WorldWideScience

Sample records for mejc.sums.ac.ir

  1. Combined IR-Raman vs vibrational sum-frequency heterospectral correlation spectroscopy

    Science.gov (United States)

    Roy, Sandra; Beutier, Clémentine; Hore, Dennis K.

    2018-06-01

    Vibrational sum-frequency generation spectroscopy is a valuable probe of surface structure, particularly when the same molecules are present in one of the adjacent bulk solid or solution phases. As a result of the non-centrosymmetric requirement of SFG, the signal generated is a marker of the extent to which the molecules are ordered in an arrangement that breaks the up-down symmetry at the surface. In cases where the accompanying changes in the bulk are of interest in understanding and interpreting the surface structure, simultaneous analysis of the bulk IR absorption or bulk Raman scattering is helpful, and may be used in heterospectral surface-bulk two-dimensional correlation. We demonstrate that, in such cases, generating a new type of bulk spectrum that combines the IR and Raman amplitudes is a better candidate than the individual IR and Raman spectra for the purpose of correlation with the SFG signal.

  2. Application of a flow generated by IR laser and AC electric field in micropumping and micromixing

    International Nuclear Information System (INIS)

    Nakano, M; Mizuno, A

    2008-01-01

    In this paper, it is described that measurement of fluid flow generated by simultaneous operation of an infrared (IR) laser and AC electric field in a microfabricated channel. When an IR laser (1026 nm) was focused under an intense AC electric field, a circulating flow was generated around the laser focus. The IR laser and the electric field generate two flow patterns of the electrohydrodynamicss. When the laser focus is placed at the center of the gap between electrodes, the flow pattern is parallel to the AC electric field toward electrodes from the centre. On the other hand, when the laser focus is placed close to one of the electrodes, one directional flow is generated. First flow pattern can be used as a micromixer and the second one as a micropump. Flow velocity profiles of the two flow patterns were measured as a function of the laser power, intensity of the AC electric field and AC frequency.

  3. An AMOLED AC-Biased Pixel Design Compensating the Threshold Voltage and I-R Drop

    Directory of Open Access Journals (Sweden)

    Ching-Lin Fan

    2011-01-01

    Full Text Available We propose a novel pixel design and an AC bias driving method for active-matrix organic light-emitting diode (AM-OLED displays using low-temperature polycrystalline silicon thin-film transistors (LTPS-TFTs. The proposed threshold voltage and I-R drop compensation circuit, which comprised three transistors and one capacitor, have been verified to supply uniform output current by simulation work using the Automatic Integrated Circuit Modeling Simulation Program with Integrated Circuit Emphasis (AIM-SPICE simulator. The simulated results demonstrate excellent properties such as low error rate of OLED anode voltage variation (<0.7% and low voltage drop of VDD power line. The proposed pixel circuit effectively enables threshold-voltage-deviation correction of driving TFT and compensates for the voltage drop of VDD power line using AC bias on OLED cathode.

  4. THE HST EXTREME DEEP FIELD (XDF): COMBINING ALL ACS AND WFC3/IR DATA ON THE HUDF REGION INTO THE DEEPEST FIELD EVER

    International Nuclear Information System (INIS)

    Illingworth, G. D.; Magee, D.; Oesch, P. A.; Bouwens, R. J.; Labbé, I.; Franx, M.; Stiavelli, M.; Van Dokkum, P. G.; Trenti, M.; Carollo, C. M.; Gonzalez, V.

    2013-01-01

    The eXtreme Deep Field (XDF) combines data from 10 years of observations with the Hubble Space Telescope Advanced Camera for Surveys (ACS) and the Wide-Field Camera 3 Infra-Red (WFC3/IR) into the deepest image of the sky ever in the optical/near-IR. Since the initial observations of the Hubble Ultra-Deep Field (HUDF) in 2003, numerous surveys and programs, including supernovae follow-up, HUDF09, CANDELS, and HUDF12, have contributed additional imaging data across this region. However, these images have never been combined and made available as one complete ultra-deep image dataset. We combine them now with the XDF program. Our new and improved processing techniques provide higher quality reductions of the total dataset. All WFC3/IR and optical ACS data sets have been fully combined and accurately matched, resulting in the deepest imaging ever taken at these wavelengths, ranging from 29.1 to 30.3 AB mag (5σ in a 0.''35 diameter aperture) in 9 filters. The combined image therefore reaches to 31.2 AB mag 5σ (32.9 at 1σ) for a flat f ν source. The gains in the optical for the four filters done in the original ACS HUDF correspond to a typical improvement of 0.15 mag, with gains of 0.25 mag in the deepest areas. Such gains are equivalent to adding ∼130 to ∼240 orbits of ACS data to the HUDF. Improved processing alone results in a typical gain of ∼0.1 mag. Our 5σ (optical+near-IR) SExtractor catalogs reveal about 14,140 sources in the full field and about 7121 galaxies in the deepest part of the XDF

  5. Sum Rules, Classical and Quantum - A Pedagogical Approach

    Science.gov (United States)

    Karstens, William; Smith, David Y.

    2014-03-01

    Sum rules in the form of integrals over the response of a system to an external probe provide general analytical tools for both experiment and theory. For example, the celebrated f-sum rule gives a system's plasma frequency as an integral over the optical-dipole absorption spectrum regardless of the specific spectral distribution. Moreover, this rule underlies Smakula's equation for the number density of absorbers in a sample in terms of the area under their absorption bands. Commonly such rules are derived from quantum-mechanical commutation relations, but many are fundamentally classical (independent of ℏ) and so can be derived from more transparent mechanical models. We have exploited this to illustrate the fundamental role of inertia in the case of optical sum rules. Similar considerations apply to sum rules in many other branches of physics. Thus, the ``attenuation integral theorems'' of ac circuit theory reflect the ``inertial'' effect of Lenz's Law in inductors or the potential energy ``storage'' in capacitors. These considerations are closely related to the fact that the real and imaginary parts of a response function cannot be specified independently, a result that is encapsulated in the Kramers-Kronig relations. Supported in part by the US Department of Energy, Office of Nuclear Physics under contract DE-AC02-06CH11357.

  6. A conformation-selective IR-UV study of the dipeptides Ac-Phe-Ser-NH2 and Ac-Phe-Cys-NH2: probing the SH···O and OH···O hydrogen bond interactions.

