, design, manufacture, inspection, and testing.

  19. Pumps of molten metal based on magnetohydrodynamicprinciple for cooling high-temperature nuclear reactors

    Czech Academy of Sciences Publication Activity Database

    Doležel, Ivo; Donátová, M.; Karban, P.; Ulrych, B.

    2009-01-01

    Roč. 85, č. 4 (2009), s. 13-15 ISSN 0033-2097 R&D Projects: GA ČR(CZ) GA102/07/0496 Institutional research plan: CEZ:AV0Z20570509 Keywords : pumps of molten metal * magnetohydrodynamic principle * nuclear reactors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.196, year: 2009

  20. Adsorption pump for helium pumping out

    International Nuclear Information System (INIS)

    Donde, A.L.; Semenenko, Yu.E.

    1981-01-01

    Adsorption pump with adsorbent cooling by liquid helium is described. Shuttered shield protecting adsorbent against radiation is cooled with evaporating helium passing along the coil positioned on the shield. The pump is also equipped with primed cylindrical shield, cooled with liquid nitrogen. The nitrogen shield has in the lower part the shuttered shield, on the pump casing there is a valve used for pump pre-burning, and valves for connection to recipient as well. Pumping- out rates are presented at different pressures and temperatures of adsorbent. The pumping-out rate according to air at absorbent cooling with liquid nitrogen constituted 5x10 -4 Pa-3000 l/s, at 2x10 -2 Pa-630 l/s. During the absorbent cooling with liquid hydrogen the pumping-out rate according to air was at 4x10 -4 Pa-580 l/s, at 2x10 -3 Pa-680 l/s, according to hydrogen - at 8x10 -5 Pa-2500 l/s, at 5x10 -3 Pa-4200 l/s. During adsorbent cooling with liquid helium the rate of pumping-out according to hydrogen at 3x10 5 Pa-2400% l/s, at 6x10 3 Pa-1200 l/s, and according to helium at 3.5x10 -5 Pa-2800 l/s, at 4x10 -3 Pa-1150 l/s. The limit vacuum is equal to 1x10 -7 Pa. The volume of the vessel with liquid helium is equal to 3.5 l. Helium consumption is 80 cm 3 /h. Consumption of liquid nitrogen from the shield is 400 cm 3 /h. The limit pressure in the pump is obtained after forevacuum pumping-out (adsorbent regeneration) at 300 K temperature. The pump is made of copper. The pump height together with primed tubes is 800 mm diameter-380 mm [ru

  1. 9 CFR 102.4 - U.S. Veterinary Biologics Establishment License.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false U.S. Veterinary Biologics... LICENSES FOR BIOLOGICAL PRODUCTS § 102.4 U.S. Veterinary Biologics Establishment License. (a) Before a U.S. Veterinary Biologics Establishment License will be issued by the Administrator for any establishment, an...

  2. 9 CFR 102.5 - U.S. Veterinary Biological Product License.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false U.S. Veterinary Biological Product... BIOLOGICAL PRODUCTS § 102.5 U.S. Veterinary Biological Product License. (a) Authorization to produce each biological product shall be specified on a U.S. Veterinary Biological Product License, issued by the...

  3. Pumped storage system model and experimental investigations on S-induced issues during transients

    Science.gov (United States)

    Zeng, Wei; Yang, Jiandong; Hu, Jinhong

    2017-06-01

    Because of the important role of pumped storage stations in the peak regulation and frequency control of a power grid, pump turbines must rapidly switch between different operating modes, such as fast startup and load rejection. However, pump turbines go through the unstable S region in these transition processes, threatening the security and stability of the pumped storage station. This issue has mainly been investigated through numerical simulations, while field experiments generally involve high risks and are difficult to perform. Therefore, in this work, the model test method was employed to study S-induced security and stability issues for a pumped storage station in transition processes. First, a pumped storage system model was set up, including the piping system, model units, electrical control systems and measurement system. In this model, two pump turbines with different S-shaped characteristics were installed to determine the influence of S-shaped characteristics on transition processes. The model platform can be applied to simulate any hydraulic transition process that occurs in real power stations, such as load rejection, startup, and grid connection. On the experimental platform, the S-shaped characteristic curves were measured to be the basis of other experiments. Runaway experiments were performed to verify the impact of the S-shaped characteristics on the pump turbine runaway stability. Full load rejection tests were performed to validate the effect of the S-shaped characteristics on the water-hammer pressure. The condition of one pump turbine rejecting its load after another defined as one-after-another (OAA) load rejection was performed to validate the possibility of S-induced extreme draft tube pressure. Load rejection experiments with different guide vane closing schemes were performed to determine a suitable scheme to adapt the S-shaped characteristics. Through these experiments, the threats existing in the station were verified, the

  4. Adiabatic pumping solutions in global AdS

    Energy Technology Data Exchange (ETDEWEB)

    Carracedo, Pablo [Meteo-Galicia,Santiago de Compostela E-15782 (Spain); Mas, Javier; Musso, Daniele; Serantes, Alexandre [Departamento de Física de Partículas, Universidade de Santiago de Compostela,Santiago de Compostela E-15782 (Spain); Instituto Galego de Física de Altas Enerxías (IGFAE),Santiago de Compostela E-15782 (Spain)

    2017-05-26

    We construct a family of very simple stationary solutions to gravity coupled to a massless scalar field in global AdS. They involve a constantly rising source for the scalar field at the boundary and thereby we name them pumping solutions. We construct them numerically in D=4. They are regular and, generically, have negative mass. We perform a study of linear and nonlinear stability and find both stable and unstable branches. In the latter case, solutions belonging to different sub-branches can either decay to black holes or to limiting cycles. This observation motivates the search for non-stationary exactly time-periodic solutions which we actually construct. We clarify the role of pumping solutions in the context of quasistatic adiabatic quenches. In D=3 the pumping solutions can be related to other previously known solutions, like magnetic or translationally-breaking backgrounds. From this we derive an analytic expression.

  5. Optical pumping of Rb by Ti:Sa laser and high-power laser diode

    Czech Academy of Sciences Publication Activity Database

    Buchta, Zdeněk; Rychnovský, Jan; Lazar, Josef

    2006-01-01

    Roč. 8, č. 1 (2006), s. 350-354 ISSN 1454-4164 R&D Projects: GA AV ČR IAA1065303; GA ČR GA102/04/2109 Institutional research plan: CEZ:AV0Z20650511 Keywords : optical pumping * Ti:Sa laser * laser diode * emission linewidth * spectroscopy * laser frequency stabilization Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.106, year: 2006

  6. 78 FR 64916 - Application(s) for Duty-Free Entry of Scientific Instruments

    Science.gov (United States)

    2013-10-30

    ... Minnesota--Twin Cities, 421 Washington Avenue SE., Minneapolis, MN 55455. Instrument: Diode-Pumped Solid... imaging of cellular organelles and calcium flux, photo-activation and photo-bleaching fluorescent proteins to study cellular organelles (mitochondria) and intracellular ion flux. The unique characteristics of...

  7. Pumping behavior of sputter ion pumps

    International Nuclear Information System (INIS)

    Chou, T.S.; McCafferty, D.

    The ultrahigh vacuum requirements of ISABELLE is obtained by distributed pumping stations. Each pumping station consists of 1000 l/s titanium sublimation pump for active gases (N 2 , H 2 , O 2 , CO, etc.), and a 20 l/s sputter ion pump for inert gases (methane, noble gases like He, etc.). The combination of the alarming production rate of methane from titanium sublimation pumps (TSP) and the decreasing pumping speed of sputter ion pumps (SIP) in the ultrahigh vacuum region (UHV) leads us to investigate this problem. In this paper, we first describe the essential physics and chemistry of the SIP in a very clean condition, followed by a discussion of our measuring techniques. Finally measured methane, argon and helium pumping speeds are presented for three different ion pumps in the range of 10 -6 to 10 -11 Torr. The virtues of the best pump are also discussed

  8. 11 CFR 102.11 - Petty cash fund (2 U.S.C. 432(h)(2)).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Petty cash fund (2 U.S.C. 432(h)(2)). 102.11 Section 102.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL REGISTRATION, ORGANIZATION, AND... and Congressional district) sought by such candidate. ...

  9. Outlook Analgesic Infusion Pumps Market Size - Trends and Opportunity Forecast to 2023

    OpenAIRE

    nishthavohra

    2018-01-01

    Analgesic infusion pumps are instruments used to carry analgesic drugs directly into patient’s body directly for pain management. Analgesic drugs provide relief from chronic disorders, including complex regional pain syndrome (CRPS), failed back syndrome pain, myocardial infarction, pneumonia, myocardial ischemia, post-operative pain, and hypertension. Lidocaine, phenol and morphine are some of the common medicines used in analgesic infusion pumps. Explore Report At: https://www.psmarket...

  10. 77 FR 61739 - Application(s) for Duty-Free Entry of Scientific Instruments

    Science.gov (United States)

    2012-10-11

    ... for which the instruments shown below are intended to be used, are being manufactured in the United... pump a dye laser to generate ultra-violet light which can be used to rack chemical species during... light (283 nm) will then fluoresce and can be detected using an intensified CCD camera. The key...

  11. TNX/HLW Long Shaft Pumps 1995-2000

    International Nuclear Information System (INIS)

    VanPelt, B.

    2002-01-01

    Problems with long shaft pumps are becoming clearer due to increased use, better instrumentation, more analysis, and increased testing activity. The problems are with reliability and not with hydraulic performance. The root cause of reliability problems is usually excessive vibration caused by design. The outlook for satisfactory pumps is improved as understanding of problems increases. Promising developments are emerging such as the tilt pad bearing. Alternative configurations, such as gas filled columns and submerged motor pumps, will require development. Continued development, in general, should be expected due to changing technology and industry changes. This report describes thirteen distinct pump programs starting with leakage of original mixer pumps in the 1980s and ending with the testing of tilt pad bearings now in progress. Eight of the programs occurred from 1996 to 2000. All involve long shaft pumps; all involve testing at TNX; and all involve a problem of some kind. The co mmon technical issue among the activities is vibration and shaft (or rotor) instability due to journal bearings. In every case, excessive shaft vibration is a reasonable and probable explanation for some or all of the problems

  12. Pumping characteristics of roots blower pumps for light element gases

    International Nuclear Information System (INIS)

    Hiroki, Seiji; Abe, Tetsuya; Tanzawa, Sadamitsu; Nakamura, Jun-ichi; Ohbayashi, Tetsuro

    2002-07-01

    The pumping speed and compression ratio of the two-stage roots blower pumping system were measured for light element gases (H 2 , D 2 and He) and for N 2 , in order to assess validity of the ITER torus roughing system as an ITER R and D task (T234). The pumping system of an Edwards EH1200 (nominal pumping speed of 1200 m 3 /s), two EH250s (ibid. 250 m 3 /s) and a backing pump (ibid. 100 m 3 /s) in series connection was tested under PNEUROP standards. The maximum pumping speeds of the two-stage system for D 2 and N 2 were 1200 and 1300 m 3 /h, respectively at 60 Hz, which satisfied the nominal pumping speed. These experimental data support the design validity of the ITER torus roughing system. (author)

  13. Dynamic modeling and dynamical analysis of pump-turbines in S-shaped regions during runaway operation

    International Nuclear Information System (INIS)

    Zhang, Hao; Chen, Diyi; Wu, Changzhi; Wang, Xiangyu; Lee, Jae-Myung; Jung, Kwang-Hyo

    2017-01-01

    Highlights: • Novel dynamic model of a pump-turbine in S-shaped regions is proposed. • A stability criterion of runaway point is given. • Global dynamic characteristics of the pump-turbine are investigated. • Effects of the slopes of the characteristic curve on the stability are studied. - Abstract: There is a region of pump-turbine operation, often called the S-shaped region, in which one unit rotational speed corresponds to three unit flows or torques. In this paper, the dynamic model of the pump-turbine in S-shaped regions is established by introducing the nonlinear piecewise function of relative parameters. Then, the global bifurcation diagrams of the pump-turbine are presented to analyze its dynamic characteristics in the S-shaped regions. Meanwhile, a stability criterion of runaway point is given based on the established theoretical model. The numerical experiments are conducted on the model and the results are in good agreement with the theoretical analysis. Furthermore, the effects of the characteristic curve slopes on the stability of the pump-turbine are studied by an innovative use of the three-dimensional bifurcation diagrams. Finally, the factors influencing the runaway stability of pump-turbines are also discussed, based on the dynamic analysis.

  14. 7 CFR 1718.102 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... LOAN SECURITY DOCUMENTS FOR ELECTRIC BORROWERS Loan Contracts With Distribution Borrowers § 1718.102 Definitions. For the purposes of this subpart: Borrower means any organization that has an outstanding loan... defined in 7 CFR 1710.2. Loan documents means the mortgage (or other security instrument acceptable to RUS...

  15. Analysis of the pump-turbine S characteristics using the detached eddy simulation method

    Science.gov (United States)

    Sun, Hui; Xiao, Ruofu; Wang, Fujun; Xiao, Yexiang; Liu, Weichao

    2015-01-01

    Current research on pump-turbine units is focused on the unstable operation at off-design conditions, with the characteristic curves in generating mode being S-shaped. Unlike in the traditional water turbines, pump-turbine operation along the S-shaped curve can lead to difficulties during load rejection with unusual increases in the water pressure, which leads to machine vibrations. This paper describes both model tests and numerical simulations. A reduced scale model of a low specific speed pump-turbine was used for the performance tests, with comparisons to computational fluid dynamics(CFD) results. Predictions using the detached eddy simulation(DES) turbulence model, which is a combined Reynolds averaged Naviers-Stokes(RANS) and large eddy simulation(LES) model, are compared with the two-equation turbulence mode results. The external characteristics as well as the internal flow are for various guide vane openings to understand the unsteady flow along the so called S characteristics of a pump-turbine. Comparison of the experimental data with the CFD results for various conditions and times shows that DES model gives better agreement with experimental data than the two-equation turbulence model. For low flow conditions, the centrifugal forces and the large incident angle create large vortices between the guide vanes and the runner inlet in the runner passage, which is the main factor leading to the S-shaped characteristics. The turbulence model used here gives more accurate simulations of the internal flow characteristics of the pump-turbine and a more detailed force analysis which shows the mechanisms controlling of the S characteristics.

  16. Regulatory instrument review: Aging management of LWR cables, containment and basemat, reactor coolant pumps, and motor-operated valves

    International Nuclear Information System (INIS)

    Werry, E.V.; Somasundaram, S.

    1995-09-01

    The results of Stage 2 of the Regulatory Instrument Review are presented in this volume. Selected regulatory instruments, such as the Code of Federal Regulations (CFR), US Nuclear Regulatory Commission (NRC), Regulatory Guides, and ASME Codes, were investigated to determine the extent to which these regulations apply aging management to selected safety-related components in nuclear power plants. The Regulatory Instrument Review was funded by the NRC under the Nuclear Plant Aging Research (NPAR) program. Stage 2 of the review focused on four safety-related structures and components; namely, cables, containment and basemat, reactor coolant pumps, and motor-operated valves. The review suggests that the primary-emphasis of the regulatory instruments was on the design, construction, start-up, and operation of a nuclear power plant, and that aging issues were primarily addressed after an aging-related problem was recognized. This Stage 2 review confirms the results of the prior review; (see Regulatory Instrument Review: Management of Aging of LWR Major Safety-Related Components NUREG/CR-5490. The observations indicate that the regulations generally address management of age-related degradation indirectly. Specific age-related degradation phenomena frequently are dealt with in bulletins and notices or through generic issues, letters, etc. The major recommendation of this report, therefore, is that the regulatory instruments should more directly and explicitly address the aging phenomenon and the management of the age-related degradation process

  17. An analytical method for defining the pump`s power optimum of a water-to-water heat pump heating system using COP

    Directory of Open Access Journals (Sweden)

    Nyers Jozsef

    2017-01-01

    Full Text Available This paper analyzes the energy efficiency of the heat pump and the complete heat pump heating system. Essentially, the maximum of the coefficient of performance of the heat pump and the heat pump heating system are investigated and determined by applying a new analytical optimization procedure. The analyzed physical system consists of the water-to-water heat pump, circulation and well pump. In the analytical optimization procedure the "first derivative equal to zero" mathematical method is applied. The objective function is the coefficient of performance of the heat pump, and the heat pump heating system. By using the analytical optimization procedure and the objective function, as the result, the local and the total energy optimum conditions with respect to the mass flow rate of hot and cold water i. e. the power of circulation or well pump are defined.

  18. On-line PWR RHR pump performance testing following motor and impeller replacement

    Energy Technology Data Exchange (ETDEWEB)

    DiMarzo, J.T.

    1996-12-01

    On-line maintenance and replacement of safety-related pumps requires the performance of an inservice test to determine and confirm the operational readiness of the pumps. In 1995, major maintenance was performed on two Pressurized Water Reactor (PWR) Residual Heat Removal (RHR) Pumps. A refurbished spare motor was overhauled with a new mechanical seal, new motor bearings and equipped with pump`s `B` impeller. The spare was installed into the `B` train. The motor had never been run in the system before. A pump performance test was developed to verify it`s operational readiness and determine the in-situ pump performance curve. Since the unit was operating, emphasis was placed on conducting a highly accurate pump performance test that would ensure that it satisfied the NSSS vendors accident analysis minimum acceptance curve. The design of the RHR System allowed testing of one train while the other was aligned for normal operation. A test flow path was established from the Refueling Water Storage Tank (RWST) through the pump (under test) and back to the RWST. This allowed staff to conduct a full flow range pump performance test. Each train was analyzed and an expression developed that included an error vector term for the TDH (ft), pressure (psig), and flow rate (gpm) using the variance error vector methodology. This method allowed the engineers to select a test instrumentation system that would yield accurate readings and minimal measurement errors, for data taken in the measurement of TDH (P,Q) versus Pump Flow Rate (Q). Test results for the `B` Train showed performance well in excess of the minimum required. The motor that was originally in the `B` train was similarly overhauled and equipped with `A` pump`s original impeller, re-installed in the `A` train, and tested. Analysis of the `A` train results indicate that the RHR pump`s performance was also well in excess of the vendors requirements.

  19. Manufacturing Hydraulic Components for the Primary Double Entry S-Pump Model

    Directory of Open Access Journals (Sweden)

    S. Iu. Kuptsov

    2015-01-01

    Full Text Available The article describes a new design of the primary pump to run in powerful units (more than 1 GW of power plants. The new construction has some advantages such as compactness, theoretical lack of radial and axial forces, and high efficiency in a wide range of flow. The abovementioned advantages can be possible owing to applying an innovative shape of the pump flow path. An impeller with the guide vanes forms the three-row single stage in the each row axial double entry blade system. The inlet and outlet parts have a shape of the involute that can ensure (according to calculated data the efficiency and stability in a wide range of flow because of a lack of the spiral parts. The results of numerical calculations of the pump working flow theoretically confirm that demanding parameters of the pump (H=286 m; Q=1,15 m3 /s can be obtained with competitive efficiency. To verify the proposed advantages of the construction, there was decision made to conduct the real physical experiment. For this purpose the small model of a real pump was designed with parameters H=14 m, Q=13 l/s. Construction of the pump model has a cartridge conception. In addition, there is a possibility for quick replacement of the some parts of the blade system in case of operational development of the pump. In order to obtain hydraulic characteristics of the pump to say nothing of the electromotor the torque gauge coupling is used. Numerical calculations for the pump model were also performed which confirm the operability. For manufacturing of the blade system the new perspective technology is applied. The main hydraulic components (impellers and guide vanes are made of ABS plastic by using 3D-printer. According to this technology parts are made layer by layer by means of welded plastic filament. Using this method the satisfactory tolerance (approximately ±0,3 mm of the parts was obtained. At that moment, it is possible to create the parts with the maximum size no higher than 150 mm

  20. Procurement specification high vacuum test chamber and pumping system

    International Nuclear Information System (INIS)

    1976-01-01

    The specification establishes requirements for a high-vacuum test chamber, associated vacuum pumps, valves, controls, and instrumentation that shall be designed and fabricated for use as a test chamber for testing a closed loop Brayton Isotope Power System (BIPS) Ground Demonstration System (GDS). The vacuum system shall include all instrumentation required for pressure measurement and control of the vacuum pumping system. A general outline of the BIPS-GDS in the vacuum chamber and the preliminary piping and instrumentation interface to the vacuum chamber are shown

  1. Functional requirements for portable exhauster system to be used during saltwell pumping

    International Nuclear Information System (INIS)

    Nelson, O.D.

    1998-01-01

    This document defines functional requirements for portable exhausters used to ventilate primary tanks during saltwell pumping, and provide back-up to primary and annulus ventilation systems at C-106 and AY-102

  2. Glutathione S-Transferase Gene Polymorphisms: Modulator of Genetic Damage in Gasoline Pump Workers.

    Science.gov (United States)

    Priya, Kanu; Yadav, Anita; Kumar, Neeraj; Gulati, Sachin; Aggarwal, Neeraj; Gupta, Ranjan

    2015-01-01

    This study investigated genetic damage in gasoline pump workers using the cytokinesis blocked micronucleus (CBMN) assay. Blood and urine samples were collected from 50 gasoline pump workers and 50 control participants matched with respect to age and other confounding factors except for exposure to benzene through gasoline vapors. To determine the benzene exposure, phenol was analyzed in urinary samples of exposed and control participants. Urinary mean phenol level was found to be significantly high (P gasoline pump workers (6.70 ± 1.78) when compared to control individuals (2.20 ± 0.63; P gasoline vapors can increase genotoxic risk in gasoline pump workers. © The Author(s) 2015.

  3. Advanced Instrumentation for Measuring Fluid-Structure Coupling Phenomena in the Guide Vanes Cascade of a Pump-Turbine Scale Model

    OpenAIRE

    Roth, Steven; Hasmatuchi, Vlad; Botero, Francisco; Farhat, Mohamed; Avellan, François

    2010-01-01

    In the present study, the fluid-structure coupling is investigated in the guide vanes of a pump-turbine scale model placed in one of the test rigs of the Laboratory for Hydraulic Machines (EPFL) in Lausanne. The paper focuses on the advanced instrumentation used to get reliable and complete fluid-structure coupling results. Semi-conductor strain gages are installed on three guide vanes which are especially weakened to account for stronger fluid-structure coupling phenomena. These are statical...

  4. Scaling of an Optically Pumped Mid-Infrared Rubidium Laser

    Science.gov (United States)

    2015-03-26

    beam, and the saturation intensity, Isat , was calculated using Equation 4.6: = ℎ( + ) , (6) where h is the...4.91 mm2, the intensity of the laser at a pump energy of 0.05 mJ was 10.2 mW/cm2. Thus I/ Isat ~ 290, so ∆νsat should have been about 17 times... Isat ~ 5796, so ∆νsat should have been about 76∆νD, in reasonable agreement with the experimental result of 53∆νD. Rb Laser Output Energy vs. Pump

  5. 5 CFR 730.102 - Definitions.

    Science.gov (United States)

    2010-01-01

    ...) NOTIFICATION OF POST-EMPLOYMENT RESTRICTIONS § 730.102 Definitions. Agency means an Executive agency as defined in 5 U.S.C. 105, but does not include the General Accounting Office. Senior executive means a member... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Definitions. 730.102 Section 730.102...

  6. Microscale Thermal-Transpiration Gas Pump

    Science.gov (United States)

    Vargo, Stephen; Muntz, Phillip; Shiflett, Geoff

    2003-01-01

    A recent addition to the growing class of microelectromechanical systems (MEMS) is a single stage of a Knudsen compressor. This device was fabricated and tested to demonstrate the feasibility of Knudsen compressors as miniature vacuum pumps for future portable scientific instruments. The attributes of Knudsen compressors that make them attractive as miniature vacuum pumps are that they contain no moving parts and operate without need for lubricants or working fluids.

  7. An Evaluation of Power Fluidics Mixing and Pumping for Application in the Single Shell Tank (SST) Retrieval Program

    International Nuclear Information System (INIS)

    CRASS, D.W.

    2001-01-01

    This document is being released for information only. It provides an explanation of fluidics pumping and mixing technology and explores the feasibility of using fluidics technology for the retrieval of S102. It concludes that there are no obvious flaws that would prevent deploying the technology and recommends further development of fluidics technology as a retrieval option. The configuration described herein does not represent the basis for project definition

  8. 17 CFR 248.102 - Examples.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Examples. 248.102 Section 248... AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.102 Examples. The examples in this subpart are not exclusive. The examples in this subpart provide guidance concerning the rules' application...

  9. Pump limiter studies in Tore Supra

    International Nuclear Information System (INIS)

    Chatelier, M.; Bonnel, P.; Bruneau, J.L.; Gil, C.; Grisolia, C.; Loarer, T.; Martin, G.; Pegourie, B.; Rodriguez, L.

    1991-01-01

    The aim of the Tore Supra pump limiter program is to study particle exhaust with a pump limiter system in long-pulse discharges with continuous pellet fueling and strong auxiliary heating. The pump limiter system consists of six vertical modules, located at the bottom of the machine, and one horizontal module at the outer midplane. The instrumentation of the limiter included pressure gauges, a residual gas analyser Langmuir probes, a spectrometer and water calorimeters. Initial results in low-density discharges, with the outboard limiter only, showed a modest effect on the plasma density, while large exhaust fluxes were measured in the pump limiter, without any external fueling

  10. Problems in instrumentation for S-odorant emissions

    International Nuclear Information System (INIS)

    Hall, H.J.

    1974-01-01

    Instrumentation to measure sulfur-containing odorants in stack emissions is much more difficult than in the ambient atmosphere, and must be matched to the specific source: key components aside from H 2 S are methyl mercaptan in paper mills, COS/CS 2 in a refinery Claus plant, and SO 2 /SO 3 in a combustion stack. Satisfactory operation for a period of six months was not achieved by any instrument in this service, in a lab and field evaluation of eight instruments of three types commercially available as of 1971. The effects of interferent gases H 2 O, SO 2 , CO 2 /CO and particulates which are diluted in ambient samples are greatly aggravated in stack gases, where the ratio of odorant to interferent may be 1:1000 or less, due to the very great sensitivity of human receptors to S-odorants. The most serious problem proved to be the analysis for odorless carbonyl sulfide, which is commonly formed where S compounds are oxidized in a reducing atmosphere. This COS has been undetected or mistaken for odorous H 2 S in most analyses. A field instrument for the general case would provide exactly simultaneous readings at five minute intervals or less for the five components H 2 S, SO 2 , COS, CSH, and total S, or their equivalent. This may be simplified to four components or less only when the composition of the sample gas is positively known

  11. Analysis of the effects of corrosion probe on riser 241-AN-102-WST-16 during seismic event

    International Nuclear Information System (INIS)

    ZIADA, H.H.

    1998-01-01

    This analysis supports the installation activity of the corrosion probe in Tank 241-AN-102. The probe is scheduled to be installed in Riser 241-AN-102-WST-16 (formerly known as Riser 15B). The purpose of this analysis is to evaluate the potential effect of the corrosion probe on the riser during a credible seismic event. The previous analysis (HNF 1997a) considered only pump jet impingement loading

  12. Comparison of infusion pumps calibration methods

    Science.gov (United States)

    Batista, Elsa; Godinho, Isabel; do Céu Ferreira, Maria; Furtado, Andreia; Lucas, Peter; Silva, Claudia

    2017-12-01

    Nowadays, several types of infusion pump are commonly used for drug delivery, such as syringe pumps and peristaltic pumps. These instruments present different measuring features and capacities according to their use and therapeutic application. In order to ensure the metrological traceability of these flow and volume measuring equipment, it is necessary to use suitable calibration methods and standards. Two different calibration methods can be used to determine the flow error of infusion pumps. One is the gravimetric method, considered as a primary method, commonly used by National Metrology Institutes. The other calibration method, a secondary method, relies on an infusion device analyser (IDA) and is typically used by hospital maintenance offices. The suitability of the IDA calibration method was assessed by testing several infusion instruments at different flow rates using the gravimetric method. In addition, a measurement comparison between Portuguese Accredited Laboratories and hospital maintenance offices was performed under the coordination of the Portuguese Institute for Quality, the National Metrology Institute. The obtained results were directly related to the used calibration method and are presented in this paper. This work has been developed in the framework of the EURAMET projects EMRP MeDD and EMPIR 15SIP03.

  13. First pump limiter experiments in TORE SUPRA

    International Nuclear Information System (INIS)

    Chatelier, M.; Klepper, C.C.; Bruneau, J.L.; Chappuis, P.; Gil, C.; Guilhem, D.; Lipa, M.; Rodriguez, L.; Vallet, J.C.; Van Houtte, D.; Watkins, J.G.

    1989-01-01

    The operation of TORE SUPRA at full power (25MW, 30s) has led to the design of a full set of actively pumped carbon limiters to remove at least 8MW and to partially control the particle balance. An interim version is now installed, composed of 5 vertical and one horizontal outboard (OPL) pump limiters, semi-inertially water cooled. The latter is a result of a collaboration between the US DOE and the Association EUR-CEA, it is fully instrumented and therefore can serve as a reference for the final design. Ohmic discharges (1.85T, 740kA, 8.5s) in helium have been used to test the thermal load on and the particle exhaust efficiency of the OPL. In these experiments the plasma is formed on the inner wall (R = 232 cm, a = 76 cm) and subsequently displaced (6 cm) outward, early on the current plateau, to lean on the OPL (R = 238 cm, a = 75 cm). In addition to the limiters above, a non-pumped outboard (ONLP) limiter of identical shape to the OPL served to produce similar discharges for better comparison and determination of particle control. A comparison is made hereafter of the thermal load and particle pumping effects on the OPL when the plasma is in contact either with the OPL/ONPL alone or with the OPL and the vertical limiters together. 3 refs., 1 fig., 2 tabs

  14. Particle exhaust studies in Tore Supra with a pump limiter

    International Nuclear Information System (INIS)

    Klepper, C.C.; Haste, G.R.; Horton, L.D.; Mioduszewski, P.K.; Uckan, T.; Bonnel, P.; Bruneau, J.L.; Chatelier, M.; Gil, C.; Grisolia, C.; Loarer, T.; Martin, G.; Pegourie, B.; Rodriguez, L.; Watkins, J.G.

    1990-01-01

    The aim of the Tore Supra pump limiter program is to study particle exhaust with a pump limiter system in long-pulse discharges with continuous pellet fueling and strong auxiliary heating. The pump limiter system consists of six vertical modules, located at the bottom of the machine, and one horizontal module at the outer midplane. The results presented here were obtained with the horizontal module only. This module was equipped with two titanium pumps with a total pumping speed of 100000 L/s. The instrumentation of the limiter included pressure gauges, a residual gas analyzer, Langmuir probes, a spectrometer viewing the neutralizer plate for H α and impurity measurements, and water calorimeters. All diagnostics have been commissioned and are operational. Initial results were obtained in low-density discharges, with no gas puffing during the shot. While only a modest effect on the plasma density was observed, large exhaust fluxes were measured in the pump limiter. The most likely source of this gas was outgassing of the graphite walls. Straightforward particle balance between the plasma efflux and the pump limiter exhaust, as applied in previous pump limiter experiments, did not apply. The core plasma and the edge plasma seemed to be largely decoupled and a multi-layer model is being developed to explain the experimental results. (orig.)

  15. High-energy high-efficiency Nd:YLF laser end-pump by 808 nm diode

    Science.gov (United States)

    Ma, Qinglei; Mo, Haiding; Zhao, Jay

    2018-04-01

    A model is developed to calculate the optimal pump position for end-pump configuration. The 808 nm wing pump is employed to spread the absorption inside the crystal. By the optimal laser cavity design, a high-energy high-efficiency Nd:YLF laser operating at 1053 nm is presented. In cw operation, a 13.6 W power is obtained with a slope efficiency of 51% with respect to 30 W incident pump power. The beam quality is near diffraction limited with M2 ∼ 1.02. In Q-switch operation, a pulse energy of 5 mJ is achieved with a peak power of 125 kW at 1 kHz repetition rate.

  16. Advancement of High Power Quasi-CW Laser Diode Arrays For Space-based Laser Instruments

    Science.gov (United States)

    Amzajerdian, Farzin; Meadows, Byron L.; Baker, nathaniel R.; Baggott, Renee S.; Singh, Upendra N.; Kavaya, Michael J.

    2004-01-01

    Space-based laser and lidar instruments play an important role in NASA s plans for meeting its objectives in both Earth Science and Space Exploration areas. Almost all the lidar instrument concepts being considered by NASA scientist utilize moderate to high power diode-pumped solid state lasers as their transmitter source. Perhaps the most critical component of any solid state laser system is its pump laser diode array which essentially dictates instrument efficiency, reliability and lifetime. For this reason, premature failures and rapid degradation of high power laser diode arrays that have been experienced by laser system designers are of major concern to NASA. This work addresses these reliability and lifetime issues by attempting to eliminate the causes of failures and developing methods for screening laser diode arrays and qualifying them for operation in space.

  17. Acceptance test report: Field test of mixer pump for 241-AN-107 caustic addition project

    International Nuclear Information System (INIS)

    Leshikar, G.A.

    1997-01-01

    The field acceptance test of a 75 HP mixer pump (Hazleton serial number N-20801) installed in Tank 241-AN-107 was conducted from October 1995 thru February 1996. The objectives defined in the acceptance test were successfully met, with two exceptions recorded. The acceptance test encompassed field verification of mixer pump turntable rotation set-up and operation, verification that the pump instrumentation functions within established limits, facilitation of baseline data collection from the mixer pump mounted ultrasonic instrumentation, verification of mixer pump water flush system operation and validation of a procedure for its operation, and several brief test runs (bump) of the mixer pump

  18. 39 CFR 10.2 - Advisory service.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Advisory service. 10.2 Section 10.2 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE RULES OF CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.2 Advisory service. (a) The General Counsel is the Ethical...

  19. Mixer pump test plan for double shell tank AZ-101

    International Nuclear Information System (INIS)

    STAEHR, T.W.

    1999-01-01

    Mixer pump systems have been chosen as the method for retrieval of tank wastes contained in double shell tanks at Hanford. This document describes the plan for testing and demonstrating the ability of two 300 hp mixer pumps to mobilize waste in tank AZ-101. The mixer pumps, equipment and instrumentation to monitor the test were installed by Project W-151

  20. Innovative application of air ejector as a pump for continuous air monitors

    International Nuclear Information System (INIS)

    Dhanasekaran, A.; Ajoy, K.C.; Santhanam, R.; Rajagopal, V.; Jose, M.T.

    2016-01-01

    Workplace monitoring, one of the key components of the radiation protection program is generally carried out by means of instruments installed permanently in respective areas or through portable air sampling instruments. Continuous air monitor (CAM) is one such monitor that constantly monitors the radionuclide concentration in air and triggers alarm as and when the air concentration goes above the pre-set levels. Conventional CAM system has a filter head, detector, display unit and a pump as four major parts. Pump may be either rotary vane or a vibrating diaphragm which are electrically driven using motors. Air lift pumps using ejectors are widely used where pump reliability and low maintenance are required, and where corrosive, abrasive, or radioactive fluids are handled. Since ejectors are uncomplicated alternative to vacuum pumps, an attempt was made to use the same as a pump for conventional CAMs. An ejector based sampling set up was made, tested and the results are represented in this paper

  1. On-line vibration monitoring for submerged vertical shaft pumps: Final report

    International Nuclear Information System (INIS)

    Walter, T.J.; Marchione, M.M.

    1988-03-01

    The overall goal of this project was to extend to vertical pumps the capability that presently exists to monitor and diagnose vibration problems in horizontal pumps. Specific objectives included the development of analytical techniques to interpret vibration measurements, the verification of these techniqeus by in-plant tests, and the development of recommendations for procuring submergible vibration sensors. A concurrent analytical and experimental approach was used to accomplish these objectives. Rotordynamic analyses of selected pumps were accomplished, and each pump was instrumented and monitored for extended periods of time. The models were used to determine important frequencies and optimum sensor locations and to predict the effect that wear, imbalance, misalighment, and other mechanical changes would have on measured vibration. The predictive ability of the models was confirmed by making changes to instrumented pumps and observing actual changes in pump vibration. Simplified guidelines have been developed to assist the interested user to develop a computer model that realistically predicts the rotordynamic performance of the installed pump. Based on the work accomplished, typical sensor locations have been established. Experience gained in application of commercially available submergible sensors is also related. 11 refs., 11 figs

  2. 48 CFR 901.102 - Authority.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Authority. 901.102 Section... REGULATIONS SYSTEM Purpose, Authority, Issuance 901.102 Authority. The DEAR and amendments thereto are issued... the authority of section 644 of the Department of Energy Organization Act (42 U.S.C. 7254), section...

  3. Standard Glbbs Energy of Formation of the Hydroxyl Radical in Aqueous Solution. Rate Constants for the Reaction C102- -t O3 S 03- -t CIO,

    DEFF Research Database (Denmark)

    Klaning, U. K.; Sehested, Knud; Holcman, J.

    1985-01-01

    The rate constants of the following reactions were determined by pulse radiolysis and stopped-flow experiments: C102- + O3 + C102 + 03-(k f= (4 f 1) X lo6 dm3 mol-' s-', k, = (1.8 f 0.2) X lo5 dm3 mol-' s-]); C102 + OH - C103- + H+ (k = (4.0 * 0.4) X lo9 dm3 mol-' s-l); C102 + 0- - C103- (k = (2.......7 * 0.4) X lo9 dm3 mol-' s-l); and O3 + C102 - C103 + O2 (k = (1.05 f 0.10) X lo3 dm3 mol-l s-'), where kf is the forward rate of reaction and k, is the reverse rate of reaction. The standard Gibbs energy of formation of OH in aqueous solution A&O,,(OH) and the corresponding standard oxidation potential...

  4. STS-55 crewmembers repair waste water tank on OV-102's middeck

    Science.gov (United States)

    1993-01-01

    Three STS-55 crewmembers participate in an inflight maintenance (IFM) exercise to counter problems experienced with a waste water tank below Columbia's, Orbiter Vehicle (OV) 102's, middeck. Mission Specialist 3 (MS3) Bernard A. Harris, Jr, inside the airlock, holds middeck floor access panel MD54G and looks below at Pilot Terence T. Henricks who is in the bilge area. Commander Steven R. Nagel is lying on middeck floor at the left.

  5. Considerations for reference pump curves

    International Nuclear Information System (INIS)

    Stockton, N.B.

    1992-01-01

    This paper examines problems associated with inservice testing (IST) of pumps to assess their hydraulic performance using reference pump curves to establish acceptance criteria. Safety-related pumps at nuclear power plants are tested under the American Society of Mechanical Engineers (ASME) Boiler and Pressure Vessel Code (the Code), Section 11. The Code requires testing pumps at specific reference points of differential pressure or flow rate that can be readily duplicated during subsequent tests. There are many cases where test conditions cannot be duplicated. For some pumps, such as service water or component cooling pumps, the flow rate at any time depends on plant conditions and the arrangement of multiple independent and constantly changing loads. System conditions cannot be controlled to duplicate a specific reference value. In these cases, utilities frequently request to use pump curves for comparison of test data for acceptance. There is no prescribed method for developing a pump reference curve. The methods vary and may yield substantially different results. Some results are conservative when compared to the Code requirements; some are not. The errors associated with different curve testing techniques should be understood and controlled within reasonable bounds. Manufacturer's pump curves, in general, are not sufficiently accurate to use as reference pump curves for IST. Testing using reference curves generated with polynomial least squares fits over limited ranges of pump operation, cubic spline interpolation, or cubic spline least squares fits can provide a measure of pump hydraulic performance that is at least as accurate as the Code required method. Regardless of the test method, error can be reduced by using more accurate instruments, by correcting for systematic errors, by increasing the number of data points, and by taking repetitive measurements at each data point

  6. Vertical pump assembly

    International Nuclear Information System (INIS)

    Dohnal, M.; Rosel, J.; Skarka, V.

    1988-01-01

    The mounting is described of the drive assembly of a vertical pump for nuclear power plants in areas with seismic risk. The assembly is attached to the building floor using flexible and damping elements. The design allows producing seismically resistant pumps without major design changes in the existing types of vertical pumps. (E.S.). 1 fig

  7. Roger Long’s gut-strung keyboard instruments and Thomas Barton’s harpsichord stringing

    OpenAIRE

    Rowland, David

    2016-01-01

    In 1720 Pepusch signed an inventory of the Duke of Chandos’s instruments that included a gut-strung harpsichord by a ‘Mr Longfellow of Pembroke Hall in Cambridge’. The maker was in fact Roger Long, Fellow and later Master of Pembroke Hall (now Pembroke College), Lowndes Professor of Astronomy, but also a keen musician and maker of astronomical, musical and other instruments. Long’s commonplace book in Pembroke’s library contains valuable information about gut and wire harpsichord stringing fr...

  8. Test specification for decant pump and winch assembly. Revision 2

    International Nuclear Information System (INIS)

    Staehr, T.W.

    1995-01-01

    This specification provides the requirements for testing of the vertical turbine decant pump including the floating suction with load sensing winch control, instrumentation and the associated PLC/PC control system. All assembly necessary for testing including piping, temporary wiring, etc., shall be performed by the Seller. All referenced figures are at the back of this document. The testing consists of performance testing, winch testing and calibration, instrumentation verification testing and run-in testing of the pump. Testing shall be done in the presence and under the direction of the Buyer in accordance with this procedure

  9. Pumping of methane by an ionization assisted Zr/Al getter pump

    International Nuclear Information System (INIS)

    Shen, G.L.

    1987-01-01

    The pumping of methane by an ionization assisted Zr/Al getter pump has been investigated. This pump consists of 12 pieces of ring getters. A spiral shape W filament is located within the ring getters. A bias voltage is applied across the filament and the getter itself. The experiments have shown that (1) when the bias voltage is turned off, the pumping speed of the getter pump for methane increases exponentially with the filament temperature; (2) when the filament temperature is held constant, its pumping speed varies directly with the ionization electron current; (3) when the filament temperature is 2063 0 C and the electron current is 57 mA, the pumping speed of the Zr/Al getter pump is 475 ml/s, and the specific speed is 16.8 ml/s cm 2 ; and (4) an activation energy and critical temperature measured for methane molecules decomposition are, respectively, 47.4 kcal/mol and about 1700 0 C. Analysis of the results indicates that methane is pumped by an ionization assisted Zr/Al getter pump not because of the adsorption and the diffusion of methane molecules directly, but because methane molecules are decomposed as C and H 2 through a catalysis of the hot W filament, carbon is adsorbed on the surface of the W filament, and is diffused into the interior of the W lattice. H 2 is immediately absorbed by the Zr/Al getters. Besides, electron impact with CH 4 would result in the additional decomposition and ionization, then the effect of electron bombardment enhances methane pumping by the Zr/Al getters

  10. Vapor space characterization of waste tank 241-S-102: Results from samples collected on 3/14/95

    International Nuclear Information System (INIS)

    Pool, K.H.; McVeety, B.D.; Clauss, T.W.

    1995-10-01

    This report describes inorganic and organic analyses results from samples obtained from the headspace of the Hanford waste storage Tank 241-S-102 (referred to as Tank S-102). The results described here were obtained to support safety and toxicological evaluations. A summary of the results for inorganic and organic analytes is listed in Table 1. Detailed descriptions of the results appear in the text. Quantitative results were obtained for the inorganic compounds ammonia (NH 3 ), nitrogen dioxide (NO 2 ), nitric oxide (NO), and water (H 2 O). Sampling for hydrogen cyanide (HCN) and sulfur oxides (SO x ) was not requested. In addition, quantitative results were obtained for the 39 TO-14 compounds plus an additional 14 analytes. Of these, 11 were observed above the 5-ppbv reporting cutoff. Eleven tentatively identified compounds (TICs) were observed above the reporting cutoff of (ca.) 10 ppbv and are reported with concentrations that are semiquantitative estimates based on internal-standard response factors. The 10 organic analytes with the highest estimated concentrations are listed in Table 1 and account for approximately 95% of the total organic components in Tank S-102. Two permanent gases, hydrogen (H 2 ) and nitrous oxide (N 2 O), were also detected

  11. Design review report, 241-S-102 cover plate review; TOPICAL

    International Nuclear Information System (INIS)

    ADAMS, M.R.

    1998-01-01

    The design for the cover plate and lead plate for shielding on 241-S-102 was reviewed on 10/21/98. All Review Comment Record comments were resolved to the satisfaction of the reviewers. Additional comments were taken during the meeting and were also resolved. A design calculation for the Radiological Design Review Screening was presented as criteria for the use of 1 inch lead plate. The review concluded that the use of 2 inch steel plate and 1 inch lead plate provided the required safety function required by HNF-SD-WM-810-001, 5.3.2.20, Basis for Interim Operation. The design was approved with the incorporated comments as recorded on RCR's and meeting minutes

  12. 19 CFR 102.23 - Origin and Manufacturer Identification

    Science.gov (United States)

    2010-04-01

    ... Section 102.23 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... address of the entity performing the origin-conferring operations pursuant to § 102.21 or § 102.22, as... product from CBP custody will be denied until a determination of the country of origin is made based upon...

  13. Active magnetic bearings: As applied to centrifugal pumps

    Science.gov (United States)

    Nelik, Lev; Cooper, Paul; Jones, Graham; Galecki, Dennis; Pinckney, Frank; Kirk, Gordon

    1992-05-01

    Application of magnetic bearings to boiler feed pumps presents various attractive features, such as longer bearing life, lower maintenance costs, and improved operability through control of the rotordynamics. Magnetic bearings were fitted to an eight-stage, 600 hp boiler feed pump, which generates 2600 ft of heat at 680 gpm and 3560 rpm. In addition to the varied and severe operating environment in steady state operation of this pump in a power plant, it is also subjected to transient loads during frequent starts and stops. These loads can now be measured by the in-built instrumentation of the magnetic bearings. Following site installation, a follow-up bearing tune-up was performed, and pump transient response testing was conducted. The bearing response was completely satisfactory, ensuring trouble-free pump operation even in the range of reduced load. The experience gained so far through design and testing proves feasibility of magnetic bearings for boiler feed pumps, which sets the stage for application of even higher energy centrifugal pumps equipped with magnetic bearings.

  14. Test specification for decant pump and winch assembly

    International Nuclear Information System (INIS)

    Staehr, T.W.

    1994-01-01

    This specification provides the requirements for testing of the vertical turbine decant pump including the floating suction arm with load sensing winch control, instrumentation and the associated PLC/PC control system

  15. Electromagnetic pump technology

    International Nuclear Information System (INIS)

    Prabhakar, R.

    1994-01-01

    Fast Breeder Reactors have an important role to play in our nuclear power programme. Liquid metal sodium is used as the coolant for removing fission heat generated in fast reactors and a distinctive physical property of sodium is its high electrical conductivity. This enables application of electromagnetic (EM) pumps, working on same principle as electric motors, for pumping liquid sodium. Due to its lower efficiency as compared to centrifugal pumps, use of EM pumps has been restricted to reactor auxiliary circuits and experimental facilities. As part of our efforts to manufacture fast reactor components indigenously, work on the development of two types of EM pumps namely flat linear induction pump (FLIP) and annular linear induction pump (ALIP) has been undertaken. Design procedures based on an equivalent circuit approach have been established and results from testing a 5.6 x 10E-3 Cum/s (20 Cum/h) FLIP in a sodium loop were used to validate the procedure. (author). 7 refs., 6 figs

  16. STS-55 crewmembers repair waste water tank under OV-102's middeck subfloor

    Science.gov (United States)

    1993-01-01

    STS-55 Pilot Terence T. Henricks uses a spotlight and pen to point out a possible problem area on a waste water tank in the bilge area below Columbia's, Orbiter Vehicle (OV) 102's, middeck. Mission Specialist 1 (MS1) and Payload Commander (PLC) Jerry L. Ross records the activity with a video camcorder. The crewmembers are participating in an inflight maintenance (IFM) exercise to counter problems experienced with the waste water tank.