    Science.gov (United States)

    Yan, Bin; Jaeqx, Sander; van der Zande, Wim J; Rijs, Anouk M

    2014-06-14

    The conformational preferences of peptides are mainly controlled by the stabilizing effect of intramolecular interactions. In peptides with polar side chains, not only the backbone but also the side chain interactions determine the resulting conformations. In this paper, the conformational preferences of the capped dipeptides Ac-Phe-Ser-NH2 (FS) and Ac-Phe-Cys-NH2 (FC) are resolved under laser-desorbed jet cooling conditions using IR-UV ion dip spectroscopy and density functional theory (DFT) quantum chemistry calculations. As serine (Ser) and cysteine (Cys) only differ in an OH (Ser) or SH (Cys) moiety; this subtle alteration allows us to study the effect of the difference in hydrogen bonding for an OH and SH group in detail, and its effect on the secondary structure. IR absorption spectra are recorded in the NH stretching region (3200-3600 cm(-1)). In combination with quantum chemical calculations the spectra provide a direct view of intramolecular interactions. Here, we show that both FS as FC share a singly γ-folded backbone conformation as the most stable conformer. The hydrogen bond strength of OH···O (FS) is stronger than that of SH···O (FC), resulting in a more compact gamma turn structure. A second conformer is found for FC, showing a β turn interaction.

  7. ACS experiment for atmospheric studies on "ExoMars-2016" Orbiter

    Science.gov (United States)

    Korablev, O. I.; Montmessin, F.; Fedorova, A. A.; Ignatiev, N. I.; Shakun, A. V.; Trokhimovskiy, A. V.; Grigoriev, A. V.; Anufreichik, K. A.; Kozlova, T. O.

    2015-12-01

    ACS is a set of spectrometers for atmospheric studies (Atmospheric Chemistry Suite). It is one of the Russian instruments for the Trace Gas Orbiter (TGO) of the Russian-European "ExoMars" program. The purpose of the experiment is to study the Martian atmosphere by means of two observations regimes: sensitive trace gases measurements in solar occultations and by monitoring the atmospheric state during nadir observations. The experiment will allow us to approach global problems of Mars research such as current volcanism, and the modern climate status and its evolution. Also, the experiment is intended to solve the mystery of methane presence in the Martian atmosphere. Spectrometers of the ACS set cover the spectral range from the near IR-range (0.7 μm) to the thermal IR-range (17 μm) with spectral resolution λ/Δλ reaching 50000. The ACS instrument consists of three independent IR spectrometers and an electronics module, all integrated in a single unit with common mechanical, electrical and thermal interfaces. The article gives an overview of scientific tasks and presents the concept of the experiment.

  8. AC losses for the various voltage-leads in a semi-triple layer BSCCO conductor

    International Nuclear Information System (INIS)

    Li, Z.; Ryu, K.; Hwang, S.D.; Cha, G.; Song, H.J.

    2011-01-01

    Two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer. Voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The loss from the total-lead significantly differs from the sum of the wire losses. In order to investigate the AC loss of the multilayer conductor in a high temperature superconductor cable, a voltage-lead was generally attached to the outermost layer of the conductor. But the conductor's AC loss has not been completely cleared due to the various contact positions and arrangements of the voltage-lead. In this paper, we prepared a semi-triple layer conductor consisting of an inner layer and an outer layer with double layer structure. To measure the AC loss of the conductor, two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer and arranged along their surfaces, as well as another voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The results show that the AC losses for each layer measured from the inner-lead and the outer-lead, respectively, are identical to the sum of the wire losses. The AC losses in the semi-triple layer conductor measured from the total-lead and the outer-lead are identical for the uniform layer current density, and similar to the sum of the wire losses in both layers. However, the losses measured for the non-uniform layer current density from three voltage-leads are unequal to each other, and the loss from the total-lead significantly differs from the sum of the wire losses.

  9. IR visible sum-frequency vibrational spectroscopy of Biphenyl-3 methylene thiol monolayer on gold and silver: effect of the visible wavelength on the SFG spectrum

    Science.gov (United States)

    Humbert, C.; Dreesen, L.; Mani, A. A.; Caudano, Y.; Lemaire, J.-J.; Thiry, P. A.; Peremans, A.

    2002-04-01

    We measured IR-visible sum-frequency generation spectra of CH 3-(C 6H 4) 2-(CH 2) 3-S-H (Biphenyl-3) self-assembled monolayers on a silver and a gold substrate. For the latter substrate, we observed different interference patterns between the resonant signal of the CH vibration and the non-resonant contribution of the substrate as a function of the visible beam wavelength. The non-linear response of the gold substrate is enhanced around 480 nm corresponding to the s-d interband transition. Such effect is not observed for the silver substrate the interband transition of which is located out of the investigated visible spectral range of 450-700 nm.

  10. Dual role of an ac driving force and the underlying two distinct order–disorder transitions in the vortex phase diagram of Ca3Ir4Sn13

    International Nuclear Information System (INIS)

    Kumar, Santosh; Singh, Ravi P.; Thamizhavel, A.; Tomy, C.V.; Grover, A.K.

    2014-01-01

    Highlights: • This work pertains to new findings related to a broad SMP anomaly. • Broad SMP prima facie encompasses two phase transformations in vortex matter. • We demarcated two phase boundaries pertaining to order–disorder transitions which have quasi first-order nature. - Abstract: We present distinct demarcation of the Bragg glass (BG) to multi-domain vortex glass (VG) transition line and the eventual amorphization of the VG phase in a weakly pinned single crystal of the superconducting compound Ca 3 Ir 4 Sn 13 on the basis of comprehension of the different yields about the second magnetization peak (SMP) anomaly in the dc magnetization and the corresponding anomalous feature in the ac susceptibility measurements. The shaking by a small ac magnetic field, inevitably present in the ac susceptibility measurements, is seen to result in contrasting responses in two different portions of the field-temperature (H, T) phase space of the multi-domain VG. In one of the portions, embracing the BG to VG transition across the onset of the SMP anomaly, the ac drive is surprisingly seen to assist the transformation of the well ordered BG phase to a lesser ordered VG phase. The BG phase exists as a superheated state over a small portion of the VG space and this attests to the first order nature of the BG to VG transition

  11. OGTT results in obese adolescents with normal HOMA-IR values.

    Science.gov (United States)

    Sahin, Nursel Muratoglu; Kinik, Sibel Tulgar; Tekindal, Mustafa Agah

    2013-01-01

    To investigate insulin resistance (IR) with OGTT in obese adolescents who have normal fasting insulin and homeostasis model assessment for insulin resistance (HOMA-IR). A total of 97 obese adolescents who had values of HOMA-IR IR using an insulin peak of ≥150 μU/mL (1041.8 pmol/L) and/or ≥75 μU/mL (520.9 pmol/L) 120 min after glucose charge and the sum of insulin levels >2083.5 pmol/L (300 μU/mL) in OGTT. IR risk factors were defined as family history of diabetes mellitus, acanthosis nigricans (AN), and hepatic steatosis. IR was detected in 61 (62.9%) patients. The IR group had significantly more frequent AN (p=0.0001). As the number of risk factors increased, the frequency of IR also increased (p=0.01). We advise to perform OGTT in obese adolescents with normal HOMA-IR, if they have risk factors for IR.

  12. Sum frequency generation for surface vibrational spectroscopy

    International Nuclear Information System (INIS)

    Hunt, J.H.; Guyot-Sionnest, P.; Shen, Y.R.

    1987-01-01

    Surface vibrational spectroscopy is one of the best means for characterizing molecular adsorbates. For this reason, many techniques have been developed in the past. However, most of them suffer from poor sensitivity, low spectral and temporal resolution, and applications limited to vacuum solid interfaces. Recently, the second harmonic generation (SHG) technique was proved repeatedly to be a simple but versatile surface probe. It is highly sensitive and surface specific; it is also capable of achieving high temporal, spatial, and spectral resolution. Being an optical technique, it can be applied to any interface accessible by light. The only serious drawback is its lack of molecular selectivity. An obvious remedy is the extension of the technique to IR-visible sum frequency generation (SFG). Surface vibrational spectroscopy with submonolayer sensitivity is then possible using SFG with the help of a tunable IR laser. The authors report here an SFG measurement of the C-H stretch vibration of monolayers of molecules at air-solid and air-liquid interfaces

  13. Dual role of an ac driving force and the underlying two distinct order–disorder transitions in the vortex phase diagram of Ca{sub 3}Ir{sub 4}Sn{sub 13}

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Santosh, E-mail: santoshkumar@phy.iitb.ac.in [Department of Physics, Indian Institute of Technology Bombay, Mumbai 400076 (India); Singh, Ravi P.; Thamizhavel, A. [Department of Condensed Matter Physics and Materials Science, Tata Institute of Fundamental Research, Mumbai 400005 (India); Tomy, C.V., E-mail: tomy@phy.iitb.ac.in [Department of Physics, Indian Institute of Technology Bombay, Mumbai 400076 (India); Grover, A.K. [Department of Condensed Matter Physics and Materials Science, Tata Institute of Fundamental Research, Mumbai 400005 (India); Department of Physics, Panjab University, Chandigarh 160014 (India)

    2014-11-15

    Highlights: • This work pertains to new findings related to a broad SMP anomaly. • Broad SMP prima facie encompasses two phase transformations in vortex matter. • We demarcated two phase boundaries pertaining to order–disorder transitions which have quasi first-order nature. - Abstract: We present distinct demarcation of the Bragg glass (BG) to multi-domain vortex glass (VG) transition line and the eventual amorphization of the VG phase in a weakly pinned single crystal of the superconducting compound Ca{sub 3}Ir{sub 4}Sn{sub 13} on the basis of comprehension of the different yields about the second magnetization peak (SMP) anomaly in the dc magnetization and the corresponding anomalous feature in the ac susceptibility measurements. The shaking by a small ac magnetic field, inevitably present in the ac susceptibility measurements, is seen to result in contrasting responses in two different portions of the field-temperature (H, T) phase space of the multi-domain VG. In one of the portions, embracing the BG to VG transition across the onset of the SMP anomaly, the ac drive is surprisingly seen to assist the transformation of the well ordered BG phase to a lesser ordered VG phase. The BG phase exists as a superheated state over a small portion of the VG space and this attests to the first order nature of the BG to VG transition.

  14. Measurement of IR optics with linear coupling's action-angle parametrization

    Science.gov (United States)

    Luo, Y.; Bai, M.; Pilat, F.; Satogata, T.; Trbojevic, D.

    2005-08-01

    Linear coupling’s action-angle parametrization is convenient for interpretation of turn-by-turn beam position monitor (BPM) data. We demonstrate how to apply this parametrization to extract Twiss and coupling parameters in interaction regions (IRs), using BPMs on each side of a long IR drift region. Example data were acquired at the Relativistic Heavy Ion Collider, using an ac dipole to excite a single transverse eigenmode. We have measured the waist of the β function and its Twiss and coupling parameters.

  15. Lower Bounds for Circuits with Few Modular Gates using Exponential Sums

    DEFF Research Database (Denmark)

    Hansen, Kristoffer Arnsfelt

    2006-01-01

    We prove that any AC0 circuit augmented with {epsilon log2 n} MODm gates and with a MAJORITY gate at the output, require size nOmega(log n) to compute MODl, when l has a prime factor not dividing m and epsilon is sufficiently small. We also obtain that the MOD2 function is hard on the average for...... gates. Our results are based on recent bounds of exponential sums that were previously introduced for proving lower bounds for MAJ o MODm o ANDd circuits....

  16. Ar ir CO2 plazma modifikuota aktyvintoji anglis acetono ir cikloheksano adsorbcijai

    Directory of Open Access Journals (Sweden)

    Piotr PIETROWSKI

    2012-06-01

    Full Text Available Žemos temperatūros plazmos poveikis, leidžiantis valdyti daugelio rūšių medžiagų, pvz., polimerų, metalų, anglies, paviršiaus savybes, šiuo metu yra tiriamas daugelyje mokslo sričių. Aktyvintoji  anglis (AC dėl savo fizikinių ir cheminių savybių naudojama kaip struktūrinis elementas dujų filtruose, kurie adsorbuodami daugelį skirtingų garų iš užteršto oro apsaugo kvėpavimo takus. Gerai žinoma, kad įvairios AC paviršiaus funkcinės grupės lemia jų hidrofobinę / hidrofilinę elgseną. Šame straipsnyje pristatomi pirminiai tyrimai, susiję su žemos temperatūros plazmos poveikiu komercinei aktyvintajai angliai. Aktyvintoji anglis buvo granuliuojama ir dedama į žemos temperatūros plazmos  rotacinę bandymų kamerą. Kamera buvo užpildoma atitinkamomis reaktyviosiomis dujomis. Plazmos poveikis buvo tiriamas nustatant aktyvintosios anglies paviršiaus dviejų pasirinktų rūšių organinių garų adsorbcijos izotermas, taip pat stebint šių garų adsorbcijos dinamiką ant dujų filtro, pagaminto iš plazma aktyvintos anglies. Remiantis gautais rezultatais, galima daryti išvadą, kad žemos temperatūros plazmos technologija gali būti taikoma aktyvintosios anglies savybėms pagerinti užtikrinant geresnę žemos temperatūros organinių garų adsorbciją.DOI: http://dx.doi.org/10.5755/j01.ms.18.2.1919

  17. Measurement of IR optics with linear coupling’s action-angle parametrization

    Directory of Open Access Journals (Sweden)

    Y. Luo

    2005-08-01

    Full Text Available Linear coupling’s action-angle parametrization is convenient for interpretation of turn-by-turn beam position monitor (BPM data. We demonstrate how to apply this parametrization to extract Twiss and coupling parameters in interaction regions (IRs, using BPMs on each side of a long IR drift region. Example data were acquired at the Relativistic Heavy Ion Collider, using an ac dipole to excite a single transverse eigenmode. We have measured the waist of the β function and its Twiss and coupling parameters.