  17. JET pump limiter

    International Nuclear Information System (INIS)

    Sonnenberg, K.; Deksnis, E.; Shaw, R.; Reiter, D.

    1988-01-01

    JET plans to install two pump limiter modules which can be used for belt-limiter, inner-wall and X-point discharges and, also, for 1-2s as the main limiter. A design is presented which is compatible with two diagnostic systems, and which allows partial removal of the pump limiter to provide access for remote-handling operations. The high heat-flux components are initially cooled during a pulse. Heat is removed between discharges by radiation and pressure contacts to a water-cooled support structure. The pumping edge will be made of annealed pyrolytic graphite. Exhaust efficiency has been estimated, for a 1-d edge model, using a Monte-Carlo calculation of neutral gas transport. When the pump limiter is operated together with other wall components we expect an efficiency of ≅ 5% (2.5 x 10 21 part/s). As a main limiter the efficiency increases to about 10%. (author)

  18. Temperature-Induced Wavelength Shift of Electron-Beam-Pumped Lasers from CdSe, CdS, and ZnO

    DEFF Research Database (Denmark)

    Hvam, Jørn Märcher

    1971-01-01

    Experimental results on the temperature dependence of the laser frequency and threshold pump power are presented in the range from liquid helium to room temperature for electron-beam-pumped CdSe, CdS, and ZnO lasers. A linear shift of the laser frequency at high temperatures and a relatively slow...

  19. News from heat-pump research - Large-scale heat pumps, components, heat pumps and solar heating; News aus der Waermepumpen-Forschung - Gross-Waermepumpen, Komponenten, Waermepumpe und Solar

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-06-15

    These proceedings summarise the presentations made at the 16{sup th} annual meeting held by the Swiss Federal Office of Energy's Heat Pump Research Program in Burgdorf, Switzerland. The proceedings include contributions on large-scale heat pumps, components and the activities of the heat pump promotion society. A summary of targets and trends in energy research in general is presented and an overview of the heat pump market in 2009 and future perspectives is given. International work within the framework of the International Energy Agency's heat pump group is reviewed, including solar - heat pump combinations. Field-monitoring and the analysis of large-scale heat pumps are discussed and the importance of the use of correct concepts in such installations is stressed. Large-scale heat pumps with carbon dioxide as working fluid are looked at, as are output-regulated air/water heat pumps. Efficient system solutions with heat pumps used both to heat and to cool are discussed. Deep geothermal probes and the potential offered by geothermal probes using carbon dioxide as a working fluid are discussed. The proceedings are rounded off with a list of useful addresses.

  20. Miniature Scroll Pumps Fabricated by LIGA

    Science.gov (United States)

    Wiberg, Dean; Shcheglov, Kirill; White, Victor; Bae, Sam

    2009-01-01

    Miniature scroll pumps have been proposed as roughing pumps (low - vacuum pumps) for miniature scientific instruments (e.g., portable mass spectrometers and gas analyzers) that depend on vacuum. The larger scroll pumps used as roughing pumps in some older vacuum systems are fabricated by conventional machining. Typically, such an older scroll pump includes (1) an electric motor with an eccentric shaft to generate orbital motion of a scroll and (2) conventional bearings to restrict the orbital motion to a circle. The proposed miniature scroll pumps would differ from the prior, larger ones in both design and fabrication. A miniature scroll pump would include two scrolls: one mounted on a stationary baseplate and one on a flexure stage (see figure). An electromagnetic actuator in the form of two pairs of voice coils in a push-pull configuration would make the flexure stage move in the desired circular orbit. The capacitance between the scrolls would be monitored to provide position (gap) feedback to a control system that would adjust the drive signals applied to the voice coils to maintain the circular orbit as needed for precise sealing of the scrolls. To minimize power consumption and maximize precision of control, the flexure stage would be driven at the frequency of its mechanical resonance. The miniaturization of these pumps would entail both operational and manufacturing tolerances of pump components. In addition, the vibrations of conventional motors and ball bearings exceed these tight tolerances by an order of magnitude. Therefore, the proposed pumps would be fabricated by the microfabrication method known by the German acronym LIGA ( lithographie, galvanoformung, abformung, which means lithography, electroforming, molding) because LIGA has been shown to be capable of providing the required tolerances at large aspect ratios.

  1. Pumps in wearable ultrafiltration devices: pumps in wuf devices.

    Science.gov (United States)

    Armignacco, Paolo; Garzotto, Francesco; Bellini, Corrado; Neri, Mauro; Lorenzin, Anna; Sartori, Marco; Ronco, Claudio

    2015-01-01

    The wearable artificial kidney (WAK) is a device that is supposed to operate like a real kidney, which permits prolonged, frequent, and continuous dialysis treatments for patients with end-stage renal disease (ESRD). Its functioning is mainly related to its pumping system, as well as to its dialysate-generating and alarm/shutoff ones. A pump is defined as a device that moves fluids by mechanical action. In such a context, blood pumps pull blood from the access side of the dialysis catheter and return the blood at the same rate of flow. The main aim of this paper is to review the current literature on blood pumps, describing the way they have been functioning thus far and how they are being engineered, giving details about the most important parameters that define their quality, thus allowing the production of a radar comparative graph, and listing ideal pumps' features. © 2015 S. Karger AG, Basel.

  2. Sodium pumping: pump problems

    International Nuclear Information System (INIS)

    Guer, M.; Guiton, P.

    Information on sodium pumps for LMFBR type reactors is presented concerning ring pump design, pool reactor pump design, secondary pumps, sodium bearings, swivel joints of the oscillating annulus, and thermal shock loads

  3. Energy recovery on a thermo-refrigerating pump: 56% of saving; Recuperation d'energie sur une thermofrigopompe: 56% d'economie

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2002-12-01

    Air conditioning engineering in medical buildings is characterized by very specific constraints. The quality and safety of the care given to patients depends on the mastery of ambient temperature conditions, hygrometry, and air hygiene. For these reasons, the Protestant hospital of Caluire (69, France) has chosen a thermo-refrigerating pump/heat pump for its air conditioning: simultaneous production of heat and coldness, three modes of operation (winter, summer and mid-seasons), thermal comfort adapted to each type of room, instrumentation for the quantification of the thermal performances of the installation, and 56% of the energy needs are supplied by the energy recovery made on the pump. (J.S.)

  4. Non-preferential fuelling of the Na(+)/K(+)-ATPase pump.

    Science.gov (United States)

    Fernández-Moncada, Ignacio; Barros, L Felipe

    2014-06-15

    There is abundant evidence that glycolysis and the Na(+)/K(+)-ATPase pump are functionally coupled, and it is thought that the nature of the coupling is energetic, with glycolysis providing the ATP that fuels the pump. This notion has been instrumental to current models of brain energy metabolism. However, structural and biophysical considerations suggest that the pump should also have access to mitochondrial ATP, which is much more abundant. In the present study, we have investigated the source of ATP that fuels the Na(+) pump in astrocytes, taking advantage of the high temporal resolution of recently available FRET nanosensors for glucose, lactate and ATP. The activity of the Na(+) pump was assessed in parallel with the Na(+)-sensitive dye SBFI AM (Na(+)-binding benzofuran isophthalate acetoxymethyl ester). OXPHOS (oxidative phosphorylation) inhibition resulted in bulk ATP depletion and a 5-fold stimulation of glycolytic flux, in spite of which Na(+) pumping was inhibited by 90%. Mathematical modelling of ATP dynamics showed that the observed pump failure is inconsistent with preferential fuelling of the Na(+) pump by glycolytic ATP. We conclude that the nature of the functional coupling between the Na(+) pump and the glycolytic machinery is not energetic and that the pump is mainly fuelled by mitochondrial ATP.

  5. High-vacuum plasma pump

    International Nuclear Information System (INIS)

    Dorodnov, A.M.; Minajchev, V.E.; Miroshkin, S.I.

    1980-01-01

    The action of an electric-arc high-vacuum pump intended for evacuating the volumes in which the operation processes are followed by a high gas evolution is considered. The operation of the pump is based on the principle of controlling the getter feed according to the gas load and effect of plasma sorbtion pumping. The pump performances are given. The starting pressure is about 5 Pa, the limiting residual pressure is about 5x10 -6 Pa, the pumping out rate of nitrogen in the pressure range 5x10 -5 -5x10 -3 Pa accounts for about 4000 l/s, the power consumption comes to 6 kW. Analyzing the results of the test operation of the pump, it has been concluded that its principal advantages are the high starting pressure, controlled getter feed rate and possibility of pumping out the gases which are usually pumped out with difficulty. The operation reliability of the pump is defined mainly by reliable operation of the ignition system of the vacuum arc [ru

  6. 41 CFR 102-37.560 - What is a public body?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a public body... PROPERTY Donations to Public Bodies in Lieu of Abandonment/Destruction § 102-37.560 What is a public body? A public body is any department, agency, special purpose district, or other instrumentality of a...

  7. Pumps and pump facilities. 2. ed.

    International Nuclear Information System (INIS)

    Bohl, W.; Bauerfeind, H.; Gutmann, G.; Leuschner, G.; Matthias, H.B.; Mengele, R.; Neumaier, R.; Vetter, G.; Wagner, W.

    1981-01-01

    This book deals with the common fundamental aspects of liquid pumps and gives an exemplary choice of the most important kinds of pumps. The scientific matter is dealt with by means of practical mathematical examples among other ways of presenting the matter. Survey of contents: Division on main operational data of pumps - pipe characteristics - pump characteristics - suction behaviour of the pumps - projecting and operation of rotary pumps - boiler feed pumps - reactor feed pumps - oscillating positive-displacement pumps - eccentric spiral pumps. (orig./GL) [de

  8. Test of a cryogenic helium pump

    International Nuclear Information System (INIS)

    Lue, J.W.; Miller, J.R.; Walstrom, P.L.; Herz, W.

    1981-01-01

    The design of a cryogenic helium pump for circulating liquid helium in a magnet and the design of a test loop for measuring the pump performance in terms of mass flow vs pump head at various pump speeds are described. A commercial cryogenic helium pump was tested successfully. Despite flaws in the demountable connections, the piston pump itself has performed satisfactorily. A helium pump of this type is suitable for the use of flowing supercritical helium through Internally Cooled Superconductor (ICS) magnets. It has pumped supercritical helium up to 7.5 atm with a pump head up to 2.8 atm. The maximum mass flow rate obtained was about 16 g/s. Performance of the pump was degraded at lower pumping speeds

  9. Pumping Characteristics of the DIII-D Cryopump

    International Nuclear Information System (INIS)

    A.S. Bozek; C.B. Baxi; R.W. Callis; M.A. Mahdavi; R.C. O'Neill; E.E. Reis

    1999-01-01

    Beginning in 1992, the first of the DIII-D divertor baffles and cryocondensation pumps was installed. This open divertor configuration, located on the outermost floor of the DIII-D vessel, includes a cryopump with a predicted pumping speed of 50,000 ell/s excluding obstructions such as support hardware. Taking the pump structural and support characteristics into consideration, the corrected pumping speed for D 2 is 30,000 ell/s [1]. In 1996, the second divertor baffle and cryopump were installed. This closed divertor structure, located on the outermost ceiling of the DIII-D vessel, has a cryopump with a predicted pumping speed of 32,000 ell/s. In the fall of 1999, the third divertor baffle and cryopump will be installed. This divertor structure will be located on the 45 o angled corner on the innermost ceiling of the DIII-D vessel, known as the private flux region of the plasma configuration. With hardware supports factored into the pumping speed calculation, the private flux cryopump is expected to have a pumping speed of 15,000 ell/s. There was question regarding the effectiveness of the private flux cryopump due to the close proximity of the private flux baffle. This led to a conductance calculation study of the impact of rotating the cryopump aperture by 180 o to allow for greater particle and gas exhaust into the cryopump's helium panel. This study concluded that the cost and schedule impact of changing the private flux cryopump orientation and design did not warrant the possible 20% (3,000 ell/s) increase in pumping ability gained by rotating the cryopump aperture 180 o . The comparison of pumping speed of the first two cryocondensation pumps with the measured results will be presented as well as the calculation of the pumping speed for the private flux cryopump now being installed

  10. Lab-on-a-Chip Instrument Development for Titan Exploration

    Science.gov (United States)

    Willis, P. A.; Greer, F.; Fisher, A.; Hodyss, R. P.; Grunthaner, F.; Jiao, H.; Mair, D.; Harrison, J.

    2009-12-01

    of these stationary phases into microdevices, both by the packing of submicron-sized beads, and by the growth of porous polymer monoliths inside empty channels via a photoinitiated chemical polymerization process. References: 1. “Monolithic photolithographically patterned Fluorocur™ PFPE membrane valves and pumps for in situ planetary exploration”, P. A. Willis et al., Lab Chip 8, 1024 (2008). 2. “The Urey Instrument: An Advanced In Situ Organic and Oxidant Detector for Mars Exploration”, A. Aubrey et al., Astrobiology 8, 583 (2008). 3. “Development and evaluation of a microdevice for amino acid biomarker detection and analysis on Mars” A. M. Skelley et al., PNAS 102, 1041 (2005).

  11. Process Skill Assessment Instrument: Innovation to measure student’s learning result holistically

    Science.gov (United States)

    Azizah, K. N.; Ibrahim, M.; Widodo, W.

    2018-01-01

    Science process skills (SPS) are very important skills for students. However, the fact that SPS is not being main concern in the primary school learning is undeniable. This research aimed to develop a valid, practical, and effective assessment instrument to measure student’s SPS. Assessment instruments comprise of worksheet and test. This development research used one group pre-test post-test design. Data were obtained with validation, observation, and test method to investigate validity, practicality, and the effectivenss of the instruments. Results showed that the validity of assessment instruments is very valid, the reliability is categorized as reliable, student SPS activities have a high percentage, and there is significant improvement on student’s SPS score. It can be concluded that assessment instruments of SPS are valid, practical, and effective to be used to measure student’s SPS result.

  12. Improvement of centrifugal pump performance through addition of splitter blades on impeller pump

    Science.gov (United States)

    Kurniawan, Krisna Eka; Santoso, Budi; Tjahjana, Dominicus Danardono Dwi Prija

    2018-02-01

    The workable way to improve pump performance is to redesign or modify the impellers of centrifugal pump. The purpose of impeller pump modification is to improve pump efficiency, reduce cross flow, reduce secondary incidence flows, and decrease backflow areas at impeller outlets. Number blades and splitter blades in the impeller are three. The outlet blade angle is 20°, and the rotating speed of impeller is 2400 rpm. The added splitter blades variations are 0.25, 0.375, and 0.5 of the original blade length. The splitter blade placements are on the outer side of the impeller. The addition of splitter blades on the outer side of the impeller with 0.5L increases the pump head until 22% and the pump has 38.66% hydraulic efficiency. The best efficiency point of water flow rate pump (Qbep) was 3.02 × 10-3 m3/s.

  13. Development of ceramic vacuum pumps for fusion reactors

    International Nuclear Information System (INIS)

    Anon.

    1990-01-01

    To achieve the magnetic field resistance and tritium resistance which are required for vacuum pumps for fusion reactors, a vacuum pump consisting of middle-ceramic turbo molecular pump (TMP), using ceramic rotor and ceramic turbo roughing pump was developed. In colaboration with the Japan Atomic Energy Research Institute, performance tests on pumping speed, compression ratio of middle-ceramic TMP and both of pumping characteristics were carried out. Sufficient performances were obtained. It was showed that middle-ceramic TMP had pumping speed of more than 500 l/s, and could achieve the pressure below 4 x 10 -7 Pa. Ceramic turbo roughing pump could vacuum from atmospheric pressure. It is concluded that complete oil-free ceramic vacuum pump can be put into practical use (K.S.)

  14. The New S-RAM Air Variable Compressor/Expander for Heat Pump and Waste Heat to Power Application

    Energy Technology Data Exchange (ETDEWEB)

    Dehoff, Ryan R [ORNL; Jestings, Lee [S-RAM Dynamics; Conde, Ricardo [S-RAM Dynamics

    2016-05-23

    S-RAM Dynamics (S-RAM) has designed an innovative heat pump system targeted for commercial and industrial applications. This new heat pump system is more efficient than anything currently on the market and utilizes air as the refrigerant instead of hydrofluorocarbon (HFC) refrigerants, leading to lower operating costs, minimal environmental costs or concerns, and lower maintenance costs. The heat pumps will be manufactured in the United States. This project was aimed at determining the feasibility of utilizing additive manufacturing to make the heat exchanger device for the new heat pump system. ORNL and S-RAM Dynamics collaborated on determining the prototype performance and subsequently printing of the prototype using additive manufacturing. Complex heat exchanger designs were fabricated using the Arcam electron beam melting (EBM) powder bed technology using Ti-6Al-4V material. An ultrasonic welding system was utilized in order to remove the powder from the small openings of the heat exchanger. The majority of powder in the small chambers was removed, however, the amount of powder remaining in the heat exchanger was a function of geometry. Therefore, only certain geometries of heat exchangers could be fabricated. SRAM Dynamics evaluated a preliminary heat exchanger design. Although the results of the additive manufacturing of the heat exchanger were not optimum, a less complex geometry was demonstrated. A sleeve valve was used as a demonstration piece, as engine designs from S-RAM Dynamics require the engine to have a very high density. Preliminary designs of this geometry were successfully fabricated using the EBM technology.

  15. Characterization of the phase composition, crystal structure and superconducting properties of Fe{sub 1.02}Se{sub y}Te{sub 1−y−x}S{sub x}

    Energy Technology Data Exchange (ETDEWEB)

    Abouhaswa, A.S., E-mail: aliabohaswa@hotmail.com [Institute of Natural Sciences, Ural Federal University, 620083, Ekaterinburg (Russian Federation); Merentsov, A.I. [Institute of Natural Sciences, Ural Federal University, 620083, Ekaterinburg (Russian Federation); Baranov, N.V. [Institute of Natural Sciences, Ural Federal University, 620083, Ekaterinburg (Russian Federation); M.N. Miheev Institute of Metal Physics, Ural Branch of RAS, 620990, Ekaterinburg (Russian Federation)

    2016-08-15

    Highlights: • The Fe{sub 1.02}Se{sub 0.5}Te{sub 0.5−x}S{sub x} and Fe{sub 1.02}Se{sub 0.4}Te{sub 0.6−x}S{sub x} samples have been synthesized. • The S for Te substitution results in a small expansion of the crystal lattice of the PbO-type phase. • This expansion is attributed to changes in the phase relation and chemical composition of phases. • There is a correlation between the changes of T{sub c} and lattice parameters of the PbO-type phase. - Abstract: Two series of the Fe{sub 1.02}Se{sub 0.5}Te{sub 0.5–x}S{sub x} (I) and Fe{sub 1.02}Se{sub 0.4}Te{sub 0.6–x}S{sub x} (II) samples with the sulfur for tellurium substitution and with the invariable Se concentrations have been synthesized and studied by means of X-ray diffraction, scanning electron microscopy, electrical resistivity and magnetic susceptibility measurements. The superconducting PbO-type phase is found to persists in the first series up to x = 0.4 and in the second one up to x = 0.5. Despite the lower ionic radius of sulfur in comparison with tellurium the replacement of tellurium by sulfur does not lead to contraction of the unit cell volume of the superconducting phase in both I and II series with ternary mixture of chalcogens. Variations of the lattice parameters caused by the S for Te substitution in the Fe{sub 1.02}Se{sub 0.5}Te{sub 0.5–x}S{sub x} and Fe{sub 1.02}Se{sub 0.4}Te{sub 0.6–x}S{sub x} samples are found to be less pronounced than that reported for the Fe{sub 1.02}Te{sub 0.5}Se{sub 0.5-x}S{sub x} system and are accompanied by lowering of the critical temperature. The behavior of the lattice parameters and critical temperature of Fe(S,Se,Te) materials with the ternary mixture of chalcogens at substitutions is ascribed to the changes in the volume fraction and chemical compositions of the coexisting tetragonal and hexagonal phases.

  16. Indigenously developed large pumping speed cryoadsorption cryopump

    International Nuclear Information System (INIS)

    Gangradey, Ranjana; Mukherjee, Samiran Shanti; Agarwal, Jyoti

    2015-01-01

    Indigenous cryoadsorption cryopump with large pumping speeds for fusion reactor application has been developed at the Institute for Plasma Research (IPR). Towards its successful realization, technological bottlenecks were identified, studied and resolved. Hydroformed cryopanels were developed from concept leading to the design and product realization with successful technology transfer to the industry. This has led to the expertise for developing hydroformed panels for any desired shape, geometry and welding pattern. Activated sorbents were developed, characterized using an experimental set up which measures adsorption isotherms down to 4K for hydrogen and helium. Special techniques were evolved for coating sorbents on hydroformed cryopanels with suitable cryo-adhesives. Various arrangements of cryopanels at 4 K surrounded by 80 K shields and baffles (which are also hydroformed) were studied and optimized by transmission probability analysis using Monte Carlo techniques. CFD analysis was used to study the temperature distribution and flow analysis during the cryogen flow through the panels. Integration of the developed technologies to arrive at the final product was a challenging task and this was meticulously planned and executed. This resulted in a cryoadsorption cryopump offering pumping speeds as high as 50,000 to 70,000 1/s for helium and 1,50,000 1/s for hydrogen with a 3.2 m 2 of sorbent panel area. The first laboratory scale pump integrating the developed technologies was a Small Scale CryoPump (SSCP-01) with a pumping speed of 2,000 1/s for helium. Subsequently, Single Panel CryoPump (SPCP-01) with pumping speed 10,000 1/s for helium and a Multiple Panel CryoPump (MPCP-08) with a pumping speed of 70,000 1/s for helium and 1,50,000 1/s for hydrogen respectively were developed. This paper describes the efforts in realizing these products from laboratory to industrial scales. (author)

  17. Electromagnetic pump

    International Nuclear Information System (INIS)

    Ito, Koji; Suetake, Norio; Aizawa, Toshie; Nakasaki, Masayoshi

    1998-01-01

    The present invention provides an electromagnetic pump suitable to a recycling pump for liquid sodium as coolants of an FBR type reactor. Namely, a stator module of the electromagnetic pump of the present invention comprises a plurality of outer laminate iron core units and outer stator modules stacked alternately in the axial direction. With such a constitution, even a long electromagnetic pump having a large number of outer stator coils can be manufactured without damaging electric insulation of the outer stator coils. In addition, the inner circumferential surface of the outer laminate iron cores is urged and brought into contact with the outer circumferential surface of the outer duct by an elastic material. With such a constitution, Joule loss heat generated in the outer stator coils and internal heat generated in the outer laminate iron cores can be released to an electroconductive fluid flowing the inner circumference of the outer duct by way of the outer duct. (I.S.)

  18. High-power extended cavity laser optimized for optical pumping ot Rb

    Czech Academy of Sciences Publication Activity Database

    Buchta, Zdeněk; Číp, Ondřej; Lazar, Josef

    2007-01-01

    Roč. 18, č. 9 (2007), N77-N80 ISSN 0957-0233 R&D Pro jects: GA ČR GA102/04/2109; GA MŠk(CZ) LC06007; GA AV ČR IAA200650504; GA AV ČR IAA1065303 Institutional research plan: CEZ:AV0Z20650511 Keywords : laser diode * emission linewidth * diffraction grating * optical pumping * spectroscopy Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.297, year: 2007

  19. Decision document for performing a long-term pumping test at the S-3 Site, Oak Ridge Y-12 Plant, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1995-02-01

    One of the principal problems confronting the remediation of Bear Creek Valley is the cleanup of contaminated groundwater. The S-3 Site is one of the locations in the valley where groundwater is most contaminated, and contamination from the S-3 Site has also caused extensive contamination of downgradient groundwater. This groundwater plume, therefore, has a high priority in the Bear Creek Valley remedial process. Pumping and treating groundwater was identified early in the feasibility study as a likely remedial alternative for the S-3 Site groundwater plume. The hydrology and geochemistry of the plume are extremely complex. There is a high degree of uncertainty in the current understanding of how the aquifer will react physically and chemically to pumping, making evaluation of a pump-and-treat alternative impractical at the present time. Before a pump-and-treat alternative can be evaluated, its technical practicability, effectiveness, and projected cost must be determined. A long-term pumping test (LTPT) at the S-3 Site has been proposed so that the information necessary to carry out this evaluation can be collected. This document constitutes the first phase in the planning process for this test

  20. On-Pump Versus Off-Pump Coronary Artery Bypass Surgery in Elderly Patients

    DEFF Research Database (Denmark)

    Houlind, Kim; Kjeldsen, Bo Juul; Madsen, Susanne Nørgaard

    2012-01-01

    BACKGROUND: Conventional coronary artery bypass grafting performed with the use of cardiopulmonary bypass is a well-validated treatment for patients with ischemic heart disease. Off-pump coronary artery bypass grafting (OPCAB) has been suggested to reduce the number of perioperative complications......, especially in elderly patients. METHODS AND RESULTS: In a multicenter, randomized trial, we assigned 900 patients >70 years of age to conventional coronary artery bypass grafting or OPCAB surgery. After 30 days, a blinded end-point committee assessed whether a combined end point of death, stroke...... experiencing the combined end point within 30 days was 10.2% for conventional coronary artery bypass grafting and 10.7% for OPCAB. Implied risk difference of 0.4% (with a 95% confidence interval, -3.6 to 4.4) showed nonsignificance in a standard test for equality (P=0.83) and for noninferiority...

  1. Emergency Diesel: Safety-related instrumentation and control with programmable logic controllers

    International Nuclear Information System (INIS)

    Breidenich, G.; Luedtke, M.

    2004-01-01

    This report presents a new concept for the design of emergency diesel equipment protection circuits as a part of the safety related instrumentation in the nuclear power plant Biblis, units A and B. The concept was implemented with state of the art SIMATIC S7/316 programmable logic controllers (PLCs) and can be adapted to any system with high availability requirements (e.g. power plant turbines, aircraft engines, mining pumps etc). (orig.)

  2. HYPOSTASES OF THE POLYPHONIC TREATMENTS IN GHEORGHE NEAGA’S INSTRUMENTAL CHAMBER MUSIC

    Directory of Open Access Journals (Sweden)

    CHICIUC NATALIA

    2016-06-01

    Full Text Available Gheorghe Neaga’s instrumental chamber music constitutes a rich repertoire with representative works for native academic music. The more so, since from the perspective of composition art, the author tended to the excellence of each element of musical expressiveness. As evidence of this can be considered his instrumental chamber works, including sonatas, suites for various instrumental configurations and instrumental ensembles, and not least, the infinite string of instrumental miniatures. Returning to the musical expressiveness, it is necessary to emphasize the fact that in Gheorghe Neaga’s instrumental chamber music is evident, in a different measure for each work, a polyphonic treatment which can be considered typical of the author. That is why the present article aims to present some principles and techniques used by the composer in his own manner in some of his creations offered as examples.

  3. Diode pumped actively Q-switched Nd:YVO4 self-Raman laser

    International Nuclear Information System (INIS)

    Su Fufang; Zhang Xingyu; Wang Qingpu; Ding Shuanghong; Jia Peng; Li Shutao; Fan Shuzhen; Zhang Chen; Liu Bo

    2006-01-01

    By using Nd:YVO 4 as the gain medium and the Raman medium simultaneously, the actively Q-switched operation of the self-Raman Nd:YVO 4 laser at 1176 nm was realized. The output characteristics including the average power, pulse energy and pulse width versus the incident pump power and pulse repetition rate were investigated. At a pulse repetition rate of 20 kHz an average power up to 0.57 W was obtained with the incident pump power of 10.2 W, corresponding to a conversion efficiency of 5.6% with respect to the diode laser input power. Meanwhile, an analysis of the self-Raman Nd:YVO 4 laser was carried out by using the rate equations. The obtained theoretical results were in agreement with the experimental results on the whole

  4. Organizational, Cultural, and Psychological Determinants of Smart Infusion Pump Work Arounds: A Study of 3 U.S. Health Systems.

    Science.gov (United States)

    Dunford, Benjamin B; Perrigino, Matthew; Tucker, Sharon J; Gaston, Cynthia L; Young, Jim; Vermace, Beverly J; Walroth, Todd A; Buening, Natalie R; Skillman, Katherine L; Berndt, Dawn

    2017-09-01

    We investigated nurse perceptions of smart infusion medication pumps to provide evidence-based insights on how to help reduce work around and improve compliance with patient safety policies. Specifically, we investigated the following 3 research questions: (1) What are nurses' current attitudes about smart infusion pumps? (2) What do nurses think are the causes of smart infusion pump work arounds? and (3) To whom do nurses turn for smart infusion pump training and troubleshooting? We surveyed a large number of nurses (N = 818) in 3 U.S.-based health care systems to address the research questions above. We assessed nurses' opinions about smart infusion pumps, organizational perceptions, and the reasons for work arounds using a voluntary and anonymous Web-based survey. Using qualitative research methods, we coded open-ended responses to questions about the reasons for work arounds to organize responses into useful categories. The nurses reported widespread satisfaction with smart infusion pumps. However, they reported numerous organizational, cultural, and psychological causes of smart pump work arounds. Of 1029 open-ended responses to the question "why do smart pump work arounds occur?" approximately 44% of the causes were technology related, 47% were organization related, and 9% were related to individual factors. Finally, an overwhelming majority of nurses reported seeking solutions to smart pump problems from coworkers and being trained primarily on the job. Hospitals may significantly improve adherence to smart pump safety features by addressing the nontechnical causes of work arounds and by providing more leadership and formalized training for resolving smart pump-related problems.

  5. Pump for extremely dangerous liquids

    Czech Academy of Sciences Publication Activity Database

    Tesař, Václav

    2011-01-01

    Roč. 89, č. 7A (2011), s. 940-956 ISSN 0263-8762 R&D Projects: GA ČR GA101/07/1499; GA AV ČR IAA200760705 Institutional research plan: CEZ:AV0Z20760514 Keywords : pump * jet pump * coanda effect Subject RIV: BK - Fluid Dynamics Impact factor: 1.968, year: 2011 http://www.sciencedirect.com/science/article/pii/S0263876210003631

  6. 14 CFR 1215.102 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... (TDRSS) Use and Reimbursement Policy for Non-U.S. Government Users § 1215.102 Definitions. (a) User. Any non-U.S. Government representative or entity who contracts with NASA to use TDRSS services. (b) TDRSS... user ground system/TDRSS interface. (c) Bit stream. The digital electronic signals acquired by TDRSS...

  7. The ORNL Modulating Heat Pump Design Tool User's Guide

    Energy Technology Data Exchange (ETDEWEB)

    Rice, C.K.

    2001-06-01

    The ORNL Modulating Heat Pump Design Tool consists of a Modulating HPDM (Heat Pump Design Model) and a parametric-analysis (contour-data generating) front-end. Collectively the program is also referred to as MODCON which is in reference to the modulating and the contour data generating capabilities. The program was developed by Oak Ridge National Laboratory for the Department of Energy to provide a publicly-available system design tool for variable- and single-speed heat pumps.

  8. Modelling of capillary Z-pinch recombination pumping of boron extreme ultraviolet laser

    Czech Academy of Sciences Publication Activity Database

    Vrba, Pavel; Bobrova, N. A.; Sasorov, P. V.; Vrbová, M.; Hübner, Jakub

    2009-01-01

    Roč. 16, č. 7 (2009), 073105 1-073105 11 ISSN 1070-664X R&D Projects: GA ČR GA102/07/0275 Institutional research plan: CEZ:AV0Z20430508 Keywords : Boron * capillary * discharges (electric * laser ablation * optical pumping * plasma heating by laser * plasma kinetic theory * plasma magnetohydrodynamics * Z pinch Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.475, year: 2009 http://link.aip.org/link/? PHP /16/073105

  9. Validation of the Organizational Culture Assessment Instrument

    Science.gov (United States)

    Heritage, Brody; Pollock, Clare; Roberts, Lynne

    2014-01-01

    Organizational culture is a commonly studied area in industrial/organizational psychology due to its important role in workplace behaviour, cognitions, and outcomes. Jung et al.'s [1] review of the psychometric properties of organizational culture measurement instruments noted many instruments have limited validation data despite frequent use in both theoretical and applied situations. The Organizational Culture Assessment Instrument (OCAI) has had conflicting data regarding its psychometric properties, particularly regarding its factor structure. Our study examined the factor structure and criterion validity of the OCAI using robust analysis methods on data gathered from 328 (females = 226, males = 102) Australian employees. Confirmatory factor analysis supported a four factor structure of the OCAI for both ideal and current organizational culture perspectives. Current organizational culture data demonstrated expected reciprocally-opposed relationships between three of the four OCAI factors and the outcome variable of job satisfaction but ideal culture data did not, thus indicating possible weak criterion validity when the OCAI is used to assess ideal culture. Based on the mixed evidence regarding the measure's properties, further examination of the factor structure and broad validity of the measure is encouraged. PMID:24667839

  10. Validation of the organizational culture assessment instrument.

    Directory of Open Access Journals (Sweden)

    Brody Heritage

    Full Text Available Organizational culture is a commonly studied area in industrial/organizational psychology due to its important role in workplace behaviour, cognitions, and outcomes. Jung et al.'s [1] review of the psychometric properties of organizational culture measurement instruments noted many instruments have limited validation data despite frequent use in both theoretical and applied situations. The Organizational Culture Assessment Instrument (OCAI has had conflicting data regarding its psychometric properties, particularly regarding its factor structure. Our study examined the factor structure and criterion validity of the OCAI using robust analysis methods on data gathered from 328 (females = 226, males = 102 Australian employees. Confirmatory factor analysis supported a four factor structure of the OCAI for both ideal and current organizational culture perspectives. Current organizational culture data demonstrated expected reciprocally-opposed relationships between three of the four OCAI factors and the outcome variable of job satisfaction but ideal culture data did not, thus indicating possible weak criterion validity when the OCAI is used to assess ideal culture. Based on the mixed evidence regarding the measure's properties, further examination of the factor structure and broad validity of the measure is encouraged.

  11. Diode-laser-pump module with integrated signal ports for pumping amplifying fibers and method

    Science.gov (United States)

    Savage-Leuchs,; Matthias, P [Woodinville, WA

    2009-05-26

    Apparatus and method for collimating pump light of a first wavelength from laser diode(s) into a collimated beam within an enclosure having first and second optical ports, directing pump light from the collimated beam to the first port; and directing signal light inside the enclosure between the first and second port. The signal and pump wavelengths are different. The enclosure provides a pump block having a first port that emits pump light to a gain fiber outside the enclosure and that also passes signal light either into or out of the enclosure, and another port that passes signal light either out of or into the enclosure. Some embodiments use a dichroic mirror to direct pump light to the first port and direct signal light between the first and second ports. Some embodiments include a wavelength-conversion device to change the wavelength of at least some of the signal light.

  12. Development of model pump for establishing hydraulic design of primary sodium pumps in PFBR

    International Nuclear Information System (INIS)

    Chougule, R.J.; Sahasrabudhe, H.G.; Rao, A.S.L.K.; Balchander, K.; Kale, R.D.

    1994-01-01

    Indira Gandhi Centre for Atomic Research, Kalpakkam indicated requirement of indigenous development of primary sodium pump, handling liquid sodium as coolant in Fast Breeder Reactor. The primary sodium pump concept selected in its preliminary design is a vertical, single stage, with single suction impeller, suction facing downwards. The pump is having diffuser, discharge casing and discharge collector. The 1/3 rd size model pump is developed to establish the hydraulic performance of the prototype primary sodium pump. The main objectives were to verify the hydraulic design to operate on low net positive suction head available (NPSHA), no evidence of visible cavitation at available NPSHA, the pump should be designed with a diffuser etc. The model pump PSP 250/40 was designed and successfully developed by Research and Development Division of M/s Kirloskar Brothers Ltd., Kirloskarvadi. The performance testing using model pump was successfully carried out on a closed circuit test rig. The performance of a model pump at three different speeds 1900 rpm, 1456 rpm and 975 rpm was established. The values of hydraulic axial thrust with and without balancing holes on impeller at 1900 rpm was measured. Visual cavitation study at 1900 rpm was carried out to establish the NPSH at bubble free operation of the pump. The tested performance of the model pump is converted to the full scale prototype pump. The predicted performance of prototype pump at 700 rpm was found to be meeting fully with the expected duties. (author). 6 figs., 3 tabs

  13. Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102

    International Nuclear Information System (INIS)

    SHULTZ, M.V.

    1999-01-01

    Tank 241-SY-101 (SY-101) waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from SY-101 to 241-SY-102 (SY-102). The results of the hazards evaluation will be compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. This document is not intended to authorize the activity or determine the adequacy of controls; it is only intended to provide information about the hazardous conditions associated with this activity. The Unreviewed Safety Question (USQ) process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis

  14. Accuracy of a new patch pump based on a microelectromechanical system (MEMS) compared to other commercially available insulin pumps: results of the first in vitro and in vivo studies.

    Science.gov (United States)

    Borot, Sophie; Franc, Sylvia; Cristante, Justine; Penfornis, Alfred; Benhamou, Pierre-Yves; Guerci, Bruno; Hanaire, Hélène; Renard, Eric; Reznik, Yves; Simon, Chantal; Charpentier, Guillaume

    2014-11-01

    The JewelPUMP™ (JP) is a new patch pump based on a microelectromechanical system that operates without any plunger. The study aimed to evaluate the infusion accuracy of the JP in vitro and in vivo. For the in vitro studies, commercially available pumps meeting the ISO standard were compared to the JP: the MiniMed® Paradigm® 712 (MP), Accu-Chek® Combo (AC), OmniPod® (OP), Animas® Vibe™ (AN). Pump accuracy was measured over 24 hours using a continuous microweighing method, at 0.1 and 1 IU/h basal rates. The occlusion alarm threshold was measured after a catheter occlusion. The JP, filled with physiological serum, was then tested in 13 patients with type 1 diabetes simultaneously with their own pump for 2 days. The weight difference was used to calculate the infused insulin volume. The JP showed reduced absolute median error rate in vitro over a 15-minute observation window compared to other pumps (1 IU/h): ±1.02% (JP) vs ±1.60% (AN), ±1.66% (AC), ±2.22% (MP), and ±4.63% (OP), P pumps: 21 (19; 25) minutes vs 90 (85; 95), 58 (42; 74), and 143 (132; 218) minutes (AN, AC, MP), P pumps (-2.2 ± 5.6% vs -0.37 ± 4.0%, P = .25). The JP was found to be easier to wear than conventional pumps. The JP is more precise over a short time period, more sensitive to catheter occlusion, well accepted by patients, and consequently, of potential interest for a closed-loop insulin delivery system. © 2014 Diabetes Technology Society.

  15. DEVELOPING MUSHROOM GYMNASTIC INSTRUMENT PROTOTYPE FOR MEN’S ARTISTIC GYMNASTIC SPORT IN CENTRAL JAVA PROVINCE

    Directory of Open Access Journals (Sweden)

    Tommy Soenyoto

    2014-03-01

    Full Text Available This study aims to develop mushroom gymnastic instrument for men’s artistic gymnastic athletes of junior and senior levels. The instrument is aimed at improving movement skills on horse saddle. Aside from its use as an exercise instrument for beginner, junior and senior levels of men’s artistic gymnastic athletes, this instrument can also be used for beginners’ level competition. This study used qualitative approach in which the data are collected from the initial step to the trial. The main procedure involved five steps: (1 the analysis of product development; (2 the development of initial product; (3 the expert validation; (4 the trial; and (5 the product revision. This study found that the mushroom gymnastic instrument can be used for men’s artistic gymnastic sport, particularly (1 for improving movement skill development on horse saddle for junior and senior athletes; (2 as an exercise instrument for beginner, junior and senior level of men’s artistic gymnastic athletes; (3 as an instrument used in competition for men’s artistic gymnastic for beginners’ level.

  16. Energy efficiency in pumps

    Energy Technology Data Exchange (ETDEWEB)

    Kaya, Durmus; Yagmur, E. Alptekin [TUBITAK-MRC, P.O. Box 21, 41470 Gebze, Kocaeli (Turkey); Yigit, K. Suleyman; Eren, A. Salih; Celik, Cenk [Engineering Faculty, Kocaeli University, Kocaeli (Turkey); Kilic, Fatma Canka [Department of Air Conditioning and Refrigeration, Kocaeli University, Kullar, Kocaeli (Turkey)

    2008-06-15

    In this paper, ''energy efficiency'' studies, done in a big industrial facility's pumps, are reported. For this purpose; the flow rate, pressure and temperature have been measured for each pump in different operating conditions and at maximum load. In addition, the electrical power drawn by the electric motor has been measured. The efficiencies of the existing pumps and electric motor have been calculated by using the measured data. Potential energy saving opportunities have been studied by taking into account the results of the calculations for each pump and electric motor. As a conclusion, improvements should be made each system. The required investment costs for these improvements have been determined, and simple payback periods have been calculated. The main energy saving opportunities result from: replacements of the existing low efficiency pumps, maintenance of the pumps whose efficiencies start to decline at certain range, replacements of high power electric motors with electric motors that have suitable power, usage of high efficiency electric motors and elimination of cavitation problems. (author)

  17. Detection of pump degradation

    International Nuclear Information System (INIS)

    Greene, R.H.; Casada, D.A.; Ayers, C.W.

    1995-08-01

    This Phase II Nuclear Plant Aging Research study examines the methods of detecting pump degradation that are currently employed in domestic and overseas nuclear facilities. This report evaluates the criteria mandated by required pump testing at U.S. nuclear power plants and compares them to those features characteristic of state-of-the-art diagnostic programs and practices currently implemented by other major industries. Since the working condition of the pump driver is crucial to pump operability, a brief review of new applications of motor diagnostics is provided that highlights recent developments in this technology. The routine collection and analysis of spectral data is superior to all other technologies in its ability to accurately detect numerous types and causes of pump degradation. Existing ASME Code testing criteria do not require the evaluation of pump vibration spectra but instead overall vibration amplitude. The mechanical information discernible from vibration amplitude analysis is limited, and several cases of pump failure were not detected in their early stages by vibration monitoring. Since spectral analysis can provide a wealth of pertinent information concerning the mechanical condition of rotating machinery, its incorporation into ASME testing criteria could merit a relaxation in the monthly-to-quarterly testing schedules that seek to verify and assure pump operability. Pump drivers are not included in the current battery of testing. Operational problems thought to be caused by pump degradation were found to be the result of motor degradation. Recent advances in nonintrusive monitoring techniques have made motor diagnostics a viable technology for assessing motor operability. Motor current/power analysis can detect rotor bar degradation and ascertain ranges of hydraulically unstable operation for a particular pump and motor set. The concept of using motor current or power fluctuations as an indicator of pump hydraulic load stability is presented

  18. Detection of pump degradation

    Energy Technology Data Exchange (ETDEWEB)

    Greene, R.H.; Casada, D.A.; Ayers, C.W. [and others

    1995-08-01

    This Phase II Nuclear Plant Aging Research study examines the methods of detecting pump degradation that are currently employed in domestic and overseas nuclear facilities. This report evaluates the criteria mandated by required pump testing at U.S. nuclear power plants and compares them to those features characteristic of state-of-the-art diagnostic programs and practices currently implemented by other major industries. Since the working condition of the pump driver is crucial to pump operability, a brief review of new applications of motor diagnostics is provided that highlights recent developments in this technology. The routine collection and analysis of spectral data is superior to all other technologies in its ability to accurately detect numerous types and causes of pump degradation. Existing ASME Code testing criteria do not require the evaluation of pump vibration spectra but instead overall vibration amplitude. The mechanical information discernible from vibration amplitude analysis is limited, and several cases of pump failure were not detected in their early stages by vibration monitoring. Since spectral analysis can provide a wealth of pertinent information concerning the mechanical condition of rotating machinery, its incorporation into ASME testing criteria could merit a relaxation in the monthly-to-quarterly testing schedules that seek to verify and assure pump operability. Pump drivers are not included in the current battery of testing. Operational problems thought to be caused by pump degradation were found to be the result of motor degradation. Recent advances in nonintrusive monitoring techniques have made motor diagnostics a viable technology for assessing motor operability. Motor current/power analysis can detect rotor bar degradation and ascertain ranges of hydraulically unstable operation for a particular pump and motor set. The concept of using motor current or power fluctuations as an indicator of pump hydraulic load stability is presented.

  19. Radiative characteristics of CVL pumped dye laser

    Energy Technology Data Exchange (ETDEWEB)

    Kubo, Uichi; Ishiguro, Takahide

    1987-09-01

    This paper describes the radiative characteristics of CVL pumped dye laser. It is compared YAG-SH (530 nm) with CVL (511, 578 nm) and CVL (511 nm) for pumping source. Influence of solvent in dye laser power was examined. The present experimental results show that efficiency of CVL (511 nm) pumped dye laser was most high. When the dye solution is at a standstill, the efficiency of dye laser with water and Sodium Lauryl Sulfate (S.L.S., 2 %wt.) was most high among the four kinds of solvent. In the condition of dye solution flow, the water and S.L.S. or ethylene glycol was useful solvent for dye laser.

  20. Surgical Instrument Sets for Special Operations Expeditionary Surgical Teams.

    Science.gov (United States)

    Hale, Diane F; Sexton, Justin C; Benavides, Linda C; Benavides, Jerry M; Lundy, Jonathan B

    The deployment of surgical assets has been driven by mission demands throughout years of military operations in Iraq and Afghanistan. The transition to the highly expeditious Golden Hour Offset Surgical Transport Team (GHOST- T) now offers highly mobile surgical assets in nontraditional operating rooms; the content of the surgical instrument sets has also transformed to accommodate this change. The 102nd Forward Surgical Team (FST) was attached to Special Operations assigned to southern Afghanistan from June 2015 to March 2016. The focus was to decrease overall size and weight of FST instrument sets without decreasing surgical capability of the GHOST-T. Each instrument set was evaluated and modified to include essential instruments to perform damage control surgery. The overall number of main instrument sets was decreased from eight to four; simplified augmentation sets have been added, which expand the capabilities of any main set. The overall size was decreased by 40% and overall weight decreased by 58%. The cardiothoracic, thoracotomy, and emergency thoracotomy trays were condensed to thoracic set. The orthopedic and amputation sets were replaced with an augmentation set of a prepackaged orthopedic external fixator set). An augmentation set to the major or minor basic sets, specifically for vascular injuries, was created. Through the reorganization of conventional FST surgical instrument sets to maintain damage control capabilities and mobility, the 102nd GHOST-T reduced surgical equipment volume and weight, providing a lesson learned for future surgical teams operating in austere environments. 2017.

  1. The Advanced Limiter Test-I (ALT-I) variable-geometry pump limiter module

    International Nuclear Information System (INIS)

    Pontau, A.E.; Malinowski, M.E.; Ver Berkmoes, A.A.; Guthrie, S.E.; Watson, R.D.; Goebel, D.M.; Campbell, G.A.

    1984-01-01

    The ALT-I variable geometry module has been designed to address many of the issues not previously settled by earlier experiments. The goal is to study the basic processes involved in pump limiter operation as well as demonstrate its utility and effect on the plasma. The flexibility and extensive instrumentation of ALT-I will offer a unique opportunity to parameterize operation and facilitate the engineering design of future pump limiters. (orig.)

  2. Nuclear-pumped lasers

    CERN Document Server

    Prelas, Mark

    2016-01-01

    This book focuses on Nuclear-Pumped Laser (NPL) technology and provides the reader with a fundamental understanding of NPLs, a review of research in the field, and exploration of large scale NPL system design and applications. Early chapters look at the fundamental properties of lasers, nuclear-pumping and nuclear reactions that may be used as drivers for nuclear-pumped lasers. The book goes on to explore the efficient transport of energy from the ionizing radiation to the laser medium and then the operational characteristics of existing nuclear-pumped lasers. Models based on Mathematica, explanations and a tutorial all assist the reader’s understanding of this technology. Later chapters consider the integration of the various systems involved in NPLs and the ways in which they can be used, including beyond the military agenda. As readers will discover, there are significant humanitarian applications for high energy/power lasers, such as deflecting asteroids, space propulsion, power transmission and mining....

  3. The U.S./IAEA Workshop on Software Sustainability for Safeguards Instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Pepper S. E.; .; Worrall, L.; Pickett, C.; Bachner, K.; Queirolo, A.

    2014-08-08

    The U.S. National Nuclear Security Administration’s Next Generation Safeguards Initiative, the U.S. Department of State, and the International Atomic Energy Agency (IAEA) organized a a workshop on the subject of ”Software Sustainability for Safeguards Instrumentation.” The workshop was held at the Vienna International Centre in Vienna, Austria, May 6-8, 2014. The workshop participants included software and hardware experts from national laboratories, industry, government, and IAEA member states who were specially selected by the workshop organizers based on their experience with software that is developed for the control and operation of safeguards instrumentation. The workshop included presentations, to orient the participants to the IAEA Department of Safeguards software activities related to instrumentation data collection and processing, and case studies that were designed to inspire discussion of software development, use, maintenance, and upgrades in breakout sessions and to result in recommendations for effective software practices and management. This report summarizes the results of the workshop.

  4. Dual-Pump CARS Development and Application to Supersonic Combustion

    Science.gov (United States)

    Magnotti, Gaetano; Cutler, Andrew D.

    2012-01-01

    A dual-pump Coherent Anti-Stokes Raman Spectroscopy (CARS) instrument has been developed to obtain simultaneous measurements of temperature and absolute mole fractions of N2, O2 and H2 in supersonic combustion and generate databases for validation and development of CFD codes. Issues that compromised previous attempts, such as beam steering and high irradiance perturbation effects, have been alleviated or avoided. Improvements in instrument precision and accuracy have been achieved. An axis-symmetric supersonic combusting coaxial jet facility has been developed to provide a simple, yet suitable flow to CFD modelers. Approximately one million dual-pump CARS single shots have been collected in the supersonic jet for varying values of flight and exit Mach numbers at several locations. Data have been acquired with a H2 co-flow (combustion case) or a N2 co-flow (mixing case). Results are presented and the effects of the compressibility and of the heat release are discussed.

  5. Centrifugal Pump Monitoring and Determination of Pump Characteristic Curves Using Experimental and Analytical Solutions

    Directory of Open Access Journals (Sweden)

    Marius Stan

    2018-02-01

    Full Text Available Centrifugal pumps are widely used in the industry, especially in the oil and gas sector for fluids transport. Classically, these are designed to transfer single phase fluids (e.g., water at high flow rates and relatively low pressures when compared with other pump types. As part of their constructive feature, centrifugal pumps rely on seals to prevent air entrapment into the rotor during its normal operation. Although this is a constructive feature, water should pass through the pump inlet even when the inlet manifold is damaged. Modern pumps are integrated in pumping units which consist of a drive (normally electric motor, a transmission (when needed, an electronic package (for monitoring and control, and the pump itself. The unit also has intake and outlet manifolds equipped with valves. Modern systems also include electronic components to measure and monitor pump working parameters such as pressure, temperature, etc. Equipment monitoring devices (vibration sensors, microphones are installed on modern pumping units to help users evaluate the state of the machinery and detect deviations from the normal working condition. This paper addresses the influence of air-water two-phase mixture on the characteristic curve of a centrifugal pump; pump vibration in operation at various flow rates under these conditions; the possibilities of using the results of experimental investigations in the numerical simulations for design and training purposes, and the possibility of using vibration and sound analysis to detect changes in the equipment working condition. Conclusions show that vibration analysis provides accurate information about the pump’s functional state and the pumping process. Moreover, the acoustic emission also enables the evaluation of the pump status, but needs further improvements to better capture and isolate the usable sounds from the environment.

  6. 48 CFR 873.102 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... SUPPLEMENTARY REGULATIONS SIMPLIFIED ACQUISITION PROCEDURES FOR HEALTH-CARE RESOURCES 873.102 Definitions...-care providers include health-care plans and insurers and any organizations, institutions, or other entities or individuals who furnish health-care resources. (38 U.S.C. 8153) Health-care resource includes...

  7. Radiative characteristics of CVL pumped dye laser

    International Nuclear Information System (INIS)

    Kubo, Uichi; Ishiguro, Takahide.

    1987-01-01

    This paper describes the radiative characteristics of CVL pumped dye laser. It is compared YAG-SH (530 nm) with CVL (511, 578 nm) and CVL (511 nm) for pumping source. Influence of solvent in dye laser power was examined. The present experimental results show that efficiency of CVL (511 nm) pumped dye laser was most high. When the dye solution is at a standstill, the efficiency of dye laser with water and Sodium Lauryl Sulfate (S.L.S., 2 %wt.) was most high among the four kinds of solvent. In the condition of dye solution flow, the water and S.L.S. or Ethylene Glycol was useful solvent for dye laser. (author)

  8. Pumping speed of parallel-louvre-blind-type cryopumps

    International Nuclear Information System (INIS)

    Saho, Norihide; Ogata, Hisanao; Kunugi, Yosifumi; Uede, Taisei; Yamasita, Yasuo; Kawakami, Hiroyuki.

    1993-01-01

    As a new type of actual-sized cryopump with high pumping speed, a parallel-louvre-blind type cryopump of a rectangular cross section with opening distance B, width C and depth D, is proposed and is produced as a trial pump unit designed as actual size. The influence of pump depth size ratio R d (=D/B) and number of secondary cryopanels on the transmission probability P bc of the pump unit is calculated by Monte Carlo simulation, and the hydrogen pumping speed is measured by experiments. The following results are obtained. (1) The transmission probability of a cryopump designed with dimensional ratio of R d = 1.3 is calculated to be 0.66 at ratios of R c (=B/C) = 0.88, which means that hydrogen pumping speed of cryopumps of this size can attain 294 m 3 · s -1 /m 2 per opening area. (2) The real hydrogen pumping speed of the trial pump unit with 30 secondary cryopanels is measured as 295 m 3 · s -1 /m 2 . (author)

  9. Test Results of a 1.2 kg/s Centrifugal Liquid Helium Pump for the ATLAS Superconducting Toroid Magnet System

    CERN Document Server

    Pengo, R; Passardi, Giorgio; Pirotte, O; ten Kate, H H J

    2002-01-01

    The toroid superconducting magnet of ATLAS-LHC experiment at CERN will be indirectly cooled by means of forced flow of liquid helium at about 4.5 K. A centrifugal pump will be used, providing a mass flow of 1.2 kg/s and a differential pressure of 40 kPa (ca. 400 mbar) at about 4300 rpm. Two pumps are foreseen, one for redundancy, in order to feed in parallel the cooling circuits of the Barrel and the two End-Caps toroid magnets. The paper describes the tests carried out at CERN to measure the characteristic curves, i.e. the head versus the mass flow at different rotational speeds, as well as the pump total efficiency. The pump is of the "fullemission" type, i.e. with curved blades and it is equipped with an exchangeable inducer. A dedicated pump test facility has been constructed at CERN, which includes a Coriolis-type liquid helium mass flow meter. This facility is connected to the helium refrigerator used for the tests at CERN of the racetrack magnets of the Barrel and of the End-Cap toroids.

  10. Pumping mechanisms in sputter-ion pumps low pressure operation

    International Nuclear Information System (INIS)

    Welch, K.M.

    1991-01-01

    It is shown that significant H 2 pumping occurs in the walls of triode pumps. Also, H 2 is pumped in the anode cells of sputter-ion pumps. This pumping occurs in a manner similar to that by which the inert gases are pumped. That is, H 2 is pumped in the walls of the anode cells by high energy neutral burial. Hydrogen in the pump walls and anodes limits the base pressure of the pump

  11. The development of state/region owned goods management’s monitoring instrument design

    Directory of Open Access Journals (Sweden)

    Ikhwanto Yogy

    2017-01-01

    Full Text Available The problems in state/region owned goods in Indonesian state and local governments are suspected to occur because of weak monitoring programs, according to many studies. A tool or instrument in implementing this monitoring program is expected to address this problem. Such tool currently doesn’t exist yet. This research aims to fill that gap by developing a monitoring instrument design for state/region owned goods by using Daerah Istimewa Yogyakarta (DIY Local Government as a research context in order to take valuable inputs for the design. This research is using developmental research method. Government Regulation were used for normative reference and Friedman’s results-based accountability quadrat were used in developing good indicators for the instrument. This research is succeeded in formulating the indicators that made up the instrument. Indicators compiled are divided into compliance-based indicators and results-based indicators. Indicators are formulated based on the validation and inputs from employees of DIY’s Assets Management Agency and experts from academia. This instrument still has some limitations that need improvement through further research.

  12. Performances of solar water pumping system using helical pump for a deep well: A case study for Madinah, Saudi Arabia

    International Nuclear Information System (INIS)

    Benghanem, M.; Daffallah, K.O.; Joraid, A.A.; Alamri, S.N.; Jaber, A.

    2013-01-01

    Highlights: ► The best performance of helical pump has been reached for a deep well. ► Very high potential of solar energy at Saudi Arabia. ► Performance of solar water pumping system for a deep well of 120 m. ► We get the best efficiency of helical pump for the head of 80 m. ► The best configuration of PV generator (24 panels) has been obtained. - Abstract: The photovoltaic water pumping systems (PVWPS) constitute a potential option to draw down water in the remote desert locations for domestic usage and livestock watering. However, the widespread of this technique requires accurate information and experiences in such system sizing and installation. The aim of this work is to determine an optimum photovoltaic (PV) array configuration, adequate to supply a DC Helical pump with an optimum energy amount, under the outdoor conditions of Madinah site. Four different PV array configurations have been tested (6S × 3P, 6S × 4P, 8S × 3P and 12S × 2P). The tests have been carried for a head of 80 m, under sunny daylight hours, in a real well at a farm in Madinah site. The best results have been obtained for two PV array configurations (6S × 4P) and (8S × 3P) which are suitable to provide the optimum energy. Powered by the selected PV array configurations, the helical pump (SQF2.5-2) delivered a maximum daily average volume of water needed (22 m 3 /day).

  13. Pumping mechanisms in sputter-ion pumps low pressure operation

    International Nuclear Information System (INIS)

    Welch, K.M.

    1991-01-01

    It is shown that significant H 2 pumping occurs in the walls of triode pumps. Also, H 2 is pumped in the anode cells of sputter-ion pumps. This pumping occurs in a manner similar to that by which the inert gases are pumped. That is, H 2 pumped in the walls of the anode cells by high energy neutral burial. Hydrogen in the pump walls and anodes limits the base pressure of the pump. 13 refs., 5 figs., 1 tab

  14. The acoustic detection of cavitation in pumps

    International Nuclear Information System (INIS)

    Macleod, I.D.; Gray, B.S.; Taylor, C.G.

    1978-01-01

    A programme was initiated to develop a reliable technique for detecting the onset of acoustic noise from cavitation in a pump and to relate this to cavitation inception data, since significant noise from collapse of vapour bubbles arising from such cavitation would reduce the sensitivity of a noise detection system for boiling of sodium in fast breeder reactors. Factors affecting the detection of cavitation are discussed. The instrumentation and techniques of frequency analysis and pulse detection are described. Two examples are then given of the application of acoustic detection techniques under controlled conditions. It is concluded that acoustic detection can be a reliable method for detecting inception of cavitation in a pump and the required conditions are stated. (U.K.)

  15. ASPECT OF LANGUAGE ON A QUALITATIVE ANALYSIS OF STUDENT’S EVALUATION INSTRUMENT

    Directory of Open Access Journals (Sweden)

    Ismanto Ismanto

    2016-11-01

    Full Text Available This article examined the characteristics of good student’s evaluation instrument. There are at least two requirements that must be met. Those are valid and reliable. The validity of the instrument can be seen from the instrument's ability to measure what should be measured. The fact the existence of the validity of an instrument may be a grain fill, the response process, internal structure, relationship with other variables, and the consequences of the implementation of the charging instrument. Analysis of the content is then known as content validity, i.e. rational analysis of the domain to be measured to determine the representation of each item on the instrument with the ability to be measured. Content validity is submitting pieces of blue print and items of the instrument to the experts to be analyzed quantitatively and qualitatively.

  16. Turbomolecular pump vacuum system for the Princeton Large Torus

    International Nuclear Information System (INIS)

    Dylla, H.F.

    1977-10-01

    A turbomolecular pump vacuum system has been designed and installed on the Princeton Large Torus (PLT). Four vertical shaft, oil-bearing, 1500 l/s turbomolecular pumps have been interfaced to the 6400 liter PLT Vacuum vessel to provide a net pumping speed of 3000 l/s for H 2 . The particular requirements and problems of tokamak vacuum systems are enumerated. A vacuum control system is described which protects the vacuum vessel from contamination, and protects the turbomolecular pumps from damage under a variety of possible failure modes. The performance of the vacuum system is presented in terms of pumping speed measurements and residual gas behavior

  17. Setting up of Nuclide GRAF-3S spark source mass spectrometer for the analysis of high purity materials

    International Nuclear Information System (INIS)

    Mahalingam, T.R.; Murugaiyan, P.; Soni, K.S.; Venkateswarlu, Ch.

    1975-01-01

    A spark source mass spectrometer model GRAF-35 manufactured by the Nuclide Corporation, U.S.A., was set up for analysis of nuclear-grade and high purity materials. The main difficulty with its successful operation was to achieve and maintain the required level of vacuum i.e. less than 2X10 -8 torr in the magnetic analyser region. With 100 1/s ion pump, the required vacuum could be achieved, but the spectrometer required periodical baking which minimises the life of the instrument. The pumping system was replaced by Ultek Boostivac pump - a combination of ion pump (150 1/s) and a titanium sublimation pump (1000 1/sec speed for condensable vapours) which eliminated baking as the necessary level of vacuum could be easily achieved whenever required. Results of the analysis of zone-refined indium and uranium for trace impurities are given. (M.G.B.)

  18. Glide path preparation in S-shaped canals with rotary pathfinding nickel-titanium instruments.

    Science.gov (United States)

    Ajuz, Natasha C C; Armada, Luciana; Gonçalves, Lucio S; Debelian, Gilberto; Siqueira, José F

    2013-04-01

    This study compared the incidence of deviation along S-shaped (double-curved) canals after glide path preparation with 2 nickel-titanium (NiTi) rotary pathfinding instruments and hand K-files. S-shaped canals from 60 training blocks were filled with ink, and preinstrumentation images were obtained by using a stereomicroscope. Glide path preparation was performed by an endodontist who used hand stainless steel K-files (up to size 20), rotary NiTi PathFile instruments (up to size 19), or rotary NiTi Scout RaCe instruments (up to size 20). Postinstrumentation images were taken by using exactly the same conditions as for the preinstrumentation images, and both pictures were superimposed. Differences along the S-shaped canal for the mesial and distal aspects were measured to evaluate the occurrence of deviation. Intragroup analysis showed that all instruments promoted some deviation in virtually all levels. Overall, regardless of the group, deviations were observed in the mesial wall at the canal terminus and at levels 4, 5, 6 and 7 mm and in the distal wall at levels 1, 2, and 3 mm. These levels corresponded to the inner walls of each curvature. Both rotary NiTi instruments performed significantly better than hand K-files at all levels (P instruments showed significantly better results than PathFiles at levels 0, 2, 3, 5, and 6 mm (P rotary NiTi instruments are suitable for adequate glide path preparation because they promoted less deviation from the original canal anatomy when compared with hand-operated instruments. Of the 2 rotary pathfinding instruments, Scout RaCe showed an overall significantly better performance. Copyright © 2013 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.

  19. B16-BL6 melanoma cells release inhibitory factor(s) of active pump activity in isolated lymph vessels.

    Science.gov (United States)

    Nakaya, K; Mizuno, R; Ohhashi, T

    2001-12-01

    We investigated whether supernatant cultured with melanoma cell lines B16-BL6 and K1735 or the Lewis lung carcinoma cell line (LLC) can regulate lymphatic pump activity with bioassay preparations isolated from murine iliac lymph vessels. B16-BL6 and LLC supernatants caused significant dilation of lymph microvessels with cessation of pump activity. B16-BL6 supernatant produced dose-related cessation of lymphatic pump activity. There was no significant tachyphylaxis in the supernatant-mediated inhibitory response of lymphatic pump activity. Pretreatment with 3 x 10(-5) M N(omega)-nitro-L-arginine methyl ester (L-NAME) or 10(-7) M or 10(-6) M glibenclamide and 5 x 10(-4) M 5-hydroxydecanoic acid caused significant reduction of supernatant-mediated inhibitory responses. Simultaneous treatment with 10(-3) M L-arginine and 3 x 10(-5) M L-NAME significantly lessened L-NAME-induced inhibition of the supernatant-mediated response, suggesting that endogenous nitric oxide (NO) plays important roles in supernatant-mediated inhibitory responses. Chemical treatment dialyzed substances of B16-BL6 cells may release nonpeptide substance(s) of <1,000 MW, resulting in significant cessation of lymphatic pump activity via production and release of endogenous NO and activation of mitochondrial ATP-sensitive K(+) channels.

  20. Copper vapour laser with an efficient semiconductor pump generator having comparable pump pulse and output pulse durations

    Energy Technology Data Exchange (ETDEWEB)

    Yurkin, A A [P N Lebedev Physics Institute, Russian Academy of Sciences, Moscow (Russian Federation)

    2016-03-31

    We report the results of experimental studies of a copper vapour laser with a semiconductor pump generator capable of forming virtually optimal pump pulses with a current rise steepness of about 40 A ns{sup -1} in a KULON LT-1.5CU active element. To maintain the operating temperature of the active element's channel, an additional heating pulsed oscillator is used. High efficiency of the pump generator is demonstrated. (lasers)

  1. Vibration monitoring/diagnostic techniques, as applied to reactor coolant pumps

    International Nuclear Information System (INIS)

    Sculthorpe, B.R.; Johnson, K.M.

    1986-01-01

    With the increased awareness of reactor coolant pump (RCP) cracked shafts, brought about by the catastrophic shaft failure at Crystal River number3, Florida Power and Light Company, in conjunction with Bently Nevada Corporation, undertook a test program at St. Lucie Nuclear Unit number2, to confirm the integrity of all four RCP pump shafts. Reactor coolant pumps play a major roll in the operation of nuclear-powered generation facilities. The time required to disassemble and physically inspect a single RCP shaft would be lengthy, monetarily costly to the utility and its customers, and cause possible unnecessary man-rem exposure to plant personnel. When properly applied, vibration instrumentation can increase unit availability/reliability, as well as provide enhanced diagnostic capability. This paper reviews monitoring benefits and diagnostic techniques applicable to RCPs/motor drives

  2. Paste pumping and deposition field trials and concepts on Syncrude's dewatered mature fine tailings MFT centrifuge cake

    Energy Technology Data Exchange (ETDEWEB)

    Lahaie, R. [Syncrude Canada Ltd., Edmonton, AB (Canada); Ahmed, I.; Labelle, M.; Brown, R. [Golder Paste Technology, Sudbury, ON (Canada)

    2009-07-01

    This presentation discussed a paste pumping and deposition field study conducted on dewatered mature fine tailings (MFT) located at Syncrude's Mildred Lake operation. Bench scale rheological examinations of centrifuge cakes and design field testing are used to determine the pumpability of MFT centrifuge cakes. The study included a transportation assessment for the conveyor and positive displacement pumps and pipelines, as well as geotechnical and environmental analyses of bulk materials. Flocculant optimization and centrifuge operational parameter assessments were conducted. Pressure differential and flow rate data were captured in the field studies in order to determine pipeline friction loss. The study showed that pipe friction factors can be obtained using the Bingham plastic model. A natural deposition angle was determined for the MFT centrifuged cake. The study showed that the cake must be sheared in order to reduce yield stress before pumping. It was concluded that displacement pumps can be used to reduced pipeline friction factors. tabs., figs.

  3. Research on Fault Diagnosis for Pumping Station Based on T-S Fuzzy Fault Tree and Bayesian Network

    Directory of Open Access Journals (Sweden)

    Zhuqing Bi

    2017-01-01

    Full Text Available According to the characteristics of fault diagnosis for pumping station, such as the complex structure, multiple mappings, and numerous uncertainties, a new approach combining T-S fuzzy gate fault tree and Bayesian network (BN is proposed. On the one hand, traditional fault tree method needs the logical relationship between events and probability value of events and can only represent the events with two states. T-S fuzzy gate fault tree method can solve these disadvantages but still has weaknesses in complex reasoning and only one-way reasoning. On the other hand, the BN is suitable for fault diagnosis of pumping station because of its powerful ability to deal with uncertain information. However, it is difficult to determine the structure and conditional probability tables of the BN. Therefore, the proposed method integrates the advantages of the two methods. Finally, the feasibility of the method is verified through a fault diagnosis model of the rotor in the pumping unit, the accuracy of the method is verified by comparing with the methods based on traditional Bayesian network and BP neural network, respectively, when the historical data is sufficient, and the results are more superior to the above two when the historical data is insufficient.

  4. Development and Optimized Design of Propeller Pump System & Structure with VFD in Low-head Pumping Station

    Science.gov (United States)

    Rentian, Zhang; Honggeng, Zhu; Arnold, Jaap; Linbi, Yao

    2010-06-01

    Compared with vertical-installed pumps, the propeller (bulb tubular) pump systems can achieve higher hydraulic efficiencies, which are particularly suitable for low-head pumping stations. More than four propeller pumping stations are being, or will be built in the first stage of the S-to-N Water Diversion Project in China, diverting water from Yangtze River to the northern part of China to alleviate water-shortage problems and develop the economy. New structures of propeller pump have been developed for specified pumping stations in Jiangsu and Shandong Provinces respectively and Variable Frequency Drives (VFDs) are used in those pumping stations to regulate operating conditions. Based on the Navier-Stokes equations and the standard k-e turbulent model, numerical simulations of the flow field and performance prediction in the propeller pump system were conducted on the platform of commercial software CFX by using the SIMPLEC algorithm. Through optimal design of bulb dimensions and diffuser channel shape, the hydraulic system efficiency has improved evidently. Furthermore, the structures of propeller pumps have been optimized to for the introduction of conventional as well as permanent magnet motors. In order to improve the hydraulic efficiency of pumping systems, both the pump discharge and the motor diameter were optimized respectively. If a conventional motor is used, the diameter of the pump casing has to be increased to accommodate the motor installed inside. If using a permanent magnet motor, the diameter of motor casing can be decreased effectively without decreasing its output power, thus the cross-sectional area is enlarged and the velocity of flowing water decreased favorably to reduce hydraulic loss of discharge channel and thereby raising the pumping system efficiency. Witness model tests were conducted after numerical optimization on specific propeller pump systems, indicating that the model system hydraulic efficiencies can be improved by 0.5%˜3.7% in

  5. Seminar on heat pump research and applications: proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Steele, R.V. Jr. (ed.)

    1984-11-01

    This volume is a compilation of papers prepared by speakers at a seminar on heat pumps. The seminar was organized by the Electric Power Research Institute (EPRI) in cooperation with Louisiana Power and Light Company and New Orleans Public Service, Inc. The seminar's purpose was to inform utility managers and engineers of the most recent developments in residential heat pump technology and applications. Statements by invited panelists on the outlook for heat pump technology are also included. The speakers, who represented key organizations in the heat pump area, including utilities, industry associations, manufacturers, independent research institutes, government, and EPRI, addressed the following topics: status of heat pump research and development, heat pump testing and rating; field monitoring of heat pumps; heat pump water heaters; heat pump reliability; and marketing programs for pumps. All papers, total of sixteen have been processed for inclusion in the Energy Data Base.

  6. The outline design of FEB-E particle exhaust and pumping system

    International Nuclear Information System (INIS)

    Zhu Yukun; Huang Jinhua; Feng Kaiming; Deng Peizhi; Li Yiqiang

    1999-01-01

    The particle exhaust of Fusion Experimental Breeder FEB-E is carried out with divertor. The FEB-E divertor consists of 48 wedge shaped cassette modules connected with primary pumping system and cooling system. The FEB-E pumping system consists of two major subsystems, the torus rough pumping system and the torus high vacuum pumping system. The torus high vacuum pumping system consists of a series of internal cryopumps located in most of the lower ports (up to 20) and additional turbomolecular pumps located outside of the bio-shield. These cryopumps are capable of providing a nominal gross pumping speed of 576 m 3 ·s -1 , regulated with inlet valves for throttle control of the exhaust particle flow in the case of high neutral pressure (>1 Pa) in the divertor. However, limited conductance through the divertor pumping slot and through the clearance between the underside of the divertor and the vacuum vessel results in the effective net pumping speed of 160 m 3 ·s -1 in the divertor private region. This pumping speed implies that a neutral pressure operation range of 0.5 - 1.0 Pa is required in the divertor private region to achieve an exhausting throughput range of 80 - 160 Pa·m 3 ·s -1 . The regeneration of cryopump is activated at the end of the 1000 s of the breeder burning

  7. Design capability of CANDU heat transport pump shafts against cracking

    International Nuclear Information System (INIS)

    Kumar, A.N.; Sheikh, Z.B.; Padgett, A.

    1993-01-01

    During 1986 three different Light Water Reactors (LWR's) in the U.S. reported either a cracked or fractured shaft on one or more of their reactor coolant (RC) pumps. The RC pumps for all these stations were supplied by Byron Jackson (BJ) Pump Company. A majority of CANDU heat transport (HT) pumps (equivalent of RC pumps) are supplied by BJ Pump Company and are similar in design to RC pumps. Hence the failure of these RC pumps in the U.S. utilities caused concern regarding the relevance of these failures to the BJ supplied CANDU HT pumps (HTP). This paper presents the results of AECL assessment to establish the capability of the HT pump shaft against cracking. Two methods were used for assessment: (a) detailed comparative design review of the HTP and RCP shafts; (b) semi-empirical analysis of the HTP shafts. The results of the AECL assessment showed significant differences in detailed design, materials, assembly and fits of various components and the control of operating parameters between the HT and RC pumps. It was concluded that because of these differences the failures similar to RC pump shafts are not likely to appear in HT pump shafts. This conclusion is further reinforced by about 140,000 hours of operating history of the longest running HT pump of comparable size to RC Pumps, without failures

  8. Centrifugal pumps

    CERN Document Server

    Anderson, HH

    1981-01-01

    Centrifugal Pumps describes the whole range of the centrifugal pump (mixed flow and axial flow pumps are dealt with more briefly), with emphasis on the development of the boiler feed pump. Organized into 46 chapters, this book discusses the general hydrodynamic principles, performance, dimensions, type number, flow, and efficiency of centrifugal pumps. This text also explains the pumps performance; entry conditions and cavitation; speed and dimensions for a given duty; and losses. Some chapters further describe centrifugal pump mechanical design, installation, monitoring, and maintenance. The

  9. 41 CFR 102-37.520 - What is the authority for public airport donations?

    Science.gov (United States)

    2010-07-01

    ... for public airport donations? 102-37.520 Section 102-37.520 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Airports § 102-37.520 What is the authority for public airport donations? The authority for public airport donations is 49 U.S.C. 47151. 49 U...

  10. Ho:YLF pumped HBr laser

    CSIR Research Space (South Africa)

    Botha, LR

    2009-10-01

    Full Text Available , “Optically Pumped Mid-Infrared HBr Laser,” IEEE J. Quantum Electron. 30(10), 2395–2400 (1994). 2. C. S. Kletecka, N. Campbell, C. R. Jones, J. W. Nicolson, and W. Rudolph, “Cascade Lasing of Molecular HBr in the Four Micron Region Pumped by a Nd:YAG laser...-Infrared Coherent Sources, (European Physical Society 2009) Invited Talk Mo3. 5. C. Bollig, H. J. Strauss, M. J. D. Esser, W. Koen, M.Schellhorn, D. Preussler, K. Nyangaza, C. Jacobs, E. H. Bernardi and L. R. Botha, “Compact Fibre-Laser-Pumped Ho:YLF Oscillator...

  11. Magnetohydrodynamic generator and pump system

    International Nuclear Information System (INIS)

    Birzvalk, Yu.A.; Karasev, B.G.; Lavrentyev, I.V.; Semikov, G.T.

    1983-01-01

    The MHD generator-pump system, or MHD coupling, is designed to pump liquid-metal coolant in the primary circuit of a fast reactor. It contains a number of generator and pump channels placed one after another and forming a single electrical circuit, but hydraulically connected parallel to the second and first circuits of the reactor. All the generator and pump channels are located in a magnetic field created by the magnetic system with an excitation winding that is fed by a regulated direct current. In 500 to 2000 MW reactors, the flow rate of the coolant in each loop of the primary circuit is 3 to 6 m 3 /s and the hydraulic power is 2 to 4 MW. This paper examines the primary characteristics of an MHD generator-pump system with various dimensions and number of channels, wall thicknesses, coolant flow rates, and magnetic fields. It is shown that its efficiency may reach 60 to 70%. The operating principle of the MHD generator-pump system is explained in the referenced patent and involves the transfer of hydraulic power from generator channels to pump channels using a magnetic field and electrical circuit common to both channels. Variations of this system may be analyzed using an equivalent circuit. 7 refs., 5 figs

  12. Mothers’ Use of Social Media to Inform Their Practices for Pumping and Providing Pumped Human Milk to Their Infants

    Directory of Open Access Journals (Sweden)

    Rei Yamada

    2016-10-01

    Full Text Available Despite U.S. mothers’ wide adoption of pumps and bottles to provide human milk (HM to their infants, mothers lack comprehensive, evidence-based guidelines for these practices. Thus, some women use online sources to seek information from each other. We aimed to characterize the information women sought online about pumping. We used data provided by ~25,000 women in an open cohort within a discussion forum about parenting. We examined 543 posts containing questions about providing pumped HM cross-sectionally and longitudinally in three time intervals: prenatal, 0 through 1.5 months postpartum, and 1.5 to 4.5 months postpartum. We used thematic analysis with Atlas.ti to analyze the content of posts. During pregnancy, women commonly asked questions about how and where to obtain pumps, both out-of-pocket and through insurance policies. Between 0–1.5 months postpartum, many mothers asked about how to handle pumped HM to ensure its safety as fed. Between 1.5–4.5 months postpartum, mothers sought strategies to overcome constraints to pumping both at home and at work and also asked about stopping pumping and providing their milk. Women’s questions related to ensuring the safety of pumped HM represent information women need from health professionals, while their questions related to obtaining pumps suggest that women may benefit from clearer guidelines from their insurance providers. The difficulties women face at home and at work identify avenues through which families and employers can support women to meet their goals for providing HM.

  13. Particle removal with pump limiters in ISX-B

    International Nuclear Information System (INIS)

    Mioduszewski, P.; Emerson, L.C.; Simpkins, J.E.

    1983-01-01

    First pump limiter experiments were performed on ISX-B. Two pump limiter modules were installed in the top and bottom of one toroidal sector of the tokamak. The modules consist of inertia cooled, TiC coated graphite heads and Zr-Al getter pumps each with a pumping speed of 1000 to 2000 l/s. The objective of the initial experiments was the demonstration of plasma particle control with pump limiters. The first set of experiments were performed in ohmic discharges (OH) in which the effect of the pump limiters on the plasma density was clearly demonstrated. In discharges characterized by: I/sub p/ = 110 kA, B/sub T/ = 15 kG, anti n/sub e/ = 1 - 5 x 10 13 cm -3 and t = 0.3 s the pressure rise in the pump limiters was typically 2 mTorr with the pumps off and 0.7 mTorr after activating the pumps. When the pumps were activated, the line-average plasma density decreased by up to a factor 2 at identical gas flow rates. The second set of measurements were performed in neutral beam heated discharges (NBI) with injected powers between 0.6 MW and 1.0 MW. Due to a cooling problem on one of the Zr-Al pumps the NBI experiments were carried out with one limiter only. The maximum pressure observed in NBI-discharges was 5 mTorr without activating the pumps, i.e., approximately twice as high as in OH-discharges. The exhaust efficiency, which is defined as the removed particle flux over the total particle flux in the scrape-off layer is estimated to be 5%

  14. High-efficiency pumps drastically reduce energy consumption

    Energy Technology Data Exchange (ETDEWEB)

    Anon

    2002-05-01

    Wilo's Stratos pumps for air conditioning and other domestic heating applications combine the advantages of wet runner technology with an innovative electronic commutator motor. The energy consumption of these high-efficiency pumps is halved compared with similar wet runner designs. With vast numbers of pumps used in buildings across Europe alone, the adoption of this technology potentially offers significant energy sayings. (Author)

  15. Design and Analysis of a Getter-Based Vacuum Pumping System for a Rocket-Borne Mass Spectrometer

    Science.gov (United States)

    Everett, E. A.; Syrstad, E. A.; Dyer, J. S.

    2010-12-01

    The mesosphere / lower thermosphere (MLT) is a transition region where the turbulent mixing of earth’s lower atmosphere gives way to the molecular diffusion of space. This region hosts a rich array of chemical processes and atmospheric phenomena, and serves to collect and distribute particles of all sizes in thin layers. Spatially resolved in situ characterization of these layers is very difficult, due to the elevated pressure of the MLT, limited access via high-speed sounding rockets, and the enormous variety of charged and neutral species that range in size from atoms to smoke and dust particles. In terrestrial applications, time-of-flight mass spectrometry (TOF-MS) is the technique of choice for performing fast, sensitive composition measurements with extremely large mass range. However, because of its reliance on high voltages and microchannel plate (MCP) detectors prone to discharge at elevated pressures, TOF-MS has rarely been employed for measurements of the MLT, where ambient pressures approach 10 mTorr. We present a novel, compact mass spectrometer design appropriate for deployment aboard sounding rockets. This Hadamard transform time-of-flight mass spectrometer (HT-TOF-MS) applies a multiplexing technique through pseudorandom beam modulation and spectral deconvolution to achieve very high measurement duty cycles (50%), with a theoretically unlimited mass range. The HT-TOF-MS employs a simple, getter-based vacuum pumping system and pressure-tolerant MCP to allow operation in the MLT. The HT-TOF-MS must provide sufficient vacuum pumping to 1) maintain a minimum mean free path inside the instrument, to avoid spectral resolution loss, and 2) to avoid MCP failure through electrostatic discharge. The design incorporates inexpensive, room temperature tube getters loaded with nano-structured barium to meet these pumping speed requirements, without the use of cryogenics or mechanical pumping systems. We present experimental results for gettering rates and

  16. LMFBR with booster pump in pumping loop

    International Nuclear Information System (INIS)

    Rubinstein, H.J.

    1975-01-01

    A loop coolant circulation system is described for a liquid metal fast breeder reactor (LMFBR) utilizing a low head, high specific speed booster pump in the hot leg of the coolant loop with the main pump located in the cold leg of the loop, thereby providing the advantages of operating the main pump in the hot leg with the reliability of cold leg pump operation

  17. A micro surface tension pump (MISPU) in a glass microchip.

    Science.gov (United States)

    Peng, Xing Yue Larry

    2011-01-07

    A non-membrane micro surface tension pump (MISPU) was fabricated on a glass microchip by one-step glass etching. It needs no material other than glass and is driven by digital gas pressure. The MISPU can be seen working like a piston pump inside the glass microchip under a microscope. The design of the valves (MISVA) and pistons (MISTON) was based on the surface tension theory of the micro surface tension alveolus (MISTA). The digital gas pressure controls the moving gas-liquid interface to open or close the input and output MISVAs to refill or drive the MISTON for pumping a liquid. Without any moving parts, a MISPU is a kind of long-lasting micro pump for micro chips that does not lose its water pumping efficiency over a 20-day period. The volumetric pump output varied from 0 to 10 nl s(-1) when the pump cycle time decreased from 5 min to 15 s. The pump head pressure was 1 kPa.

  18. Enhancement of pump absorption efficiency by bending and twisting of double clad rare earth doped fibers (Conference Presentation)

    Science.gov (United States)

    Koška, Pavel; Peterka, Pavel; Doya, Valérie; Aubrecht, Jan; Kasik, Ivan; Podrazký, Ondřej

    2017-05-01

    chaotic double-clad fiber amplifier," Opt. Lett., vol. 26, no. 12, pp. 872-874, (2001). [2] Kouznetsov, D., Moloney, J. V., "Efficiency of pump absorption in double-clad fiber amplifiers. II. Broken circular symmetry," J. Opt. Soc. Am. B, vol. 19, no. 6, pp. 1259-1263, June 2002. [3] Li, Y., Jackson, S. D., Fleming, S., "High absorption and low splice loss properties of hexagonal double-clad fiber," IEEE Photonics Technol. Lett., vol 16, no. 11, pp. 2502-2504, Nov. 2004. [4] Ko\\vska, P. and Peterka, P., "Numerical analysis of pump propagation and absorption in specially tailored double-clad rare-earth doped fiber," Optical and Quantum Electronics, vol. 47, no. 9, pp. 3181-3191 (2015). [5] Ko\\vska, P., Peterka, P., and Doya, V., "Numerical modeling of pump absorption in coiled and twisted double-clad fibers," IEEE J. Sel. Top. Quantum Electron., vol. 22, no. 2 (2016). [6] Ko\\vska, P., Peterka, P., Aubrecht, J., Podrazký, O., Todorov, F., Becker, M., Baravets, Y., Honzátko, P., and Kašík, I., "Enhanced pump absorption efficiency in coiled and twisted double-clad thulium-doped fibers," Opt. Express, vol. 24, no. 1, pp. 102-107 (2016).

  19. Detection of efflux pump activity among clinical isolates of ...

    African Journals Online (AJOL)

    Purpose: To detect efflux pump activity (EPA) and screening a suspected efflux pump inhibitor (EPI) [1- (3-(trifluoromethyl)benzyl]-piperazine (TFMBP)], which could help in reducing multi-drug resistance (MDR). Methods: Eighteen isolates, viz, 14 S. aureus, 2 S. lentus, 1 S. xylosus and 1 Micrococcus species from various ...

  20. The ORNL Modulating Heat Pump Design Tool -- Mark IV User's Guide

    Energy Technology Data Exchange (ETDEWEB)

    Rice, C.K.

    2001-09-27

    The ORNL Modulating Heat Pump Design Tool consists of a Modulating HPDM (Heat Pump Design Model) and a parametric-analysis (contour-data generating) front-end. Collectively the program is also referred to as MODCON which is in reference to the modulating and the contour data generating capabilities. The program was developed by Oak Ridge National Laboratory for the Department of Energy to provide a publicly-available system design tool for variable- and single-speed heat pumps.

  1. Pumping and leak detection system of the HL-2A

    International Nuclear Information System (INIS)

    Cao Zeng; Xu Yunxian; Fu Weidong

    2001-01-01

    The pumping system is a combination of 8 turbomolecular pumps with three stages pumping for HL-2A vacuum vessel, a total effective pumping speed at the vessel of 12 m 3 ·s -1 for nitrogen. The leak detection of element and vessel is performed with inspiration, case of leak detection and two mass spectrometry. The total leak rate of vessel is bellow 1 x 10 -5 Pa ·m 3 ·s -1 . The base pressure is 1 x 10 -5 Pa

  2. The pumping of hydrogen and helium by sputter-ion pumps

    International Nuclear Information System (INIS)

    Welch, K.M.; Pate, D.J.; Todd, R.J.

    1992-01-01

    The pumping of hydrogen in diode and triode sputter-ion pumps is discussed. The type of cathode material used in these pumps is shown to have a significant impact on the effectiveness with which hydrogen is pumped. Examples of this include data for pumps with aluminum and titanium-alloy cathodes. Diode pumps with aluminum cathodes are shown to be no more effective in the pumping of hydrogen than in the pumping of helium. The use of titanium or titanium alloy anodes is also shown to measurably impact on the speed of these pumps at.very low pressures. This stems from the fact that hydrogen is x10 6 more soluble in titanium than in stainless steel. Hydrogen becomes resident in the anodes because of fast neutral burial. Lastly, quantitative data are given for the He speeds and capacities of both noble and conventional diode and triode pumps. The effectiveness of various pump regeneration procedures, subsequent to the pumping of He, is reported.These included bakeout and N 2 glow discharge cleaning. The comparative desorption of He with the subsequent pumping of N 2 is reported on. The N 2 speed of these pumps was used as the benchmark for defining the size of the pumps vs. their respective He speeds

  3. Liquid metals pumping

    International Nuclear Information System (INIS)

    Le Frere, J.P.

    1984-01-01

    Pumps used to pump liquid metals depend on the liquid metal and on the type of application concerned. One deals more particularly with electromagnetic pumps, the main pumps used with mechanical pumps. To pump sodium in the nuclear field, these two types of pumps are used; the pumps of different circuits of Super Phenix are presented and described [fr

  4. Development and test of a plastic deep-well pump

    International Nuclear Information System (INIS)

    Zhang, Q H; Gao, X F; Xu, Y; Shi, W D; Lu, W G; Liu, W

    2013-01-01

    To develop a plastic deep-well pump, three methods are proposed on structural and forming technique. First, the major hydraulic components are constructed by plastics, and the connection component is constructed by steel. Thus the pump structure is more concise and slim, greatly reducing its weight and easing its transportation, installation, and maintenance. Second, the impeller is designed by maximum diameter method. Using same pump casing, the stage head is greatly increased. Third, a sealing is formed by impeller front end face and steel end face, and two slots are designed on the impeller front end face, thus when the two end faces approach, a lubricating pair is formed, leading to an effective sealing. With above methods, the pump's axial length is greatly reduced, and its stage head is larger and more efficient. Especially, the pump's axial force is effectively balanced. To examine the above proposals, a prototype pump is constructed, and its testing results show that the pump efficiency exceeds the national standard by 6%, and the stage head is improved by 41%, meanwhile, its structure is more concise and ease of transportation. Development of this pump would provide useful experiences for further popularity of plastic deep-well pumps

  5. 41 CFR 102-117.280 - What aspects of the TSP's performance are important to measure?

    Science.gov (United States)

    2010-07-01

    ...'s performance are important to measure? 102-117.280 Section 102-117.280 Public Contracts and... § 102-117.280 What aspects of the TSP's performance are important to measure? Important TSP performance...) Percentage of customer satisfaction reports on carrier performance. ...

  6. A high-flow holweck pump for fusion applications

    International Nuclear Information System (INIS)

    Iseli, M.; Dinner, P.J.; Murdoch, D.K.

    1995-01-01

    Present concepts for power reactors require high pumping speed for the torus exhaust (10 5 -10 6 1/s) with low tritium inventories. Conventional approaches using Compound Cryopumps necessitate high tritium inventories and Turbomolecular pumps require large scale-up in throughput and are sensitive to eddy current heating of the rotor and sudden venting thrust. Cooling the gas to low temperature (20K) increases the gas density at the pump-entrance enough to obtain high throughputs from compact mechanical devices such as molecular drag pumps. A numerical model of such a pump and experimental results confirm the high pumping speed achievable with this concept. The model is used for extrapolation and optimisation of the design of a prototype. (orig.)

  7. Pump limiter experiment in the TFR tokamak

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    Pump limiter experiments are carried out in the TFR Tokamak. The first TFR pump limiter is located in the outer part of the torus, its double-throat head is made of graphite tiles, the neutralizer plates are made of stainless steel, and it is pumped by a 3500 l s -1 titanium sublimation pump. The first attempts showed that the exhaust efficiency ε of this pump limiter was low (1.5% of the total plasma particle efflux). To improve on these results, a new limiter head with a single longer throat has been built. The particles were better trapped and the pumping achieved an important decrease of the recycling coefficient. Geometric features and also the highly non linear regime of pressure in the pump limiter as a function of the density at the entrance slot could explain the increase by a factor 3.5 of the exhaust efficiency (ε = 5%). Ion temperatures of the order of a few eV have been deduced from Doppler broadening measurements at the neutralizer plate of the pump limiter. (orig.)

  8. Pumping services alliance: A new strategy for the 90's

    International Nuclear Information System (INIS)

    Milligan, M.R.; Smith, T.; Crombie, D.

    1993-01-01

    Shell Canada has forged a pumping services alliance with Nowsco Well Service Ltd. for an initial two year period. The alliance will cover pumping related services such as well cementation, well stimulation, coiled tubing work and, in the future could include other services such as pressure testing, corrosion inhibition treatments, flowline pigging, and pumping pipeline inspection tools. The alliance represents a major challenge in operating philosophy away from a competitive bidding strategy to a new strategy of forging business alliances that afford both parties benefits in a more cooperative mode. The alliance incorporates the service company more into the business of Shell Canada and comprises engineering and operations capability. The perceived benefits such an alliance would bring to the business are identified and the key issues that guided selection are documented. Detailed submissions from four major service companies were received and reviwed in a prequalification stage; final selection was made by a multi-disciplinary team. A joint mission statement was prepared that represented Nowsco's and Shell's vision of the alliance and helped guide the negotiations leading to a contract being struck complete with key result areas and performance measurement criteria. 5 refs

  9. Continuously pumping and reactivating gas pump

    International Nuclear Information System (INIS)

    Batzer, T.H.; Call, W.R.

    1984-01-01

    Apparatus for continuous pumping using cycling cyropumping panels. A plurality of liquid helium cooled panels are surrounded by movable nitrogen cooled panels the alternatively expose or shield the helium cooled panels from the space being pumped. Gases condense on exposed helium cooled panels until the nitrogen cooled panels are positioned to isolate the helium cooled panels. The helium cooled panels are incrementally warmed, causing captured gases to accumulate at the base of the panels, where an independent pump removes the gases. After the helium cooled panels are substantially cleaned of condensate, the nitrogen cooled panels are positioned to expose the helium cooled panels to the space being pumped

  10. Continuously pumping and reactivating gas pump

    Science.gov (United States)

    Batzer, Thomas H.; Call, Wayne R.