  18. Synthesis of oxindole from acetanilide via Ir(iii)-catalyzed C-H carbenoid functionalization.

    Science.gov (United States)

    Patel, Pitambar; Borah, Gongutri

    2016-12-22

    Herein we disclose the first report on the synthesis of oxindole derivatives from acetanilide via Ir(iii)-catalyzed intermolecular C-H functionalization with diazotized Meldrum's acid. A broad range of substituted anilides were found to react smoothly under the Ir(iii)-catalytic system to afford the corresponding N-protected oxindoles. The N-protecting groups, such as Ac, Bz or Piv, can be easily removed to furnish the oxindole. Various synthetic applications of the synthesized oxindole were also demonstrated.

  19. Electronuclear sum rules

    International Nuclear Information System (INIS)

    Arenhoevel, H.; Drechsel, D.; Weber, H.J.

    1978-01-01

    Generalized sum rules are derived by integrating the electromagnetic structure functions along lines of constant ratio of momentum and energy transfer. For non-relativistic systems these sum rules are related to the conventional photonuclear sum rules by a scaling transformation. The generalized sum rules are connected with the absorptive part of the forward scattering amplitude of virtual photons. The analytic structure of the scattering amplitudes and the possible existence of dispersion relations have been investigated in schematic relativistic and non-relativistic models. While for the non-relativistic case analyticity does not hold, the relativistic scattering amplitude is analytical for time-like (but not for space-like) photons and relations similar to the Gell-Mann-Goldberger-Thirring sum rule exist. (Auth.)

  20. Composite Finite Sums

    KAUST Repository

    Alabdulmohsin, Ibrahim M.

    2018-03-07

    In this chapter, we extend the previous results of Chap. 2 to the more general case of composite finite sums. We describe what composite finite sums are and how their analysis can be reduced to the analysis of simple finite sums using the chain rule. We apply these techniques, next, on numerical integration and on some identities of Ramanujan.

  1. Composite Finite Sums

    KAUST Repository

    Alabdulmohsin, Ibrahim M.

    2018-01-01

    In this chapter, we extend the previous results of Chap. 2 to the more general case of composite finite sums. We describe what composite finite sums are and how their analysis can be reduced to the analysis of simple finite sums using the chain rule. We apply these techniques, next, on numerical integration and on some identities of Ramanujan.

  2. Simple Finite Sums

    KAUST Repository

    Alabdulmohsin, Ibrahim M.

    2018-01-01

    We will begin our treatment of summability calculus by analyzing what will be referred to, throughout this book, as simple finite sums. Even though the results of this chapter are particular cases of the more general results presented in later chapters, they are important to start with for a few reasons. First, this chapter serves as an excellent introduction to what summability calculus can markedly accomplish. Second, simple finite sums are encountered more often and, hence, they deserve special treatment. Third, the results presented in this chapter for simple finite sums will, themselves, be used as building blocks for deriving the most general results in subsequent chapters. Among others, we establish that fractional finite sums are well-defined mathematical objects and show how various identities related to the Euler constant as well as the Riemann zeta function can actually be derived in an elementary manner using fractional finite sums.

  3. Simple Finite Sums

    KAUST Repository

    Alabdulmohsin, Ibrahim M.

    2018-03-07

    We will begin our treatment of summability calculus by analyzing what will be referred to, throughout this book, as simple finite sums. Even though the results of this chapter are particular cases of the more general results presented in later chapters, they are important to start with for a few reasons. First, this chapter serves as an excellent introduction to what summability calculus can markedly accomplish. Second, simple finite sums are encountered more often and, hence, they deserve special treatment. Third, the results presented in this chapter for simple finite sums will, themselves, be used as building blocks for deriving the most general results in subsequent chapters. Among others, we establish that fractional finite sums are well-defined mathematical objects and show how various identities related to the Euler constant as well as the Riemann zeta function can actually be derived in an elementary manner using fractional finite sums.

  4. IR OPTICS MEASUREMENT WITH LINEAR COUPLING'S ACTION-ANGLE PARAMETERIZATION

    International Nuclear Information System (INIS)

    LUO, Y.; BAI, M.; PILAT, R.; SATOGATA, T.; TRBOJEVIC, D.

    2005-01-01

    A parameterization of linear coupling in action-angle coordinates is convenient for analytical calculations and interpretation of turn-by-turn (TBT) beam position monitor (BPM) data. We demonstrate how to use this parameterization to extract the twiss and coupling parameters in interaction regions (IRs), using BPMs on each side of the long IR drift region. The example of TBT BPM analysis was acquired at the Relativistic Heavy Ion Collider (RHIC), using an AC dipole to excite a single eigenmode. Besides the full treatment, a fast estimate of beta*, the beta function at the interaction point (IP), is provided, along with the phase advance between these BPMs. We also calculate and measure the waist of the beta function and the local optics

  5. ac impedance, DSC and FT-IR investigations on (x)PVAc-(1 - x)PVdF blends with LiClO4

    International Nuclear Information System (INIS)

    Baskaran, R.; Selvasekarapandian, S.; Kuwata, N.; Kawamura, J.; Hattori, T.

    2006-01-01

    The blended polymer electrolytes comprising poly(vinyl acetate) (PVAc)-poly(vinylidene fluoride) (PVdF) have been prepared for different blend composition with constant lithium perchlorate (LiClO 4 ) ratio by solution casting technique. The formation of the blend polymer electrolyte complex has been confirmed by FT-IR spectroscopy analysis. DSC analysis has been performed in order to observe the change in transition temperature that is caused by the blending of polymers and addition of LiClO 4 . The ac impedance and dielectric spectroscopy studies are carried out on the blended matrix to identify the optimized blend composition, which is having high ionic conductivity. The temperature dependence of conductivity of the polymer electrolytes is found to follow VTF type equation. The high ionic conductivity of 6.4 x 10 -4 S cm -1 at 343 K has been observed for blended polymer electrolyte having blend ratio 75:25 (PVAc:PVdF). The ionic transference number of mobile ions has been estimated by Wagner's polarization method and the value is reported to be t ion is 0.95-0.98 for all the blended samples. The modulus spectra reveal the non-Debye nature and distribution of relaxation times of the samples. The dielectric spectra show the low frequency dispersion, which implies the space charge effects arising from the electrodes

  6. Expansion around half-integer values, binomial sums, and inverse binomial sums

    International Nuclear Information System (INIS)

    Weinzierl, Stefan

    2004-01-01

    I consider the expansion of transcendental functions in a small parameter around rational numbers. This includes in particular the expansion around half-integer values. I present algorithms which are suitable for an implementation within a symbolic computer algebra system. The method is an extension of the technique of nested sums. The algorithms allow in addition the evaluation of binomial sums, inverse binomial sums and generalizations thereof

  7. A New Sum Analogous to Gauss Sums and Its Fourth Power Mean

    Directory of Open Access Journals (Sweden)

    Shaofeng Ru

    2014-01-01

    Full Text Available The main purpose of this paper is to use the analytic methods and the properties of Gauss sums to study the computational problem of one kind of new sum analogous to Gauss sums and give an interesting fourth power mean and a sharp upper bound estimate for it.