    1984-01-01

    Apparatus for continuous pumping using cycling cyropumping panels. A plurality of liquid helium cooled panels are surrounded by movable nitrogen cooled panels the alternatively expose or shield the helium cooled panels from the space being pumped. Gases condense on exposed helium cooled panels until the nitrogen cooled panels are positioned to isolate the helium cooled panels. The helium cooled panels are incrementally warmed, causing captured gases to accumulate at the base of the panels, where an independent pump removes the gases. After the helium cooled panels are substantially cleaned of condensate, the nitrogen cooled panels are positioned to expose the helium cooled panels to the space being pumped.

  11. Pumping characteristics for H2, CO and gas mixture of H2 and CO of distributed ion pump for the SPring-8 storage ring

    International Nuclear Information System (INIS)

    Hirano, Nobuo; Kobari, Toshiaki; Matsumoto, Manabu

    1995-01-01

    Evacuation in the vacuum chamber of the deflection magnet part of the SPring-8 storage ring is planned to be performed with a non evaporable getter pump (NEG) as well as a distributed ion pump (DIP). Pumping characteristics for H 2 , CO and a gas mixture of H 2 and CO of DIP was investigated. The structure of the DIP constructed on a trial basis and an experimental setup to measure the DIP pumping characteristics were described. Pumping speed above 100 L/s per 1 m at the 10 -6 Pa device and pumping speed of about 500 L/s per 1 m at the 10 -7 Pa device were achieved for a gas mixture of H 2 and CO (37% and 55% CO). On the DIP saturated with CO, pumping speed for H 2 is about twice that of pumping speed for CO at the 10 -7 Pa device. Pumping speed for CO is about 1.5 times of the speed for N 2 at the 10 -6 Pa device. Pressure of 1.2 x 10 -8 Pa (9.0 x 10 -11 Torr) is achieved at a room temperature by baking at 150degC for 40 hr. Thus, it was confirmed that the DIP has sufficient pumping characteristics as a pump for the SPring-8 storage ring. (T.H.)

  12. Reactor coolant pump seal leakage monitoring

    International Nuclear Information System (INIS)

    Stevens, D.M.; Spencer, J.W.; Morris, D.J.; James, W.; Shugars, H.G.

    1986-01-01

    Problems with reactor coolant pump seals have historically accounted for a large percentage of unscheduled outages. Studies performed for the Electric Power Research Institute (EPRI) have shown that the replacement of coolant pump seals has been one of the leading causes of nuclear plant unavailability over the last ten years. Failures of coolant pump seals can lead to primary coolant leakage rates of 200-500 gallons per minute into the reactor building. Airborne activity and high surface contamination levels following these failures require a major cleanup effort and increases the time and personnel exposure required to refurbish the pump seals. One of the problems in assessing seal integrity is the inability to accurately measure seal leakage. Because seal leakage flow is normally very small, it cannot be sensed directly with normal flow instrumentation, but must be inferred from several other temperature and flow measurements. In operating plants the leakage rate has been quantified with a tipping-bucket gauge, a device which indicates when one quart of water has been accumulated. The tipping-bucket gauge has been used for most rainfall-intensity monitoring. The need for a more accurate and less expensive gauge has been addressed. They have developed a drop-counter precipitation sensor has been developed and optimized. The applicability of the drop-counter device to the problem of measuring seal leakage is being investigated. If a review of system specification and known drop-counter performance indicates that this method is feasible for measuring seal leak rates, a drop-counter gauge will be fabricated and tested in the laboratory. If laboratory tests are successful the gauge will be demonstrated in a pump test loop at Ontario Hydro and evaluated under simulated plant conditions. 3 references, 2 figures

  13. Intercomparison of the comparative reactivity method (CRM) and pump-probe technique for measuring total OH reactivity in an urban environment

    Science.gov (United States)

    Hansen, R. F.; Blocquet, M.; Schoemaecker, C.; Léonardis, T.; Locoge, N.; Fittschen, C.; Hanoune, B.; Stevens, P. S.; Sinha, V.; Dusanter, S.

    2015-10-01

    The investigation of hydroxyl radical (OH) chemistry during intensive field campaigns has led to the development of several techniques dedicated to ambient measurements of total OH reactivity, which is the inverse of the OH lifetime. Three techniques are currently used during field campaigns, including the total OH loss rate method, the pump-probe method, and the comparative reactivity method. However, no formal intercomparison of these techniques has been published so far, and there is a need to ensure that measurements of total OH reactivity are consistent among the different techniques. An intercomparison of two OH reactivity instruments, one based on the comparative reactivity method (CRM) and the other based on the pump-probe method, was performed in October 2012 in a NOx-rich environment, which is known to be challenging for the CRM technique. This study presents an extensive description of the two instruments, the CRM instrument from Mines Douai (MD-CRM) and the pump-probe instrument from the University of Lille (UL-FAGE), and highlights instrumental issues associated with the two techniques. It was found that the CRM instrument used in this study underestimates ambient OH reactivity by approximately 20 % due to the photolysis of volatile organic compounds (VOCs) inside the sampling reactor; this value is dependent on the position of the lamp within the reactor. However, this issue can easily be fixed, and the photolysis of VOCs was successfully reduced to a negligible level after this intercomparison campaign. The UL-FAGE instrument may also underestimate ambient OH reactivity due to the difficulty to accurately measure the instrumental zero. It was found that the measurements are likely biased by approximately 2 s-1, due to impurities in humid zero air. Two weeks of ambient sampling indicate that the measurements performed by the two OH reactivity instruments are in agreement, within the measurement uncertainties for each instrument, for NOx mixing ratios

  14. Measurement and evaluation of pumping speed and gas discharge characteristics of titanium getter pump by conductance modulation method

    International Nuclear Information System (INIS)

    Terada, Keiko; Okano, Tatsuo; Tsuji, Hiroshi.

    1989-01-01

    The conductance modulation method is designed to determine the pumping speed from a known conductance. With the method, the intrinsic pumping speed Sp and net pumping speed S * can be determined in a wide range up to near the ultimate pressure. In the present study, the pumping speed and gas discharge rate of a titanium getter pump at 77K are analyzed, and the results are compared with measurements made at room temperature. The pressure in a vacuum chamber depends on the gas load and the pumping speed. The pressure varies from P A to P B as the conductance of the orifice is changed from C A to C B . The ultimate pressure also changes from P AO to P BO . The intrinsic and net pumping speeds can be calculated from P A , P B , P AO and P BO . The major feature of the conductance modulation method is that the intrinsic and net pumping speeds can be determined from a change in the conductance without knowing the sensitivity of the vacuum meter or the flow rate of gas entering the chamber from outside. With this feature, the method is very effective for measuring the balance between the gas discharge and pumping speed near the ultimate pressure. (N.K.)

  15. Quantitative pump-induced wavefront distortions in laser-diode- and flash-lamp-pumped Nd:YLF laser rods

    International Nuclear Information System (INIS)

    Skeldon, M.D.; Saager, R.B.; Seka, W.

    1999-01-01

    Detailed interferometric measurements of the induced thermal distortions due to laser-diode and xenon flashlamp pumping of Nd:YLF are presented. The thermal distortions are quantified in terms of the primary aberrations of defocus, astigmatism, coma, and spherical. Defocus and astigmatism are shown to dominate the thermal aberrations. The measured defocus and astigmatism are converted to the conventional thermal-focal lengths in two perpendicular directions with respect to the Nd:YLF crystalline c axis for each of the two polarization states σ and π. A comparison of the thermal-focal lengths measured with the xenon flashlamp- and laser-diode-pumped rods is given when the rods are pumped to the same small-signal gain. The authors calculate effective dioptric-power coefficients from the data for comparison to those reported in the literature for krypton-flashlamp pumping. A thermal-time constant of 1.5 s is measured for the laser-diode-pumped Nd:YLF laser rod

  16. Effect of pump limiter throat on pumping efficiency

    International Nuclear Information System (INIS)

    Ghendrih, P.; Grosman, A.; Samain, A.; Capes, H.; Morera, J.P.

    1988-01-01

    The necessary control of plasma edge density has led to the development of pump limiters to achieve this task. On Tore Supra, where a large part of the program is devoted to plasma edge studies, two types of such density control apparatus have been implemented, a set of pump limiters and the pumps associated to the ergodic divertor (magnetically assisted pump limiters). Generally two different kinds of pump limiters can be used, those with a throat which drives the plasma from the open edge plasma (SOL) to the neutralizer plate, and those without or with a very short throat. We are interested here in this aspect of the pump limiter concept, i.e. on the throat effect on neutral density build-up in the vicinity of the pumping plates (and hence on pumping efficieny). The underlying idea of this throat effect can be readily understood; indeed while the neutral capture in pump limiters without throats is only a ballistic effect, on expects the plasma to improve the efficiency of pump-limiters via plasma-neutral-sidewall interactions in the throat. This problem has been studied both numerically and analytically. The paper is divided as follows. In section 2, we describe the basic features of pump-limiters which are modelized by the numerical code Cezanne. Section 3 is devoted to the throat length effect considering in particular the neutral density profile in the throat and the neutral density buil-up as a function of the throat lenght. In section 4, we show that the plugging effect occurs for reasonnable values of throat lengths. An analytical value of the plugging length is discussed and compared to the values obtained numerically

  17. An actively mode-locked Ho: YAG solid laser pumped by a Tm: YLF laser

    International Nuclear Information System (INIS)

    Yao, B Q; Cui, Z; Wang, J; Duan, X M; Dai, T Y; Du, Y Q; Yuan, J H; Liu, W

    2015-01-01

    A continuous wave mode-locked (CWML) Ho: YAG laser based on an acousto-optic modulator (AOM) pumped by a 1.9 μm Tm: YLF laser is demonstrated. This is the first time a report on an active CWML Ho: YAG laser has been published. A maximum output power of 1.04 W at 2097.25 nm in the CWML regime is obtained at a pump power of 13.2 W, corresponding to a slope efficiency of 13.3%. The mode-locked pulse repetition frequency is 82.76 MHz and the single pulse energy is 12.57 nJ. The mode-locked pulse width is 102 ps measured through a no-background second harmonic autocorrelation with KTP as the nonlinear crystal. Furthermore, the M 2 factor is calculated to be 1.146. (letter)

  18. Modeling, simulation, and identification of the servo pumps

    Energy Technology Data Exchange (ETDEWEB)

    Negoita, C G; Vasiliu, D; Vasiliu, Ne; Calinoiu, C, E-mail: claudia.negoita@gmail.co [Faculty of Power Engineering, University POLITEHNICA of Bucharest 313, Splaiul Independentei, Bucharest, 060042 (Romania)

    2010-08-15

    This paper contains the results of a systematic research on the steady-state behavior, and the transients occurring in a basic hydrostatic system containing a servo pump. The optimum structure of such a device working in given condition is found step by step, the synthesis stages are alternating with the analysis ones, in order to establish some general synthesis criteria, as well as for creating some images of the design parameters influence on the real system dynamic behavior. The dynamic computation of the servo pumps is based on the experimental researches carried out by the authors on the control force of the variable displacement axial piston pumps. The analysis takes into account the pressure feedback, the rigid or spring mechanical feedback or the electrical position feedback. The theoretical models are developed by AMESim (Advanced Modeling and Simulation Environment for Systems Engineering). The experimental tests were performed by the aid of LabVIEW software from National Instruments Corporation in the frame of a national certified laboratory set up by the aid of Parker Hannifin Corporation.

  19. Hybrid pump for Pazflor deepwater development

    Energy Technology Data Exchange (ETDEWEB)

    Bibet, Pierre-Jean

    2010-07-01

    Subsea Processing gives engineers permanent technical challenges due to the comprehensive specifications which often stretch the proven limits of technology. It is particularly true for pumps that have to boost a multiphase effluent, because they must, often at the same time, be tolerant to free gas, able to handle very viscous, generate a high ?P, and be efficient. The Pazflor project decided to base the development on full utilization of subsea pumps. This paper presents the state of the art of the pumps that are designed to be installed on the sea floor. It further describes why existing technology could not match the technical requirements for the Pazflor project. It finally presents the pump specifically developed for this world first full field's development application, the so called 'Hybrid Pump', with the description of the associated qualification program and results. (Author)

  20. Quantitative proteomic analysis of the inhibitory effects of CIL-102 on viability and invasiveness in human glioma cells

    International Nuclear Information System (INIS)

    Teng, Chih-Chuan; Kuo, Hsing-Chun; Sze, Chun-I

    2013-01-01

    CIL-102 (1-[4-(furo[2,3-b]quinolin-4-ylamino)phenyl]ethanone), the major active agent of the alkaloid derivative, has been demonstrated to exert anticancer effects. Herein, we present an investigation focused on the identification of the target(s) of CIL-102's action and the mechanism of its action in apoptotic and anti-invasive pathways. Proteomic approaches were used to purify and identify the protein substrates using 2D difference gel electrophoresis (2D SDS-PAGE) to assess changes in the expression of relevant protein treatment with CIL-102 that resulted in the inhibition of viability and invasion. Our results demonstrate that CIL-102 treatment of U87 cells decreased cell proliferation and invasiveness. CIL-102 dose-dependent induction of apoptosis and inhibitory invasiveness were accompanied by sustained phosphorylation of JNK1/2 and p70S6K as well as generation of the reactive oxygen species. In addition, differential proteins displayed between CIL-102-treated and untreated U87 were determined and validated. There were 11 differentially expressed proteins between the CIL-102-treated and untreated groups. Furthermore, we demonstrated that CIL-102 inhibited cancer cell proliferation and reduced anti-invasion properties by up-regulating the levels of FUMH (Fumarate hydratase). The investigation demonstrated that there was an increase in the cellular levels of FUMH in the CIL-102 reduction in viability and invasion via the activation of JNK1/2 and mTOR signaling modules. NAC administration and shRNA FUMH conferred resistance to CIL-102-inhibited HIF1α and MMP-2 levels via inhibition of JNK1/2 and mTOR activation. We concluded that CIL-102-induced an apoptosis cascade and decreased aggressiveness in astrocytoma cells by modulation of mitochondria function, providing a new mechanism for CIL-102 treatment. - Highlights: • We found the effect of CIL-102 on neuroblastoma cells. • Fumarate hydratase as a CIL-102's target by proteomic differential displays. • CIL

  1. Quantitative proteomic analysis of the inhibitory effects of CIL-102 on viability and invasiveness in human glioma cells

    Energy Technology Data Exchange (ETDEWEB)

    Teng, Chih-Chuan [Institute of Nursing and Department of Nursing, Chang Gung University of Science and Technology, Taiwan (China); Chronic Diseases and Health Promotion Research Center, CGUST, Taiwan (China); Institute of Basic Medicine Science, National Cheng Kung University, Tainan, Taiwan (China); Kuo, Hsing-Chun [Institute of Nursing and Department of Nursing, Chang Gung University of Science and Technology, Taiwan (China); Chronic Diseases and Health Promotion Research Center, CGUST, Taiwan (China); Department of Medical Research China Medical University Hospital, Taichung, Taiwan (China); Sze, Chun-I, E-mail: szec@mail.ncku.edu.tw [Institute of Basic Medicine Science, Department of Cell Biology and Anatomy and Pathology, National Cheng Kung University, Tainan, Taiwan (China)

    2013-11-01

    CIL-102 (1-[4-(furo[2,3-b]quinolin-4-ylamino)phenyl]ethanone), the major active agent of the alkaloid derivative, has been demonstrated to exert anticancer effects. Herein, we present an investigation focused on the identification of the target(s) of CIL-102's action and the mechanism of its action in apoptotic and anti-invasive pathways. Proteomic approaches were used to purify and identify the protein substrates using 2D difference gel electrophoresis (2D SDS-PAGE) to assess changes in the expression of relevant protein treatment with CIL-102 that resulted in the inhibition of viability and invasion. Our results demonstrate that CIL-102 treatment of U87 cells decreased cell proliferation and invasiveness. CIL-102 dose-dependent induction of apoptosis and inhibitory invasiveness were accompanied by sustained phosphorylation of JNK1/2 and p70S6K as well as generation of the reactive oxygen species. In addition, differential proteins displayed between CIL-102-treated and untreated U87 were determined and validated. There were 11 differentially expressed proteins between the CIL-102-treated and untreated groups. Furthermore, we demonstrated that CIL-102 inhibited cancer cell proliferation and reduced anti-invasion properties by up-regulating the levels of FUMH (Fumarate hydratase). The investigation demonstrated that there was an increase in the cellular levels of FUMH in the CIL-102 reduction in viability and invasion via the activation of JNK1/2 and mTOR signaling modules. NAC administration and shRNA FUMH conferred resistance to CIL-102-inhibited HIF1α and MMP-2 levels via inhibition of JNK1/2 and mTOR activation. We concluded that CIL-102-induced an apoptosis cascade and decreased aggressiveness in astrocytoma cells by modulation of mitochondria function, providing a new mechanism for CIL-102 treatment. - Highlights: • We found the effect of CIL-102 on neuroblastoma cells. • Fumarate hydratase as a CIL-102's target by proteomic differential

  2. Small-sized pump for the target chamber of the E-SUVI accelerator

    International Nuclear Information System (INIS)

    Borts, B.V.; Kravchenko, S.F.; Pisarev, G.V.; Rubashko, V.G.; Khorenko, V.K.

    1980-01-01

    The target chamber of the accelerator ESUVI is located at the high voltage end of the accelerating tube under the electrostatic generator conductor. The pumping out from the target chamber region has been performed through the accelerating tube its rate constituting 1.5 l/s which resulted in oxidation and contamination of the surface of irradiated targets in the course of the irradiation of chemically active materials. For obtaining high vacuum in a target chamber a small-size gettering-ionic pump of the ORBITRON type has been developed which operates in the autonomous mode. The pump pumping out rate in the pressure range 10 -5 -10 -7 mm Hg constitutes for air and nitrogen 20-25 l/s, ffor oxygen 30-40 l/s, for hydrogen 100-120 l/s. The pump weight without supply units is 2 kg. The pumps permits performing pressure indicator in the target chamber. Using the developed pump makes possible to decrease the target chamber pressure to 1x10 -6 mm Hg for active gases to 10 -8 -10 -9 mm Hg

  3. Study of Hydrogen Pumping through Condensed Argon in Cryogenic pump

    International Nuclear Information System (INIS)

    Jadeja, K A; Bhatt, S B

    2012-01-01

    In ultra high vacuum (UHV) range, hydrogen is a dominant residual gas in vacuum chamber. Hydrogen, being light gas, pumping of hydrogen in this vacuum range is limited with widely used UHV pumps, viz. turbo molecular pump and cryogenic pump. Pre condensed argon layers in cryogenic pump create porous structure on the surface of the pump, which traps hydrogen gas at a temperature less than 20° K. Additional argon gas injection in the cryogenic pump, at lowest temperature, generates multiple layers of condensed argon as a porous frost with 10 to 100 A° diameters pores, which increase the pumping capacity of hydrogen gas. This pumping mechanism of hydrogen is more effective, to pump more hydrogen gas in UHV range applicable in accelerator, space simulation etc. and where hydrogen is used as fuel gas like tokamak. For this experiment, the cryogenic pump with a closed loop refrigerator using helium gas is used to produce the minimum cryogenic temperature as ∼ 14° K. In this paper, effect of cryosorption of hydrogen is presented with different levels of argon gas and hydrogen gas in cryogenic pump chamber.

  4. Evolution from a natural flavones nucleus to obtain 2-(4-Propoxyphenyl)quinoline derivatives as potent inhibitors of the S. aureus NorA efflux pump.

    Science.gov (United States)

    Sabatini, Stefano; Gosetto, Francesca; Manfroni, Giuseppe; Tabarrini, Oriana; Kaatz, Glenn W; Patel, Diixa; Cecchetti, Violetta

    2011-08-25

    Overexpression of efflux pumps is an important mechanism by which bacteria evade the effects of substrate antimicrobial agents. Inhibition of such pumps is a promising strategy to circumvent this resistance mechanism. NorA is a Staphylococcus aureus efflux pump that confers reduced susceptibility to many structurally unrelated agents, including fluoroquinolones, resulting in a multidrug resistant phenotype. In this work, a series of 2-phenyl-4(1H)-quinolone and 2-phenyl-4-hydroxyquinoline derivatives, obtained by modifying the flavone nucleus of known efflux pump inhibitors (EPIs), were synthesized in an effort to identify more potent S. aureus NorA EPIs. The 2-phenyl-4-hydroxyquinoline derivatives 28f and 29f display potent EPI activity against SA-1199B, a strain that overexpresses norA, in an ethidium bromide efflux inhibition assay. The same compounds, in combination with ciprofloxacin, were able to completely restore its antibacterial activity against both S. aureus SA-K2378 and SA-1199B, norA-overexpressing strains. © 2011 American Chemical Society

  5. Hemoglobin Level to Facilitate Off-Pump Coronary Artery Bypass without Transfusion.

    Science.gov (United States)

    Kim, Kun Il; Lee, Won Yong; Ko, Ho Hyun; Kim, Hyoung Soo; Jeong, Jae Han

    2014-08-01

    Conservation of blood during cardiac surgery is important because of the shortage of donor blood, risks associated with transfusion, and the costs of allogeneic blood products. This retrospective study explored the feasibility of off-pump coronary artery bypass (OPCAB) without transfusion. One hundred and two consecutive patients underwent OPCAB from January 2007 to June 2012 at Hallym University Sacred Heart Hospital. Excluding 10 chronic renal failures patients, 102 patients were enrolled. Their characteristics, clinical data, and laboratory data were analyzed. We investigated the success rate of OPCAB without transfusion according to pre-operative hemoglobin (Hb), and the cutoff point of the Hb level and the risk factors for transfusion. We implemented multidisciplinary blood-saving protocols. The overall operative mortality and the success rate of OPCAB without transfusion were 2.9% (3/102) and 73.5% (75/102). The success rates in patients with Hb70 years, diagnosis of acute myocardial infarction, preoperative Hb and creatinine levels, and operation time. The events precipitating the need for transfusion were low Hb level in 9 patients and hypotension or excessive bleeding in 18 patients. The preoperative Hb level of >11 facilitates OPCAB without transfusion. These results suggest that transfusion-free OPCAB can be performed by modifying the risk factors and correctable causes of transfusion and improving various blood salvage methods.

  6. High-Temperature Salt Pump Review and Guidelines - Phase I Report

    Energy Technology Data Exchange (ETDEWEB)

    Robb, Kevin R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Jain, Prashant K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Hazelwood, Thomas J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2016-05-01

    Fluoride salt cooled high-temperature reactor (FHR) concepts include pumps for forced circulation of the primary and secondary coolants. As part of a cooperative research and development agreement between the Shanghai Institute of Applied Physics and the Oak Ridge National Laboratory (ORNL), a research project was initiated to aid in the development of pumps for high-temperature salts. The objectives of the task included characterization of the behavior of an existing ORNL LSTL pump; design and test a modified impeller and volute for improved pump characteristics; and finally, provide lessons learned, recommendations, and guidelines for salt pump development and design. The pump included on the liquid salt test loop (LSTL) at ORNL served as a case study. This report summarizes the progress to date. The report is organized as follows. First, there is a review, focused on pumps, of the significant amount of work on salts at ORNL during the 1950s 1970s. The existing pump on the LSTL is then described. Plans for hot and cold testing of the pump are then discussed, including the design for a cold shakedown test stand and the required LSTL modifications for hot testing. Initial hydraulic and vibration modeling of the LSTL pump is documented. Later, test data from the LSTL will be used to validate the modeling approaches, which could then be used for future pump design efforts. Some initial insights and test data from the pump are then provided. Finally, some preliminary design goals and requirements for a future LSTL pump are provided as examples of salt pump design considerations.

  7. High-Temperature Salt Pump Review and Guidelines - Phase I Report

    International Nuclear Information System (INIS)

    Robb, Kevin R.; Jain, Prashant K.; Hazelwood, Thomas J.

    2016-01-01

    Fluoride salt cooled high-temperature reactor (FHR) concepts include pumps for forced circulation of the primary and secondary coolants. As part of a cooperative research and development agreement between the Shanghai Institute of Applied Physics and the Oak Ridge National Laboratory (ORNL), a research project was initiated to aid in the development of pumps for high-temperature salts. The objectives of the task included characterization of the behavior of an existing ORNL LSTL pump; design and test a modified impeller and volute for improved pump characteristics; and finally, provide lessons learned, recommendations, and guidelines for salt pump development and design. The pump included on the liquid salt test loop (LSTL) at ORNL served as a case study. This report summarizes the progress to date. The report is organized as follows. First, there is a review, focused on pumps, of the significant amount of work on salts at ORNL during the 1950s 1970s. The existing pump on the LSTL is then described. Plans for hot and cold testing of the pump are then discussed, including the design for a cold shakedown test stand and the required LSTL modifications for hot testing. Initial hydraulic and vibration modeling of the LSTL pump is documented. Later, test data from the LSTL will be used to validate the modeling approaches, which could then be used for future pump design efforts. Some initial insights and test data from the pump are then provided. Finally, some preliminary design goals and requirements for a future LSTL pump are provided as examples of salt pump design considerations.

  8. Evolution in miniaturized column liquid chromatography instrumentation and applications: An overview.

    Science.gov (United States)

    Nazario, Carlos E D; Silva, Meire R; Franco, Maraíssa S; Lanças, Fernando M

    2015-11-20

    The purpose of this article is to underline the miniaturized LC instrumental system and describe the evolution of commercially available systems by discussing their advantages and drawbacks. Nowadays, there are already many miniaturized LC systems available with a great variety of pump design, interface and detectors as well as efficient columns technologies and reduced connections devices. The solvent delivery systems are able to drive the mobile phase without flow splitters and promote gradient elution using either dual piston reciprocating or syringe-type pumps. The mass spectrometry as detection system is the most widely used detection system; among many alternative ionization sources direct-EI LC-MS is a promising alternative to APCI. In addition, capillary columns are now available showing many possibilities of stationary phases, inner diameters and hardware materials. This review provides a discussion about miniaturized LC demonstrating fundamentals and instrumentals' aspects of the commercially available miniaturized LC instrumental system mainly nano and micro LC formats. This review also covers the recent developments and trends in instrumentation, capillary and nano columns, and several applications of this very important and promising field. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Progression of scoliosis in patients with spastic quadriplegia after the insertion of an intrathecal baclofen pump.

    Science.gov (United States)

    Ginsburg, Glen M; Lauder, Anthony J

    2007-11-15

    Medical and radiographic review of 19 consecutive patients with spastic quadriplegia before and after intrathecal baclofen pump insertion with special attention paid to progression of scoliosis. Many orthopedic surgeons who treat spastic quadriplegic patients have noticed a trend of marked scoliosis progression after the administration of intrathecal baclofen (ITB) via subcutaneous pump and catheter. The purpose of this study is to quantify scoliosis progression in this patient population before and after baclofen administration and compare this to published natural history data. The authors had noted rapid progression of scoliosis in spastic quadriplegic patients after intrathecal baclofen pump insertion. This had been noted at other centers, but no significant statistical analysis had been done comparing prepump to postpump scoliosis progression in these patients. To document the magnitude and rate of scoliosis progressions after the placement of an ITB pump, the charts and radiographs of 19 consecutive nonambulatory patients with spastic quadriplegia and an ITB pump were reviewed. To document the rate of scoliosis progression, each patient had at least 2 pre and 2 postpump insertion spinal radiographs made. All radiographs were made with the patients in the supine position without orthoses. A board-certified orthopedic surgeon reviewed these radiographs. Skeletal maturity was assessed using Risser grading. Catheter tip location and rate of baclofen administration were recorded. For 19 patients with complete radiographic data, average Cobb angles were 10.2 degrees before pump insertion and 25 degrees at an average of 20.9 months after pump insertion (P quadriplegia and ITB pump. The authors are now performing spinal fusions for curves that exceed 40 degrees to 50 degrees in the presence of an ITB pump as recommended by previous reviews of scoliosis and accompanying quadriplegia.

  10. 7. heat pump forum. Lectures; 7. Forum Waermepumpe. Vortraege

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2009-07-01

    Within the 7th heat pump forum of the German Federal Association for heat pumps e.V. (Berlin, Federal Republic of Germany) between 22nd and 23rd March, 2009, at the Ellington Hotel in Berlin, the following lectures were held: (1) Potentials of the near-surface geothermics in Germany (H. Gassner); (2) Significance of renewable energy sources after the Bundestag election (D. Schuetz); (3) European draft laws in survey: EE regulation, EPBD, EuP (M. Ferber); (4) My personal experiences with heat pumps (G. Nuesslein); (5) European energy policy with relevance to the German heating market (A. Luecke); (6) Do we economize sustainable? - Reactions of companies on the challenge of a sustainable development (C. Berg); (7) Utilize the crisis now - the economic chances of a sustainable energy supply (C. Kemfert); (8) EE regulation: Status quo. Report of the National Renewable Eneregy Action Plan (NREAP) (K. Freier); (9) A legal evaluation of the EE regulation for the energy market (T. Mueller); (10) MAP funding guidelines (U. Sattler); (11) Utilization of renewable energies for heat generation - Experiences of the housing industry (I. Vogler); (12) Combination o the central near-heat supply and decentral drinking water heating in multi-storey new buildings (M.-J. Mucke); (13) Eddicient contracting for heat pumps (A. Kaemmerer); (14) Eco-Design - EU-guidelines and their effects on the heat pump (M. Roffe-Vidal); (15) The quality seal for heat pumps in the Swiss promotion policy (R. Phillips); (16) Enhancement of the significance of the EHPA quality seal in Europe (K. Ochsner); (17) Chances and benefit of export initiatives for the heat pump industry (C. Wittig); (18) The heat pump market in Ireland (P. Murphy); (19) Quantum heat pumps in double capacitors (M. Enzensperger); (20) First CO{sub 2}-free football stadium worldwide thanks to heat pumps (A. Poehlmann); (21) The heat pump in turnkey solid-construction house (C. Schmidt); (22) Instruments of quality requirement and

  11. 49 CFR 1014.102 - Application.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 8 2010-10-01 2010-10-01 false Application. 1014.102 Section 1014.102 Transportation Other Regulations Relating to Transportation (Continued) SURFACE TRANSPORTATION BOARD, DEPARTMENT... HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE SURFACE TRANSPORTATION BOARD § 1014.102 Application...

  12. 40 CFR 152.102 - Publication.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Publication. 152.102 Section 152.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Agency Review of Applications § 152.102 Publication. The Agency will...

  13. Submersible fans and pumps for cryogenic fluids

    International Nuclear Information System (INIS)

    Mark, J.W.

    1986-01-01

    Submersible electric motor driven fans of three sizes have been designed, built and operated at 21 0 K at the Stanford Linear Accelerator Center. The largest is a 100-mm diameter, 2 stage vaneaxial fan with a nominal capacity of 6 L/s at 2 m head. It is driven by a 4 pole, 3 phase induction motor that runs at 1750 rpm. The next smaller one is an 85-mm diameter centrifugal pump. It pumps 3 L/s at a head of 5 m. The third is a 75-mm single stage vaneaxial fan with a nominal capacity is 3 L/s at a head of 2 m. The 85-mm pump and the 75-mm fan are driven by 2 pole, 3 phase induction motors running at 3550 rpm. The motors were modified to operate submerged in the cryogenic fluid. The pumps have been operated in liquid hydrogen, liquid deuterium, and pressurized helium gas at 21 0 K. They can also operate with denser fluids such as liquid nitrogen, but rotational speed, capacity, and head will be reduced. They have been operated while submerged in liquid helium

  14. Dry vacuum pumps

    International Nuclear Information System (INIS)

    Sibuet, R

    2008-01-01

    For decades and for ultimate pressure below 1 mbar, oil-sealed Rotary Vane Pumps have been the most popular solution for a wide range of vacuum applications. In the late 80ies, Semiconductor Industry has initiated the development of the first dry roughing pumps. Today SC applications are only using dry pumps and dry pumping packages. Since that time, pumps manufacturers have developed dry vacuum pumps technologies in order to make them attractive for other applications. The trend to replace lubricated pumps by dry pumps is now spreading over many other market segments. For the Semiconductor Industry, it has been quite easy to understand the benefits of dry pumps, in terms of Cost of Ownership, process contamination and up-time. In this paper, Technology of Dry pumps, its application in R and D/industries, merits over conventional pumps and future growth scope will be discussed

  15. Double-effect absorption heat pump, phase 3

    Science.gov (United States)

    Cook, F. B.; Cremean, S. P.; Jatana, S. C.; Johnson, R. A.; Malcosky, N. D.

    1987-06-01

    The RD&D program has resulted in design, development and testing of a packaged prototype double-effect generator cycle absorption gas heat pump for the residential and small commercial markets. The 3RT heat pump prototype has demonstrated a COPc of 0.82 and a COPh of 1.65 at ARI rating conditions. The heat pump prototype includes a solid state control system with built-in diagnostics. The absorbent/refrigerant solution thermophysical properties were completely characterized. Commercially available materials of construction were identified for all heat pump components. A corrosion inhibitor was identified and tested in both static and dynamic environments. The safety of the heat pump was analyzed by using two analytical approaches. Pioneer Engineering estimated the factory standard cost to produce the 3RT heat pump at $1,700 at a quantity of 50,000 units/year. One United States patent was allowed covering the heat pump technology, and two divisional applications and three Continuation-in-Park Applications were filed with the U.S.P.T.O. Corresponding patent coverage was applied for in Canada, the EEC, Australia, and Japan. Testing of the prototype heat pump is continuing, as are life tests of multiple pump concepts amd long-term dynamic corrosion tests. Continued development and commercialization of gas absorption heat pumps based on the technology are recommended.

  16. Off-Pump Versus On-Pump Coronary Artery Bypass Grafting

    DEFF Research Database (Denmark)

    Møller, Christian H; Steinbrüchel, Daniel A

    2014-01-01

    Coronary artery bypass grafting (CABG) remains the preferred treatment in patients with complex coronary artery disease. However, whether the procedure should be performed with or without the use of cardiopulmonary bypass, referred to as off-pump and on-pump CABG, is still up for debate....... Intuitively, avoidance of cardiopulmonary bypass seems beneficial as the systemic inflammatory response from extracorporeal circulation is omitted, but no single randomized trial has been able to prove off-pump CABG superior to on-pump CABG as regards the hard outcomes death, stroke or myocardial infarction....... In contrast, off-pump CABG is technically more challenging and may be associated with increased risk of incomplete revascularization. The purpose of the review is to summarize the current literature comparing outcomes of off-pump versus on-pump coronary artery bypass surgery....

  17. 22 CFR 225.102 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 225.102 Section 225.102 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PROTECTION OF HUMAN SUBJECTS § 225.102 Definitions. (a... includes communication or interpersonal contact between investigator and subject. “Private information...

  18. 45 CFR 2104.102 - Application.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2104.102 Section 2104.102 Public Welfare Regulations Relating to Public Welfare (Continued) COMMISSION OF FINE ARTS ENFORCEMENT OF....102 Application. This part applies to all programs or activities conducted by the agency. ...

  19. 29 CFR 1615.102 - Application.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Application. 1615.102 Section 1615.102 Labor Regulations Relating to Labor (Continued) EQUAL EMPLOYMENT OPPORTUNITY COMMISSION ENFORCEMENT OF NONDISCRIMINATION ON... COMMISSION AND IN ACCESSIBILITY OF COMMISSION ELECTRONIC AND INFORMATION TECHNOLOGY § 1615.102 Application...

  20. 45 CFR 1706.102 - Application.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1706.102 Section 1706.102 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND... CONDUCTED BY NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE § 1706.102 Application. This part...

  1. 7 CFR 959.102 - Communications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 959.102 Section 959.102 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Regulations General § 959.102 Communications. Unless otherwise provided in the order, or by specific direction...

  2. A simulation-based analysis of variable flow pumping in ground source heat pump systems with different types of borehole heat exchangers: A case study

    International Nuclear Information System (INIS)

    Zarrella, Angelo; Emmi, Giuseppe; De Carli, Michele

    2017-01-01

    Highlights: • The work focuses on the variable flow in ground source heat pump systems. • The constant and variable speed circulation pumps in the ground loop are compared. • The constant temperature difference control across the heat pump is studied. • The variable flow affects the energy performance of the heat pump. • The constant temperature difference control offers an attractive energy saving. - Abstract: A simulation model of ground source heat pump systems has been used to investigate to what extent a variable flow of the heat-carrier fluid of the ground loop affects the energy efficiency of the entire system. The model contemporaneously considers the borehole heat exchangers, the heat pump, the building load, and the control strategies for the circulation pumps of the ground loop. A constant speed of the circulation pumps of the ground loop was compared with a variable flow controlled by means of a constant temperature difference across the heat pump on the ground side considering the load profile of an office building located in North Italy. The analysis was carried out for a single U-tube, double U-tube and coaxial pipe heat exchangers. The control strategies adopted to manage the flow rate of the heat-carrier fluid of the ground loop affect both the heat exchange rate of the borehole field and the heat pump’s long-term energy efficiency. The simulations show considerable differences in the system’s seasonal energy efficiency. The constant speed of the circulation pumps leads to the best results as far as the heat pump’s energy performance was concerned, but this advantage was lost because of the greater amount of electrical energy used by the circulation pumps; this, of course, affects the energy efficiency of the entire system. The optimal solution appears then to be a constant temperature difference in the heat-carrier fluid across the heat pump.

  3. 29 CFR 541.102 - Management.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Management. 541.102 Section 541.102 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS DEFINING AND... Executive Employees § 541.102 Management. Generally, “management” includes, but is not limited to...

  4. 46 CFR 507.102 - Application.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 9 2010-10-01 2010-10-01 false Application. 507.102 Section 507.102 Shipping FEDERAL MARITIME COMMISSION GENERAL AND ADMINISTRATIVE PROVISIONS ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE FEDERAL MARITIME COMMISSION § 507.102 Application. This...

  5. 17 CFR 149.102 - Application.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Application. 149.102 Section 149.102 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION ENFORCEMENT OF... COMMISSION § 149.102 Application. This part applies to all programs or activities conducted by the agency. ...

  6. 44 CFR 16.102 - Application.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Application. 16.102 Section 16.102 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... ACTIVITIES CONDUCTED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY § 16.102 Application. This regulation (§§ 16...

  7. 28 CFR 36.102 - Application.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 36.102 Section 36.102... ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General § 36.102 Application. (a) General. This part applies to any... courses related to applications, licensing, certification, or credentialing for secondary or postsecondary...

  8. 50 CFR 550.102 - Application.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Application. 550.102 Section 550.102 Wildlife and Fisheries MARINE MAMMAL COMMISSION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY MARINE MAMMAL COMMISSION § 550.102 Application. This part...

  9. 45 CFR 1214.102 - Application.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1214.102 Section 1214.102 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE....102 Application. This part applies to all programs or activities conducted by the agency, except for...

  10. 16 CFR 1028.102 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Definitions. 1028.102 Section 1028.102 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL PROTECTION OF HUMAN SUBJECTS § 1028.102... investigator and subject. “Private information” includes information about behavior that occurs in a context in...

  11. 49 CFR 28.102 - Application.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Application. 28.102 Section 28.102 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION § 28.102 Application. This part...

  12. From medicine to natural philosophy: Francis Hauksbee's way to the air-pump.

    Science.gov (United States)

    Brundtland, Terje

    2008-06-01

    Francis Hauksbee (1660-1713) is well known for his double-barrelled air-pump. However, the origin of this pump, and Hauksbee's background, are often described as a mystery. This text seeks to dispel the riddle. It is argued that Hauksbee's competence as an exceptional maker of air-pumps was developed between 1699 and 1703 as a result of his experiences with the construction, manufacturing and sale of cupping-glasses. His cupping utensils embodied a new design, where syringes were used to evacuate the glasses, instead of the traditional way by fire or mouth suction. These syringes, which in fact were small air-pumps, were perfected between 1699 and 1701. A larger syringe, introduced in 1701, served as a transition from the cupping-syringe to his first air-pump for use in natural philosophy. This syringe was described as a 'combined engine', which could serve as an air-pump, a condensing engine and a syringe for injecting air, wax or mercury into pathological specimens. Hauksbee's first air-pump was a single-barrelled model introduced in 1702, based on the combined engine. Its various features, such as easy and convenient leak-tightening, exact pressure measurements by an in-built barometer and an air-inlet function for readmission of air into the receiver, are discussed. Finally, it is shown that these activities gave Hauksbee the reputation of being an outstanding instrument-maker, years before the double-barrelled air-pump was in sight.

  13. Heat pump technology

    CERN Document Server

    Von Cube, Hans Ludwig; Goodall, E G A

    2013-01-01

    Heat Pump Technology discusses the history, underlying concepts, usage, and advancements in the use of heat pumps. The book covers topics such as the applications and types of heat pumps; thermodynamic principles involved in heat pumps such as internal energy, enthalpy, and exergy; and natural heat sources and energy storage. Also discussed are topics such as the importance of the heat pump in the energy industry; heat pump designs and systems; the development of heat pumps over time; and examples of practical everyday uses of heat pumps. The text is recommended for those who would like to kno

  14. Liquid metal pump

    Science.gov (United States)

    Pennell, William E.

    1982-01-01

    The liquid metal pump comprises floating seal rings and attachment of the pump diffuser to the pump bowl for isolating structural deflections from the pump shaft bearings. The seal rings also eliminate precision machining on large assemblies by eliminating the need for a close tolerance fit between the mounting surfaces of the pump and the seals. The liquid metal pump also comprises a shaft support structure that is isolated from the pump housing for better preservation of alignment of shaft bearings. The shaft support structure also allows for complete removal of pump internals for inspection and repair.

  15. Liquid metal pump

    International Nuclear Information System (INIS)

    Pennell, W.E.

    1982-01-01

    The liquid metal pump comprises floating seal rings and attachment of the pump diffuser to the pump bowl for isolating structural deflections from the pump shaft bearings. The seal rings also eliminate precision machining on large assemblies by eliminating the need for a close tolerance fit between the mounting surfaces of the pump and the seals. The liquid metal pump also comprises a shaft support structure that is isolated from the pump housing for better preservation of alignment of shaft bearings. The shaft support structure also allows for complete removal of pump internals for inspection and repair

  16. CFD Analysis of a Centrifugal Pump with Supercritical Carbon Dioxide as a Working Fluid

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seong Gu; Lee, Jeong Ik; Ahn, Yoonhan; Lee, Jekyoung [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Cha, Jae Eun [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Addad, Yacine [Khalifa Univ. of Science Technology and Research, Abu Dhabi (United Arab Emirates)

    2013-05-15

    The research team is conducting a S-CO{sub 2} pump experiment to obtain fundamental data for the advanced pump design and measure the overall performance of the pump near the critical point. The S-CO{sub 2} pump testing loop configuration is similar to SNL and JAEA testing loop while the operating conditions and focus of experiment are different from other test facilities. This paper presents the methodology of a 3-dimensional flow analysis for the S-CO{sub 2} pump by using the commercial CFD code. In Figure 2, the results at the 1.5kg/s mass flow rate seems to be close agreement between the CFD efficiency and S-CO{sub 2} test results. In the low mass flow rate of 1.0kg/s, CFD predicted 17∼25% higher efficiency than the test result. In the real test facility, the steel structure of pump is not an adiabatic wall and also the mechanical losses such as suction, blade loading and leakage exist in the pump. The reason why CFD analysis showed higher pump efficiency at the low mass flow is the above mentioned losses were excluded from the model. However, as the mass flow rate increases these have less effect on the efficiency. If the heat transfer through the structure and pump losses are applied in the analysis, other losses can be estimated. From the S-CO{sub 2} pump experiment, more data will be obtained and compared to the CFD analyses under the methodology presented in this paper. After the fluid behavior in the pump are well understood, these analysis results will be used for optimizing impeller for advanced S-CO{sub 2} compressor design in the future. However, it is very encouraging that even at very small mass flow rate the efficiency of S-CO{sub 2} pump near the critical point operation is very high compared to the manufacturer water test. The reason behind such phenomenon will be more carefully studied in the future.

  17. Heat pumps at the maltings

    Energy Technology Data Exchange (ETDEWEB)

    1987-11-01

    Heat pumps have halved the energy costs of producing finished malt at two of the country's maltsters. The fuel-fired kilning processes described are now performed by heat pumps with considerable energy and production benefits at the maltings of J.P. Simpson and Co. (Alnwick) Ltd, in Tivetshall St Margaret, Norfolk, and of Munton and Fison Plc of Stowmarket, Suffolk. The heat pump system installed at the Station Malting of J.P. Simpson was devised by the Electricity Council Research Centre at Capenhurst near Chester. Energy cost benefits of Pound 6,000 a month are being realised at Simpsons, but there is the added benefit that the system has been designed to provide conditioned air to the germination cycle to ensure that the correct temperature is maintained throughout the year. At the Cedars factory of Munton and Fison, heat pumps were used on a trial basis for plant micropropagation and for a fish farming unit.

  18. Reactor feedwater pump control device

    International Nuclear Information System (INIS)

    Nishiyama, Hiroyuki.

    1990-01-01

    An amount of feedwater necessary for ensuring reactor inventory after scram is ensured automatically based on the reactor output before scram of a BWR type reactor. That is, if scram should occur, a feedwater flow rate just before the scram is stored by reactor output signals. Further, the amount of feedwater required after the scram is determined based on the output of the memory. The reactor power after the scram based on a feedwater flow rate and a main steam flow rate is inputted to an integrator, to calculate and output the amount of the feedwater flow rate (1) injected after the scram for the inventory. A coast down flowrate (2) in a case of pump trip is forecast by the output signals. Automatic trip is outputted to all turbine driving feedwater pumps when the sum of (1) and (2) exceeds a necessary and sufficient amount of feedwater required for ensuring inventory. For motor driving feedwater pumps, only a portion, for example, one of the pumps is automatically started while other pumps are stopped their operation, only in this case, to prevent excess water feeding. (I.S.)

  19. Heat pumps

    CERN Document Server

    Brodowicz, Kazimierz; Wyszynski, M L; Wyszynski

    2013-01-01

    Heat pumps and related technology are in widespread use in industrial processes and installations. This book presents a unified, comprehensive and systematic treatment of the design and operation of both compression and sorption heat pumps. Heat pump thermodynamics, the choice of working fluid and the characteristics of low temperature heat sources and their application to heat pumps are covered in detail.Economic aspects are discussed and the extensive use of the exergy concept in evaluating performance of heat pumps is a unique feature of the book. The thermodynamic and chemical properties o

  20. 28 CFR 39.102 - Application.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 39.102 Section 39.102 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE § 39.102 Application. This part applies to...

  1. 45 CFR 2490.102 - Application.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2490.102 Section 2490.102 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION... MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.102 Application. This part (§§ 2490.101-2490.170) applies to...

  2. 28 CFR 35.102 - Application.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 35.102 Section 35.102 Judicial Administration DEPARTMENT OF JUSTICE NONDISCRIMINATION ON THE BASIS OF DISABILITY IN STATE AND LOCAL GOVERNMENT SERVICES General § 35.102 Application. (a) Except as provided in paragraph (b) of this...

  3. 45 CFR 2301.102 - Application.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2301.102 Section 2301.102 Public Welfare Regulations Relating to Public Welfare (Continued) ARCTIC RESEARCH COMMISSION ENFORCEMENT OF... COMMISSION § 2301.102 Application. This part (§§ 2301.101-2301.170) applies to all programs or activities...

  4. 7 CFR 1709.102 - Policy.

    Science.gov (United States)

    2010-01-01

    ... ASSISTANCE TO HIGH ENERGY COST COMMUNITIES RUS High Energy Cost Grant Program § 1709.102 Policy. (a) All high... 7 Agriculture 11 2010-01-01 2010-01-01 false Policy. 1709.102 Section 1709.102 Agriculture...). (b) RUS may give priority consideration to projects that benefit smaller rural communities...

  5. 3 CFR 102.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 3 The President 1 2010-01-01 2010-01-01 false Employment. 102.140 Section 102.140 Presidential... PROGRAMS OR ACTIVITIES CONDUCTED BY THE EXECUTIVE OFFICE OF THE PRESIDENT § 102.140 Employment. No... employment under any program or activity conducted by the agency. The definitions, requirements, and...

  6. 7 CFR 948.102 - Communications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 948.102 Section 948.102 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Rules and Regulations General § 948.102 Communications. Unless otherwise provided in §§ 948.1 to 948.92...

  7. Heat Load Sharing in a Capillary Pumped Loop with Multiple Evaporators and Multiple Condensers

    Science.gov (United States)

    Ku, Jentung

    2005-01-01

    This paper describes the heat load sharing function among multiple parallel evaporators in a capillary pumped loop (CPL). In the normal mode of operation, the evaporators cool the instruments by absorbing the waste heat. When an instruments is turned off, the attached evaporator can keep it warm by receiving heat from other evaporators serving the operating instruments. This is referred to as heat load sharing. A theoretical basis of heat load sharing is given first. The fact that the wicks in the powered evaporators will develop capillary pressure to force the generated vapor to flow to cold locations where the pressure is lower leads to the conclusion that heat load sharing is an inherent function of a CPL with multiple evaporators. Heat load sharing has been verified with many CPLs in ground tests. Experimental results of the Capillary Pumped Loop 3 (CAPL 3) Flight Experiment are presented in this paper. Factors that affect the amount of heat being shared are discussed. Some constraints of heat load sharing are also addressed.

  8. Seismic fragility capacity of equipment--horizontal shaft pump test

    International Nuclear Information System (INIS)

    Iijima, T.; Abe, H.; Suzuki, K.

    2005-01-01

    The current seismic fragility capacity of horizontal shaft pump is 1.6 x 9.8 m/s 2 (1.6 g), which was decided from previous vibration tests and we believe that it must have sufficient margin. The purpose of fragility capacity test is to obtain realistic seismic fragility capacity of horizontal shaft pump by vibration tests. Reactor Building Closed Cooling Water (RCW) Pump was tested as a typical horizontal shaft pump, and then bearings and liner rings were tested as important parts to evaluate critical acceleration and dispersion. Regarding RCW pump test, no damage was found, though maximum input acceleration level was 6 x 9.8 m/s 2 (6 g). Some kinds of bearings and liner rings were tested on the element test. Input load was based on seismic motion which was same with the RCW pump test, and maximum load was equivalent to over 20 times of design seismic acceleration. There was not significant damage that caused emergency stop of pump but degradation of surface roughness was found on some kinds of bearings. It would cause reduction of pump life, but such damage on bearings occurred under large seismic load condition that was equivalent to over 10 to 20 g force. Test results show that realistic fragility capacity of horizontal shaft pump would be at least four times as higher as current value which has been used for our seismic PSA. (authors)

  9. Experimental Study on Series Operation of Sliding Vane Pump and Centrifugal Pump

    OpenAIRE

    Li, Tao; Zhang, Weiming; Jiang, Ming; Li, Zhengyang

    2013-01-01

    A platform for sliding vane pump and centrifugal pump tests is installed to study the series operation of them under different characteristics of pipeline. Firstly, the sliding vane pump and the centrifugal pump work independently, and the performance is recorded. Then, the two types of pumps are combined together, with the sliding vane pump acting as the feeding pump. Comparison is made between the performance of the independently working pump and the performance of series operation pump. Re...

  10. 25 CFR 720.102 - Application.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Application. 720.102 Section 720.102 Indians THE OFFICE OF NAVAJO AND HOPI INDIAN RELOCATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE NAVAJO AND HOPI INDIAN RELOCATION COMMISSION § 720.102 Application...

  11. Centrifugal pump handbook

    CERN Document Server

    Pumps, Sulzer

    2010-01-01

    This long-awaited new edition is the complete reference for engineers and designers working on pump design and development or using centrifugal pumps in the field. This authoritative guide has been developed with access to the technical expertise of the leading centrifugal pump developer, Sulzer Pumps. In addition to providing the most comprehensive centrifugal pump theory and design reference with detailed material on cavitation, erosion, selection of materials, rotor vibration behavior and forces acting on pumps, the handbook also covers key pumping applications topics and operational

  12. The potential for buoyant displacement gas release events in Tank 241-SY-102 after waste transfer from Tank 241-SY-101

    International Nuclear Information System (INIS)

    Wells, BE; Meyer, P.E.; Chen, G.

    2000-01-01

    Tank 241-SY-101 (SY-101) is a double-shell, radioactive waste storage tank with waste that, before the recent transfer and water back-dilution operations, was capable of retaining gas and producing buoyant displacement (BD) gas release events (GREs). Some BD GREs caused gas concentrations in the tank headspace to exceed the lower flammability limit (LFL). A BD GRE occurs when a portion of the nonconvective layer retains enough gas to become buoyant, rises to the waste surface, breaks up, and releases some of its stored gas. The installation of a mixer pump in 1993 successfully mitigated gas retention in the settled solids layer in SY-101 and has since prevented BD GREs. However, operation of the mixer pump over the years caused gas retention in the floating crust layer and a corresponding accelerated waste level growth. The accelerating crust growth trend observed in 1997--98 led to initiation of sequences of waste removal and water back-dilutions in December 1999. Waste is removed from the mixed slurry layer in Tank SY-101 and transferred into Tank 241-Sy-102 (SY-102). Water is then added back to dissolve soluble solids that retain gas. The initial transfer of 89,500 gallons of SY-101 waste, diluted in-line at 0.94:1 by volume with water, to SY-102 was conducted in December 1999. The second transfer of 230,000 gallons of original SY-101 waste, diluted approximately 0.9:1, was completed in January 2000, and the third transfer of 205,500 gallons of original SY-101 waste diluted at 0.9:1 was completed in March 2000

  13. 29 CFR 102.151 - Settlement.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Settlement. 102.151 Section 102.151 Labor Regulations... Expenses § 102.151 Settlement. The applicant and the General Counsel may agree on a proposed settlement of... on a proposed settlement of an award before an application has been filed, the proposed settlement...

  14. 12 CFR 410.102 - Application.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Application. 410.102 Section 410.102 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.102 Application...

  15. 29 CFR 102.7 - State.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false State. 102.7 Section 102.7 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Definitions § 102.7 State. The term State as used herein shall include the District of Columbia and all States, Territories, and possessions...

  16. Electromagnetic pumping of liquid lithium in inertial confinement fusion reactors

    International Nuclear Information System (INIS)

    Baker, R.S.; Blink, J.A.; Tessier, M.J.

    1983-01-01

    The basic operating principles and geometries of ten electromagnetic pumps are described. Two candidate pumps, the annular-linear-induction pump and the helical-rotor electromagnetic pump, are compared for possible use in a full-scale liquid-lithium inertial confinement fusion reactor. A parametric design study completed for the helical-rotor pump is shown to be valid when applied to an experimental sodium pump. Based upon the preliminary HYLIFE requirements for a lithium flow rate per pump of 8.08 m 3 /s at a head of 82.5 kPa, a complete set of 70 variables are specified for a helical-rotor pump with either a normally conducting or a superconducting winding. The two alternative designs are expected to perform with efficiencies of 50 and 60%, respectively

  17. Penis Pump

    Science.gov (United States)

    ... your appointment might be less involved. Choosing a penis pump Some penis pumps are available without a ... it doesn't get caught in the ring. Penis pumps for penis enlargement Many advertisements in magazines ...

  18. Pumping characteristics of sputter ion pump (SIP) and titanium sublimation pump (TSP) combination

    International Nuclear Information System (INIS)

    Ratnakala, K.C.; Patel, R.J.; Bhavsar, S.T.; Pandiyar, M.L.; Ramamurthi, S.S.

    1995-01-01

    For achieving hydrocarbon free, clean ultra high vacuum, SIP-TSP combination is one of the ideal choice for pumping. For the SRS facility in Centre for Advanced Technology (CAT), we are utilising this combination, enmass. For this purpose, two modules of these combination set-ups are assembled, one with the TSP as an integral part of SIP and the other, with TSP as a separate pump mounted on the top of SIP. The pump bodies were vacuum degassed at 700 degC at 10 -5 mbar for 3 hrs. An ultimate vacuum of 3 x 10 -11 mbar was achieved, after a bake-out at 250 degC for 4 hrs, followed by continuous SIP pumping for 48 hrs, with two TSP flashing at approximately 10 hrs interval. The pump-down patterns as well as the pressure-rise patterns are studied. (author). 2 refs., 5 figs

  19. INSTRUMENTATION FOR MEASURING AND TRANSMISSION THE SOLAR RADIATION THROUGH EARTH’S ATMOSPHERE

    Directory of Open Access Journals (Sweden)

    Alexandru Dan Toma

    2013-07-01

    Full Text Available The Sun's energy is distributed over a broad range of the electromagnetic spectrum and Sun behaves approximately like a "blackbody" radiating at a temperature of about 5800 K with maximum output in the green-yellow part of the visible spectrum, around 500 nm. Not all solar radiation reaching the top of the atmosphere reaches Earth's surface due to a various optical phenomena in regard to solar radiation crossing the Earth’s atmosphere. In order to investigate them, there are two general categories of instruments used to measure the transmission of solar radiation through Earth's atmosphere: instruments that measure radiation from the entire sky and instruments that measure only direct solar radiation. Within each of these categories, instruments can be further subdivided into those that measure radiation over a broad range of wavelengths and those that measure only specific wavelengths.

  20. 12 CFR 509.102 - Discovery.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Discovery. 509.102 Section 509.102 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE IN ADJUDICATORY PROCEEDINGS Local Rules § 509.102 Discovery. (a) In general. A party may take the deposition of an...

  1. 32 CFR 935.102 - Information.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Information. 935.102 Section 935.102 National... WAKE ISLAND CODE Criminal Actions § 935.102 Information. (a) Any offense may be prosecuted by a written information signed by the Island Attorney. However, if the offense is one for which issue of a citation is...

  2. Solid Phase Characterization of Tank 241-AY-102 Annulus Space Particulate

    Energy Technology Data Exchange (ETDEWEB)

    Cooke, G. A.

    2013-01-30

    The Special Analytical Studies Group at the 222-S Laboratory (222-S) examined the particulate recovered from a series of samples from the annular space of tank 241-AY-102 (AY-102) using solid phase characterization (SPC) methods. These include scanning electron microscopy (SEM) using the ASPEX®1 scanning electron microscope, X-ray diffraction (XRD) using the Rigaku®2 MiniFlex X-ray diffractometer, and polarized light microscopy (PLM) using the Nikon®3 Eclipse Pol optical microscope. The SEM is equipped with an energy dispersive X-ray spectrometer (EDS) to provide chemical information.

  3. Characterization of the kinetics and mechanisms of inhibition of drugs interacting with the S.cerevisiae multidrug resistance pumps Pdr5p and Snq2p

    Czech Academy of Sciences Publication Activity Database

    Hendrych, T.; Kodedová, M.; Sigler, Karel; Gášková, D.

    2009-01-01

    Roč. 1788, č. 3 (2009), s. 717-723 ISSN 0006-3002 R&D Projects: GA MŠk 1M0570 Grant - others:UK(CZ) 7674/2007 Institutional research plan: CEZ:AV0Z50200510 Keywords : yeast MDR pump * pump inhibitor * membrane potential Subject RIV: EE - Microbiology, Virology

  4. Ligand Promiscuity between the Efflux Pumps Human P-Glycoprotein and S. aureus NorA.

    Science.gov (United States)

    Brincat, Jean Pierre; Broccatelli, Fabio; Sabatini, Stefano; Frosini, Maria; Neri, Annalisa; Kaatz, Glenn W; Cruciani, Gabriele; Carosati, Emanuele

    2012-03-08

    Thirty-two diverse compounds were evaluated for their ability to inhibit both Pgp-mediated efflux in mouse T-lymphoma L5178 MDR1 and NorA-mediated efflux in S. aureus SA-1199B. Only four compounds were strong inhibitors of both efflux pumps. Three compounds were found to inhibit Pgp exclusively and strongly, while seven compounds inhibited only NorA. These results demonstrate that Pgp and NorA inhibitors do not necessarily overlap, opening the way to safer therapeutic use of effective NorA inhibitors.

  5. [The CAD-S, an instrument for the assessment of adaptation to divorce - separation].

    Science.gov (United States)

    Yárnoz Yaben, Sagrario; Comino González, Priscila

    2010-02-01

    The CAD-S, an Instrument for the Assessment of Adaptation to Divorce - Separation. This paper presents an instrument for the evaluation of the adaptation to divorce-separation. The CAD-S is a questionnaire created in Spanish, made up of 20 items whose aim is the evaluation of the family's adaptation to divorce-separation, using one of the parents as informant. Data were collected in four different samples of divorced persons and their children from different autonomous comunities from the Spanish state. 223 parents and 160 children from divorced families took part in this study. Four factors emerged, accounting for 52.39 percent of the total variance: psychological and emotional difficulties, conflict with the ex-partner, disposition to co-parentality, and negative outcomes of separation for children. The results suggest that CAD-S appears to be a reliable and valid instrument, with high internal consistency (Cronbach's alpha) and adequate construct validity supported by its relations with measures of satisfaction with life (SWLS), in the case of parents, and conduct problems (CBCL) for children.

  6. Pumping of hydrocarbons using non-evaporable getters

    International Nuclear Information System (INIS)

    Emerson, L.C.; Knize, R.J.; Cecchi, J.L.

    1986-01-01

    Pumping speed measurements have been obtained for a number of gaseous hydrocarbons including members of the alkene, alkadiene, and cycloalkane groups as a function of temperature using a Zr-Al alloy getter. Pumping speeds were obtained by analysis of an exponential least squares fit to the pressure decay curve following introduction of each gas. It was found that these pumping speeds are relatively high (up to 400 1/s) and exhibit, with only a few exceptions, little temperature dependence. This is in contrast to the earlier reported results for the alkane series

  7. High and ultra-high vacuum pumping techniques: applications in accelerators and storage rings

    International Nuclear Information System (INIS)

    Schaefer, G.

    1988-01-01

    A survey is given on gas transfer pumps, especially Turbomolecular pumps, and entrapment pumps (cryopumps and getter pumps) mainly with regard to their application in evacuating particle accelerators and storage rings. (A.C.A.S.) [pt

  8. First operation experiences with ITER-FEAT model pump

    International Nuclear Information System (INIS)

    Mack, A.; Day, Chr.; Haas, H.; Murdoch, D.K.; Boissin, J.C.; Schummer, P.

    2001-01-01

    Design and manufacturing of the model cryopump for ITER-FEAT have been finished. After acceptance tests at the contractor's premises the pump was installed in the TIMO-facility which was prepared for testing the pump under ITER-FEAT relevant operating conditions. The procedures for the final acceptance tests are described. Travelling time, positioning accuracy and leak rate of the main valve are within the requirements. The heat loads to the 5 and 80 K circuits are a factor two better than the designed values. The maximum pumping speeds for H 2 , D 2 , He, Ne were measured. The value of 58 m 3 /s for D 2 is well above the contractual required value of 40 m 3 /s

  9. Dual-Pump CARS Development and Application to Supersonic Combustion

    Science.gov (United States)

    Magnotti, Gaetano

    Successful design of hypersonic air-breathing engines requires new computational fluid dynamics (CFD) models for turbulence and turbulence-chemistry interaction in supersonic combustion. Unfortunately, not enough data are available to the modelers to develop and validate their codes, due to difficulties in taking measurements in such a harsh environment. Dual-pump coherent anti-Stokes Raman spectroscopy (CARS) is a non-intrusive, non-linear, laser-based technique that provides temporally and spatially resolved measurements of temperature and absolute mole fractions of N2, O2 and H2 in H2-air flames. A dual-pump CARS instrument has been developed to obtain measurements in supersonic combustion and generate databases for the CFD community. Issues that compromised previous attempts, such as beam steering and high irradiance perturbation effects, have been alleviated or avoided. Improvements in instrument precision and accuracy have been achieved. An axis-symmetric supersonic combusting coaxial jet facility has been developed to provide a simple, yet suitable flow to CFD modelers. The facility provides a central jet of hot "vitiated air" simulating the hot air entering the engine of a hypersonic vehicle flying at Mach numbers between 5 and 7. Three different silicon carbide nozzles, with exit Mach number 1, 1.6 and 2, are used to provide flows with the effects of varying compressibility. H2 co-flow is available in order to generate a supersonic combusting free jet. Dual-pump CARS measurements have been obtained for varying values of flight and exit Mach numbers at several locations. Approximately one million Dual-pump CARS single shots have been collected in the supersonic jet for varying values of flight and exit Mach numbers at several locations. Data have been acquired with a H2 co-flow (combustion case) or a N 2 co-flow (mixing case). Results are presented and the effects of the compressibility and of the heat release are discussed.

  10. Concrete volute pumps: technology review and improvement

    Science.gov (United States)

    Prunières, R.; Longatte, F.; Catelan, F. X.; Philippot, J. M.

    2012-11-01

    When pumps need to deliver large water flow rates (typically more than 5 m3.s-1), concrete volute pumps (CVP) offer an interesting alternative to standard vertical wet-pit pumps. One of the major advantages of CVP is its simplicity in terms of design, manufacturability and maintainability. In addition, CVP geometrical arrangement allows to reach high performances in terms of hydraulic and mechanical behaviour. These advantages can be specifically appreciated when such pumps are used in the energy field for Power Plants which need high flow rate and reliability, and can lead to important financial savings over the Plant lifetime compared to vertical wet-pit pumps. Finally, as CVP was for a long time limited to total head rise lower than 30 mWC, it was established through CFD analysis that the addition of guide vanes between the impeller and the volute allows to achieve higher head rise without risk.

  11. Performing Pumping Test Data Analysis Applying Cooper-Jacob’s Method for Estimating of the Aquifer Parameters

    Directory of Open Access Journals (Sweden)

    Dana Khider Mawlood

    2016-06-01

    Full Text Available Single well test is more common than aquifer test with having observation well, since the advantage of single well test is that the pumping test can be conducted on the production well with the absence of observation well. A kind of single well test, which is step-drawdown test used to determine the efficiency and specific capacity of the well, however in case of single well test it is possible to estimate Transmissivity, but the other parameter which is Storativity is overestimated, so the aim of this study is to analyze four pumping test data located in KAWRGOSK area by using cooper-Jacob’s (1946 time drawdown approximation of Theis method to estimate the aquifer parameters, also in order to determine the reasons which are affecting the reliability of the Storativity value and obtain the important aspect behind that in practice.

  12. Autonomous Optofluidic Chemical Analyzers for Marine Applications: Insights from the Submersible Autonomous Moored Instruments (SAMI for pH and pCO2

    Directory of Open Access Journals (Sweden)

    Chun-Ze Lai

    2018-01-01

    Full Text Available The commercial availability of inexpensive fiber optics and small volume pumps in the early 1990's provided the components necessary for the successful development of low power, low reagent consumption, autonomous optofluidic analyzers for marine applications. It was evident that to achieve calibration-free performance, reagent-based sensors would require frequent renewal of the reagent by pumping the reagent from an impermeable, inert reservoir to the sensing interface. Pumping also enabled measurement of a spectral blank further enhancing accuracy and stability. The first instrument that was developed based on this strategy, the Submersible Autonomous Moored Instrument for CO2 (SAMI-CO2, uses a pH indicator for measurement of the partial pressure of CO2 (pCO2. Because the pH indicator gives an optical response, the instrument requires an optofluidic design where the indicator is pumped into a gas permeable membrane and then to an optical cell for analysis. The pH indicator is periodically flushed from the optical cell by using a valve to switch from the pH indicator to a blank solution. Because of the small volume and low power light source, over 8,500 measurements can be obtained with a ~500 mL reagent bag and 8 alkaline D-cell battery pack. The primary drawback is that the design is more complex compared to the single-ended electrode or optode that is envisioned as the ideal sensor. The SAMI technology has subsequently been used for the successful development of autonomous pH and total alkalinity analyzers. In this manuscript, we will discuss the pros and cons of the SAMI pCO2 and pH optofluidic technology and highlight some past data sets and applications for studying the carbon cycle in aquatic ecosystems.

  13. Neutral pumping rates for a next step tokamak ignition device

    International Nuclear Information System (INIS)

    Galambos, J.D.; Peng, Y.K.M.; Heifetz, D.

    1985-01-01

    Neutral pumping rates are calculated for pump-limiter and divertor options of a next step tokamak ignition device using a method that accounts for the coupled effects of neutral transport and plasma transport. For both pump limiters and divertors the plasma flow into the channel surrounding the neutralizer plate is greatly reduced by the neutral recycling. The fraction of this flow that is pumped can be large (>50%) but in general is dependent on the particular geometry and plasma conditions. It is estimated that pumping speeds greater than or approximately 10 5 L/s are adequate for the exhaust requirements in the pump-limiter and the divertor cases

  14. Field results of antifouling techniques for optical instruments

    Science.gov (United States)

    Strahle, W.J.; Hotchkiss, F.S.; Martini, Marinna A.

    1998-01-01

    An anti-fouling technique is developed for the protection of optical instruments from biofouling which leaches a bromide compound into a sample chamber and pumps new water into the chamber prior to measurement. The primary advantage of using bromide is that it is less toxic than the metal-based antifoulants. The drawback of the bromide technique is also discussed.

  15. Centrifugal pumps

    CERN Document Server

    Gülich, Johann Friedrich

    2014-01-01

    This book gives an unparalleled, up-to-date, in-depth treatment of all kinds of flow phenomena encountered in centrifugal pumps including the complex interactions of fluid flow with vibrations and wear of materials. The scope includes all aspects of hydraulic design, 3D-flow phenomena and partload operation, cavitation, numerical flow calculations, hydraulic forces, pressure pulsations, noise, pump vibrations (notably bearing housing vibration diagnostics and remedies), pipe vibrations, pump characteristics and pump operation, design of intake structures, the effects of highly viscous flows, pumping of gas-liquid mixtures, hydraulic transport of solids, fatigue damage to impellers or diffusers, material selection under the aspects of fatigue, corrosion, erosion-corrosion or hydro-abrasive wear, pump selection, and hydraulic quality criteria. As a novelty, the 3rd ed. brings a fully analytical design method for radial impellers, which eliminates the arbitrary choices inherent to former design procedures. The d...

  16. The design and testing of sodium pumps in the UK to meet the CDFR cavitation criteria

    International Nuclear Information System (INIS)

    Preece, G.E.; Macleod, I.D.; Wilkinson, D.

    2002-01-01

    A primary objective in the design of the sodium pumps for the UK Commercial Demonstration Fast Reactor has been to avoid cavitation during normal operation. This requirement arises from the need to avoid blade erosion and also, in the case of the Primary Sodium Pumps (PSP), the generation of cavitation noise which might otherwise interfere with instrumentation installed to detect noise of boiling in the core. This paper outlines the approach adopted to achieve a pump design with good cavitation performance and the programme of model testing carried out in a water loop to establish the cavitation boundaries for incipient cavitation of selected designs using both visual and acoustic techniques

  17. The IAEA's Universal Instrument Token

    International Nuclear Information System (INIS)

    Naumann, I.; Wishard, B.; Morgan, K.; Christoph, B.; Schwier, A.; Frank, T.

    2015-01-01

    The IAEA currently seeks to improve the harmonization of security approaches across safeguards equipment. The protection of digital safeguards data is based on several principles: a) the signing of data in measurement devices using standard public/private-key-based signature generation, b) the storage of secret keys on certified, tamper-protected cryptographic devices, and c) well-established cryptographic algorithms and protocols based on global standards and internationally recognized cryptographic libraries. This paper discusses a cryptographic token, the Universal Instrument Token, which constitutes the core element of the architecture for signing safeguards data. This architecture supports the above principles and is compliant with the IAEA's information security policies and guidelines. An important side-condition is that the UIT must be implemented across a wide range of operating systems and hardware architectures, which mandates the use of open-source software for all software-related parts involved. The UIT is permanently connected to the measuring device (usually via the USB port) and requires complex hardware drivers and middleware components. Identifying open-source based, mature and ready-for-use smart card drivers and tools that are compatible with a range of operating systems was a major challenge. Reliable and well-established cryptographic libraries reside at the core of every information-security application. Different types of review software, typically software products used at IAEA headquarters in Vienna but occasionally also in the facilities, need to contain some specific software modules in order to verify the digital signatures attached to the data. Finally, also required are enrollment tools which generate private keys and certify their corresponding public counterparts using the IAEA's internal Certification Authority. In 2014, the roll-out of the UIT has raised the security of IAEA instrument data signing to a level which is

  18. Study on operation of a research reactor during one PCS pump failure accident

    Energy Technology Data Exchange (ETDEWEB)

    Seo, Kyoung Woo; Yoon, Hyu Ngi; Kim, Seong Hoon; Chi, Dae Young; Yoon, Juh Yeon [KAERI, Daejeon (Korea, Republic of)

    2012-10-15

    The Primary cooling system (PCS) of a research reactor is designed to provide adequate cooling to the reactor core with a reasonable margin during all operation modes. The PCS consists of pumps, heat exchangers, and all necessary interconnecting pipes, valves, and instruments. The number of pumps is determined from a safety and economic point of view. As the number of pump trains increase, the cost increases according to the increase in safety class equipment. However, it is impossible to install one pump for a PCS because a zero flow can instantaneously occur during a pump failure such as a pump seizure. Thus, a PCS frequently consists of two parallel 50% capacity pumps and heat exchangers. In addition, check valves are generally installed to prevent a reversal flow when multiple pumps are designed to operate. However, if a swing type check valve is used, it should be estimated whether the slam due to instantaneous closing of the valve affects the system vibration. To reduce the vibration by a slam phenomenon, additional equipment such as a damper will be installed in the valve. The purpose of the check valve in PCS is to prevent the flow path when a reverse flow occurs. The installation of additional equipment will make it difficult to perform this function. In this study, it is estimated whether the PCS can operate without check valves. First, a flow analysis using Flowmaster was compared and verified by the calculation employing a empirical correlation. Second, the simulation for a one pump failure accident was performed and analyzed.

  19. Study on operation of a research reactor during one PCS pump failure accident

    International Nuclear Information System (INIS)

    Seo, Kyoung Woo; Yoon, Hyu Ngi; Kim, Seong Hoon; Chi, Dae Young; Yoon, Juh Yeon

    2012-01-01

    The Primary cooling system (PCS) of a research reactor is designed to provide adequate cooling to the reactor core with a reasonable margin during all operation modes. The PCS consists of pumps, heat exchangers, and all necessary interconnecting pipes, valves, and instruments. The number of pumps is determined from a safety and economic point of view. As the number of pump trains increase, the cost increases according to the increase in safety class equipment. However, it is impossible to install one pump for a PCS because a zero flow can instantaneously occur during a pump failure such as a pump seizure. Thus, a PCS frequently consists of two parallel 50% capacity pumps and heat exchangers. In addition, check valves are generally installed to prevent a reversal flow when multiple pumps are designed to operate. However, if a swing type check valve is used, it should be estimated whether the slam due to instantaneous closing of the valve affects the system vibration. To reduce the vibration by a slam phenomenon, additional equipment such as a damper will be installed in the valve. The purpose of the check valve in PCS is to prevent the flow path when a reverse flow occurs. The installation of additional equipment will make it difficult to perform this function. In this study, it is estimated whether the PCS can operate without check valves. First, a flow analysis using Flowmaster was compared and verified by the calculation employing a empirical correlation. Second, the simulation for a one pump failure accident was performed and analyzed

  20. PUMPS

    Science.gov (United States)

    Thornton, J.D.

    1959-03-24

    A pump is described for conveving liquids, particure it is not advisable he apparatus. The to be submerged in the liquid to be pumped, a conduit extending from the high-velocity nozzle of the injector,and means for applying a pulsating prcesure to the surface of the liquid in the conduit, whereby the surface oscillates between positions in the conduit. During the positive half- cycle of an applied pulse liquid is forced through the high velocity nozzle or jet of the injector and operates in the manner of the well known water injector and pumps liquid from the main intake to the outlet of the injector. During the negative half-cycle of the pulse liquid flows in reverse through the jet but no reverse pumping action takes place.

  1. Mobile CARS instrument for combustion and plasma diagnostics

    International Nuclear Information System (INIS)

    Anderson, T.J.; Eckbreth, A.C.

    1985-01-01

    A mobile CARS system for combustion and plasma diagnostics is described. The instrument is compact, easily transportable, readily adaptable to a wide variety of laboratories and experiments, capable of withstanding high noise and vibration levels, and remotely operable to protect the operator and delicate components from high noise or hazardous environments. The system is intended for single-pulse temperature and concentration measurements in practical combustion systems, such as gas turbines and diesel engines and plasma process applications. The instrument consists of three major subsystems, each of which is easily transportable. The transmitter consists of a modified, commercially available, 20 Hz Nd:YAG laser, self-constructed dye lasers, and appropriate optics to produce the CARS pump and Stokes beams in the properly phase-matched orientation and direct them to the measured point. The transmitter consists of two optical pallets on a 2 1/2- x 5-ft cart and is connected by a single umbilical to the laser power supply. The receiver subsystem is a smaller optical pallet (2 x 2 ft), which collects the Stokes, pump, and CARS beams, separates them, and focuses the CARS beam into an optical fiber for transmission to a remotely located spectrograph. The receiver also contains two photomultiplier tubes, one to monitor alignment of the transmitter and the other, used in conjunction with a reference cell and the residual Stokes and pump beams, to determine gas concentrations

  2. Waste segregation analysis for salt well pumping in the 200 W Area -- Task 3.4

    International Nuclear Information System (INIS)

    Reynolds, D.A.

    1995-01-01

    There is an estimated 7 million liters (1.9 million gallons) of potentially complexed waste that need to be pumped from single-shell tanks (SST) in the 200 West Area. This represents up to 40% of the salt well liquor that needs to be pumped in the 200 West Area. There are three double-shell (DST) tanks in the 241-SY tank farm in the 200 West Area. Tank 241-SY-101 is full and not usable. Tank 241-SY-102 has a transuranic (TRU) sludge in the bottom. Current rules prohibit mixing complexed waste with TRU waste. Tank 241-SY-103 has three major problems. First, 241-SY-103 is on the Flammable Watch list. Second, adding waste to tank 241-SY-103 has the potential for an episodic release of hydrogen gas. Third, 241-SY-103 will not hold all of the potentially complexed waste from the SSTs. This document looks at more details regarding the salt well pumping of the 200 West Area tank farm. Some options are considered but it is beyond the scope of this document to provide an in-depth study necessary to provide a defensible solution to the complexed waste problem

  3. 77 FR 32942 - Application(s) for Duty-Free Entry of Scientific Instruments

    Science.gov (United States)

    2012-06-04

    ... Statutory Import Programs Staff, Room 3720, U.S. Department of Commerce, Washington, DC 20230. Applications..., College Station, TX 77843-3123. Instrument: Arc melting system. Manufacturer: Edmund Beuhler GmbH, Germany...

  4. Pump characteristics and applications

    CERN Document Server

    Volk, Michael

    2013-01-01

    Providing a wealth of information on pumps and pump systems, Pump Characteristics and Applications, Third Edition details how pump equipment is selected, sized, operated, maintained, and repaired. The book identifies the key components of pumps and pump accessories, introduces the basics of pump and system hydraulics as well as more advanced hydraulic topics, and details various pump types, as well as special materials on seals, motors, variable frequency drives, and other pump-related subjects. It uses example problems throughout the text, reinforcing the practical application of the formulae

  5. On-line PWR RHR pump performance testing following motor and impeller replacement

    International Nuclear Information System (INIS)

    DiMarzo, J.T.

    1996-01-01

    On-line maintenance and replacement of safety-related pumps requires the performance of an inservice test to determine and confirm the operational readiness of the pumps. In 1995, major maintenance was performed on two Pressurized Water Reactor (PWR) Residual Heat Removal (RHR) Pumps. A refurbished spare motor was overhauled with a new mechanical seal, new motor bearings and equipped with pump's 'B' impeller. The spare was installed into the 'B' train. The motor had never been run in the system before. A pump performance test was developed to verify it's operational readiness and determine the in-situ pump performance curve. Since the unit was operating, emphasis was placed on conducting a highly accurate pump performance test that would ensure that it satisfied the NSSS vendors accident analysis minimum acceptance curve. The design of the RHR System allowed testing of one train while the other was aligned for normal operation. A test flow path was established from the Refueling Water Storage Tank (RWST) through the pump (under test) and back to the RWST. This allowed staff to conduct a full flow range pump performance test. Each train was analyzed and an expression developed that included an error vector term for the TDH (ft), pressure (psig), and flow rate (gpm) using the variance error vector methodology. This method allowed the engineers to select a test instrumentation system that would yield accurate readings and minimal measurement errors, for data taken in the measurement of TDH (P,Q) versus Pump Flow Rate (Q). Test results for the 'B' Train showed performance well in excess of the minimum required. The motor that was originally in the 'B' train was similarly overhauled and equipped with 'A' pump's original impeller, re-installed in the 'A' train, and tested. Analysis of the 'A' train results indicate that the RHR pump's performance was also well in excess of the vendors requirements

  6. Tank 241-AX-102 tank characterization plan

    International Nuclear Information System (INIS)

    Carpenter, B.C.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-AX-102

  7. Pump element for a tube pump

    DEFF Research Database (Denmark)

    2011-01-01

    The invention relates to a tube pump comprising a tube and a pump element inserted in the tube, where the pump element comprises a rod element and a first and a second non-return valve member positioned a distance apart on the rod element. The valve members are oriented in the same direction...... relative to the rod element so as to allow for a fluid flow in the tube through the first valve member, along the rod element, and through the second valve member. The tube comprises an at least partly flexible tube portion between the valve members such that a repeated deformation of the flexible tube...... portion acts to alternately close and open the valve members thereby generating a fluid flow through the tube. The invention further relates to a pump element comprising at least two non-return valve members connected by a rod element, and for insertion in an at least partly flexible tube in such tube...

  8. Pumping behavior of sputtering ion pump

    Energy Technology Data Exchange (ETDEWEB)

    Chou, T.S.; Bittner, J.; Schuchman, J.

    1991-12-31

    To optimize the design of a distributed ion pump (DIP) for the Superconducting X-Ray Lithography Source (SXLS) the stability of the rotating electron cloud at very high magnetic field beyond transition, must be re-examined. In this work the pumping speed and frequency spectrum of a DIP at various voltages (1 to 10 KV) and various magnetic fields (0.1 to 4 Tesla) are measured. Three cell diameters 10 mm, 5 mm and 2.5 mm, each 8 mm long, and with 3 or 4 mm gaps between anode and cathode are investigated. In this study both the titanium cathodes and the stainless steel anode plates are perforated with holes comparable in size to the anode cell diameters. Only the partially saturated pumping behavior is under investigation. The ultimate pressure and conditioning of the pump will be investigated at a later date when the stability criterion for the electron cloud is better understood.

  9. Pumping behavior of sputtering ion pump

    Energy Technology Data Exchange (ETDEWEB)

    Chou, T.S.; Bittner, J.; Schuchman, J.

    1991-01-01

    To optimize the design of a distributed ion pump (DIP) for the Superconducting X-Ray Lithography Source (SXLS) the stability of the rotating electron cloud at very high magnetic field beyond transition, must be re-examined. In this work the pumping speed and frequency spectrum of a DIP at various voltages (1 to 10 KV) and various magnetic fields (0.1 to 4 Tesla) are measured. Three cell diameters 10 mm, 5 mm and 2.5 mm, each 8 mm long, and with 3 or 4 mm gaps between anode and cathode are investigated. In this study both the titanium cathodes and the stainless steel anode plates are perforated with holes comparable in size to the anode cell diameters. Only the partially saturated pumping behavior is under investigation. The ultimate pressure and conditioning of the pump will be investigated at a later date when the stability criterion for the electron cloud is better understood.

  10. Multiple pump housing

    Science.gov (United States)

    Donoho, II, Michael R.; Elliott; Christopher M.

    2010-03-23

    A fluid delivery system includes a first pump having a first drive assembly, a second pump having a second drive assembly, and a pump housing. At least a portion of each of the first and second pumps are located in the housing.

  11. Computation of water hammer protection of modernized pumping station

    Science.gov (United States)

    Himr, Daniel

    2014-03-01

    Pumping station supplies water for irrigation. Maximal capacity 2 × 1.2m3·s-1 became insufficient, thus it was upgraded to 2 × 2m3·s-1. Paper is focused on design of protection against water hammer in case of sudden pumps trip. Numerical simulation of the most dangerous case (when pumps are giving the maximal flow rate) showed that existing air vessels were not able to protect the system and it would be necessary to add new vessels. Special care was paid to influence of their connection to the main pipeline, because the resistance of the connection has a significant impact on the scale of pressure pulsations. Finally, the pump trip was performed to verify if the system worked correctly. The test showed that pressure pulsations are lower (better) than computation predicted. This discrepancy was further analysed.

  12. 76 FR 11199 - Application(s) for Duty-Free Entry of Scientific Instruments

    Science.gov (United States)

    2011-03-01

    ... before March 21, 2011. Address written comments to Statutory Import Programs Staff, Room 3720, U.S... instrument will be used to examine tissue specimens to identify and characterize pathologic tissue changes...

  13. 5 CFR 430.102 - Performance management.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Performance management. 430.102 Section 430.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE MANAGEMENT Performance Management § 430.102 Performance management. (a) Performance management is the...

  14. Assessing the energy efficiency of pumps and pump units background and methodology

    CERN Document Server

    Bernd Stoffel, em Dr-Ing

    2015-01-01

    Assessing the Energy Efficiency of Pumps and Pump Units, developed in cooperation with Europump, is the first book available providing the background, methodology, and assessment tools for understanding and calculating energy efficiency for pumps and extended products (pumps+motors+drives). Responding to new EU requirements for pump efficiency, and US DOE exploratory work in setting pump energy efficiency guidelines, this book provides explanation, derivation, and illustration of PA and EPA methods for assessing energy efficiency. It surveys legislation related to pump energy eff

  15. Effect of Non-linear Velocity Loss Changes in Pumping Stage of Hydraulic Ram Pumps on Pumping Discharge Rate

    Directory of Open Access Journals (Sweden)

    Reza Fatahialkouhi

    2018-03-01

    Full Text Available The ram pump is a device which pumps a portion of input discharge to the pumping system in a significant height by using renewable energy of water hammer. The complexities of flow hydraulic on one hand and on the other hand the use of simplifying assumptions in ram pumps have caused errors in submitted analytical models for analyzing running cycle of these pumps. In this study it has been tried to modify the governing analytical model on hydraulic performance of these pumps in pumping stage. In this study by creating a logical division, the cycle of the ram pump was divided into three stages of acceleration, pumping and recoil and the governing equations on each stage of cycling are presented by using method of characteristics. Since the closing of impulse valve is nonlinear, velocity loss in pumping stage is considered nonlinearly. Also the governing equations in pumping stage were modified by considering disc elasticity of impulse valve and changing volume of the pump body when the water hammer phenomenon is occurred. In order to evaluate results and determine empirical factors of the proposed analytical model, a physical model of the ram pump is made with internal diameter of 51 mm. Results of this study are divided into several parts. In the first part, loss coefficients of the impulse valve were measured experimentally and empirical equations of drag coefficient and friction coefficient of the impulse valve were submitted by using nonlinear regression. In the second part, results were evaluated by using experimental data taken from this study. Evaluation of statistical error functions showed that the proposed model has good accuracy for predicting experimental observations. In the third part, in order to validate the results in pumping stage, the analytical models of Lansford and Dugan (1941 and Tacke (1988 were used and the error functions resulted from prediction of experimental observations were investigated through analytical models of

  16. Solid Phase Characterization of Tank 241-AY-102 Annulus Space Particulate

    International Nuclear Information System (INIS)

    Cooke, G. A.

    2013-01-01

    The Special Analytical Studies Group at the 222-S Laboratory (222-S) examined the particulate recovered from a series of samples from the annular space of tank 241-AY-102 (AY-102) using solid phase characterization (SPC) methods. These include scanning electron microscopy (SEM) using the ASPEX(R)1 scanning electron microscope, X-ray diffraction (XRD) using the Rigaku(R)2 MiniFlex X-ray diffractometer, and polarized light microscopy (PLM) using the Nikon(R)3 Eclipse Pol optical microscope. The SEM is equipped with an energy dispersive X-ray spectrometer (EDS) to provide chemical information

  17. Effective temporal resolution in pump-probe spectroscopy with strongly chirped pulses

    International Nuclear Information System (INIS)

    Polli, D.; Lanzani, G.; Brida, D.; Cerullo, G.; Mukamel, S.

    2010-01-01

    This paper introduces a general theoretical description of femtosecond pump-probe spectroscopy with chirped pulses whose joint spectral and temporal profile is expressed by Wigner spectrograms. We demonstrate that the actual experimental time resolution intimately depends on the pulse-sample interaction and that the commonly used instrumental response function needs to be replaced by a sample-dependent effective response function. We also show that, using the proper configurations in excitation and/or detection, it is possible to overcome the temporal smearing of the measured dynamics due to chirp-induced pulse broadening and recover the temporal resolution that would be afforded by the transform-limited pulses. We verify these predictions with experiments using broadband chirped pump and probe pulses. Our results allow optimization of the temporal resolution in the common case when the chirp of the pump and/or probe pulse is not corrected and may be extended to a broad range of time-resolved experiments.

  18. 76 FR 20953 - Application(s) for Duty-Free Entry of Scientific Instruments

    Science.gov (United States)

    2011-04-14

    ... the U.S. Department of Commerce in Room 3720. Docket Number: 11-023. Applicant: UChicago Argonne, LLC... Ltd., Switzerland. Intended Use: The instrument will be used for resonant inelastic x-ray scattering...

  19. 48 CFR 4.102 - Contractor's signature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contractor's signature. 4.102 Section 4.102 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL ADMINISTRATIVE MATTERS Contract Execution 4.102 Contractor's signature. (a) Individuals. A contract with an...

  20. Solar-pumped lasers for space power transmission

    Science.gov (United States)

    Taussig, R.; Bruzzone, C.; Nelson, L.; Quimby, D.; Christiansen, W.

    1979-01-01

    Multi-Megawatt CW solar-pumped lasers appear to be technologically feasible for space power transmission in the 1990s time frame. A new concept for a solar-pumped laser is presented which utilizes an intermediate black body cavity to provide a uniform optical pumping environment for the lasant, either CO or CO2. Reradiation losses are minimized with resulting high efficiency operation. A 1 MW output laser may weigh as little as 8000 kg including solar collector, black body cavity, laser cavity and ducts, pumps, power systems and waste heat radiator. The efficiency of such a system will be on the order of 10 to 20%. Details of the new concept, laser design, comparison to competing solar-powered lasers and applications to a laser solar power satellite (SPS) concept are presented.

  1. Performance Analysis Of Single-Pumped And Dual-Pumped Parametric Optical Amplifier

    Directory of Open Access Journals (Sweden)

    Sandar Myint

    2015-06-01

    Full Text Available Abstract In this study we present a performance analysis of single-pumped and dual- pumped parametric optical amplifier and present the analysis of gain flatness in dual- pumped Fiber Optical Parametric Amplifier FOPA based on four-wave mixing FWM. Result shows that changing the signal power and pump power give the various gains in FOPA. It is also found out that the parametric gain increase with increase in pump power and decrease in signal power. .Moreover in this paper the phase matching condition in FWM plays a vital role in predicting the gain profile of the FOPAbecause the parametric gain is maximum when the total phase mismatch is zero.In this paper single-pumped parametric amplification over a 50nm gain bandwidth is demonstrated using 500 nm highly nonlinear fiber HNLF and signal achieves about 31dB gain. For dual-pumped parametric amplification signal achieves 26.5dB gains over a 50nm gain bandwidth. Therefore dual-pumped parametric amplifier can provide relatively flat gain over a much wider bandwidth than the single-pumped FOPA.

  2. Instrumentation requirements for radiological defense of the U.S. population in community shelters. Final report

    International Nuclear Information System (INIS)

    Haaland, C.M.; Gant, K.S.

    1978-08-01

    Estimates are made of requirements for instruments for radiological defense of the U.S. population in the event of a nuclear attack. A detailed Community Shelter Plan posture is developed for each of 42,000 Standard Location Areas. Travel distance from residence to shelter in urban areas is limited to approximately 1 mile. Sixty percent of the U.S. population is sheltered in home basements, thirty-one percent in National Shelter Survey shelters, and nine percent is in neither. Three minimum allocations of instruments are developed. Allocation A, one radiological defense set per shelter, is essentially the same as the current civil defense allocations but is found to be inadequate for about 100,000 shelters having more than 100 occupants. Allocation B requires 3.4 million new dosimeters based on estimated shelter occupancy and provides a minimum instrumentation for radiological defense but not enough instruments to maintain individual dose records. Allocation C would require 18.1 million new dosimeters and would provide adequate instrumentation to maintain dose records for all shelter occupants

  3. Use of ultrafast dispersed pump-dump-probe and pump-repump-probe spectroscopies to explore the light-induced dynamics of peridinin in solution.

    Science.gov (United States)

    Papagiannakis, Emmanouil; Vengris, Mikas; Larsen, Delmar S; van Stokkum, Ivo H M; Hiller, Roger G; van Grondelle, Rienk

    2006-01-12

    Optical pump-induced dynamics of the highly asymmetric carotenoid peridinin in methanol was studied by dispersed pump-probe, pump-dump-probe, and pump-repump-probe transient absorption spectroscopy in the visible region. Dispersed pump-probe measurements show that the decay of the initially excited S2 state populates two excited states, the S1 and the intramolecular charge-transfer (ICT) state, at a ratio determined by the excitation wavelength. The ensuing spectral evolution occurs on the time scale of a few picoseconds and suggests the equilibration of these states. Dumping the stimulated emission of the ICT state with an additional 800-nm pulse after 400- and 530-nm excitation preferentially removes the ICT state contribution from the broad excited-state absorption, allowing for its spectral characterization. At the same time, an unrelaxed ground-state species, which has a subpicosecond lifetime, is populated. The application of the 800-nm pulse at early times, when the S2 state is still populated, led to direct generation of the peridinin cation, observed for the first time in a transient absorption experiment. The excited and ground electronic states manifold of peridinin has been reconstructed using target analysis; this approach combined with the measured multipulse spectroscopic data allows us to estimate the spectra and time scales of the corresponding transient states.

  4. Residual heat removal pump and low pressure safety injection pump retrofit program

    International Nuclear Information System (INIS)

    Dudiak, J.G.; McKenna, J.M.