  8. Monolayers of gold nanostars with two Near-IR LSPR capable of additive photothermal response

    KAUST Repository

    Pallavicini, Piersandro

    2015-07-06

    Monolayers of photothermally responsive gold nanostars on PEI-coated surfaces display two Localized Surface Plasmon Resonances (LSPR) in the near-IR region that can be laser-irradiated either separately, obtaining two different T jumps, or simultaneously, obtaining a T jump equal to the sum of what obtained with separate irradiations

  9. Monolayers of gold nanostars with two Near-IR LSPR capable of additive photothermal response

    KAUST Repository

    Pallavicini, Piersandro; Basile, Simone; Chirico, Giuseppe; Dacarro, Giacomo; D'Alfonso, Laura; Donà , Alice; Patrini, Maddalena; Falqui, Andrea; Sironi, Laura; Taglietti, Angelo

    2015-01-01

    Monolayers of photothermally responsive gold nanostars on PEI-coated surfaces display two Localized Surface Plasmon Resonances (LSPR) in the near-IR region that can be laser-irradiated either separately, obtaining two different T jumps, or simultaneously, obtaining a T jump equal to the sum of what obtained with separate irradiations

  10. The Cryogenic Anti-Coincidence detector for ATHENA X-IFU: pulse analysis of the AC-S7 single pixel prototype

    Science.gov (United States)

    D'Andrea, M.; Argan, A.; Lotti, S.; Macculi, C.; Piro, L.; Biasotti, M.; Corsini, D.; Gatti, F.; Torrioli, G.

    2016-07-01

    The ATHENA observatory is the second large-class mission in ESA Cosmic Vision 2015-2025, with a launch foreseen in 2028 towards the L2 orbit. The mission addresses the science theme "The Hot and Energetic Universe", by coupling a high-performance X-ray Telescope with two complementary focal-plane instruments. One of these is the X-ray Integral Field Unit (X-IFU): it is a TES based kilo-pixel order array able to provide spatially resolved high-resolution spectroscopy (2.5 eV at 6 keV) over a 5 arcmin FoV. The X-IFU sensitivity is degraded by the particles background expected at L2 orbit, which is induced by primary protons of both galactic and solar origin, and mostly by secondary electrons. To reduce the background level and enable the mission science goals, a Cryogenic Anticoincidence (CryoAC) detector is placed address the final design of the CryoAC. It will verify some representative requirements at single-pixel level, especially the detector operation at 50 mK thermal bath and the threshold energy at 20 keV. To reach the final DM design we have developed and tested the AC-S7 prototype, with 1 cm2 absorber area sensed by 65 Ir TESes. Here we will discuss the pulse analysis of this detector, which has been illuminated by the 60 keV line from a 241Am source. First, we will present the analysis performed to investigate pulses timings and spectrum, and to disentangle the athermal component of the pulses from the thermal one. Furthermore, we will show the application to our dataset of an alternative method of pulse processing, based upon Principal Component Analysis (PCA). This kind of analysis allow us to recover better energy spectra than achievable with traditional methods, improving the evaluation of the detector threshold energy, a fundamental parameter characterizing the CryoAC particle rejection efficiency.

  11. E-Learning in Type I Midecal Uneversites of Iran

    Directory of Open Access Journals (Sweden)

    A Mohammadi

    2009-06-01

    Full Text Available Background and purpose: Changes in medicine and medical education has yield to employment of new teaching methods and a shift to more student centered strategies in education. E-learning is one of these methods that can be used with greater flexibility and has the potential to enhance medical education. For our universities, using e-learning strategies in current curricula and continuous education is an inevitable issue and universities have begun their way in this era.Methods: we reviewed the websites of 9 type 1 Iranian universities of medical sciences including Ahvaz (http://ajums.ac.ir,Iran(http://www.iums.ac.ir,Isfahan(http://www.mui.ac.ir,Kerman(http://www.kmu.ac.ir,Mashad(http://www.mums.ac.irShahidBeheshti (http://www.sbmu.ac.ir, Shiraz (http://www.sums.ac.ir, Tabriz (http://www.tbzmed.ac.ir and Tehran (http://www.tums.ac.iruniversities of medical sciences.We tried to access these sites twice per week for two weeks. Two of the authors performed the search within these sites separately as follows: the homepages’ main menus were reviewed to find links to any kind of e-learning activity. This was done for the homepages of vice-chancellors of education too.Then if the site had a search option, the keywords of “e-learning”, “blended learning” and “electronic learning” were searched both in English and Persian. Then existing e-learning activities were assessed according to formal site utilization, providing interactive content, registration option for students and faculties and tracking option for students’ activities. The results of two authors were compared to reach a consensus.Results: Among these 8 universities, there was just one straight link to distance learning office in Shiraz University of Medical Sciences’ website and a link to online continuous medical education in Tehran University of Medical Sciences’ website. Others had no link for an office or a kind ofe-learning activity in their homepages.Conclusion: We

  12. A sum-over-paths algorithm for third-order impulse-response moment extraction within RC IC-interconnect networks

    Science.gov (United States)

    Wojcik, E. A.; Ni, D.; Lam, T. M.; Le Coz, Y. L.

    2015-07-01

    We have created the first stochastic SoP (Sum-over-Paths) algorithm to extract third-order impulse-response (IR) moment within RC IC interconnects. It employs a newly discovered Feynman SoP Postulate. Importantly, our algorithm maintains computational efficiency and full parallelism. Our approach begins with generation of s-domain nodal-voltage equations. We then perform a Taylor-series expansion of the circuit transfer function. These expansions yield transition diagrams involving mathematical coupling constants, or weight factors, in integral powers of complex frequency s. Our SoP Postulate enables stochastic evaluation of path sums within the circuit transition diagram to order s3-corresponding to the order of IR moment (m3) we seek here. We furnish, for the first time, an informal algebraic proof independently validating our SoP Postulate and algorithm. We list, as well, detailed procedural steps, suitable for coding, that define an efficient stochastic algorithm for m3 IR extraction. Origins of the algorithm's statistical "capacitor-number cubed" correction and "double-counting" weight factors are explained, for completeness. Our algorithm was coded and successfully tested against exact analytical solutions for 3-, 5-, and 10-stage RC lines. We achieved better than 0.65% 1-σ error convergence, after only 10K statistical samples, in less than 1 s of 2-GHz Pentium® execution time. These results continue to suggest that stochastic SoP algorithms may find useful application in circuit analysis of massively coupled networks, such as those encountered in high-end digital IC-interconnect CAD.