    1992-01-01

    Residual Heat Removal (RHR) and low pressure safety injection (LPSI) pumps installed in pressurized water-to-reactor power plants are used to provide low-head safety injection in the event of loss of coolant in the reactor coolant system. Because these pumps are subjected to rather severe temperature and pressure transients, the majority of pumps installed in the RHR service are vertical pumps with a single stage impeller. Typically the pump impeller is mounted on an extended motor shaft (close-coupled configuration) and a mechanical seal is employed at the pump end of the shaft. Traditionally RHR and LPSI pumps have been a significant maintenance item for many utilities. Periodic mechanical seal of motor bearing replacement often is considered routine maintenance. The closed-coupled pump design requires disassembly of the casing cover from the lower pump casing while performing these routine maintenance tasks. This paper introduces a design modification developed to convert the close-coupled RHR and LPSI pumps to a coupled configuration

  5. The Performance test of Mechanical Sodium Pump with Water Environment

    International Nuclear Information System (INIS)

    Cho, Chungho; Kim, Jong-Man; Ko, Yung Joo; Jeong, Ji-Young; Kim, Jong-Bum; Ko, Bock Seong; Park, Sang Jun; Lee, Yoon Sang

    2015-01-01

    As contrasted with PWR(Pressurized light Water Reactor) using water as a coolant, sodium is used as a coolant in SFR because of its low melting temperature, high thermal conductivity, the high boiling temperature allowing the reactors to operate at ambient pressure, and low neutron absorption cross section which is required to achieve a high neutron flux. But, sodium is violently reactive with water or oxygen like the other alkali metal. So Very strict requirements are demanded to design and fabricate of sodium experimental facilities. Furthermore, performance testing in high temperature sodium environments is more expensive and time consuming and need an extra precautions because operating and maintaining of sodium experimental facilities are very difficult. The present paper describes performance test results of mechanical sodium pump with water which has been performed with some design changes using water test facility in SAM JIN Industrial Co. To compare the hydraulic characteristic of model pump with water and sodium, the performance test of model pump were performed using vender's experimental facility for mechanical sodium pump. To accommodate non-uniform thermal expansion and to secure the operability and the safety, the gap size of some parts of original model pump was modified. Performance tests of modified mechanical sodium pump with water were successfully performed. Water is therefore often selected as a surrogate test fluid because it is not only cheap, easily available and easy to handle but also its important hydraulic properties (density and kinematic viscosity) are very similar to that of the sodium. Normal practice to thoroughly test a design or component before applied or installed in reactor is important to ensure the safety and operability in the sodium-cooled fast reactor (SFR). So, in order to estimate the hydraulic behavior of the PHTS pump of DSFR (600 MWe Demonstraion SFR), the performance tests of the model pump such as performance

  6. Magnetic composite Hydrodynamic Pump with Laser Induced Graphene Electrodes

    KAUST Repository

    Khan, Mohammed Asadullah; Hristovski, Ilija R.; Marinaro, Giovanni; Kosel, Jü rgen

    2017-01-01

    A polymer based magneto hydrodynamic pump capable of actuating saline fluids is presented. The benefit of this pumping concept to operate without any moving parts is combined with simple and cheap fabrication methods and a magnetic composite material, enabling a high level of integration. The operating principle, fabrication methodology and flow characteristics of the pump are detailed. The pump electrodes are created by laser printing of polyimide, while the permanent magnet is molded from an NdFeB powder - polydimethylsiloxane (PDMS) composite. The cross-section area of the pump is 240 mm $^2$ . The electrode length is 5 mm. The magnetic characteristics of the NdFeB-PDMS composite indicate high degree of magnetization, which increases the pump efficiency. Using a saline solution similar to seawater, the pump produces 3.4 mm/s flow velocity at a voltage of 7.5V and a current density of 30 mA/cm $^2$ .

  7. Magnetic composite Hydrodynamic Pump with Laser Induced Graphene Electrodes

    KAUST Repository

    Khan, Mohammed Asadullah

    2017-05-24

    A polymer based magneto hydrodynamic pump capable of actuating saline fluids is presented. The benefit of this pumping concept to operate without any moving parts is combined with simple and cheap fabrication methods and a magnetic composite material, enabling a high level of integration. The operating principle, fabrication methodology and flow characteristics of the pump are detailed. The pump electrodes are created by laser printing of polyimide, while the permanent magnet is molded from an NdFeB powder - polydimethylsiloxane (PDMS) composite. The cross-section area of the pump is 240 mm $^2$ . The electrode length is 5 mm. The magnetic characteristics of the NdFeB-PDMS composite indicate high degree of magnetization, which increases the pump efficiency. Using a saline solution similar to seawater, the pump produces 3.4 mm/s flow velocity at a voltage of 7.5V and a current density of 30 mA/cm $^2$ .

  8. Thermal fracture and pump limit of Nd: glass

    International Nuclear Information System (INIS)

    Wang Mingzhe; Ma Wen; Tan Jichun; Zhang Yongliang; Li Mingzhong; Jing Feng

    2011-01-01

    Based on published fracture experiments and 3D transient finite-element analyses, and taking the first principal stress as the criterion and the Griffith crack theory to determine the critical fracture stress, a Weibull statistical model is established to predict the fracture possibility of Nd: glass with certain pump parameters. Other issues which limit the pump power are also presented. The results show that the fracture limit of laser medium depends on the optical polishing technology. For a short pulse and high energy Nd: glass laser, taking America's polishing technology in the 1990s as reference,the pump saturation limits the pump power to 18 kW/cm 2 when the repetition rate is lower than 1 Hz, while the thermal fracture limits the pump power when the repetition rate is higher than 10 Hz. (authors)

  9. Diode-pumped Yb:Sr5(PO4)3F laser performance

    International Nuclear Information System (INIS)

    Marshall, C.D.; Payne, S.A.; Smith, L.K.

    1995-01-01

    The performance of the first diode-pumped Yb 3+ -doped Sr 5 (PO 4 ) 3 F (Yb:S-FAP) laser is discussed. We found the pumping dynamics and extraction cross-sections of Yb:S-FAP crystals to be similar to those previously inferred by purely spectroscopic techniques. The saturation fluence for pumping was measured to be 2.2 J/cm 2 using three different methods based on either the spatial, temporal, or energy transmission properties of a Yb:S-FAP rod. The small signal gain implies an emission cross section of 6.0 x 10 -20 cm 2 that falls within error bars of the previously reported value of 7.3 x 10 -20 cm 2 , obtained from spectroscopic techniques. Up to 1.7 J/cm 3 of stored energy density was achieved in a 6 x 6 x 44 mm Yb:S-FAP amplifier rod. An InGaAs diode array has been fabricated that has suitable specifications for pumping a 3 x 3 x 30 mm Yb:S-FAP rod. In a free running configuration diode-pumped slope efficiencies up to 43% were observed with output energies up to ∼0.5 J per 1 ms pulse. When the rod was mounted in a copper block for cooling, 13 W of average power was produced with power supply limited operation at 70 Hz and 500 μs pulses

  10. 75 FR 82372 - Application(s) for Duty-Free Entry of Scientific Instruments

    Science.gov (United States)

    2010-12-30

    ... Minnesota School of Dentistry, 6-150 MoosT, 515 Delaware St., S E, Minneapolis, MN 55455. Instrument: Dental... biofilm of dental decay in children. This custom made imaging system will image under resin composite...

  11. 23 CFR 810.102 - Eligible projects.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Eligible projects. 810.102 Section 810.102 Highways... SPECIAL USE HIGHWAY PROJECTS Highway Public Transportation Projects and Special Use Highway Facilities § 810.102 Eligible projects. Under this subpart the Federal Highway Administrator may approve on any...

  12. 5 CFR 10.2 - Accountability systems.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Accountability systems. 10.2 Section 10.2 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE RULES AGENCY ACCOUNTABILITY SYSTEMS; OPM AUTHORITY TO REVIEW PERSONNEL MANAGEMENT PROGRAMS (RULE X) § 10.2 Accountability systems. The Director of...

  13. 42 CFR 422.102 - Supplemental benefits.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Supplemental benefits. 422.102 Section 422.102... (CONTINUED) MEDICARE PROGRAM MEDICARE ADVANTAGE PROGRAM Benefits and Beneficiary Protections § 422.102 Supplemental benefits. (a) Mandatory supplemental benefits. (1) Subject to CMS approval, an MA organization may...

  14. Pump Application as Hydraulic Turbine – Pump as Turbine (PaT)

    OpenAIRE

    Rusovs, D

    2009-01-01

    The paper considers pump operation as hydraulic turbine with purpose to produce mechanical power from liquid flow. The Francis hydraulic turbine was selected for comparison with centrifugal pump in reverse operation. Turbine and centrifugal pump velocity triangles were considered with purpose to evaluate PaT efficiency. Shape of impeller blades for turbine and pumps was analysed. Specific speed calculation is carried out with purpose to obtain similarity in pump and turbine description. For ...

  15. Operational Test Report (OTR) for U-105 Pumping and Instrumentation and Control (PIC) Skid

    International Nuclear Information System (INIS)

    KOCH, M.R.

    2000-01-01

    Attached is the completed Operation Test Procedure (OTP-200-004, Rev. A-18). OTP includes a print out of the Programmable Logic Controller (PLC) Ladder Diagram. Ladder Diagram was designed for installation in the PLC used to monitor and control pumping activity for Tank Farm 241-U-105. The completed OTP and OTR are referenced in the IS PIC Skid Configuration Drawing (H-2-829998)

  16. Operational Test Report (OTR) for U-105 Pumping and Instrumentation and Control (PIC) Skid

    Energy Technology Data Exchange (ETDEWEB)

    KOCH, M.R.

    2000-02-28

    Attached is the completed Operation Test Procedure (OTP-200-004, Rev. A-18). OTP includes a print out of the Programmable Logic Controller (PLC) Ladder Diagram. Ladder Diagram was designed for installation in the PLC used to monitor and control pumping activity for Tank Farm 241-U-105. The completed OTP and OTR are referenced in the IS PIC Skid Configuration Drawing (H-2-829998).

  17. Operational Test Report (OTR) for U-103 Pumping and Instrumentation and Control (PIC) Skid

    Energy Technology Data Exchange (ETDEWEB)

    KOCH, M.R.

    2000-02-28

    Attached is the completed Operation Test Procedure (OTP-200-004, Rev. A-16). OTP includes a print out of the Programmable Logic Controller (PLC) Ladder Diagram. Ladder Diagram was designed for installation in the PLC used to monitor and control pumping activity for Tank Farm 241-U-103. The completed OTP and OTR are referenced in the 25 PIC Skid Configuration Drawing (H-2-829998).

  18. ENERGY STAR Certified Pool Pumps

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 1.1 ENERGY STAR Program Requirements for Pool Pumps that are effective as of February 15,...

  19. 46 CFR 193.10-5 - Fire pumps.

    Science.gov (United States)

    2010-10-01

    ... Pitot tube pressure of not less than 50 p.s.i. Where 11/2-inch hose is permitted in lieu of 21/2-inch... 21/2-inch hose had been permitted. Where 3/4-inch hose is permitted by Table 193.10-5(a), the Pitot... fire pumps; or (B) Another suitable pump capable of supplying one hose stream at a Pitot tube pressure...

  20. Heat pumps

    CERN Document Server

    Macmichael, DBA

    1988-01-01

    A fully revised and extended account of the design, manufacture and use of heat pumps in both industrial and domestic applications. Topics covered include a detailed description of the various heat pump cycles, the components of a heat pump system - drive, compressor, heat exchangers etc., and the more practical considerations to be taken into account in their selection.

  1. A study of water pump efficiency for household water demand at Lubuklinggau

    Science.gov (United States)

    Emiliawati, Anna

    2017-11-01

    Water pump is a device to transport liquid from one place to another. This device is used in most of household in Indonesia. Small-scale water pump which is effective to lift more discharge is generally used. The ones that are most preferred are centrifugal types which having low absorbability. Pump performance is limited by pressure level in real electrical power whereas pump efficiency is influenced by head and discharge. The research aims to find out the efficiency of five distinct brands of home water pumps which are broadly distributed in market. Efficiency analysis take by laboratorium and financial analysis using NPV and BCR are done in order to obtained dicharge and pressure from each pump. At the end of the research, one out of 5 home water pump brands will be selected as the optimal working home water pump with low operational expense based on the utilizing age. The result of the research shows that the maximum efficiency value among various brands of water pump is diverse. Each value is arranged as follow from water pump A to E orderly: 12,9%, 13,5%, 12,8%, 14,8%, and 3,4%. From the calculation, water demand of South Lubuklinggau at stage 1 is 1117,7 l/s and stage 2 is 3495,2 l/s.. Moreover, the researcher conducts of investment, operation and maintenance cost with 25 years pump utilizing age towards 2 conditions (1) of maximum efficiency, i.e. pump A Rp16.563.971; pump B Rp12.163.798; pump C Rp11.809.513,2; pump D Rp11.473.928,3; pump E Rp12.648.708,3; (2) of max discharge, i.e. pump A Rp111.993.822,8; pump B Rp26.128.845,1; pump C Rp51.697.208,8; pump D Rp51.098.687,4; pump E Rp22.915.952,7;Financial analysis with interest rate 13% show a positive NPV(+) for all pump except pump A in max efficiency and a negative NPV (-) for all except pump B in max discharge. BCR value for max efficiency are pump A 0,8; pump B 1,6; pump C 1,7; pump D 1,7 and pump E 1,3. And for max discharge are pump A 0,2; pump B 1,1; pump C 0,7; pump D 0,7 and pump E 0,9. Result

  2. Reactor coolant purification system circulation pumps (CUW pumps)

    International Nuclear Information System (INIS)

    Tsutsui, Toshiaki

    1979-01-01

    Coolant purification equipments for BWRs have been improved, and the high pressure purifying system has become the main type. The quantity of purifying treatment also changed to 2% of the flow rate of reactor feed water. As for the circulation pumps, canned motor pumps are adopted recently, and the improvements of reliability and safety are attempted. The impurities carried in by reactor feed water and the corrosion products generated in reactors and auxiliary equipments are activated by neutron irradiation or affect heat transfer adversely, adhering to fuel claddings are core structures. Therefore, a part of reactor coolant is led to the purification equipments, and returned to reactors after the impurities are eliminated perfectly. At the time of starting and stopping reactors, excess reactor water and the contaminated water from reactors are transferred to main condenser hot wells or waste treatment systems. Thus the prescribed water quality is maintained. The operational modes of and the requirements for the CUW pumps, the construction and the features of the canned motor type CUW pumps are explained. Recently, a pump operated for 11 months without any maintenance has been disassembled and inspected, but the wear of bearings has not been observed, and the high reliability of the pump has been proved. (Kako, I.)

  3. Development of an international standard on instruments setpoints based on ISA S67.04 - 1994

    International Nuclear Information System (INIS)

    Quinn, E.L.

    1996-01-01

    This is a summary of the application for and development of an international standard on instrument setpoints, based on the Instrument Society of America (ISA) Standard S67.04 - 1994. The forum this new standard was proposed in is the International Electrotechnique Commission (IEC), based in Geneva, Switzerland, which is the international commission which oversees electrical and instrumentation standards for all applications around the world. The Instrument Society of America (ISA) is a United States based Society for the advancement of instrumentation and controls related science and technology and has 30,000 members. A division within the ISA is the Standard and Practices board which has over 5000 members actively involved in standards development and approval. In 1994, the ISA SP67, Nuclear Power Plant Standards Committee authorized that the IEC be approached to develop and issue an IEC standard on Instrument Setpoints. This application was formally submitted in January, 1995 to the IEC and approved for ballot to member countries in June, 1995. Approval for standard development by IEC was received in October, 1995 and the first draft vas issued in February, 1996, and is currently under review by the IEC working group. It is very important to focus on the approach that the U.S. and other countries are taking toward development of IEC standards that can apply to all nuclear instrumentation applications around the world. By referencing IEC standards in design specification, vendors can be solicited from many different countries, thereby ensuring that the highest quality products can be used. This also offsets the need to specify individual standards in the specification, based on the country that each vendor solicited, represents. In summary, this standard development process, with support from the American National Standards Institute (ANSI) will assist U.S. suppliers in competing in the global market for products and services into the next century. (author)

  4. The role of capacitance in a wind-electric water pumping system

    Energy Technology Data Exchange (ETDEWEB)

    Ling, Shitao [West Texas A& M Univ., Canyon, TX (United States); Clark, R.N. [Conservation and Production Research Lab., Bushland, TX (United States)

    1997-12-31

    The development of controllers for wind-electric water pumping systems to enable the use of variable voltage, variable frequency electricity to operate standard AC submersible pump motors has provided a more efficient and flexible water pumping system to replace mechanical windmills. A fixed capacitance added in parallel with the induction motor improves the power factor and starting ability of the pump motor at the lower cut-in frequency. The wind-electric water pumping system developed by USDA-Agricultural Research Service, Bushland, TX, operated well at moderate wind speeds (5-12 m/s), but tended to lose synchronization in winds above 12 m/s, especially if they were gusty. Furling generally did not occur until synchronization had been lost and the winds had to subside before synchronization could be reestablished. The frequency needed to reestablish synchronization was much lower (60-65 Hz) than the frequency where synchronization was lost (70-80 Hz). As a result, the load (motor and pump) stayed off an excessive amount of time thus causing less water to be pumped and producing a low system efficiency. The controller described in this paper dynamically connects additional capacitance of the proper amount at the appropriate time to keep the system synchronized (running at 55 to 60 Hz) and pumping water even when the wind speed exceeds 15 m/s. The system efficiency was improved by reducing the system off-line time and an additional benefit was reducing the noise caused by the high speed blade rotation when the load was off line in high winds.

  5. 7 CFR 1900.102 - Applicable law.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Applicable law. 1900.102 Section 1900.102 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... GENERAL Applicability of Federal Law § 1900.102 Applicable law. Loans made by FmHA or its successor agency...

  6. 40 CFR 280.102 - Trust fund.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Trust fund. 280.102 Section 280.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) TECHNICAL STANDARDS AND CORRECTIVE ACTION REQUIREMENTS FOR OWNERS AND OPERATORS OF UNDERGROUND STORAGE TANKS (UST) Financial Responsibility § 280.102 Trust...

  7. 41 CFR 51-10.102 - Application.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Application. 51-10.102 Section 51-10.102 Public Contracts and Property Management Other Provisions Relating to Public Contracts... WHO ARE BLIND OR SEVERELY DISABLED § 51-10.102 Application. This part applies to all programs or...

  8. 20 CFR 653.102 - Job information.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Job information. 653.102 Section 653.102... SERVICE SYSTEM Services for Migrant and Seasonal Farmworkers (MSFWs) § 653.102 Job information. All State agencies shall make job order information conspicuous and available to MSFWs in all local offices. This...

  9. 19 CFR 360.102 - Online registration.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Online registration. 360.102 Section 360.102... ANALYSIS SYSTEM § 360.102 Online registration. (a) In general. (1) Any importer, importing company, customs.... boxes will not be accepted. A user identification number will be issued within two business days...

  10. Preliminary design of RDE feedwater pump impeller

    International Nuclear Information System (INIS)

    Sri Sudadiyo

    2018-01-01

    Nowadays, pumps are being widely used in the thermal power generation including nuclear power plants. Reaktor Daya Experimental (RDE) is a proposed nuclear reactor concept for the type of nuclear power plant in Indonesia. This RDE has thermal power 10 MW th , and uses a feedwater pump within its steam cycle. The performance of feedwater pump depends on size and geometry of impeller model, such as the number of blades and the blade angle. The purpose of this study is to perform a preliminary design on an impeller of feedwater pump for RDE and to simulate its performance characteristics. The Fortran code is used as an aid in data calculation in order to rapidly compute the blade shape of feedwater pump impeller, particularly for a RDE case. The calculations analyses is solved by utilizing empirical correlations, which are related to size and geometry of a pump impeller model, while performance characteristics analysis is done based on velocity triangle diagram. The effect of leakage, pass through the impeller due to the required clearances between the feedwater pump impeller and the volute channel, is also considered. Comparison between the feedwater pump of HTR-10 and of RDE shows similarity in the trend line of curve shape. These characteristics curves will be very useful for the values prediction of performance of a RDE feedwater pump. Preliminary design of feedwater pump provides the size and geometry of impeller blade model with 5-blades, inlet angle 14.5 degrees, exit angle 25 degrees, inside diameter 81.3 mm, exit diameter 275.2 mm, thickness 4.7 mm, and height 14.1 mm. In addition, the optimal values of performance characteristics were obtained when flow capacity was 4.8 kg/s, fluid head was 29.1 m, shaft mechanical power was 2.64 kW, and efficiency was 52 % at rotational speed 1750 rpm. (author)

  11. 22 CFR 102.8 - Reporting accidents.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Reporting accidents. 102.8 Section 102.8... Accidents Abroad § 102.8 Reporting accidents. (a) To airline and Civil Aeronautics Administration... probably be the first to be informed of the accident, in which event he will be expected to report the...

  12. 21 CFR 102.5 - General principles.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false General principles. 102.5 Section 102.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION COMMON OR USUAL NAME FOR NONSTANDARDIZED FOODS General Provisions § 102.5 General principles. (a...

  13. 2011 IEEE Visualization Contest Winner: Visualizing Unsteady Vortical Behavior of a Centrifugal Pump

    KAUST Repository

    Otto, Mathias

    2012-09-01

    In the 2011 IEEE Visualization Contest, the dataset represented a high-resolution simulation of a centrifugal pump operating below optimal speed. The goal was to find suitable visualization techniques to identify regions of rotating stall that impede the pump\\'s effectiveness. The winning entry split analysis of the pump into three parts based on the pump\\'s functional behavior. It then applied local and integration-based methods to communicate the unsteady flow behavior in different regions of the dataset. This research formed the basis for a comparison of common vortex extractors and more recent methods. In particular, integration-based methods (separation measures, accumulated scalar fields, particle path lines, and advection textures) are well suited to capture the complex time-dependent flow behavior. This video (http://youtu.be/ oD7QuabY0oU) shows simulations of unsteady flow in a centrifugal pump. © 2012 IEEE.

  14. Verification Test of Hydraulic Performance for Reactor Coolant Pump

    Energy Technology Data Exchange (ETDEWEB)

    Park, Sang Jun; Kim, Jae Shin; Ryu, In Wan; Ko, Bok Seong; Song, Keun Myung [Samjin Ind. Co., Seoul (Korea, Republic of)

    2010-01-15

    According to this project, basic design for prototype pump and model pump of reactor coolant pump and test facilities has been completed. Basic design for prototype pump to establish structure, dimension and hydraulic performance has been completed and through primary flow analysis by computational fluid dynamics(CFD), flow characteristics and hydraulic performance have been established. This pump was designed with mixed flow pump having the following design requirements; specific velocity(Ns); 1080.9(rpm{center_dot}m{sup 3}/m{center_dot}m), capacity; 3115m{sup 3}/h, total head ; 26.3m, pump speed; 1710rpm, pump efficiency; 77.0%, Impeller out-diameter; 349mm, motor output; 360kw, design pressure; 17MPaG. The features of the pump are leakage free due to no mechanical seal on the pump shaft which insures reactor's safety and law noise level and low vibration due to no cooling fan on the motor which makes eco-friendly product. Model pump size was reduced to 44% of prototype pump for the verification test for hydraulic performance of reactor coolant pump and was designed with mixed flow pump and canned motor having the following design requirements; specific speed(NS); 1060.9(rpm{center_dot}m{sup 3}/m{center_dot}m), capacity; 539.4m{sup 3}/h, total head; 21.0m, pump speed; 3476rpm, pump efficiency; 72.9%, Impeller out-diameter; 154mm, motor output; 55kw, design pressure; 1.0MPaG. The test facilities were designed for verification test of hydraulic performance suitable for pump performance test, homologous test, NPSH test(cavitation), cost down test and pressure pulsation test of inlet and outlet ports. Test tank was designed with testing capacity enabling up to 2000m{sup 3}/h and design pressure 1.0MPaG. Auxiliary pump was designed with centrifugal pump having capacity; 1100m{sup 3}/h, total head; 42.0m, motor output; 190kw

  15. 19 CFR 102.22 - Rules of origin for textile and apparel products of Israel.

    Science.gov (United States)

    2010-04-01

    ... of Israel. 102.22 Section 102.22 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... textile and apparel products of Israel. (a) Applicability. The provisions of this section will control for... product of Israel for purposes of the customs laws and the administration of quantitative limitations. A...

  16. 29 CFR 102.70 - Runoff election.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Runoff election. 102.70 Section 102.70 Labor Regulations... Runoff election. (a) The regional director shall conduct a runoff election, without further order of the... objections are filed as provided in § 102.69. Only one runoff shall be held pursuant to this section. (b...

  17. 29 CFR 102.4 - Region; subregion.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Region; subregion. 102.4 Section 102.4 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Definitions § 102.4 Region; subregion. The term region as used herein shall mean that part of the United States or any Territory thereof...

  18. Raising the temperature of the UK heat pump market: Learning lessons from Finland

    International Nuclear Information System (INIS)

    Hannon, Matthew J.

    2015-01-01

    Heat pumps play a central role in decarbonising the UK's buildings sector as part of the Committee on Climate Change's (CCC) updated abatement scenario for meeting the UK's fourth carbon budget. However, the UK has one of the least developed heat pump markets in Europe and renewable heat output from heat pumps will need to increase by a factor of 50 over the next 15 years to be in line with the scenario. Therefore, this paper explores what lessons the UK might learn from Finland to achieve this aim considering that its current level of heat pump penetration is comparable with that outlined in the CCC scenario for 2030. Despite the two countries’ characteristic differences we argue they share sufficient similarities for the UK to usefully draw some policy-based lessons from Finland including: stimulating new-build construction and renovation of existing stock; incorporating renewable heat solutions in building energy performance standards; and bringing the cost of heat pumps in-line with gas fired heating via a combination of subsidies, taxes and energy RD&D. Finally, preliminary efforts to grow the heat pump market could usefully focus on properties unconnected to the gas-grid, considering these are typically heated by relatively expensive oil or electric heating technologies. -- Highlights: •Heat pumps are expected to play a key role in meeting the UK's 4th carbon budget. •Today, heat pump deployment per capita in the UK is one of the lowest in Europe. •Finland offers some policy lessons given its high level of heat pump deployment. •Policies: raising build rates, building standards and heat pump cost-effectiveness. •Deployment efforts should focus on buildings not heated by relatively low-cost gas

  19. Fluid-structure coupling in the guide vanes cascade of a pump-turbine scale model

    International Nuclear Information System (INIS)

    Roth, S; Hasmatuchi, V; Botero, F; Farhat, M; Avellan, F

    2010-01-01

    The present study concerns fluid-structure coupling phenomena occurring in a guide vane cascade of a pump-turbine scale model placed in the EPFL PF3 test rig. An advanced instrument set is used to monitor both vibrating structures and the surrounding flow. The paper highlights the interaction between vibrating guide vanes and the flow behavior. The pressure fluctuations in the stay vanes region are found to be strongly influenced by the amplitude of the vibrating guide vanes. Moreover, the flow induces different hydrodynamic damping on the vibrating guide vanes depending on the operating point of the pump-turbine.

  20. Fluid-structure coupling in the guide vanes cascade of a pump-turbine scale model

    Science.gov (United States)

    Roth, S.; Hasmatuchi, V.; Botero, F.; Farhat, M.; Avellan, F.

    2010-08-01

    The present study concerns fluid-structure coupling phenomena occurring in a guide vane cascade of a pump-turbine scale model placed in the EPFL PF3 test rig. An advanced instrument set is used to monitor both vibrating structures and the surrounding flow. The paper highlights the interaction between vibrating guide vanes and the flow behavior. The pressure fluctuations in the stay vanes region are found to be strongly influenced by the amplitude of the vibrating guide vanes. Moreover, the flow induces different hydrodynamic damping on the vibrating guide vanes depending on the operating point of the pump-turbine.

  1. Pumping life

    DEFF Research Database (Denmark)

    Sitsel, Oleg; Dach, Ingrid; Hoffmann, Robert Daniel

    2012-01-01

    The name PUMPKIN may suggest a research centre focused on American Halloween traditions or the investigation of the growth of vegetables – however this would be misleading. Researchers at PUMPKIN, short for Centre for Membrane Pumps in Cells and Disease, are in fact interested in a large family o......’. Here we illustrate that the pumping of ions means nothing less than the pumping of life....

  2. Champagne Heat Pump

    Science.gov (United States)

    Jones, Jack A.

    2004-01-01

    The term champagne heat pump denotes a developmental heat pump that exploits a cycle of absorption and desorption of carbon dioxide in an alcohol or other organic liquid. Whereas most heat pumps in common use in the United States are energized by mechanical compression, the champagne heat pump is energized by heating. The concept of heat pumps based on other absorption cycles energized by heat has been understood for years, but some of these heat pumps are outlawed in many areas because of the potential hazards posed by leakage of working fluids. For example, in the case of the water/ammonia cycle, there are potential hazards of toxicity and flammability. The organic-liquid/carbon dioxide absorption/desorption cycle of the champagne heat pump is similar to the water/ammonia cycle, but carbon dioxide is nontoxic and environmentally benign, and one can choose an alcohol or other organic liquid that is also relatively nontoxic and environmentally benign. Two candidate nonalcohol organic liquids are isobutyl acetate and amyl acetate. Although alcohols and many other organic liquids are flammable, they present little or no flammability hazard in the champagne heat pump because only the nonflammable carbon dioxide component of the refrigerant mixture is circulated to the evaporator and condenser heat exchangers, which are the only components of the heat pump in direct contact with air in habitable spaces.

  3. Double twist : Can-K's electric submersible twin screw pump is designed to handle the nastiest crudes

    Energy Technology Data Exchange (ETDEWEB)

    Byfield, M.

    2010-12-15

    This article described the Can-K Group of Companies' electric submersible twin screw pump (ESTSP) designed for pumping heavy crudes with high levels of asphaltenes, hydrogen sulphide, wax, and methane. The technology was awarded the 2010 winner of best production technology for a company with fewer than 100 employees. The ESTSP can pump at a greater depth than other lift technologies. The design challenges included making the pump small enough to fit inside the well casing while also able to generate the high pressures necessary for pumping heavy oil. The ESTSP can compete directly against other lift technologies, including electric submersible pumps (ESPs). In the design, two shafts are separated by a timing gear. Each shaft has short sections of interlocking screws that do not touch, which lessens tension and the need for torque, lowering electricity consumption. The ESTSP is more efficient than ESP systems, particularly in more viscous mediums with high gas-to-oil ratios. The positive displacement pump interprets only volume and does not distinguish between gas and oil, functioning with gas content up to 97 percent. ESTSP can also handle more sand than ESP because it does not rely on centrifugal force. A patented screw design also helps prevent pump seizure resulting from sand and other solids. The pump uses downhole electric motors from other manufacturers. The inherent efficiencies of twin screw pumps give the technology the potential to replace conventional ESPs. 2 figs.

  4. Dynamic characteristics of a pump-turbine during hydraulic transients of a model pumped-storage system: 3D CFD simulation

    International Nuclear Information System (INIS)

    Zhang, X X; Cheng, Y G; Xia, L S; Yang, J D

    2014-01-01

    The runaway process in a model pumped-storage system was simulated for analyzing the dynamic characteristics of a pump-turbine. The simulation was adopted by coupling 1D (One Dimensional) pipeline MOC (Method of Characteristics) equations with a 3D (Three Dimensional) pump-turbine CFD (Computational Fluid Dynamics) model, in which the water hammer wave in the 3D zone was defined by giving a pressure dependent density. We found from the results that the dynamic performances of the pump-turbine do not coincide with the static operating points, especially in the S-shaped characteristics region, where the dynamic trajectories follow ring-shaped curves. Specifically, the transient operating points with the same Q 11 and M 11 in different moving directions of the dynamic trajectories give different n 11 . The main reason of this phenomenon is that the transient flow patterns inside the pump-turbine are influenced by the ones in the previous time step, which leads to different flow patterns between the points with the same Q 11 and M 11 in different moving directions of the dynamic trajectories

  5. Dynamic characteristics of a pump-turbine during hydraulic transients of a model pumped-storage system: 3D CFD simulation

    Science.gov (United States)

    Zhang, X. X.; Cheng, Y. G.; Xia, L. S.; Yang, J. D.

    2014-03-01

    The runaway process in a model pumped-storage system was simulated for analyzing the dynamic characteristics of a pump-turbine. The simulation was adopted by coupling 1D (One Dimensional) pipeline MOC (Method of Characteristics) equations with a 3D (Three Dimensional) pump-turbine CFD (Computational Fluid Dynamics) model, in which the water hammer wave in the 3D zone was defined by giving a pressure dependent density. We found from the results that the dynamic performances of the pump-turbine do not coincide with the static operating points, especially in the S-shaped characteristics region, where the dynamic trajectories follow ring-shaped curves. Specifically, the transient operating points with the same Q11 and M11 in different moving directions of the dynamic trajectories give different n11. The main reason of this phenomenon is that the transient flow patterns inside the pump-turbine are influenced by the ones in the previous time step, which leads to different flow patterns between the points with the same Q11 and M11 in different moving directions of the dynamic trajectories.

  6. Recent progress in diode-pumped mid-infrared vibronic solid-state lasers

    International Nuclear Information System (INIS)

    Sorokina, I.T.; Sorokin, E.; Mirov, S.; Schaffers, K.

    2002-01-01

    Full text: The last few years were marked by the increased interest of researchers towards the new class of transition-metal doped zinc chalcogenides. In particular Cr:ZnSe attracts a lot of attention as broadly tunable continuous-wave (cw), mode-locked and diode-pumped lasers operating around 2.5 mm. This interest is explained by the absence of other comparable tunable room-temperature laser sources in this spectral region. However, another member of the II-VI compounds family Cr:ZnS, has yet remained barely studied as a laser medium. Recently we demonstrated the first continuous-wave room-temperature tunable over more than 280 nm around 2.3 μm Cr 2+ :ZnS laser, pumped with a Co:MgF2 laser and yielding over 100 mW of output power. The most recent result is the development of a compact tunable over 700 nm continuous-wave room-temperature Cr 2+ :ZnS laser, pumped by the diode-pumped Er-fiber laser at 1.6 μm and generating 0.7 W of the linearly polarized radiation. We also demonstrated direct diode-pumping at 1.6 μm of the Cr 2+ :ZnS. Although the Cr:ZnS exhibited lower (relatively to the Cr:ZnSe) efficiency and output power due to the higher passive losses of the available Cr:ZnS samples, the analysis of the spectroscopic and laser data indicates the high potential of Cr:ZnS for compact broadly tunable mid-infrared systems, as well as for high power applications. The physics of the novel diode-pumped laser systems is highly interesting. It comprises the features of the ion-doped dielectric crystalline lasers and semiconductors. For example, we observe in these media, for the first time to our knowledge, a new nonlinear phenomenon, which is analogous to the opto-optical switching process, where the laser output of the diode-pumped continuous-wave Cr:ZnSe and Cr:ZnS lasers around 2.5 μm is modulated by only a few milliwatt of the visible (470-500 nm) and near-infrared radiation (740-770 nm). We present a physical explanation of the observed effect. Refs. 4 (author)

  7. Laser pumped lasers for isotope separation

    International Nuclear Information System (INIS)

    Fry, S.M.

    1976-01-01

    A study of the isotope separation laser requirements reveals that high pressure polyatomic molecular gas laser pumped lasers can attain the necessary characteristics including tunability, energy output, pulse width, and repetition rate. The results of a search, made for molecules meeting the appropriate requirements for one of several pump schemes utilizing a CO 2 laser and with output in the 12 μm or 16μm wavelength range, are presented. Several methods of pumping are reviewed and two novel pump schemes are presented. A laser pumped laser device design is given, and operation of this device and associated diagnostic equipment is confirmed by repeating experiments in OCS and NH 3 . The results of OCS laser experiments show that an improvement in pump rate and output per unit length is obtained with the device, using a wedged transverse pumping scheme. A new multi-line laser system in NH 3 pumped by a TEA CO 2 laser is reported. More than forty transitions spanning the wavelength range of 9.2 to 13.8 μm are observed and identified. A strong output at 12.08 μm is one of the closest lines yet found to the required laser isotope separation wavelength. Far infrared emission near 65 μm is observed and is responsible for populating levels which lase in pure ammonia near 12.3 μm. Buffer gas (e.g., N 2 or He) pressures of approximately 40--800 torr cause energy transfer by collision-induced rotationaltransitions from the pumped antisymmetric to the lasing symmetric levels in the nu 2 = 1 band of ammonia. Most of the observed lines are aP(J,K) transitions which originate from the nu 2 /sup s/ band. Measurements of the pressure dependence of the laser output shows that some lines lase at pressures greater than one atmosphere. Transient behavior of the 12.08 μm line is calculated from a simplified analytic model and these calculations are compared to the experimental results

  8. Role of bacterial efflux pumps in biofilm formation.

    Science.gov (United States)

    Alav, Ilyas; Sutton, J Mark; Rahman, Khondaker Miraz

    2018-02-28

    Efflux pumps are widely implicated in antibiotic resistance because they can extrude the majority of clinically relevant antibiotics from within cells to the extracellular environment. However, there is increasing evidence from many studies to suggest that the pumps also play a role in biofilm formation. These studies have involved investigating the effects of efflux pump gene mutagenesis and efflux pump inhibitors on biofilm formation, and measuring the levels of efflux pump gene expression in biofilms. In particular, several key pathogenic species associated with increasing multidrug resistance, such as Acinetobacter baumannii, Escherichia coli, Pseudomonas aeruginosa and Staphylococcus aureus, have been investigated, whilst other studies have focused on Salmonella enterica serovar Typhimurium as a model organism and problematic pathogen. Studies have shown that efflux pumps, including AcrAB-TolC of E. coli, MexAB-OprM of P. aeruginosa, AdeFGH of A. baumannii and AcrD of S. enterica, play important roles in biofilm formation. The substrates for such pumps, and whether changes in their efflux activity affect biofilm formation directly or indirectly, remain to be determined. By understanding the roles that efflux pumps play in biofilm formation, novel therapeutic strategies can be developed to inhibit their function, to help disrupt biofilms and improve the treatment of infections. This review will discuss and evaluate the evidence for the roles of efflux pumps in biofilm formation and the potential approaches to overcome the increasing problem of biofilm-based infections.

  9. Breastfeeding FAQs: Pumping

    Science.gov (United States)

    ... of pump is best? You can buy or rent a breast pump from lactation consultants, hospitals, retail ... place to do it. Many companies offer their employees pumping and nursing areas. If yours doesn't, ...

  10. 36 CFR 905.737-102 - Enforcement proceedings.

    Science.gov (United States)

    2010-07-01

    ... or 5 CFR part 737 after a final decision by: (1) Prohibiting the individual from making, on behalf of... CORPORATION STANDARDS OF CONDUCT Conduct and Responsibilities of Former Employees-Enforcement § 905.737-102... there is reasonable cause to believe that a former employee has violated 18 U.S.C. 207 or 5 CFR part 737...

  11. Radioactive air emissions notice of construction for installation and operation of a waste retrieval system and tanks 241-AP-102 and 241-AP-104 project

    Energy Technology Data Exchange (ETDEWEB)

    DEXTER, M.L.

    1999-11-15

    This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year.

  12. Radioactive air emissions notice of construction for installation and operation of a waste retrieval system and tanks 241-AP-102 and 241-AP-104 project

    International Nuclear Information System (INIS)

    DEXTER, M.L.

    1999-01-01

    This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year

  13. Development and evaluation of cryosorption pump and cryotrapping pump for CTR applications

    International Nuclear Information System (INIS)

    Kuribayashi, S.; Ota, H.; Sato, H.

    1986-01-01

    In order to obtain the engineering data to design compound cryopump for CTR, the authors tested the cryosorption pump and cryotrapping pump. The cryosorption panel was consisted of coconut charcoal metallically bonded to 4.2K cryopanel by brazing. The initial pumping speed of helium of cryosorption pump was found to be ≅2.2 iota/scm/sup 2/. The speed dropped off with loading (about 8 Torr iota/cm/sup 2/) to 1.5 iota/scm/sup 2/. The initial helium pumping speed of the 4.2K cryotrapping pump by argon spray was found to be ≅6 iota/scm/sup 2/. The speed, however, dropped off with loading (≅0.3 Torr iota/cm/sup 2/) to less than 5%. These results indicate that the cryosorption pump by coconut charcoal is superior to the cryotrapping pump, because the capacity of the former is larger than the latter

  14. Efficiency and threshold pump intensity of CW solar-pumped solid-state lasers

    Science.gov (United States)

    Hwang, In H.; Lee, Ja H.

    1991-01-01

    The authors consider the relation between the threshold pumping intensity, the material properties, the resonator parameters, and the ultimate slope efficiencies of various solid-state laser materials for solar pumping. They clarify the relation between the threshold pump intensity and the material parameters and the relation between the ultimate slope efficiency and the laser resonator parameters such that a design criterion for the solar-pumped solid-state laser can be established. Among the laser materials evaluated, alexandrite has the highest slope efficiency of about 12.6 percent; however, it does not seem to be practical for a solar-pumped laser application because of its high threshold pump intensity. Cr:Nd:GSGG is the most promising for solar-pumped lasing. Its threshold pump intensity is about 100 air-mass-zero (AM0) solar constants and its slope efficiency is about 12 percent when thermal deformation is completely prevented.

  15. Operating function tests of the PWR type RHR pump for engineering safety system under simulated strong ground excitation

    International Nuclear Information System (INIS)

    Uga, Takeo; Shiraki, Kazuhiro; Homma, Toshiaki; Inazuka, Hisashi; Nakajima, Norifumi.

    1979-08-01

    Results are described of operating function verification tests of a PWR RHR pump during an earthquake. Of the active reactor components, the PWR residual heat removal pump was chosen from view points of aseismic classification, safety function, structural complexity and past aseismic tests. Through survey of the service conditions and structure of this pump, seismic test conditions such as acceleration level, simulated seismic wave form and earthquake duration were decided for seismicity of the operating pump. Then, plans were prepared to evaluate vibration chracteristics of the pump and to estimate its aseismic design margins. Subsequently, test facility and instrumentation system were designed and constructed. Experimental results could thus be acquired on vibration characteristics of the pump and its dynamic behavior during different kinds and levels of simulated earthquake. In conclusion: (1) Stiffeners attached to the auxiliary system piping do improve aseismic performance of the pump. (2) The rotor-shaft-bearing system is secure unless it is subjected to transient disturbunces having high frequency content. (3) The motor and pump casing having resonance frequencies much higher than frequency content of the seismic wave show only small amplifications. (4) The RHR pump possesses an aseismic design margin more than 2.6 times the expected ultimate earthquake on design basis. (author)

  16. Development of a proof of concept low temperature 4He Superfluid Magnetic Pump

    Science.gov (United States)

    Jahromi, Amir E.; Miller, Franklin K.

    2017-03-01

    We describe the development and experimental results of a proof of concept Superfluid Magnetic Pump in this work. This novel low temperature, no moving part pump can replace the existing bellows-piston driven 4He or 3He-4He mixture compressor/circulators used in various sub Kelvin refrigeration systems such as dilution, Superfluid pulse tube, Stirling, or active magnetic regenerative refrigerators. Due to the superior thermal transport properties of sub-Lambda 4He this pump can also be used as a simple circulator to distribute cooling over large surface areas. Our pump was experimentally shown to produce a maximum flow rate of 440 mg/s (averaged over cycle), 665 mg/s (peak) and produced a maximum pressure difference of 2323 Pa using only the more common isotope of helium, 4He. This pump worked in an ;ideal; thermodynamic state: The experimental results matched with the theoretical values predicted by a computer model. Pump curves were developed to map the performance of this pump. This successful demonstration will enable this novel pump to be implemented in suitable sub Kelvin refrigeration systems.

  17. An anthropomorphic transhumeral prosthesis socket developed based on an oscillometric pump and controlled by force-sensitive resistor pressure signals.

    Science.gov (United States)

    Razak, N A Abd; Gholizadeh, H; Hasnan, N; Osman, N A Abu; Fadzil, S S Mohd; Hashim, N A

    2017-02-01

    While considering the importance of the interface between amputees and prosthesis sockets, we study an anthropomorphic prosthesis socket whose size can be dynamically changed according to the requirements of the residual limb. First, we introduce the structure and function of the anthropomorphic prosthesis socket. Second, we study the dynamic model of the prosthesis system and analyze the dynamic characteristics of the prosthesis socket system, the inputs of an oscillometric pump, and the control mechanism of force-sensitive resistor (FSR) pressure signals. Experiments on 10 healthy subjects using the designed system yield an average detection result between 102 and 112 kPa for the FSR pressure sensor and 39 and 41 kPa for the oscillometric pump. Results show the function of the FSR pressure signal in maintaining the contact pressure between the sockets and the residual limb. The potential development of an auto-adjusted socket that uses an oscillometric pump system will provide prosthetic sockets with controllable contact pressure at the residual limb. Moreover, this development is an attractive research area for researchers involved in rehabilitation engineering, prosthetics, and orthotics.

  18. The appropriateness of a proton pump inhibitor prescription.

    LENUS (Irish Health Repository)

    Moran, N

    2014-11-01

    Proton pump inhibitors (PPIs) are one of the most commonly prescribed groups of drug in Ireland, at great expense to the Irish healthcare executive. This study aims to evaluate the appropriateness of PPI prescriptions on admission and discharge in a tertiary referral hospital. All non-elective admissions in the Emergency Department in one week were included in the study. 102 patients in total were included, with 36 (35.4%) treated with a PPI on admission. Of these, only 3 (8.3%) had a clear indication noted as per current NICE guidelines. 18 new in-hospital PPI prescriptions were documented. 11 (61%) of which were present on discharge prescriptions. Continuing PPI prescription on discharge into the community may be inappropriate, costly and potentially harmful. Brief interventions aimed at reducing inappropriate PPI prescriptions have been shown to be effective at reducing the cost and potential harm of unnecessary treatment.

  19. THE CHOSEN INSTRUMENT? RECONSIDERING THE EARLY RELATIONSHIP BETWEEN PAN AMERICAN AIRWAYS AND THE U.S. GOVERNMENT

    Directory of Open Access Journals (Sweden)

    Erik Benson

    2004-01-01

    Full Text Available During the late I920s and early 1930s, Pan American Airways became known as the U.S. “chosen instrument” for international commercial aviation. Most scholarly work about the U.S. government/Pan Am relationship presents the airline as the government’s instrument. This article challenges this traditional perspective. In certain ways Pan Am was an “instrument,” yet in others it defied such categorization. Thus, any notion that Pan Am was a “chosen instrument” merits qualification. Drawing upon the “corporatist” historical model, this study will present a more sophisticated account of this relationship, one that considers the role of business elites in shaping U.S. policy.

  20. Analysis of hypocycloid drive application in a high-pressure fuel pump

    Directory of Open Access Journals (Sweden)

    Bor Mateusz

    2017-01-01

    Full Text Available This paper undertakes the problem of applying a hypocycloid mechanism in the drive of pumping sections of high-pressure pumps for Diesel combustion engines. The authors have reviewed existing pump drive mechanisms, analyzed the weak links in existing solutions and discussed the latest trends in common rail systems. Further sections describe the design of a pump utilizing a hypocycloid mechanism, demonstrate beneficial functional features and present selected results of the assembly’s dynamic simulation. As a result of work, a pump model was developed, with operating parameters that do not deviate from those of the latest solutions of leading manufacturers, simultaneously eliminating the greatest flaws of existing pumps that lead to their premature wear.

  1. Pumping station design for a pumped-storage wind-hydro power plant

    International Nuclear Information System (INIS)

    Anagnostopoulos, John S.; Papantonis, Dimitris E.

    2007-01-01

    This work presents a numerical study of the optimum sizing and design of a pumping station unit in a hybrid wind-hydro plant. The standard design that consists of a number of identical pumps operating in parallel is examined in comparison with two other configurations, using one variable-speed pump or an additional set of smaller jockey pumps. The aim is to reduce the amount of the wind generated energy that cannot be transformed to hydraulic energy due to power operation limits of the pumps and the resulting step-wise operation of the pumping station. The plant operation for a period of one year is simulated by a comprehensive evaluation algorithm, which also performs a detailed economic analysis of the plant using dynamic evaluation methods. A preliminary study of the entire plant sizing is carried out at first using an optimization tool based on evolutionary algorithms. The performance of the three examined pumping station units is then computed and analyzed in a comparative study. The results reveal that the use of a variable-speed pump constitutes the most effective and profitable solution, and its superiority is more pronounced for less dispersed wind power potential

  2. Individual dual-emitting CdS multi-branched nanowire arrays under various pumping powers

    Science.gov (United States)

    Guo, S.; Zhao, F. Y.; Li, Y.; Song, G. L.; Li, A.; Chai, K.; Liang, L.; Ma, Z.; Weller, D.; Liu, R. B.

    2016-10-01

    High-quality Tin doped Cadmium Sulfide (CdS) comb-like nanostructures have been synthesized by a simple in situ seeding chemical vapor deposition process. The color-tunable dual emission of these comb-like nanostructures is demonstrated by changing the excitation power intensity. In fact, the color-tunable emission is in principal due to the variation of the dual emission intensity, which is proven by photoluminescence spectra and real color photoluminescence charge-coupled device images. Especially for different parts in the nano comb, the emission color can be varied even under the same pumping power. This is mainly due to the difference in local structure. By comparison, the color variation was not observed in pure CdS multi-branched nanostructures. The lifetime results demonstrate that the green emission originate from the recombination of free excitons. The origin of red emission is from the recombination of the dopant-induced intrinsic or extrinsic defect states. These findings provide potential applications of laser assisted anti-counterfeit label and micro-size monitors.

  3. An experimental investigation of pump as turbine for micro hydro application

    International Nuclear Information System (INIS)

    Raman, N; Hussein, I; Palanisamy, K; Foo, B

    2013-01-01

    This paper presents the results of an experimental investigation of a centrifugal pump working as turbine (PAT). An end suction centrifugal pump was tested in turbine mode at PAT experimental rig installed in the Mechanical Engineering Laboratory of Universiti Tenaga Nasional. The pump with specific speed of 15.36 (m, m 3 /s) was used in the experiment and the performance characteristic of the PAT was determined. The experiment showed that a centrifugal pump can satisfactorily be operated as turbine without any mechanical problems. As compared to pump operation, the pump was found to operate at higher heads and discharge values in turbine mode. The best efficiency point (BEP) in turbine mode was found to be lower than BEP in pump mode. The results obtained were also compared to the work of some previous researchers.

  4. Tank 241-AZ-101 and tank 241-AZ-102, airlift circulator operation vapor sampling and analysis plan

    International Nuclear Information System (INIS)

    TEMPLETON, A.M.

    1999-01-01

    This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained during the operation of the tank 241-AZ-101 and 241-AZ-102 airlift circulators (ALCs). The purpose of the ALC operation is to support portions of the operational test procedure (OTP) for Project W-030 (OTP-W030-001) and to perform functional test in support of Project W-151. Project W-030 is the 241-A-702 ventilation upgrade project (241-AZ-702) and Project W-151 is the 241-AZ-101 Mixer Pump Test. The functional tests will check the operability of the tank 241-AZ-101 ALCs. Process Memo's No.2E98-082 and No.2E99-001 (LMHC 1999a, LMHC 1999b) direct the operation of the ALCs and the Industrial Hygiene monitoring respectively. A series of tests will be conducted in which the ALCs in tanks 241-AZ-101 and 241-AZ-102 will be operated at different air flow rates. Vapor samples will be obtained to determine constituents that may be present in the tank headspace during ALC operation at tanks 241-AZ-101 and 241-AZ-102 as the waste is disturbed. During the testing, vapor samples will be obtained from the headspace of tanks 241-AZ-101 and 241-AZ-102 via the unused port on the standard hydrogen monitoring system (SHMS). Results will be used to provide the waste feed delivery program with environmental air permitting data for tank waste disturbing activities. Because of radiological concerns, the samples will be filtered for particulates. It is recognized that this may remove some organic compounds

  5. BWR series pump recirculation system

    International Nuclear Information System (INIS)

    Dillmann, C.W.

    1992-01-01

    This patent describes a recirculation system for driving reactor coolant water contained in an annular downcomer defined between a boiling water reactor vessel and a reactor core spaced radially inwardly therefrom. It comprises a plurality of circumferentially spaced second pumps disposed in the downcomer, each including an inlet for receiving from the downcomer a portion of the coolant water as pump inlet flow, and an outlet for discharging the pump inlet flow pressurized in the second pump as pump outlet flow; and means for increasing pressure of the pump inlet flow at the pump inlet including a first pump disposed in series flow with the second pump for first receiving the pump inlet flow from the downcomer and discharging to the second pump inlet flow pressurized in the first pump

  6. 29 CFR 102.143 - “Adversary adjudication” defined; entitlement to award; eligibility for award.

    Science.gov (United States)

    2010-07-01

    ...; eligibility for award. 102.143 Section 102.143 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS... Marketing Act (12 U.S.C. 1141j(a)) with not more than 500 employees; and (5) Any other partnership, corporation, association, unit of local government, or public or private organization with a net worth of not...

  7. Affordable Hybrid Heat Pump Clothes Dryer

    Energy Technology Data Exchange (ETDEWEB)

    TeGrotenhuis, Ward E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Butterfield, Andrew [Jabil, St. Petersburg, FL (United States); Caldwell, Dustin D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Crook, Alexander [Jabil, St. Petersburg, FL (United States)

    2016-06-30

    This project was successful in demonstrating the feasibility of a step change in residential clothes dryer energy efficiency by demonstrating heat pump technology capable of 50% energy savings over conventional standard-size electric dryers with comparable drying times. A prototype system was designed from off-the-shelf components that can meet the project’s efficiency goals and are affordable. An experimental prototype system was built based on the design that reached 50% energy savings. Improvements have been identified that will reduce drying times of over 60 minutes to reach the goal of 40 minutes. Nevertheless, the prototype represents a step change in efficiency over heat pump dryers recently introduced to the U.S. market, with 30% improvement in energy efficiency at comparable drying times.

  8. Early outcome of off-pump versus on-pump coronary revascularization

    African Journals Online (AJOL)

    Introduction: The use of coronary artery bypass surgery (CABG) with cardiopulmonary bypass (CPB) or without CPB technique (off-pump) can be associated with different mortality and morbidity and their outcomes remain uncertain. The goal of this study was to evaluate the early outcome of on-pump versus off-pump CABG.

  9. Scrape-off profiles and effects of limiter pumping in Tore Supra

    International Nuclear Information System (INIS)

    Budny, R.

    1986-11-01

    A one dimensional plasma scrape-off model was used to simulate Tore Supra discharges which are limited by various combinations of the pumped and inner limiters. Scrape-off profiles of the electron density and temperature, ion temperature, and neutral density are given. For each case, various fractions of the ion flux to the neutralizers were assumed to be pumped. Modifications of the scrap-off profiles caused by pumping are predicted. Pumping efficiencies are calculated including the effects of flux amplification caused by recycling. The pumping efficiency is estimated to be 8% for low-power discharges formed on the outer pumped limiter, 7.5% for intermediate-power discharges formed on the seven-module pumped-limiter system, and 5% for full-power discharges formed on both the inner limiter and the pumped-limiter system. The maximum particle removal rate is estimated to be 150 Tl/s

  10. TFTR ultrahigh-vacuum pumping system incorporating mercury diffusion pumps

    International Nuclear Information System (INIS)

    Sink, D.A.; Sniderman, M.

    1976-06-01

    The TFTR vacuum vessel will have a system of four 61 cm diameter mercury diffusion pumps to provide a base pressure in the 10 -8 to 10 -9 Torr range as well as a low impurity level within the vessel. The system, called the Torus Vacuum Pumping System (TVPS), will be employed with the aid of an occasional 250 0 C bakeout in situ as well as periodic applications of aggressive discharge cleaning. The TVPS is an ultrahigh-vacuum (UHV) system using no elastomers as well as being a closed system with respect to tritium or any tritiated gases. The backing system employing approximately 75 all-metal isolation valves is designed with the features of redundancy and flexibility employed in a variety of ways to meet the fundamental requirements and functions enumerated for the TVPS. Since the design, is one which is a modification of the conceptual design of the TVPS, those features which have changed are discussed. Calculations are presented for the major performance parameters anticipated for the TVPS and include conductances, effective pumping speeds, base pressures, operating parameters, getter pump parameters, and calculations of time constants associated with leak checking. Modifications in the vacuum pumping system for the guard regions on the twelve bellows sections are presented so that it is compatible with the main TVPS. The bellows pumping system consists of a mechanical pump unit, a zirconium aluminum getter pump unit and a residual gas analyzer. The control and management of the TVPS is described with particular attention given to providing both manual and automatic control at a local station and at the TFTR Central Control. Such operations as testing, maintenance, leak checking, startup, bakeout, and various other operations are considered in some detail. Various aspects related to normal pulsing, discharge cleaning, non-tritium operations and tritium operations are also taken into consideration. A cost estimate is presented

  11. Hanford Tanks 241-AY-102 and 241-BX-101: Sludge Composition and Contaminant Release Data

    International Nuclear Information System (INIS)

    Krupka, Kenneth M.; Deutsch, William J.; Lindberg, Michael J.; Cantrell, Kirk J.; Hess, Nancy J.; Schaef, Herbert T.; Arey, Bruce W.

    2004-01-01

    This report describes the results of testing sludge samples from Hanford tanks 241-AY-102 (AY-102) and 241-BX-101 (BX-101). These tests were conducted to characterize the sludge and assess the water leachability of contaminants from the solids. This work is being conducted to support the tank closure risk assessments being performed by CH2M HILL Hanford Group, Inc. for the U.S. Department of Energy. This is the first report of testing of BX-101 sludge and the second report of testing of AY-102. Lindberg and Deutsch (2003) described the first phase of testing on AY-102 material

  12. 16 CFR 1034.102 - Application.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Application. 1034.102 Section 1034.102 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS... Application. This part applies to all programs or activities conducted by the agency. ...

  13. Divertor pumping system with NBI cryopump for JT-60

    International Nuclear Information System (INIS)

    Akino, Noboru; Kuriyama, Masaaki; Ohga, Tokumichi; Seki, Hiroshi; Tanai, Yutaka

    1998-08-01

    The pumping system for JT-60 W-shape divertor with the NBI cryopump have been developed. The pumping speed achieved in the divertor region was 13-15 m 3 /s for deuterium gas with three units of the NBI cryopumps. In a simulation experiment of helium ash exhaust through the divertor, pumping of a mixed gas of helium and deuterium has been demonstrated using the NBI cryosorption pumps covered with an argon condensed layer. Control of neutral particle pressure in the divertor region became possible by having remodeled an aperture of the existing fast shutter, which is installed between the JT-60 vacuum vessel and NBI beam-line, to be regulated. (author)

  14. Photovoltaic pump systems

    Science.gov (United States)

    Klockgether, J.; Kiessling, K. P.

    1983-09-01

    Solar pump systems for the irrigation of fields and for water supply in regions with much sunshine are discussed. For surface water and sources with a hoisting depth of 12 m, a system with immersion pumps is used. For deep sources with larger hoisting depths, an underwater motor pump was developed. Both types of pump system meet the requirements of simple installation and manipulation, safe operation, maintenance free, and high efficiency reducing the number of solar cells needed.

  15. Damages on pumps and systems the handbook for the operation of centrifugal pumps

    CERN Document Server

    Merkle, Thomas

    2014-01-01

    Damage on Pumps and Systems. The Handbook for the Operation of Centrifugal Pumps offers a combination of the theoretical basics and practical experience for the operation of circulation pumps in the engineering industry. Centrifugal pumps and systems are extremely vulnerable to damage from a variety of causes, but the resulting breakdown can be prevented by ensuring that these pumps and systems are operated properly. This book provides a total overview of operating centrifugal pumps, including condition monitoring, preventive maintenance, life cycle costs, energy savings and economic aspects. Extra emphasis is given to the potential damage to these pumps and systems, and what can be done to prevent breakdown. Addresses specific issues about pumping of metal chips, sand, abrasive dust and other solids in fluidsEmphasis on economic and efficiency aspects of predictive maintenance and condition monitoring Uses life cycle costs (LCC) to evaluate and calculate the costs of pumping systems

  16. Electrokinetic pump

    Science.gov (United States)

    Patel, Kamlesh D.

    2007-11-20

    A method for altering the surface properties of a particle bed. In application, the method pertains particularly to an electrokinetic pump configuration where nanoparticles are bonded to the surface of the stationary phase to alter the surface properties of the stationary phase including the surface area and/or the zeta potential and thus improve the efficiency and operating range of these pumps. By functionalizing the nanoparticles to change the zeta potential the electrokinetic pump is rendered capable of operating with working fluids having pH values that can range from 2-10 generally and acidic working fluids in particular. For applications in which the pump is intended to handle highly acidic solutions latex nanoparticles that are quaternary amine functionalized can be used.

  17. Application of heterogeneous blading systems is the way for improving efficiency of centrifugal energy pumps

    Science.gov (United States)

    Pochylý, F.; Haluza, M.; Fialová, S.; Dobšáková, L.; Volkov, A. V.; Parygin, A. G.; Naumov, A. V.; Vikhlyantsev, A. A.; Druzhinin, A. A.

    2017-11-01

    The results of independent research implemented by the teams of authors representing the Brno University of technology (Czech Republic) and Moscow Power Engineering Institute National Research University (Russia) are presented and compared. The possibilities for improving the energy efficiency of slow-speed centrifugal pumps (with a specific speed coefficient n s engineering—in thermal power stations, in heat electric-power stations, in nuclear power plants, and in boiler rooms—were investigated. These are supply pumps, condensate pumps, precharge pumps, etc. The pumps with such values of n s are widely used in some technological cycles of oil-and-gas and chemical industries too. The research was focused on achieving the shape of the pump efficiency characteristics providing a significant extension of its effective working zone and increasing its integrated efficiency. The results were obtained based on new approaches to the formation of a blading system of an impeller of a slow-speed centrifugal pump different from the traditional blading system. The analytical dependences illustrating the influence of individual geometry of a blading system on the efficiency were presented. The possibilities of purposeful changing of its structure were demonstrated. It was experimentally confirmed that use of the innovative blading system makes it possible to increase the pump efficiency by 1-4% (in the experiments for the pumps with n s = 33 and 55) and to extend its efficient working zone approximately by 15-20% (in the experiment for the pumps with n s = 33 and 66). The latter is especially important for the supply pumps of NPP power units. The experimental results for all investigated pumps are presented in comparison with the characteristics of the efficiency provided by the blading systems designed by traditional methods.

  18. Pumping behavior of ion pump elements at high and misaligned magnetic fields

    Energy Technology Data Exchange (ETDEWEB)

    Hseuh, H. C.; Jiang, W. S.; Mapes, M.

    1994-11-01

    The pumping speeds of several diode type ion pump elements with cell radii of 5 mm, 5.5 mm, 6 mm, 9 mm and 12 mm were measured while being subjected to a magnetic field B, ranging from 500 Gauss up to 15 KG, and misalignment angles (angles between the direction of B and the anode axis) from 0 to 13 degrees. The pumping speeds of elements with the 9 mm and 12 mm cells peaked around 1--2 KG, then dropped off rapidly with an increasing magnetic field. The pumping speeds of the smaller cell elements remained constant with an increasing magnetic field. The pumping speeds of all the elements decreased with increasing misalignment. The measured pumping speeds from this study are 3--4 times lower than the calculated pumping, speeds using previously reported empirical formulae.

  19. Pumping behavior of ion pump elements at high and misaligned magnetic fields

    International Nuclear Information System (INIS)

    Hseuh, H.C.; Jiang, W.S.; Mapes, M.

    1994-01-01

    The pumping speeds of several diode type ion pump elements with cell radii of 5 mm, 5.5 mm, 6 mm, 9 mm and 12 mm were measured while being subjected to a magnetic field B, ranging from 500 Gauss up to 15 KG, and misalignment angles (angles between the direction of B and the anode axis) from 0 to 13 degrees. The pumping speeds of elements with the 9 mm and 12 mm cells peaked around 1--2 KG, then dropped off rapidly with an increasing magnetic field. The pumping speeds of the smaller cell elements remained constant with an increasing magnetic field. The pumping speeds of all the elements decreased with increasing misalignment. The measured pumping speeds from this study are 3--4 times lower than the calculated pumping, speeds using previously reported empirical formulae

  20. Comparing laser induced plasmas formed in diode and excimer pumped alkali lasers.

    Science.gov (United States)

    Markosyan, Aram H

    2018-01-08

    Lasing on the D 1 transition (6 2 P 1/2 → 6 2 S 1/2 ) of cesium can be reached in both diode and excimer pumped alkali lasers. The first uses D 2 transition (6 2 S 1/2 → 6 2 P 3/2 ) for pumping, whereas the second is pumped by photoexcitation of ground state Cs-Ar collisional pairs and subsequent dissociation of diatomic, electronically-excited CsAr molecules (excimers). Despite lasing on the same D 1 transition, differences in pumping schemes enables chemical pathways and characteristic timescales unique for each system. We investigate unavoidable plasma formation during operation of both systems side by side in Ar/C 2 H 6 /Cs.

  1. Planning the Future of U.S. Particle Physics (Snowmass 2013): Chapter 8: Instrumentation Frontier

    Energy Technology Data Exchange (ETDEWEB)

    Demarteau, M; Lipton, R; Nicholson, H; Shipsey, I; Akerib, D; Albayrak-Yetkin, A; Alexander, J; Anderson, J; Artuso, M; Asner, D; Ball, R; Battaglia, M; Bebek, C; Beene, J; Benhammou, Y; Bentefour, E; Bergevin, M; Bernstein, A; Bilki, B; Blucher, E; Bolla, G; Bortoletto, D; Bowden, N; Brooijmans, G; Byrum, K; Cabrera, B; Cancelo, G; Carlstrom, J; Casey, B; Chang, C; Chapman, J; Chen, CH; Childres, I; Christian, D; Convery, M; Corso, WCJ; Cumalat, J; Cushman, P; Via, CD; Dazeley, S; Debbins, P; Deptuch, G; Dhawan, S; Benedetto, VD; DiGiovene, B; Djurcic, Z; Dye, S; Elagin, A; Estrada, J; Evans, H; Etzion, E; Fast, J; Ferretti, C; Fisher, P; Fleming, B; Francis, K; Friedman, P; Frisch, H; Garcia-Sciveres, M; Gatto, C; Geronim, G; Gilchriese, G; Golwala, S; Grant, C; Grillo, A; Grünendahl, E; Gorham, P; Guan, L; Gutierrez, G; Haber, C; Hall, J; Haller, G; Hast, C; Heintz, U; Hemmick, T; Hitlin, DG; Hogan, C; Hohlmann, M; Hoppe, E; Hsu, L; Huffer, M; Irwin, K; Izraelevitch, F; Jennings, G; Johnson, M; Jung, A; Kagan, H; Kenney, C; Kettell, S; Khanna, R; Khristenko, V; Krennrich, F; Kuehn, K; Kutschke, R; Learned, J; Lee, AT; Levin, D; Liu, T; Liu, ATK; Lissauer, D; Love, J; Lynn, D; MacFarlane, D; Magill, S; Majewski, S; Mans, J; Maricic, J; Marleau, P; Mazzacane, A; McKinsey, D; Mehl, J; Mestvirisvilli, A; Meyer, S; Mokhov, N; Moshe, M; Mukherjee, A; Murat, P; Nahn, S; Narain, M; Nadel-Turonski, P; Newcomer, M; Nishimura, K; Nygren, D; Oberla, E; Onel, Y; Oreglia, M; Orrell, J; Paley, J; Para, A; Parker, S; Polychronakos, V; Pordes, S; Privitera, P; Prosser, A; Pyle, M; Raaf, J; Ramberg, E; Rameika, R; Rebel, B; Repond, J; Reyna, D; Ristori, L; Rivera, R; Ronzhin, A; Rusack, R; Russ, J; Ryd, A; Sadrozinski, H; Sahoo, H; Sanchez, MC; Sanzeni, C; Schnetzer, S; Seidel, S; Seiden, A; Schmidt, I; Shenai, A; Shutt, T; Silver, Y; Smith, W; Snowden-Ifft, D; Sonnenschein, A; Southwick, D; Spiegel, L; Stanitzki, M; Striganov, S; Su, D; Sumner, R; Svoboda, R; Sweany, M; Talaga, R; Tayloe, R; Tentindo, S; Terentiev, N; Thom-Levy, J; Thorn, C; Tiffenberg, J; Trischuk, W; Tschirhart, R; Turner, M; Underwood, D; Uplegger, L; Urheim, J; Vagins, M; Bibber, KV; Varner, G; Varner, R; Va' vra, J; Lippe, HVD; Wagner, R; Wagner, S; Weaverdyck, C; Wenzel, H; Weinstein, A; Wetstein, M; White, A; Wigman, R; Wilson, P; Winn, D; Winter, P; Woody, C; Xia, L; Xie, JQ; Ye, Z; Yeh, MF; Yetkin, T; Yoo, JH; Yu, J; Yu, JM; Zeller, S; Zhang, JL; Zhu, JJ; Zhou, B; Zhu, RY; Zitzer, B

    2014-01-23

    These reports present the results of the 2013 Community Summer Study of the APS Division of Particles and Fields ("Snowmass 2013") on the future program of particle physics in the U.S. Chapter 8, on the Instrumentation Frontier, discusses the instrumentation needs of future experiments in the Energy, Intensity, and Cosmic Frontiers, promising new technologies for particle physics research, and issues of gathering resources for long-term research in this area.

  2. Update on diode-pumped solid-state laser experiments for inertial fusion energy

    International Nuclear Information System (INIS)

    Marshall, C.; Smith, L.; Payne, S.

    1994-01-01

    The authors have completed the initial phase of the diode-pumped solid-state laser (DPSSL) experimental program to validate the expected pumping dynamics and extraction cross-sections of Yb 3+ -doped Sr 5 (PO 4 ) 3 F (Yb:S-FAP) crystals. Yb:S-FAP crystals up to 25 x 25 x 175 mm in size have been grown for this purpose which have acceptable loss characteristics ( 2 ). The saturation fluence for pumping has been measured to be 2.2 J/cm 2 using three different methods based on either the spatial, temporal, or energy transmission properties of a Yb:S-FAP rod. The small signal gain under saturated pumping conditions was measured. These measurements imply an emission cross section of 6.0 x 10 -20 cm 2 that falls within error bars of the previously reported value of 7.3 x 10 -20 cm 2 , obtained from purely spectroscopic techniques. The effects of radiation trapping on the emission lifetime have been quantified. The long lifetime of Yb:S-FAP has beneficial effects for diode-pumped amplifier designs, relative to materials with equivalent cross sections but shorter lifetimes, in that less peak pump intensity is required (thus lower diode costs) and that lower spontaneous emission rates lead to a reduction in amplified spontaneous emission. Consequently, up to 1.7 J/cm 3 of stored energy density was achieved in a 6x6x44 mm Yb:S-FAP amplifier rod; this stored energy density is large relative to typical flashlamp-pumped Nd:glass values of 0.3 to 0.5 J/cm 3 . A 2.4 kW peak power InGaAs diode array has been fabricated by Beach, Emanuel, and co-workers which meets the central wavelength, bandwidth, and energy specifications for the author's immediate experiments. These results further increase their optimism of being able to produce a ∼ 10% efficient diode-pumped solid state laser for inertial fusion energy

  3. 47 CFR 25.102 - Station authorization required.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station authorization required. 25.102 Section 25.102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS General § 25.102 Station authorization required. (a) No person shall use or operate...

  4. Dysprosium-doped PbGa2S4 laser generating at 4.3 μm directly pumped by 1.7 μm laser diode.

    Science.gov (United States)

    Jelínková, Helena; Doroshenko, Maxim E; Jelínek, Michal; Sulc, Jan; Osiko, Vyacheslav V; Badikov, Valerii V; Badikov, Dmitrii V

    2013-08-15

    In this Letter, we demonstrate the pulsed and CW operation of the Dy:PbGa(2)S(4) laser directly pumped by the 1.7 μm laser diode. In the pulsed regime (pulse duration 5 ms; repetition rate 20 Hz), the maximum mean output power of 9.5 mW was obtained with the slope efficiency of 9.3% with respect to the absorbed pump power. The generated wavelength was 4.32 μm, and the laser beam cross section was approximately Gaussian on both axes. Stable CW laser generation was also successfully obtained with the maximum output power of 67 mW and the slope efficiency of 8%. Depopulation of the lower laser level by 1.7 μm pump radiation absorption followed by 1.3 μm upconversion fluorescence was demonstrated. These results show the possibility of construction of the compact diode-pumped solid-state pulsed or CW laser generating at 4.3 μm in the power level of tens mW operating at room temperature.

  5. Liquid metal pump

    International Nuclear Information System (INIS)

    Pennell, W.E.

    1981-01-01

    A liquid metal pump comprising a shaft support structure which is isolated from the pump housing for better preservation of alignment of shaft bearings. The shaft carries an impeller and the support structure carries an impeller cage which is slidably disposed in a diffuser so as to allow complete removal of pump internals for inspection and repair. The diffuser is concentrically supported in the pump housing which also takes up all reaction forces generated by the discharge of the liquid metal from the diffuser, with floating seals arranged between impeller cage and the diffuser. The space between the diffuser and the pump housing permits the incoming liquid to essentially surround the diffuser. (author)

  6. Rotary piston blood pumps: past developments and future potential of a unique pump type.

    Science.gov (United States)

    Wappenschmidt, Johannes; Autschbach, Rüdiger; Steinseifer, Ulrich; Schmitz-Rode, Thomas; Margreiter, Raimund; Klima, Günter; Goetzenich, Andreas

    2016-08-01

    The design of implantable blood pumps is either based on displacement pumps with membranes or rotary pumps. Both pump types have limitations to meet the clinical requirements. Rotary piston blood pumps have the potential to overcome these limitations and to merge the benefits. Compared to membrane pumps, they are smaller and with no need for wear-affected membranes and valves. Compared to rotary pumps, the blood flow is pulsatile instead of a non-physiological continuous flow. Furthermore, the risk of flow-induced blood damage and platelet activation may be reduced due to low shear stress to the blood. The past developments of rotary piston blood pumps are summarized and the main problem for long-term application is identified: insufficient seals. A new approach with seal-less drives is proposed and current research on a simplified rotary piston design is presented. Expert commentary: The development of blood pumps focuses mainly on the improvement of rotary pumps. However, medical complications indicate that inherent limitations of this pump type remain and restrict the next substantial step forward in the therapy of heart failure patients. Thus, research on different pump types is reasonable. If the development of reliable drives and bearings succeeds, rotary piston blood pumps become a promising alternative.

  7. 40 CFR 26.102 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Definitions. 26.102 Section 26.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PROTECTION OF HUMAN SUBJECTS Basic EPA...) Human subject means a living individual about whom an investigator (whether professional or student...

  8. 18 CFR 376.102 - Organization.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Organization. 376.102... OF ENERGY REVISED GENERAL RULES ORGANIZATION, MISSION, AND FUNCTIONS; OPERATIONS DURING EMERGENCY CONDITIONS Organization, Mission, and Functions § 376.102 Organization. The Commission is established as an...

  9. Duodopa pump treatment in patients with advanced Parkinson's disease

    DEFF Research Database (Denmark)

    Karlsborg, Merete; Korbo, Lise; Regeur, Lisbeth

    2010-01-01

    Patients with advanced Parkinson's disease (PD) often develop motor complications including fluctuations and involuntary movements (dyskinesias). In Denmark, treatment has comprised Deep Brain Stimulation (DBS) since the late 1990s, and as from 2002 use of a subcutaneous apomorphine pump. Monothe......Patients with advanced Parkinson's disease (PD) often develop motor complications including fluctuations and involuntary movements (dyskinesias). In Denmark, treatment has comprised Deep Brain Stimulation (DBS) since the late 1990s, and as from 2002 use of a subcutaneous apomorphine pump...

  10. Pumping machinery theory and practice

    CERN Document Server

    Badr, Hassan M

    2014-01-01

    Pumping Machinery Theory and Practice comprehensively covers the theoretical foundation and applications of pumping machinery. Key features: Covers characteristics of centrifugal pumps, axial flow pumps and displacement pumpsConsiders pumping machinery performance and operational-type problemsCovers advanced topics in pumping machinery including multiphase flow principles, and two and three-phase flow pumping systemsCovers different methods of flow rate control and relevance to machine efficiency and energy consumptionCovers different methods of flow rate control and relevance to machine effi

  11. Test results for the Oasis 3C high performance water-pumping windmill

    Energy Technology Data Exchange (ETDEWEB)

    Eggleston, D.M. [DME Engineering, Midland, TX (United States)

    1997-12-31

    The WINDTech International, L.L.C. Oasis 3C, a 3 m diameter, high-performance water-pumping windmill, was tested at the DME Engineering Wind Test Site just south of Midland, Texas from August through December, 1996. This machine utilizes a 3:1 gearbox with rotating counterweights, similar to a conventional oilfield pumping unit, driven by a multibladed rotor. The rotating counterweight system balances most of the pumping loads and reduces gear loads and starting torque by a factor of at least two and often by a factor of four or more. The torque reduction substantially extends gear and bearing life, and reduces wind speeds required for starting by 30 to 50% or more. The O3C was tested pumping from a quiescent fluid depth of 12.2 m (40 ft) from a 28.3 m (93 ft)-deep well, with additional pumping depth simulated using a pressure regulator valve system. A 9.53 cm (3.75 in.) diameter Harbison-Fischer seal-less single-acting piston pump was used to eliminate pump seal friction as a variable, and standard O3C stroke lengths of 30.5 and 15.2 cm (12 and 6 inches) were used. The regulator spring was set to give a maximum stroke rate of 33 strokes per minute. The water pumped was returned to the well after flowing through a settling tank. The tests were performed in accordance with AWEA WECS testing standards. Instrumentation provided 16 channels of data to accurately measure machine performance, including starting wind speeds, flow rates, O3C azimuth, tail furl angle, wind direction tracking errors, RPM, sucker rod loads, and other variables. The most significant performance data is summarized herein. A mathematical model of machine performance was developed that fairly accurately predicts performance for each of three test conditions. The results verify that the O3C is capable of pumping water at wind speeds from 30% to more than 50% lower than comparable un-counterbalanced units.

  12. Ultrafast S1 and ICT state dynamics of a marine carotenoid probed by femtosecond one- and two-photon pump-probe spectroscopy

    International Nuclear Information System (INIS)

    Kosumi, Daisuke; Kusumoto, Toshiyuki; Fujii, Ritsuko; Sugisaki, Mitsuru; Iinuma, Yoshiro; Oka, Naohiro; Takaesu, Yuki; Taira, Tomonori; Iha, Masahiko; Frank, Harry A.; Hashimoto, Hideki

    2011-01-01

    Ultrafast relaxation kinetics of fucoxanthin in polar and non-polar solvents have been studied by femtosecond pump-probe spectroscopy. Transient absorption associated with S 1 or intramolecular charge transfer (ICT) excited state has been observed following either one-photon excitation to the optically allowed S 2 state or two-photon excitation to the symmetry-forbidden S 1 state. The results suggest that the ICT state formed after excitation of fucoxanthin in a polar solvent is a distinct excited state from S 1 .

  13. Regulatory analysis for Generic Issue 23: Reactor coolant pump seal failure. Draft report for comment

    Energy Technology Data Exchange (ETDEWEB)

    Shaukat, S K; Jackson, J E; Thatcher, D F

    1991-04-01

    This report presents the regulatory/backfit analysis for Generic Issue 23 (GI-23), 'Reactor Coolant Pump Seal Failure'. A backfit analysis in accordance with 10 CFR 50.109 is presented in Appendix E. The proposed resolution includes quality assurance provisions for reactor coolant pump seals, instrumentation and procedures for monitoring seal performance, and provisions for seal cooling during off-normal plant conditions involving loss of all seal cooling such as station blackout. Research, technical data, and other analyses supporting the resolution of this issue are summarized in the technical findings report (NUREG/CR-4948) and cost/benefit report (NUREG/CR-5167). (author)

  14. ENERGY STAR Certified Geothermal Heat Pumps

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 3.1 ENERGY STAR Program Requirements for Geothermal Heat Pumps that are effective as of...

  15. 24 CFR 811.102 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Definitions. 811.102 Section 811... URBAN DEVELOPMENT (SECTION 8 HOUSING ASSISTANCE PROGRAMS, SECTION 202 DIRECT LOAN PROGRAM, SECTION 202... PROGRAM) TAX EXEMPTION OF OBLIGATIONS OF PUBLIC HOUSING AGENCIES AND RELATED AMENDMENTS § 811.102...

  16. 42 CFR 93.102 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 93.102 Section 93.102 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

  17. Diode-pumped Kerr-lens mode-locked femtosecond Yb:YAG ceramic laser

    Science.gov (United States)

    Zi-Ye, Gao; Jiang-Feng, Zhu; Ke, Wang; Jun-Li, Wang; Zhao-Hua, Wang; Zhi-Yi, Wei

    2016-02-01

    We experimentally demonstrated a diode-pumped Kerr-lens mode-locked femtosecond laser based on an Yb:YAG ceramic. Stable laser pulses with 97-fs duration, 2.8-nJ pulse energy, and 320-mW average power were obtained. The femtosecond oscillator operated at a central wavelength of 1049 nm and a repetition rate of 115 MHz. To the best of our knowledge, this is the first demonstration of a Kerr-lens mode-locked operation in a diode-pumped Yb:YAG ceramic laser with sub-100 fs pulse duration. Project supported by the National Major Scientific Instrument Development Project of China (Grant No. 2012YQ120047), the National Natural Science Foundation of China (Grant No. 61205130), and the Fundamental Research Funds for the Central Universities, China (Grant No. JB140502).

  18. 42 CFR 102.74 - Disapproval of benefits.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Disapproval of benefits. 102.74 Section 102.74 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION PROGRAM Secretarial Determinations § 102.74 Disapproval of benefits. (a) If the Secretary...

  19. Development of low-cost, high-performance non-evaporable getter (NEG) pumps

    Energy Technology Data Exchange (ETDEWEB)

    Mase, Kazuhiko, E-mail: mase@post.kek.jp [Institute of Materials Structure Science, KEK, 1-1 Oho, Tsukuba 305-0801 (Japan); SOKENDAI (The Graduate University for Advanced Studies), 1-1 Oho, Tsukuba 305-0801 (Japan); Tanaka, Masato [Faculty of Engineering, Chiba University, 1-33 Yayoi-cho, Inage-ku 263-8522 (Japan); Ida, Naoya [Faculty of Science and Technology, Hirosaki University, 1 Bunkyocho, Hirosaki 036-8560 (Japan); Kodama, Hiraku [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan); Kikuchi, Takashi [Institute of Materials Structure Science, KEK, 1-1 Oho, Tsukuba 305-0801 (Japan)

    2016-07-27

    Low-cost, high-performance non-evaporable getter (NEG) pumps were constructed using commercial NEG pills comprising 70 wt% Zr, 24.6 wt% V, and 5.4 wt% Fe, a conflat flange with an outer diameter of 70, 152, or 203 mm (DN 40 CF, DN 100 CF, and DN 160 CF, respectively), and a tantalum heater. After activation at 400 °C for 30 min, the pumping speeds of a DN 40 CF NEG pump measured with the orifice method were 47–40, 8–6, 24–17, and 19–15 L/s for H{sub 2}, N{sub 2}, CO, and CO{sub 2} gasses, respectively. NEG pumps using DN 100 CF and DN 160 CF were also developed, and their pumping speeds are estimated. These NEG pumps are favorable alternatives to sputtering ion pumps in VSX beamlines because they do not produce hydrocarbons except during the activation period. The NEG pumps can also be used for accelerators, front ends, end stations, and differential pumping systems.

  20. 76 FR 50997 - Application(s) for Duty-Free Entry of Scientific Instruments

    Science.gov (United States)

    2011-08-17

    ... DEPARTMENT OF COMMERCE International Trade Administration Application(s) for Duty-Free Entry of..., School of Earth Sciences, 275 Mendenhall Laboratory, 125 South Oval Mall, Columbus, OH 43210. Instrument... and high-contrast images, a stage that is easy to move, a focus that does not change with changing...

  1. 75 FR 29974 - Application(s) for Duty-Free Entry of Scientific Instruments

    Science.gov (United States)

    2010-05-28

    ... allows for observation and analyses of samples at both room and liquid-nitrogen temperature... observation and analyses of samples at both room and liquid-nitrogen temperature. Justification for Duty-Free... School, Department of Cell Biology, Rm. S7-210, 55 Lake Avenue North, Worcester, MA 01655. Instrument...

  2. Waste mixing and diluent selection for the planned retrieval of Hanford Tank 241-SY-102: A preliminary assessment

    International Nuclear Information System (INIS)

    Onishi, Y.; Hudson, J.D.

    1996-01-01

    This preliminary assessment documents a set of analyses that were performed to determine the potential for Hanford waste Tank 241-SY-102 waste properties to be adversely affected by mixing the current tank contents or by injecting additional diluent into the tank during sludge mobilization. As a part of this effort, the effects of waste heating that will occur as a result of mixer pump operations are also examined. Finally, the predicted transport behavior of the resulting slurries is compared with the waste acceptance criteria for the Cross-Site Transfer System (CSTS). This work is being performed by Pacific Northwest National Laboratory in support of Westinghouse Hanford Company's W-211 Retrieval Project. We applied the equilibrium chemical code, GMIN, to predict potential chemical reactions. We examined the potential effects of mixing the current tank contents (sludge and supernatant liquid) at a range of temperatures and, separately, of adding pure water at a volume ratio of 1:2:2 (sludge:supernatant liquid:water) as an example of further diluting the current tank contents. The main conclusion of the chemical modeling is that mixing the sludge and the supernate (with or without additional water) in Tank 241-SY-102 dissolves all sodium-containing solids (i.e., NaNO 3 (s), thenardite, NaF(s), and halite), but does not significantly affect the amorphous Cr(OH) 3 and calcite phase distribution. A very small amount of gibbsite [Al(OH) 3 (s)] might precipitate at 25 degrees C, but a somewhat larger amount of gibbsite is predicted to dissolve at the higher temperatures. In concurrence with the reported tank data, the model affirmed that the interstitial solution within the sludge is saturated with respect to many of the solids species in the sludge, but that the supernatant liquid is not in saturation with many of major solids species in sludge. This indicates that a further evaluation of the sludge mixing could prove beneficial

  3. Spatial modification of laser beam under the influence of Λ-type strong pump

    International Nuclear Information System (INIS)

    Lee, Won Kyu; Noh, Young Chul; Jeon, Jin Ho; Lee, Jai Hyung; Chang, Joon Sung

    1999-01-01

    The laser beam propagating through the resonant medium undergo severe deformation because of nonlinear interaction such as self-focusing, self-defocusing, etc. When strong pump beam coexists with the probe beam, propagation characteristics can be changed. We use samarium (Sm) vapor as the nonlinear medium. Probe laser is tuned around 4f 6 6s 27 F 0 -> 4f 6 ( 7 F)6s6p( 1 P 0 ) transition line of Sm (561.601 nm) and the pump laser is tuned around 4f 6 6s 27 F 1 -> 4f 6 ( 7 F)6s6p( 1 P 0 ) transition line of Sm (572.019 nm). The probe and the pump beams are Λ-type configuration. The transmission of the probe beam is changed as the intensity and the detuning of the pump beam are varied. The degree of self-focusing is also modified. (author)

  4. ATES/heat pump simulations performed with ATESSS code

    Science.gov (United States)

    Vail, L. W.

    1989-01-01

    Modifications to the Aquifer Thermal Energy Storage System Simulator (ATESSS) allow simulation of aquifer thermal energy storage (ATES)/heat pump systems. The heat pump algorithm requires a coefficient of performance (COP) relationship of the form: COP = COP sub base + alpha (T sub ref minus T sub base). Initial applications of the modified ATES code to synthetic building load data for two sizes of buildings in two U.S. cities showed insignificant performance advantage of a series ATES heat pump system over a conventional groundwater heat pump system. The addition of algorithms for a cooling tower and solar array improved performance slightly. Small values of alpha in the COP relationship are the principal reason for the limited improvement in system performance. Future studies at Pacific Northwest Laboratory (PNL) are planned to investigate methods to increase system performance using alternative system configurations and operations scenarios.

  5. Pump integrated closed loop control. The intelligent actuator pump - state of the art and perspectives; Pumpenintegrierte Prozessregelung. Der intelligente Aktor Pumpe - Stand und Moeglichkeiten

    Energy Technology Data Exchange (ETDEWEB)

    Paulus, Thomas; Schullerer, Joachim; Oesterle, Manfred [KSB AG, Frankenthal (Germany)

    2009-07-01

    In many areas of industrial automation, centrifugal pumps and systems of centrifugal pumps are important actuators of a process und therefore a fundamental part of the entire plant. In contrary to the controlled valves, located behind the pump in the pipework system, the functions of the intelligent actuator pump or system of pumps are rarely used and noticed. With regard to the reduction of life cycle costs of the asset pump, pump integrated closed loop control of the fluid transport task has advantages over central closed loop control e.g. in a process control system. This article contains a survey of the intelligent actuator pump, its structure and functions with regard to the solution of the fluid transport task and according pump integrated closed loop control. (orig.)

  6. 29 CFR 102.127 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Definitions. 102.127 Section 102.127 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Ex Parte Communications... parte communication means an oral or written communication not on the public record with respect to...

  7. 5 CFR 185.102 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Definitions. 185.102 Section 185.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES..., or accounting or bookkeeping entry made: (a) With respect to a claim or to obtain the approval or...

  8. 19 CFR 102.25 - Textile or apparel products under the North American Free Trade Agreement.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Textile or apparel products under the North American Free Trade Agreement. 102.25 Section 102.25 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION... or apparel products under the North American Free Trade Agreement. In connection with a claim for...

  9. High-vacuum pumping out of hydrogen isotopes by compressed and electrophysical pumps

    International Nuclear Information System (INIS)

    Bychkova, A.D.; Ershova, Z.V.; Saksaganskij, G.L.; Serebrennikov, D.V.

    1982-01-01

    To explain the selection of parameters of vacuum systems of projected thermonuclear devices, experiments are performed on the pumping-out of deuterium and tritium by high-vacuum pumps of different types. The values of the fast response of turbomolecular, diffusion vapour-mercury, magneto-discharge and titanium getter pumps in the operation pressure range are determined. The rate of sorption of hydrogen isotopes by non-spraying gas absorber of cial alloy depending on the amount of the gas absorbed and temperature, is measured. Gas current is determined by the pressure drop on the diagram of the known conductivity. Individual calibration of manometric converters for different gases using a mercury burette is performed preliminarily. The means of high-vacuum pumping-out that have been studied have the following values of fast response for tritium (relatively to protium): turbomolecular pump-0.95; evaporation getter pump-0.25; magneto-discharge pumps-0.65-0.9; cial alloy-0.1...0.5

  10. 41 CFR 109-27.102-1 - Applicability.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-1 Applicability. Replenishment of inventories of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.102-1 Section 109-27.102-1 Public Contracts and Property Management Federal Property Management...

  11. 41 CFR 109-27.102-51 - Policy.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-51 Policy. Systems contracting for supply... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-27.102-51 Section 109-27.102-51 Public Contracts and Property Management Federal Property Management Regulations...

  12. 7 CFR 3560.102 - Housing project management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Housing project management. 3560.102 Section 3560.102... § 3560.102 Housing project management. (a) General. Borrowers hold final responsibility for housing project management and must ensure that operations comply with the terms of all loan or grant documents...

  13. 29 CFR 102.104 - Withdrawal of petition.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Withdrawal of petition. 102.104 Section 102.104 Labor... Orders and Advisory Opinions Regarding Board Jurisdiction § 102.104 Withdrawal of petition. The petitioner may withdraw his petition at any time prior to issuance of the Board's advisory opinion. ...

  14. 29 CFR 784.102 - General legislative history.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false General legislative history. 784.102 Section 784.102 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... Aquatic Products Legislative History of Exemptions § 784.102 General legislative history. (a) As orginally...

  15. 41 CFR 101-27.102-2 - Guidelines.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Guidelines. 101-27.102-2 Section 101-27.102-2 Public Contracts and Property Management Federal Property Management Regulations... Replenishment § 101-27.102-2 Guidelines. Guidelines for implementing the EOQ principle of stock replenishment...

  16. STS-35 payload specialists perform balancing act on OV-102's middeck

    Science.gov (United States)

    1990-01-01

    Aided by the microgravity environment aboard Columbia, Orbiter Vehicle (OV) 102, STS-35 Payload Specialist Ronald A. Parise balances Payload Specialist Samuel T. Durrance on his index finger in front of the middeck starboard wall. Durrance is wearing a blood pressure cuff and is holding a beverage container and food package during the microgravity performance. The waste management compartment (WMC), side hatch, and orbiter galley are seen behind the two crewmembers. Durrance's feet are at the forward lockers.

  17. Measure Guideline: Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A.; Easley, S.

    2012-05-01

    The report evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provide a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.

  18. Wet motor geroter fuel pump

    Energy Technology Data Exchange (ETDEWEB)

    Wiernicki, M.V.

    1987-05-05

    This patent describes a wet motor gerotor fuel pump for pumping fuel from a fuel source to an internal combustion which consists of: gerotor pump means comprising an inner pump gear, an outer pump gear, and second tang means located on one of the inner and outer pump gears. The second tang means further extends in a second radial direction radially offset from the first radial direction and forms a driving connection with the first tang means such that the fuel pump pumps fuel from the fuel source into the narrow conduit inlet chamber, through the gerotor pump means past the electric motor means into the outlet housing means substantially along the flow axis to the internal combustion engine.

  19. Optical--microwave pumping of alkali atoms and population capture

    International Nuclear Information System (INIS)

    Aleksandrov, E.B.; Vershovskii, A.K.