  13. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  14. IL 6: 2D-IR spectroscopy: chemistry and biophysics in real time

    International Nuclear Information System (INIS)

    Bredenbeck, Jens

    2010-01-01

    Pulsed multidimensional experiments, daily business in the field of NMR spectroscopy, have been demonstrated only relatively recently in IR spectroscopy. Similar as nuclear spins in multidimensional NMR, molecular vibrations are employed in multidimensional IR experiments as probes of molecular structure and dynamics, albeit with femtosecond time resolution. Different types of multidimensional IR experiments have been implemented, resembling basic NMR experiments such as NOESY, COSY and EXSY. In contrast to one-dimensional linear spectroscopy, such multidimensional experiments reveal couplings and correlations of vibrations, which are closely linked to molecular structure and its change in time. The use of mixed IR/VIS pulse sequences further extends the potential of multidimensional IR spectroscopy, enabling studies of ultrafast non-equilibrium processes as well as surface specific, highly sensitive experiments. A UV/VIS pulse preceding the IR pulse sequence can be used to prepare the system under study in a non-equilibrium state. 2D-IR snapshots of the evolving non-equilibrium system are then taken, for example during a photochemical reaction or during the photo-cycle of a light sensitive protein. Preparing the system in a non-equilibrium state by UV/Vis excitation during the IR pulse sequence allows for correlating states of reactant and product of the light triggered process via their 2D-IR cross peaks - a technique that has been used to map the connectivity between different binding sites of a ligand as it migrates through a protein. Introduction of a non-resonant VIS pulse at the end of the IR part of the experiment allows to selectively up-convert the infrared signal of interfacial molecules to the visible spectral range by sum frequency generation. In this way, femtosecond interfacial 2D-IR spectroscopy can be implemented, achieving sub-monolayer sensitivity. (author)

  15. Selecting Sums in Arrays

    DEFF Research Database (Denmark)

    Brodal, Gerth Stølting; Jørgensen, Allan Grønlund

    2008-01-01

    In an array of n numbers each of the \\binomn2+nUnknown control sequence '\\binom' contiguous subarrays define a sum. In this paper we focus on algorithms for selecting and reporting maximal sums from an array of numbers. First, we consider the problem of reporting k subarrays inducing the k largest...... sums among all subarrays of length at least l and at most u. For this problem we design an optimal O(n + k) time algorithm. Secondly, we consider the problem of selecting a subarray storing the k’th largest sum. For this problem we prove a time bound of Θ(n · max {1,log(k/n)}) by describing...... an algorithm with this running time and by proving a matching lower bound. Finally, we combine the ideas and obtain an O(n· max {1,log(k/n)}) time algorithm that selects a subarray storing the k’th largest sum among all subarrays of length at least l and at most u....

  16. Investigation of Ir-modified carbon felt as the positive electrode of an all-vanadium redox flow battery

    International Nuclear Information System (INIS)

    Wang, W.H.; Wang, X.D.

    2007-01-01

    Porous graphite felts have been used as electrode materials for all-vanadium redox flow batteries due to their wide operating potential range, stability as both an anode and a cathode, and availability in high surface area. In this paper, the carbon felt was modified by pyrolysis of Ir reduced from H 2 IrCl 6 . ac impedance and steady-state polarization measurements showed that the Ir-modified materials have improved activity and lowered overpotential of the desired V(IV)/V(V) redox process. Ir-modification of carbon felt enhanced the electro-conductivity of electrode materials. The Ir-material, when coated on the graphite felt electrode surface, lowered the cell internal resistance. A test cell was assembled with the Ir-modified carbon felt as the activation layer of the positive electrode, the unmodified raw felt as the activation layer of the negative electrode. At an operating current density of 20 mA cm -2 , a voltage efficiency of 87.5% was achieved. The resistance of the cell using Ir-modified felt decreased 25% compared to the cell using non-modified felt

  17. Zero-Sum Flows in Designs

    International Nuclear Information System (INIS)

    Akbari, S.; Khosrovshahi, G.B.; Mofidi, A.

    2010-07-01

    Let D be a t-(v, k, λ) design and let N i (D), for 1 ≤ i ≤ t, be the higher incidence matrix of D, a (0, 1)-matrix of size (v/i) x b, where b is the number of blocks of D. A zero-sum flow of D is a nowhere-zero real vector in the null space of N 1 (D). A zero-sum k-flow of D is a zero-sum flow with values in {±,...,±(k-1)}. In this paper we show that every non-symmetric design admits an integral zero-sum flow, and consequently we conjecture that every non-symmetric design admits a zero-sum 5-flow. Similarly, the definition of zero-sum flow can be extended to N i (D), 1 ≤ i ≤ t. Let D = t-(v,k, (v-t/k-t)) be the complete design. We conjecture that N t (D) admits a zero-sum 3-flow and prove this conjecture for t = 2. (author)

  18. Small sum privacy and large sum utility in data publishing.

    Science.gov (United States)

    Fu, Ada Wai-Chee; Wang, Ke; Wong, Raymond Chi-Wing; Wang, Jia; Jiang, Minhao

    2014-08-01

    While the study of privacy preserving data publishing has drawn a lot of interest, some recent work has shown that existing mechanisms do not limit all inferences about individuals. This paper is a positive note in response to this finding. We point out that not all inference attacks should be countered, in contrast to all existing works known to us, and based on this we propose a model called SPLU. This model protects sensitive information, by which we refer to answers for aggregate queries with small sums, while queries with large sums are answered with higher accuracy. Using SPLU, we introduce a sanitization algorithm to protect data while maintaining high data utility for queries with large sums. Empirical results show that our method behaves as desired. Copyright © 2014 Elsevier Inc. All rights reserved.