    1985-01-01

    The steady-state distribution of the populations of the hyperfine sublevels of the ground state of alkali atoms is calculated for the case in which the atoms are subjected to a spectrally selective optical pumping on 2 S 1 /sub // 2 -- 2 P/sub 1/2,3/2/ transitions and a simultaneous pumping by microwave fields which are at resonance with transitions in the hyperfine structure of the ground state, F = 2, M/sub F/ = +- 2, +- 1bold-arrow-left-rightF = 1, M/sub F/ = +- 1. The addition of the microwave pumping is shown to substantially increase the population difference for the O--O transition in the hyperfine structure. During selective optical pumping of the F = 1 level, the population inversion which can be achieved for the O--O transition is limited by the effect of population capture. This capture can be eliminated by using incoherent microwave fields. The quality factor of the O--O resonance is calculated as a function of the parameters of the pump. The outlook for the use of composite pumping in frequency-stabilization systems is discussed

  20. Pump failure leads to alternative vertical pump condition monitoring technique

    International Nuclear Information System (INIS)

    DeVilliers, Adriaan; Glandon, Kevin

    2011-01-01

    Condition monitoring and detecting early signs of potential failure mechanisms present particular problems in vertical pumps. Most often, the majority of the pump assembly is not readily accessible for visual or audible inspection or conventional vibration monitoring techniques using accelerometers and/or proximity sensors. The root cause failure analysis of a 2-stage vertical centrifugal service-water pump at a nuclear power generating facility in the USA is presented, highlighting this long standing challenge in condition monitoring of vertical pumps. This paper will summarize the major findings of the root cause analysis (RCA), highlight the limitations of traditional monitoring techniques, and present an expanded application of motor current monitoring as a means to gain insight into the mechanical performance and condition of a pump. The 'real-world' example of failure, monitoring and correlation of the monitoring technique to a detailed pump disassembly inspection is also presented. This paper will explain some of the reasons behind well known design principles requiring natural frequency separation from known forcing frequencies, as well as explore an unexpected submerged brittle fracture failure mechanism, and how such issues may be avoided. (author)

  1. Diode-pumped laser with improved pumping system

    Science.gov (United States)

    Chang, Jim J.

    2004-03-09

    A laser wherein pump radiation from laser diodes is delivered to a pump chamber and into the lasing medium by quasi-three-dimensional compound parabolic concentrator light channels. The light channels have reflective side walls with a curved surface and reflective end walls with a curved surface. A flow tube between the lasing medium and the light channel has a roughened surface.

  2. Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102

    International Nuclear Information System (INIS)

    Shultz, M.V.

    1999-01-01

    Tank 241-SY-101 waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from Tank 241-SY-101 to Tank 241-SY-102. The results of the hazards evaluation were compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. Revision 1 of this document deletes hazardous conditions no longer applicable to the current waste transfer design and incorporates hazardous conditions related to the use of an above ground pump pit and overground transfer line. This document is not part of the AB and is not a vehicle for requesting authorization of the activity; it is only intended to provide information about the hazardous conditions associated with this activity. The AB Control Decision process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis

  3. Optimal hydraulic design of new-type shaft tubular pumping system

    International Nuclear Information System (INIS)

    Zhu, H G; Zhang, R T; Zhou, J R

    2012-01-01

    Based on the characteristics of large flow rate, low-head, short annual operation time and high reliability of city flood-control pumping stations, a new-type shaft tubular pumping system featuring shaft suction box, siphon-type discharge passage with vacuum breaker as cutoff device was put forward, which possesses such advantages as simpler structure, reliable cutoff and higher energy performance. According to the design parameters of a city flood control pumping station, a numerical computation model was set up including shaft-type suction box, siphon-type discharge passage, pump impeller and guide vanes. By using commercial CFD software Fluent, RNG κ-ε turbulence model was adopted to close the three-dimensional time-averaged incompressible N-S equations. After completing optimal hydraulic design of shaft-type suction box, and keeping the parameters of total length, maximum width and outlet section unchanged, siphon-type discharge passages of three hump locations and three hump heights were designed and numerical analysis on the 9 hydraulic design schemes of pumping system were proceeded. The computational results show that the changing of hump locations and hump heights directly affects the internal flow patterns of discharge passages and hydraulic performances of the system, and when hump is located 3.66D from the inlet section and hump height is about 0.65D (D is the diameter of pump impeller), the new-type shaft tubular pumping system achieves better energy performances. A pumping system model test of the optimal designed scheme was carried out. The result shows that the highest pumping system efficiency reaches 75.96%, and when at design head of 1.15m the flow rate and system efficiency were 0.304m 3 /s and 63.10%, respectively. Thus, the validity of optimal design method was verified by the model test, and a solid foundation was laid for the application and extension of the new-type shaft tubular pumping system.

  4. Identification of MPL R102P Mutation in Hereditary Thrombocytosis

    Directory of Open Access Journals (Sweden)

    Christine Bellanné-Chantelot

    2017-09-01

    Full Text Available The molecular basis of hereditary thrombocytosis is germline mutations affecting the thrombopoietin (TPO/TPO receptor (MPL/JAK2 signaling axis. Here, we report one family presenting two cases with a mild thrombocytosis. By sequencing JAK2 and MPL coding exons, we identified a germline MPL R102P heterozygous mutation in the proband and his daughter. Concomitantly, we detected high TPO levels in the serum of these two patients. The mutation was not found in three other unaffected cases from the family except in another proband’s daughter who did not present thrombocytosis but had a high TPO level. The MPL R102P mutation was first described in congenital amegakaryocytic thrombocytopenia in a homozygous state with a loss-of-function activity. It was previously shown that MPL R102P was blocked in the endoplasmic reticulum without being able to translocate to the plasma membrane. Thus, this case report identifies for the first time that MPL R102P mutation can differently impact megakaryopoiesis: thrombocytosis or thrombocytopenia depending on the presence of the heterozygous or homozygous state, respectively. The paradoxical effect associated with heterozygous MPL R102P may be due to subnormal cell-surface expression of wild-type MPL in platelets inducing a defective TPO clearance. As a consequence, increased TPO levels may activate megakaryocyte progenitors that express a lower, but still sufficient level of MPL for the induction of proliferation.

  5. Optically pumped atoms

    CERN Document Server

    Happer, William; Walker, Thad

    2010-01-01

    Covering the most important knowledge on optical pumping of atoms, this ready reference is backed by numerous examples of modelling computation for optical pumped systems. The authors show for the first time that modern scientific computing software makes it practical to analyze the full, multilevel system of optically pumped atoms. To make the discussion less abstract, the authors have illustrated key points with sections of MATLAB codes. To make most effective use of contemporary mathematical software, it is especially useful to analyze optical pumping situations in the Liouville spa

  6. Instrumentation

    Energy Technology Data Exchange (ETDEWEB)

    Decreton, M

    2001-04-01

    SCK-CEN's research and development programme on instrumentation involves the assessment and the development of sensitive measurement systems used within a radiation environment. Particular emphasis is on the assessment of optical fibre components and their adaptability to radiation environments. The evaluation of ageing processes of instrumentation in fission plants, the development of specific data evaluation strategies to compensate for ageing induced degradation of sensors and cable performance form part of these activities. In 2000, particular emphasis was on in-core reactor instrumentation applied to fusion, accelerator driven and water-cooled fission reactors. This involved the development of high performance instrumentation for irradiation experiments in the BR2 reactor in support of new instrumentation needs for MYRRHA, and for diagnostic systems for the ITER reactor.

  7. Development of α and/or β activity aerosol instrumentation

    International Nuclear Information System (INIS)

    Lu Zhengyong; Li Aiwu; Gou Quanlu

    1996-01-01

    A radioactive aerosol instrumentation is developed recently for measuring the α and/or β activity of artificial radioactivity aerosols which are produced in nuclear facilities. The instrumentation has the function discriminating natural radioactivity aerosols resulted from radon and thoron daughters, and it is enabled in time and without delay to measure α and β artificial activity collected with a filter by pumping aerosols through this filter. The energy discrimination and compensation method is used for eliminating the influence of natural αradioactivity aerosols. To minimize the influence of natural β-radioactivity aerosols, the method measuring the ratio α/β of natural aerosols is also used in the instrument. The improved methods eliminating the influence of natural background α and β aerosols are used so that both α and β artificial activities in aerosol filter samples can be monitored simultaneously. The instrumentation is appropriate for monitoring α and/or β artificial radioactive aerosols

  8. Outcome of Cardiac Rehabilitation Following Off-Pump Versus On-Pump Coronary Bypass Surgery

    Directory of Open Access Journals (Sweden)

    Reza Arefizadeh

    2017-05-01

    CONCLUSIONS: Regarding QOL and psychological status, there were no differences in the CR outcome between those who underwent off-pump bypass surgery and those who underwent on-pump surgery; nevertheless, the off-pump technique was superior to the on-pump method on METs improvement following CR.

  9. Measure Guideline. Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States); Easley, S. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States)

    2012-05-01

    This measure guideline evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provides a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.

  10. Vacuum technology Practice for scientific instruments

    CERN Document Server

    Yoshimura, Nagamitsu

    2008-01-01

    Nanotechnology has reached a level where almost every new development and even every new product uses features of nanoscopic properties of materials. As a consequence, an enormous amount of scientific instruments is used in order to synthesize and analyze new structures and materials. Due to the surface sensitivity of such materials, many of these instruments require ultrahigh vacuum that has to be provided under extreme conditions like very high voltages. In this book, Yoshimura provides a review of the UHV related development during the last decades. His very broad experience in the design enables him to present us this detailed reference. After a general description how to design UHV systems, he covers all important issue in detail, like pumps, outgasing, Gauges, and Electrodes for high voltages. Thus, this book serves as reference for everybody using UVH in his scientific equipment

  11. 29 CFR 102.116 - Signature of orders.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Signature of orders. 102.116 Section 102.116 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Certification and Signature of Documents § 102.116 Signature of orders. The executive secretary or the associate executive...

  12. 28 CFR 34.102 - Peer review procedures.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Peer review procedures. 34.102 Section 34.102 Judicial Administration DEPARTMENT OF JUSTICE OJJDP COMPETITION AND PEER REVIEW PROCEDURES Peer Review § 34.102 Peer review procedures. The OJJDP peer review process is contained in an OJJDP “Peer...

  13. 42 CFR 413.102 - Compensation of owners.

    Science.gov (United States)

    2010-10-01

    ...) Definitions—(1) Compensation. Compensation means the total benefit received by the owner for the services he... 42 Public Health 2 2010-10-01 2010-10-01 false Compensation of owners. 413.102 Section 413.102... § 413.102 Compensation of owners. (a) Principle. A reasonable allowance of compensation for services of...

  14. 29 CFR 102.138 - Definition of meeting.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Definition of meeting. 102.138 Section 102.138 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.138 Definition of meeting. For purposes of this subpart, meeting shall mean the deliberations of...

  15. 241-SY-101 DACS instrument problem screen (SCR 448) acceptance test procedure

    International Nuclear Information System (INIS)

    ERMI, A.M.

    1999-01-01

    The operability of the 241-SY-101 Data Acquisition and Control System (DACS) to provide proper control and monitoring of the mitigation mixer pump and instrumentation installed in the 241-SY-101 underground storage tank utilizing the [INSTPROB] screen will be systematically evaluated by the performance of this procedure

  16. Interim safety equipment list for 241-C-106 waste retrieval, project W-320

    International Nuclear Information System (INIS)

    Conner, J.C.

    1996-01-01

    The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices

  17. Interim safety equipment list for 241-C-106 waste retrieval, project W-320

    Energy Technology Data Exchange (ETDEWEB)

    Conner, J.C.

    1996-01-25

    The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices.

  18. 22 CFR 102.27 - Docket.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Docket. 102.27 Section 102.27 Foreign Relations... other than the Director of the Office of Aviation and summaries of oral communications prepared in...) All comments submitted under this subpart and placed in the docket, are available for public...

  19. 31 CFR 17.102 - Application.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Application. 17.102 Section 17.102 Money and Finance: Treasury Office of the Secretary of the Treasury ENFORCEMENT OF NONDISCRIMINATION ON... Application. This part applies to all programs or activities conducted by the agency, except for programs or...

  20. Cyclic fatigue of nickel-titanium rotary instruments in a double (S-shaped) simulated curvature.

    Science.gov (United States)

    Al-Sudani, Dina; Grande, Nicola M; Plotino, Gianluca; Pompa, Giorgio; Di Carlo, Stefano; Testarelli, Luca; Gambarini, Gianluca

    2012-07-01

    The goal of the present study was to test the fatigue resistance of nickel-titanium rotary files in a double curvature (S-shaped) artificial root canal and to compare those results with single curvature artificial root canals. Two nickel-titanium endodontic instruments consisting of identical instrument sizes (constant .06 taper and 0.25 tip diameter) were tested, ProFile instruments and Vortex instruments. Both instruments were tested for fatigue inside an artificial canal with a double curvature and inside a curved artificial canal with a single curvature. Ten instruments for each group were tested to fracture in continuous rotary motion at 300 rpm. Number of cycles to failure (NCF) was calculated to the nearest whole number, and the length of the fractured fragment was measured in millimeters. Data were statistically analyzed with a level of significance set at 95% confidence level. The NCF value was always statistically lower in the double curved artificial canal when compared with the single curve (P instruments of the same size of different brand only in the single curve; ProFile registered a mean of 633.5 ± 75.1 NCF, whereas Vortex registered a mean of 548 ± 48.9 NCF. Regardless of the differences between the instruments used in the present study, the results suggest that the more complex is the root canal, the more adverse are the effects on the cyclic fatigue resistance of the instruments. Copyright © 2012 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.

  1. Tests of cooling water pumps at Dukovany nuclear power plant

    International Nuclear Information System (INIS)

    Travnicek, J.

    1986-01-01

    Tests were performed to examine the operating conditions of the 1600 BQDV cooling pumps of the main coolant circuit of unit 1 of the Dukovany nuclear power plant. For the pumps, the performance was tested in the permissible operating range, points were measured below this range and the guaranteed operating point was verified. Pump efficiency was calculated from the measured values. The discussion of the measurement of parameters has not yet been finished because the obtained values of the amount delivered and thus of the pump efficiency were not up to expectation in all detail. It was also found that for obtaining the guaranteed flow the pump impeller had to be opened to 5deg -5.5deg instead of the declared 3deg. Also tested were pump transients, including the start of the pump, its stop, the operation and failure of one of the two pumps. In these tests, pressures were also measured at the inlet and the outlet of the inner part of the TG 11 turbine condenser. It was shown that the time course and the pressure course of the processes were acceptable. In addition to these tests, pressure losses in the condenser and the cooling water flow through the feed pump electromotor cooler wre tested for the case of a failure of one of the two pumps. (E.S.)

  2. Pumps for nuclear facilities

    International Nuclear Information System (INIS)

    1999-01-01

    The guide describes how the Finnish Radiation and Nuclear Safety Authority (STUK) controls pumps and their motors at nuclear power plants and other nuclear facilities. The scope of the control is determined by the Safety Class of the pump in question. The various phases of the control are: (1) review of construction plan, (2) control of manufacturing, and construction inspection, (3) commissioning inspection, and (4) control during operation. STUK controls Safety Class 1, 2 and 3 pumps at nuclear facilities as described in this guide. STUK inspects Class EYT (non-nuclear) pumps separately or in connection with the commissioning inspections of the systems. This guide gives the control procedure and related requirements primarily for centrifugal pumps. However, it is also applied to the control of piston pumps and other pump types not mentioned in this guide

  3. Operating experience with a high capacity helium pump under supercritical conditions

    International Nuclear Information System (INIS)

    Lehmann, W.; Minges, J.

    1984-01-01

    This chapter discusses the development and testing of a high-capacity piston pump to provide forced cooling for large superconducting magnets. The pump is a three cylinder, vertically arranged single-acting piston pump equipped with a frequency controlled three-phase geared motor operating at room temperature. The pump is capable of delivering up to 150 g/s at a maximum speed of 310 rpm and under the inlet conditions of 4 bar/4.5 K. No decline was noticed in delivery head and efficiencies during more than 560 hours of operation. It is concluded that the pump satisfies all requirements for circulating large mass flows across great pressure differences as needed (e.g. in fusion magnet design)

  4. 29 CFR 1650.102 - Delegation of authority.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Delegation of authority. 1650.102 Section 1650.102 Labor... for the Collection of Debts by Salary Offset § 1650.102 Delegation of authority. The Chair delegated to the Chief Human Capital Officer the authority to collect debts owed by current EEOC employees, and...

  5. 10 CFR 611.102 - Eligible project costs.

    Science.gov (United States)

    2010-01-01

    ... Accounting Principles and these costs may be considered by DOE in determining the Borrower's contribution to... 10 Energy 4 2010-01-01 2010-01-01 false Eligible project costs. 611.102 Section 611.102 Energy... PROGRAM Direct Loan Program § 611.102 Eligible project costs. (a) Eligible costs are: (1) Those costs that...

  6. Survey of pumps for tritium gas

    International Nuclear Information System (INIS)

    Dowell, T.M.

    1983-05-01

    This report considers many different types of pumps for their possible use in pumping tritium gas in the low, intermediate and high vacuum ranges. No one type of pump is suitable for use over the wide range of pumping pressure required in a typical pumping system. The favoured components for such a system are: bellows pump (low vacuum); orbiting scroll pump (intermediate vacuum); magnetically suspended turbomolecular pump (high vacuum); cryopump (high vacuum). Other pumps which should be considered for possible future development are: mound modified vane pump; SRTI wobble pump; roots pump with canned motor. It is proposed that a study be made of a future tritium pumping system in a Canadian tritium facility, e.g. a tritium laboratory

  7. Building 772 - CERN’s new calibration facility for radiation protection instruments is ready to go

    CERN Document Server

    2014-01-01

    Building 772 is becoming the new home of CERN’s calibration facility for radiation protection instrumentation. The new laboratory in Prévessin will be a state-of-the-art calibration facility and the first of its kind in both France and Switzerland, offering a wide range of possibilities with respect to radiation fields and instrumentation.   New four-axis calibration bench for radiation protection instruments.   Civil engineering work started in November 2013 in Prévessin and Building 772 is now finished and ready for inauguration. CERN’s calibration facility was previously located in Building 172 in Meyrin. Although still very accurate, the technology used was becoming obsolete and needed replacement. “Having considered different options, the decision was taken to build a new facility fully designed and conceived to meet all international safety and technical requirements of such a laboratory,” says Pie...

  8. Safe pumping of hazardous liquids—A survey of no-moving-part pump principles

    Czech Academy of Sciences Publication Activity Database

    Tesař, Václav

    2011-01-01

    Roč. 168, č. 1 (2011), s. 23-34 ISSN 1385-8947 R&D Projects: GA ČR GA101/07/1499; GA AV ČR IAA200760705 Institutional research plan: CEZ:AV0Z20760514 Keywords : fluidics * pump * hazardous liquid Subject RIV: BK - Fluid Dynamics Impact factor: 3.461, year: 2011 http://www.sciencedirect.com/science/journal/13858947

  9. 31 CFR 0.102 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Policy. 0.102 Section 0.102 Money and Finance: Treasury Office of the Secretary of the Treasury DEPARTMENT OF THE TREASURY EMPLOYEE RULES OF... is not limited to: (1) Reassignment of work duties; (2) Disqualification from a particular assignment...

  10. 75 FR 67949 - Application(s) for Duty-Free Entry of Scientific Instruments

    Science.gov (United States)

    2010-11-04

    ... Importation Act of 1966 (Pub. L. 89-651, as amended by Pub. L. 106-36; 80 Stat. 897; 15 CFR part 301), we.... 133, Austin, Texas 78758-4497. Instrument: Hexapod Actuators. Manufacturer: ADS International, S.r.l...: October 20, 2010. Dated: October 29, 2010. Gregory Campbell, Acting Director, IA Subsidies Enforcement...

  11. Normetex Pump Alternatives Study

    International Nuclear Information System (INIS)

    Clark, Elliot A.

    2013-01-01

    A mainstay pump for tritium systems, the Normetex scroll pump, is currently unavailable because the Normetex company went out of business. This pump was an all-metal scroll pump that served tritium processing facilities very well. Current tritium system operators are evaluating replacement pumps for the Normetex pump and for general used in tritium service. An all-metal equivalent alternative to the Normetex pump has not yet been identified. 1. The ideal replacement tritium pump would be hermetically sealed and contain no polymer components or oils. Polymers and oils degrade over time when they contact ionizing radiation. 2. Halogenated polymers (containing fluorine, chlorine, or both) and oils are commonly found in pumps. These materials have many properties that surpass those of hydrocarbon-based polymers and oils, including thermal stability (higher operating temperature) and better chemical resistance. Unfortunately, they are less resistant to degradation from ionizing radiation than hydrocarbon-based materials (in general). 3. Polymers and oils can form gaseous, condensable (HF, TF), liquid, and solid species when exposed to ionizing radiation. For example, halogenated polymers form HF and HCl, which are extremely corrosive upon reaction with water. If a pump containing polymers or oils must be used in a tritium system, the system must be designed to be able to process the unwanted by-products. Design features to mitigate degradation products include filters and chemical or physical traps (eg. cold traps, oil traps). 4. Polymer components can work in tritium systems, but must be replaced regularly. Polymer components performance should be monitored or be regularly tested, and regular replacement of components should be viewed as an expected normal event. A radioactive waste stream must be established to dispose of used polymer components and oil with an approved disposal plan developed based on the facility location and its regulators. Polymers have varying

  12. Performance of Wind Pump Prototype

    African Journals Online (AJOL)

    Mulu

    Mekelle University, Mekelle, Ethiopia (*mul_at@yahoo.com). ABSTRACT. A wind ... balanced rotor power and reciprocating pump, hence did not consider the effect of pump size. ... Keywords: Wind pump, Windmill, Performance testing, Pump efficiency, Pump discharge, ... Unfortunately, in rural places, where the houses are.

  13. 42 CFR 102.73 - Approval of benefits.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Approval of benefits. 102.73 Section 102.73 Public... PROGRAM Secretarial Determinations § 102.73 Approval of benefits. When the Secretary has determined that benefits will be paid to a requester and has calculated the type and amount of such benefits, he will...

  14. Test report for the run-in acceptance testing of the hydrogen mitigation retrieval Pump-3

    International Nuclear Information System (INIS)

    Berglin, B.G.; Nash, Ch.R.

    1997-01-01

    This report will provide the findings of the demonstration test conducted on the Double-Shell Tank (DST) 241-SY-101 HMR Pump-3 in accordance with WHC-SDWM-TP-434 ''Test plan for run-in acceptance testing of hydrogen mitigation/retrieval pump-3'' at the 400 Area Maintenance and Storage Facility (MASF) building from 7 June 1996 through 30 July 1996 per work package 4A-96-92/W. The DST 241-SY-101 hydrogen mitigation retrieval Pump-3 is a 200-HP submersible electric driven pump that has been modified for use in the DST 241-SY-101 containing mixed waste located in the 200W area. The pump has a motor driven rotation mechanism that allows the pump column to rotate through 355 degree. Prior to operation, pre-operational checks were performed which included loop calibration grooming and alignment of instruments, learning how plumb HMR-3 assembly hung in a vertical position and bump test of the motor to determine rotation direction. The pump was tested in the MASF Large Diameter Cleaning Vessel (LDCV) with process water at controlled temperatures and levels. In addition, the water temperature of the cooling water to the motor oil heat exchanger was recorded during testing. A 480-volt source powered a Variable Frequency Drive (VFD). The VFD powered the pump at various frequencies and voltages to control speed and power output of the pump. A second VFD powered the oil cooling pump. A third VFD was not available to operate the rotational drive motor during the 72 hour test, so it was demonstrated as operational before and after the test. A Mini Acquisition and Control System (Mini-DACS) controls pump functions and monitoring of the pump parameters. The Mini-DACS consists of three computers, software and some Programmable Logic Controllers (PLC). Startup and shutdown of either the pump motor or the oil cooling pump can be accomplished by the Mini-DACS. When the pump was in operation, the Mini-DACS monitors automatically collects data electronically. However, some required data

  15. Tank 241-AZ-101 criticality assessment resulting from pump jet mixing: Sludge mixing simulation

    Energy Technology Data Exchange (ETDEWEB)

    Onishi, Y.; Recknagle, K.

    1997-04-01

    Tank 241-AZ-101 (AZ-101) is one of 28 double-shell tanks located in the AZ farm in the Hanford Site`s 200 East Area. The tank contains a significant quantity of fissile materials, including an estimated 9.782 kg of plutonium. Before beginning jet pump mixing for mitigative purposes, the operations must be evaluated to demonstrate that they will be subcritical under both normal and credible abnormal conditions. The main objective of this study was to address a concern about whether two 300-hp pumps with four rotating 18.3-m/s (60-ft/s) jets can concentrate plutonium in their pump housings during mixer pump operation and cause a criticality. The three-dimensional simulation was performed with the time-varying TEMPEST code to determine how much the pump jet mixing of Tank AZ-101 will concentrate plutonium in the pump housing. The AZ-101 model predicted that the total amount of plutonium within the pump housing peaks at 75 g at 10 simulation seconds and decreases to less than 10 g at four minutes. The plutonium concentration in the entire pump housing peaks at 0.60 g/L at 10 simulation seconds and is reduced to below 0.1 g/L after four minutes. Since the minimum critical concentration of plutonium is 2.6 g/L, and the minimum critical plutonium mass under idealized plutonium-water conditions is 520 g, these predicted maximums in the pump housing are much lower than the minimum plutonium conditions needed to reach a criticality level. The initial plutonium maximum of 1.88 g/L still results in safety factor of 4.3 in the pump housing during the pump jet mixing operation.

  16. Leak Mitigation in Mechanically Pumped Fluid Loops for Long Duration Space Missions

    Science.gov (United States)

    Miller, Jennifer R.; Birur, Gajanana; Bame, David; Mastropietro, A. J.; Bhandari, Pradeep; Lee, Darlene; Karlmann, Paul; Liu, Yuanming

    2013-01-01

    Mechanically pumped fluid loops (MPFLs) are increasingly considered for spacecraft thermal control. A concern for long duration space missions is the leak of fluid leading to performance degradation or potential loop failure. An understanding of leak rate through analysis, as well as destructive and non-destructive testing, provides a verifiable means to quantify leak rates. The system can be appropriately designed to maintain safe operating pressures and temperatures throughout the mission. Two MPFLs on the Mars Science Laboratory Spacecraft, launched November 26, 2011, maintain the temperature of sensitive electronics and science instruments within a -40 deg C to 50 deg C range during launch, cruise, and Mars surface operations. With over 100 meters of complex tubing, fittings, joints, flex lines, and pumps, the system must maintain a minimum pressure through all phases of the mission to provide appropriate performance. This paper describes the process of design, qualification, test, verification, and validation of the components and assemblies employed to minimize risks associated with excessive fluid leaks from pumped fluid loop systems.

  17. 21 CFR 102.19 - Petitions.

    Science.gov (United States)

    2010-04-01

    ... display panel of a food for which a common or usual name regulation is established is too small to... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Petitions. 102.19 Section 102.19 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

  18. Low-cost, high-performance nonevaporable getter pumps using nonevaporable getter pills

    International Nuclear Information System (INIS)

    Kodama, Hiraku; Ohno, Shinya; Tanaka, Masatoshi; Tanaka, Masato; Okudaira, Koji K.; Mase, Kazuhiko; Kikuchi, Takashi

    2016-01-01

    Nonevaporable getter (NEG) pumps are widely used for maintaining a clean ultrahigh vacuum (UHV) of ≤10"−"8" Pa because of their high pumping speeds for hydrogen (H_2) and active gases in the UHV region. In addition, they are oil free, evaporation free, sputtering free, sublimation free, magnetic field free, vibration free, economical, compact, lightweight, and energy saving. In the present paper, the authors report a new NEG pump which is composed of commercial 60 NEG pills (ϕ10 × 3 mm; 70 wt. % Zr, 24.6 wt. % V, and 5.4 wt. % Fe), titanium parts, a DN 40 conflat flange, and a tantalum heater. The NEG pills are vertically and radially aligned around the heater to maximize the effective area for pumping. After activation at 400 °C for 30 min, the pumping speeds of the NEG pump were measured with the orifice method. Pumping speeds of 140–130, 200–140, 190–130, and 35–17 l/s were estimated for H_2, CO, CO_2, and N_2 gasses, respectively, in a pumped-quantity range of 0.01–0.1 Pa l. Since the NEG pump is composed of a heating unit and a NEG module, the pumping speeds can be improved by increasing the number of NEG modules. These NEG pumps are favorable alternatives to sputtering ion pumps or titanium sublimation pumps.

  19. Low-cost, high-performance nonevaporable getter pumps using nonevaporable getter pills

    Energy Technology Data Exchange (ETDEWEB)

    Kodama, Hiraku; Ohno, Shinya; Tanaka, Masatoshi [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan); Tanaka, Masato; Okudaira, Koji K. [Faculty of Engineering, Chiba University, 1-33 Yayoi-cho, Inage-ku 263-8522 (Japan); Mase, Kazuhiko, E-mail: mase@post.kek.jp; Kikuchi, Takashi [Institute of Materials Structure Science, KEK, 1-1 Oho, Tsukuba 305-0801 (Japan)

    2016-09-15

    Nonevaporable getter (NEG) pumps are widely used for maintaining a clean ultrahigh vacuum (UHV) of ≤10{sup −8 }Pa because of their high pumping speeds for hydrogen (H{sub 2}) and active gases in the UHV region. In addition, they are oil free, evaporation free, sputtering free, sublimation free, magnetic field free, vibration free, economical, compact, lightweight, and energy saving. In the present paper, the authors report a new NEG pump which is composed of commercial 60 NEG pills (ϕ10 × 3 mm; 70 wt. % Zr, 24.6 wt. % V, and 5.4 wt. % Fe), titanium parts, a DN 40 conflat flange, and a tantalum heater. The NEG pills are vertically and radially aligned around the heater to maximize the effective area for pumping. After activation at 400 °C for 30 min, the pumping speeds of the NEG pump were measured with the orifice method. Pumping speeds of 140–130, 200–140, 190–130, and 35–17 l/s were estimated for H{sub 2}, CO, CO{sub 2}, and N{sub 2} gasses, respectively, in a pumped-quantity range of 0.01–0.1 Pa l. Since the NEG pump is composed of a heating unit and a NEG module, the pumping speeds can be improved by increasing the number of NEG modules. These NEG pumps are favorable alternatives to sputtering ion pumps or titanium sublimation pumps.

  20. Development of a computer-adaptive physical function instrument for Social Security Administration disability determination.

    Science.gov (United States)

    Ni, Pengsheng; McDonough, Christine M; Jette, Alan M; Bogusz, Kara; Marfeo, Elizabeth E; Rasch, Elizabeth K; Brandt, Diane E; Meterko, Mark; Haley, Stephen M; Chan, Leighton

    2013-09-01

    To develop and test an instrument to assess physical function for Social Security Administration (SSA) disability programs, the SSA-Physical Function (SSA-PF) instrument. Item response theory (IRT) analyses were used to (1) create a calibrated item bank for each of the factors identified in prior factor analyses, (2) assess the fit of the items within each scale, (3) develop separate computer-adaptive testing (CAT) instruments for each scale, and (4) conduct initial psychometric testing. Cross-sectional data collection; IRT analyses; CAT simulation. Telephone and Internet survey. Two samples: SSA claimants (n=1017) and adults from the U.S. general population (n=999). None. Model fit statistics, correlation, and reliability coefficients. IRT analyses resulted in 5 unidimensional SSA-PF scales: Changing & Maintaining Body Position, Whole Body Mobility, Upper Body Function, Upper Extremity Fine Motor, and Wheelchair Mobility for a total of 102 items. High CAT accuracy was demonstrated by strong correlations between simulated CAT scores and those from the full item banks. On comparing the simulated CATs with the full item banks, very little loss of reliability or precision was noted, except at the lower and upper ranges of each scale. No difference in response patterns by age or sex was noted. The distributions of claimant scores were shifted to the lower end of each scale compared with those of a sample of U.S. adults. The SSA-PF instrument contributes important new methodology for measuring the physical function of adults applying to the SSA disability programs. Initial evaluation revealed that the SSA-PF instrument achieved considerable breadth of coverage in each content domain and demonstrated noteworthy psychometric properties. Copyright © 2013 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.

  1. Pumped energy transfer stations (STEP)

    International Nuclear Information System (INIS)

    Tournery, Jean-Francois

    2015-12-01

    As objectives of development are high for renewable energies (they are supposed to cover 50 per cent of new energy needs by 2035), pumped energy transfer stations are to play an important role in this respect. The author first discusses the consequences of the development of renewable energies on the exploitation of electric grids: issue of intermittency for some of them, envisaged solutions. Then, he addresses one of the solutions: the storage of electric power. He notices that increasing the potential energy of a volume of water is presently the most mature solution to face massive needs of the power system. Dams and pumped energy transfer stations represent now almost the whole installed storage power in the world. The author then presents these pumped energy transfer stations: principle, brief history (the first appeared in Italy and Switzerland at the end of the 1890's). He indicates the various parameters of assessment of such stations: maximum stored energy, installed power in pumping mode and turbine mode, time constant, efficiency, level of flexibility. He discusses economic issues. He describes and comments the operation of turbine-pump groups: ternary groups, reversible binary groups. He discusses barriers to be overcome and technical advances to be made for varying speed groups and for marine stations. He finally gives an overview (table with number of stations belonging to different power ranges, remarkable installations) of existing stations in China, USA, Japan, Germany, Austria, Spain, Portugal, Italy, Switzerland, France and UK, and indicate predictions regarding storage needs at the world level. Some data are finally indicated for the six existing French installations

  2. Solar Pumping : The Basics

    OpenAIRE

    World Bank Group

    2018-01-01

    Solar photovoltaic water pumping (SWP) uses energy from solar photovoltaic (PV) panels to power an electric water pump. The entire process, from sunlight to stored energy, is elegant and simple. Over last seven years, the technology and price of solar pumping have evolved dramatically and hence the opportunities it presents. Solar pumping is most competitive in regions with high solar inso...

  3. Electrokinetic pumps and actuators

    International Nuclear Information System (INIS)

    Phillip M. Paul

    2000-01-01

    Flow and ionic transport in porous media are central to electrokinetic pumping as well as to a host of other microfluidic devices. Electrokinetic pumping provides the ability to create high pressures (to over 10,000 psi) and high flow rates (over 1 mL/min) with a device having no moving parts and all liquid seals. The electrokinetic pump (EKP) is ideally suited for applications ranging from a high pressure integrated pump for chip-scale HPLC to a high flow rate integrated pump for forced liquid convection cooling of high-power electronics. Relations for flow rate and current fluxes in porous media are derived that provide a basis for analysis of complex microfluidic systems as well as for optimization of electrokinetic pumps

  4. Electrokinetic pumps and actuators

    Energy Technology Data Exchange (ETDEWEB)

    Phillip M. Paul

    2000-03-01

    Flow and ionic transport in porous media are central to electrokinetic pumping as well as to a host of other microfluidic devices. Electrokinetic pumping provides the ability to create high pressures (to over 10,000 psi) and high flow rates (over 1 mL/min) with a device having no moving parts and all liquid seals. The electrokinetic pump (EKP) is ideally suited for applications ranging from a high pressure integrated pump for chip-scale HPLC to a high flow rate integrated pump for forced liquid convection cooling of high-power electronics. Relations for flow rate and current fluxes in porous media are derived that provide a basis for analysis of complex microfluidic systems as well as for optimization of electrokinetic pumps.

  5. Off-pump versus on-pump coronary artery bypass grafting for ischaemic heart disease

    DEFF Research Database (Denmark)

    Møller, Christian H; Penninga, Luit; Wetterslev, Jørn

    2012-01-01

    Coronary artery bypass grafting (CABG) is performed both without and with cardiopulmonary bypass, referred to as off-pump and on-pump CABG respectively. However, the preferable technique is unclear.......Coronary artery bypass grafting (CABG) is performed both without and with cardiopulmonary bypass, referred to as off-pump and on-pump CABG respectively. However, the preferable technique is unclear....

  6. BRIEF COMMUNICATIONS: Optically pumped ultraviolet BR2 laser

    Science.gov (United States)

    Kamrukov, A. S.; Kozlov, N. P.; Protasov, Yu S.; Ushmarov, E. Yu

    1989-12-01

    A report is given of lasing achieved for the first time in optically pumped molecular bromine (D' 3Π2g→A' 3π2u, λL approx 292 nm). It was pumped by thermal vacuum ultraviolet radiation emitted by plasmadynamic discharges of magnetoplasma compressors, formed directly in the laser active medium. An output energy of ~ 1.1 J was obtained per laser pulse of ~ 5-μs duration from a Br2:Ar approx 1:450 active mixture at a pressure of ~ 4 atm. A comparison was made of the experimental output parameters of optically pumped Br2, I2, and XeF (B-X) lasers when their geometries and excitation energies were identical.

  7. Pumps in nuclear power plants

    International Nuclear Information System (INIS)

    Kim, J.H.

    1991-01-01

    This paper reports that pumps play an important role in nuclear plant operation. For instance, reactor coolant pumps (RCPs) should provide adequate cooling for reactor core in both normal operation and transient or accident conditions. Pumps such as Low Pressure Safety Injection (LPSI) pump in the Emergency Core Cooling System (ECCS) play a crucial role during an accident, and their reliability is of paramount importance. Some key issues involved with pumps in nuclear plant system include the performance of RCP under two-phase flow conditions, piping vibration due to pump operating in two-phase flows, and reliability of LPSI pumps

  8. Detection of pump degradation

    International Nuclear Information System (INIS)

    Casada, D.

    1995-01-01

    There are a variety of stressors that can affect the operation of centrifugal pumps. Although these general stressors are active in essentially all centrifugal pumps, the stressor level and the extent of wear and degradation can vary greatly. Parameters that affect the extent of stressor activity are manifold. In order to assure the long-term operational readiness of a pump, it is important to both understand the nature and magnitude of the specific degradation mechanisms and to monitor the performance of the pump. The most commonly applied method of monitoring the condition of not only pumps, but rotating machinery in general, is vibration analysis. Periodic or continuous special vibration analysis is a cornerstone of most pump monitoring programs. In the nuclear industry, non-spectral vibration monitoring of safety-related pumps is performed in accordance with the ASME code. Pump head and flow rate are also monitored, per code requirements. Although vibration analysis has dominated the condition monitoring field for many years, there are other measures that have been historically used to help understand pump condition; advances in historically applied technologies and developing technologies offer improved monitoring capabilities. The capabilities of several technologies (including vibration analysis, dynamic pressure analysis, and motor power analysis) to detect the presence and magnitude of both stressors and resultant degradation are discussed

  9. 20 CFR 655.102 - Special procedures.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Special procedures. 655.102 Section 655.102 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR TEMPORARY EMPLOYMENT OF... in force until modified by the Administrator. ...

  10. Diagnosis of feed water, condensate and circulation pumps in electric power plants; Diagnostico de bombas de agua de alimentacion, condensado y circulacion en centrales termoelectricas

    Energy Technology Data Exchange (ETDEWEB)

    Colin Castellanos, Carlos [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1991-12-31

    This article encompasses the analysis and the diagnosis of the pump`s performance that belong to the feed water, condensate and circulation systems of a fossil fuel power plant (FFPP). For this analysis pressure, temperature and flow data were collected by means of field installed instrumentation, as well as these pumps` motors current consumption and voltage values. Later on, the capacity and the pump efficiency are calculated and compared with the design values, to obtain the actual performance of the equipment with the aid of their characteristic curves (Q vs {Delta}H, Q vs {pi}, etc.). [Espanol] Este articulo comprende el analisis y el diagnostico de comportamiento de las bombas, las cuales forman parte de los sistemas de agua de alimentacion, condensado y circulacion de una central termoelectrica (CT). Para el analisis se recopilan datos de presion, temperatura y flujo de la instrumentacion instalada en campo, asi como de los valores de consumo de corriente y de voltaje en los motores de dichas bombas. Posteriormente, se calcula la capacidad y la eficiencia de las bombas en operacion real y se comparan con los valores de diseno, para obtener el comportamiento real del equipo con ayuda de las curvas caracteristicas (Q vs {Delta}H, Q vs {pi}, etcetera).

  11. Diagnosis of feed water, condensate and circulation pumps in electric power plants; Diagnostico de bombas de agua de alimentacion, condensado y circulacion en centrales termoelectricas

    Energy Technology Data Exchange (ETDEWEB)

    Colin Castellanos, Carlos [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1992-12-31

    This article encompasses the analysis and the diagnosis of the pump`s performance that belong to the feed water, condensate and circulation systems of a fossil fuel power plant (FFPP). For this analysis pressure, temperature and flow data were collected by means of field installed instrumentation, as well as these pumps` motors current consumption and voltage values. Later on, the capacity and the pump efficiency are calculated and compared with the design values, to obtain the actual performance of the equipment with the aid of their characteristic curves (Q vs {Delta}H, Q vs {pi}, etc.). [Espanol] Este articulo comprende el analisis y el diagnostico de comportamiento de las bombas, las cuales forman parte de los sistemas de agua de alimentacion, condensado y circulacion de una central termoelectrica (CT). Para el analisis se recopilan datos de presion, temperatura y flujo de la instrumentacion instalada en campo, asi como de los valores de consumo de corriente y de voltaje en los motores de dichas bombas. Posteriormente, se calcula la capacidad y la eficiencia de las bombas en operacion real y se comparan con los valores de diseno, para obtener el comportamiento real del equipo con ayuda de las curvas caracteristicas (Q vs {Delta}H, Q vs {pi}, etcetera).

  12. Impulse pumping modelling and simulation

    International Nuclear Information System (INIS)

    Pierre, B; Gudmundsson, J S

    2010-01-01

    Impulse pumping is a new pumping method based on propagation of pressure waves. Of particular interest is the application of impulse pumping to artificial lift situations, where fluid is transported from wellbore to wellhead using pressure waves generated at wellhead. The motor driven element of an impulse pumping apparatus is therefore located at wellhead and can be separated from the flowline. Thus operation and maintenance of an impulse pump are facilitated. The paper describes the different elements of an impulse pumping apparatus, reviews the physical principles and details the modelling of the novel pumping method. Results from numerical simulations of propagation of pressure waves in water-filled pipelines are then presented for illustrating impulse pumping physical principles, and validating the described modelling with experimental data.

  13. Instrument Modeling and Synthesis

    Science.gov (United States)

    Horner, Andrew B.; Beauchamp, James W.

    During the 1970s and 1980s, before synthesizers based on direct sampling of musical sounds became popular, replicating musical instruments using frequency modulation (FM) or wavetable synthesis was one of the “holy grails” of music synthesis. Synthesizers such as the Yamaha DX7 allowed users great flexibility in mixing and matching sounds, but were notoriously difficult to coerce into producing sounds like those of a given instrument. Instrument design wizards practiced the mysteries of FM instrument design.

  14. 33 CFR 157.126 - Pumps.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Pumps. 157.126 Section 157.126... Washing (COW) System on Tank Vessels Design, Equipment, and Installation § 157.126 Pumps. (a) Crude oil must be supplied to the COW machines by COW system pumps or cargo pumps. (b) The pumps under paragraph...

  15. Pump safety device

    International Nuclear Information System (INIS)

    Timmermans, Francis; Vandervorst, Jean.

    1981-01-01

    Safety device for longitudinally leak proofing the shaft of a pump in the event of the fracture of the dynamic seal separating the pump fluid high pressure chamber from the low pressure chamber. It is designed for fitting to the primary pumps of nuclear reactors. It includes a hollow cyclindrical piston located coaxially around the pump shaft and normally housed in a chamber provided for this purpose in the fixed housing of the dynamic seal, and means for moving this piston coaxially so as to compress a safety O ring between the shaft and the piston in the event of the dynamic seal failing [fr

  16. Detection of pump degradation

    International Nuclear Information System (INIS)

    Casada, D.A.

    1994-01-01

    There are a variety of stressors that can affect the operation of centrifugal pumps. These can generally be classified as: Mechanical; Hydraulic; Tribological; Chemical; and Other (including those associated with the pump driver). Although these general stressors are active in essentially all centrifugal pumps, the stressor level and the extent of wear and degradation can vary greatly. Parameters that affect the extent of stressor activity are manifold. In order to assure the long-term operational readiness of a pump, it is important to both understand the nature and magnitude of the specific degradation mechanisms and to monitor the performance of the pump

  17. Supercritical waste oxidation pump investigation

    International Nuclear Information System (INIS)

    Thurston, G.; Garcia, K.

    1993-02-01

    This report investigates the pumping techniques and pumping equipment that would be appropriate for a 5,000 gallon per day supercritical water oxidation waste disposal facility. The pumps must boost water, waste, and additives from atmospheric pressure to approximately 27.6 MPa (4,000 psia). The required flow ranges from 10 gpm to less than 0.1 gpm. For the higher flows, many commercial piston pumps are available. These pumps have packing and check-valves that will require periodic maintenance; probably at 2 to 6 month intervals. Several commercial diaphragm pumps were also discovered that could pump the higher flow rates. Diaphragm pumps have the advantage of not requiring dynamic seals. For the lower flows associated with the waste and additive materials, commercial diaphragm pumps. are available. Difficult to pump materials that are sticky, radioactive, or contain solids, could be injected with an accumulator using an inert gas as the driving mechanism. The information presented in this report serves as a spring board for trade studies and the development of equipment specifications

  18. Dual throat NaK pump performance evaluation (conceptual design of prototype)

    International Nuclear Information System (INIS)

    Johnson, J.L.

    1972-01-01

    An evaluation of the performance of the dual throat NaK pump for the 5 Kwe Reactor TE System is discussed. Performance at nominal operating conditions and at startup conditions is predicted. The basis for selection of this pump design is presented. (U.S.)

  19. Work plan for vibration cable re-route and water flush system modifications for 107-AN mixer pump

    International Nuclear Information System (INIS)

    Leshikar, G.A.

    1995-01-01

    A mixer pump (75 horsepower Hazleton submersible) is to be installed in the central pump pit of Double-Shell Tank 241-AN-107 for the Caustic Addition Project. The mixer pump will be used as a platform to inject, mix, and entrain caustic with the waste, in order to bring the waste hydroxyl ion concentration into compliance with Tank Farm operating specifications. Testing of the mixer pump and caustic addition system revealed that the mixer pump's vibration cable picks up electromagnetic interference from the motor power cable during variable speed operation of the pump. Also, it was noted that the mixer pump's water flush system may not be as effective as desired. Ergo this work plan for improving the operation of these mixer pump subsystems. A new vibration cable shall be routed entirely outside the mixer pump support column pipe, up thru a new penetration in the pump mounting flange. The existing penetration in the side of the pipe is to be plugged. Increasing the distance between power and instrument cables may reduce or eliminate electromagnetic interference to the vibration monitor. The mixer pump water flush system shall be modified to allow pressure isolation of individual branches. A header is to be installed on the middle section of the support column. Each branch (there are three) shall contain a solenoid valve (normally open) to control flow into the branch. The solenoid cables shall be routed up thru three new penetrations in the pump mounting flange to a new electrical box mounted on the flange. The existing flush piping to the inlet screen will remain but the continuation of the flush piping to the pump discharge nozzles is to be removed and the tee plugged. New stainless steel tubing is to be run down to the pump discharge nozzles. Pressure isolation of individual branches will maximize the flush system's effectiveness at blasting potential sediment clogs out of the pump discharge nozzles

  20. Dicty_cDB: SHL102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL102 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - SHL102Z 634 - - - - Show SHL102 Library SH (Link to library) Clone ID SHL102 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...TCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*...A FSTCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*kkiklnnk Frame C: ---lk