  19. AC Initiation System.

    Science.gov (United States)

    An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

  20. Out-of-equilibrium fluctuation-dissipation relations verified by the electrical and thermoelectrical AC-conductances in a quantum dot

    Energy Technology Data Exchange (ETDEWEB)

    Crepieux, Adeline [Aix Marseille Univ., Universite de Toulon, CNRS, CPT, Marseille (France)

    2017-09-15

    The electrical and heat currents flowing through a quantum dot are calculated in the presence of a time-modulated gate voltage with the help of the out-of-equilibrium Green function technique. From the first harmonics of the currents, we extract the electrical and thermoelectrical trans-admittances and ac-conductances. Next, by a careful comparison of the ac-conductances with the finite-frequency electrical and mixed electrical-heat noises, we establish the fluctuation-dissipation relations linking these quantities, which are thus generalized out-of-equilibrium for a quantum system. It is shown that the electrical ac-conductance associated to the displacement current is directly linked to the electrical noise summed over reservoirs, whereas the relation between the thermoelectrical ac-conductance and the mixed noise contains an additional term proportional to the energy step that the electrons must overcome when traveling through the junction. A numerical study reveals however that a fluctuation-dissipation relation involving a single reservoir applies for both electrical and thermoelectrical ac-conductances when the frequency dominates over the other characteristic energies. (copyright 2017 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  1. Study on ac losses of HTS coil carrying ac transport current

    International Nuclear Information System (INIS)

    Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

    2005-01-01

    Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

  2. Multi-phase AC/AC step-down converter for distribution systems

    Science.gov (United States)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  3. Structure, properties, and disorder in the new distorted-Hollandite PbIr{sub 4}Se{sub 8}

    Energy Technology Data Exchange (ETDEWEB)

    Trump, Benjamin A., E-mail: btrump1@jhu.edu [Department of Chemistry, Johns Hopkins University, Baltimore, MD 21218 (United States); Department of Physics and Astronomy, Institute for Quantum Matter, Johns Hopkins University, Baltimore, MD 21218 (United States); McQueen, Tyrel M., E-mail: mcqueen@jhu.edu [Department of Chemistry, Johns Hopkins University, Baltimore, MD 21218 (United States); Department of Physics and Astronomy, Institute for Quantum Matter, Johns Hopkins University, Baltimore, MD 21218 (United States); Department of Material Science and Engineering, Johns Hopkins University, Baltimore, MD 21218 (United States)

    2016-10-15

    The synthesis and physical properties of the new distorted-Hollandite PbIr{sub 4}Se{sub 8} are reported. Powder X-ray diffraction and transmission electron microscopy show that the structure consists of edge- and corner-sharing IrSe{sub 6} octahedra, with one-dimensional channels occupied by Pb. The structure contains Se-Se anion-anion bonding, leading to an electron count of Pb{sup 2+}(Ir{sup 3+}){sub 4}(Se{sub 2}){sup 2-}(Se{sup 2−}){sub 6}, confirmed by bond-valence sums and diamagnetic behavior. Structural and heat capacity measurements demonstrate disorder on the Pb site, due to the combination of lone-pair effects and the large size of the one-dimensional channels. Comparisons are made to known Hollandite and pseudo-Hollandite structures, which demonstrates that the anion-anion bonding in PbIr{sub 4}Se{sub 8} distorts its structure, to accommodate the Ir{sup 3+} state. An electronic structure calculation indicates semiconductor character with a band gap of 0.76(11) eV.

  4. Sums and Gaussian vectors

    CERN Document Server

    Yurinsky, Vadim Vladimirovich

    1995-01-01

    Surveys the methods currently applied to study sums of infinite-dimensional independent random vectors in situations where their distributions resemble Gaussian laws. Covers probabilities of large deviations, Chebyshev-type inequalities for seminorms of sums, a method of constructing Edgeworth-type expansions, estimates of characteristic functions for random vectors obtained by smooth mappings of infinite-dimensional sums to Euclidean spaces. A self-contained exposition of the modern research apparatus around CLT, the book is accessible to new graduate students, and can be a useful reference for researchers and teachers of the subject.

  5. Using Squares to Sum Squares

    Science.gov (United States)

    DeTemple, Duane

    2010-01-01

    Purely combinatorial proofs are given for the sum of squares formula, 1[superscript 2] + 2[superscript 2] + ... + n[superscript 2] = n(n + 1) (2n + 1) / 6, and the sum of sums of squares formula, 1[superscript 2] + (1[superscript 2] + 2[superscript 2]) + ... + (1[superscript 2] + 2[superscript 2] + ... + n[superscript 2]) = n(n + 1)[superscript 2]…

  6. Impaired Insulin Signaling is Associated with Hepatic Mitochondrial Dysfunction in IR+/−-IRS-1+/− Double Heterozygous (IR-IRS1dh Mice

    Directory of Open Access Journals (Sweden)

    Andras Franko

    2017-05-01

    Full Text Available Mitochondria play a pivotal role in energy metabolism, but whether insulin signaling per se could regulate mitochondrial function has not been identified yet. To investigate whether mitochondrial function is regulated by insulin signaling, we analyzed muscle and liver of insulin receptor (IR+/−-insulin receptor substrate-1 (IRS-1+/− double heterozygous (IR-IRS1dh mice, a well described model for insulin resistance. IR-IRS1dh mice were studied at the age of 6 and 12 months and glucose metabolism was determined by glucose and insulin tolerance tests. Mitochondrial enzyme activities, oxygen consumption, and membrane potential were assessed using spectrophotometric, respirometric, and proton motive force analysis, respectively. IR-IRS1dh mice showed elevated serum insulin levels. Hepatic mitochondrial oxygen consumption was reduced in IR-IRS1dh animals at 12 months of age. Furthermore, 6-month-old IR-IRS1dh mice demonstrated enhanced mitochondrial respiration in skeletal muscle, but a tendency of impaired glucose tolerance. On the other hand, 12-month-old IR-IRS1dh mice showed improved glucose tolerance, but normal muscle mitochondrial function. Our data revealed that deficiency in IR/IRS-1 resulted in normal or even elevated skeletal muscle, but impaired hepatic mitochondrial function, suggesting a direct cross-talk between insulin signaling and mitochondria in the liver.

  7. Credal Sum-Product Networks

    NARCIS (Netherlands)

    Maua, Denis Deratani; Cozman, Fabio Gagli; Conaty, Diarmaid; de Campos, Cassio P.

    2017-01-01

    Sum-product networks are a relatively new and increasingly popular class of (precise) probabilistic graphical models that allow for marginal inference with polynomial effort. As with other probabilistic models, sum-product networks are often learned from data and used to perform classification.

  8. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  9. Experimental Study on the Influence of AC Stray Current on the Cathodic Protection of Buried Pipe

    Directory of Open Access Journals (Sweden)

    Qingmiao Ding

    2016-01-01

    Full Text Available The size of the damaged area of the coating and its position on the pipeline impacted the cathodic protection potential, and there was a damaged area of the greatest impact value. When damaged area was 300 mm2, the IR drop was the largest, and this situation could easily lead to inadequate protection; when the parallel spacing between pipeline and interference source was unchanged, the measured value curves of cathodic protection potential presented “U” shaped trend with the increasing stray current interference intensity. Under certain parallel spacing between pipeline and interference source, high alternating stray current intensity would cause serious negative offsets, so that the overprotection of the pipeline occurred, and make the coating crack; there was a parallel threshold length. When less than the threshold, the pipe-ground potential increases rapidly with the parallel length increasing. In order to judge whether a pipeline was interference by AC stray current and the risk of stray current corrosion, we should make a comprehensive analysis of the cathodic protection energizing potential, the switch-off potential, AC pipe-soil potential, IR drops, and so on.

  10. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  11. Neutrino mass sum-rule

    Science.gov (United States)

    Damanik, Asan

    2018-03-01

    Neutrino mass sum-rele is a very important research subject from theoretical side because neutrino oscillation experiment only gave us two squared-mass differences and three mixing angles. We review neutrino mass sum-rule in literature that have been reported by many authors and discuss its phenomenological implications.

  12. Sums of squares of integers

    CERN Document Server

    Moreno, Carlos J

    2005-01-01

    Introduction Prerequisites Outline of Chapters 2 - 8 Elementary Methods Introduction Some Lemmas Two Fundamental Identities Euler's Recurrence for Sigma(n)More Identities Sums of Two Squares Sums of Four Squares Still More Identities Sums of Three Squares An Alternate Method Sums of Polygonal Numbers Exercises Bernoulli Numbers Overview Definition of the Bernoulli Numbers The Euler-MacLaurin Sum Formula The Riemann Zeta Function Signs of Bernoulli Numbers Alternate The von Staudt-Clausen Theorem Congruences of Voronoi and Kummer Irregular Primes Fractional Parts of Bernoulli Numbers Exercises Examples of Modular Forms Introduction An Example of Jacobi and Smith An Example of Ramanujan and Mordell An Example of Wilton: t (n) Modulo 23 An Example of Hamburger Exercises Hecke's Theory of Modular FormsIntroduction Modular Group ? and its Subgroup ? 0 (N) Fundamental Domains For ? and ? 0 (N) Integral Modular Forms Modular Forms of Type Mk(? 0(N);chi) and Euler-Poincare series Hecke Operators Dirichlet Series and ...

  13. Adding a dimension to the infrared spectra of interfaces: 2D SFG spectroscopy via mid-IR pulse shaping

    Science.gov (United States)

    Zanni, Martin

    2012-02-01

    Sum-frequency generation spectroscopy provides an infrared spectrum of interfaces and thus has widespread use in the materials and chemical sciences. In this presentation, I will present our recent work in developing a 2D pulse sequence to generate 2D SFG spectra of interfaces, in analogy to 2D infrared spectra used to measure bulk species. To develop this spectroscopy, we have utilized many of the tricks-of-the-trade developed in the 2D IR and 2D Vis communities in the last decade, including mid-IR pulse shaping. With mid-IR pulse shaping, the 2D pulse sequence is manipulated by computer programming in the desired frequency resolution, rotating frame, and signal pathway. We believe that 2D SFG will become an important tool in the interfacial sciences in an analogous way that 2D IR is now being used in many disciplines.

  14. Del cogito, ergo sum, al volo, ergo sum. Influència de la subjectivitat il·lustrada de Kant i la subjectivitat romàntica de Herder en l'evolució de la pedagogia

    OpenAIRE

    Barnola Canales, Quim

    2016-01-01

    El "Cogito ergo sum" ens situa en el racionalisme de Descartes, del qual partiran els il·lustrats amb Immanuel Kant al capdavant. En canvi, el romanticisme amb Herder considera que la raó no és prioritària en la construcció de l'individu, sinó que primer estan els sentits, després la fantasia i en tercer lloc la raó. Heus ací la contraposició entre raó geomètrica i raó dialèctica. A través de l'evolució de la pedagogia es debaten aquests termes fins a arribar als seguidors de l'Escola Nova, q...

  15. Sum rules in classical scattering

    International Nuclear Information System (INIS)

    Bolle, D.; Osborn, T.A.

    1981-01-01

    This paper derives sum rules associated with the classical scattering of two particles. These sum rules are the analogs of Levinson's theorem in quantum mechanics which provides a relationship between the number of bound-state wavefunctions and the energy integral of the time delay of the scattering process. The associated classical relation is an identity involving classical time delay and an integral over the classical bound-state density. We show that equalities between the Nth-order energy moment of the classical time delay and the Nth-order energy moment of the classical bound-state density hold in both a local and a global form. Local sum rules involve the time delay defined on a finite but otherwise arbitrary coordinate space volume S and the bound-state density associated with this same region. Global sum rules are those that obtain when S is the whole coordinate space. Both the local and global sum rules are derived for potentials of arbitrary shape and for scattering in any space dimension. Finally the set of classical sum rules, together with the known quantum mechanical analogs, are shown to provide a unified method of obtaining the high-temperature expansion of the classical, respectively the quantum-mechanical, virial coefficients

  16. Synthesis, characterization and AC conductivity studies of silver doped conducting polyaniline/graphene/SrTiO3 composites

    Science.gov (United States)

    Vinay, K.; Shivakumar, K.; Ravikiran, Y. T.; Revanasiddappa, M.

    2018-05-01

    The present work is an investigation of ac conduction behaviour and dielectric response of Polyaniline/Ag/Graphene/SrTiO3 (PAGS) composite prepared by in-situ chemical oxidative interfacial polymerization using (NH4)2S2O8 as an oxidising agent at 0-5°C. The structural characterization of the samples was examined using FT-IR and XRD techniques. The ac conductivity and dielectric response of synthesized polymer composites were investigated at room temperature in the frequency range varying from 5 × 101 - 5 × 106 Hz using HIOKI make 3532-50 LCR Hi-tester. The ac conductivity increases with increase in frequency and follows the regular trend, the real dielectric constant (ɛ') and imaginary dielectric constant (ɛ'') decreases with increase in frequency and exhibits almost zero dielectric loss at higher frequencies, which suggests that the composite is a lossless material at frequencies beyond 3Hz.

  17. AcEST: BP912775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9VIRU L protein OS=Lymphocytic choriomeningitis... 33 10.0 >tr|Q672V4|Q672V4_ASPFL Monooxygenase OS=Aspergil...N 162 >tr|A2SUM3|A2SUM3_9VIRU L protein OS=Lymphocytic choriomeningitis virus GN=L PE=4 SV=1 Length = 2209 S...: 261 LSLGKWLKPVGNKGVRAAVTPSGQAIALVEEKG-KRASSVFVARPAGMD 308 >sp|P14240|L_LYCVA RNA-directed RNA polymerase OS=Lymphocytic choriomenin...gitis virus (strain Armstrong) GN=L PE=1 SV=1 Length = 2210 Score = 30.8 bits (68),

  18. Counting Triangles to Sum Squares

    Science.gov (United States)

    DeMaio, Joe

    2012-01-01

    Counting complete subgraphs of three vertices in complete graphs, yields combinatorial arguments for identities for sums of squares of integers, odd integers, even integers and sums of the triangular numbers.

  19. Cosmic Sum Rules

    DEFF Research Database (Denmark)

    T. Frandsen, Mads; Masina, Isabella; Sannino, Francesco

    2011-01-01

    We introduce new sum rules allowing to determine universal properties of the unknown component of the cosmic rays and show how it can be used to predict the positron fraction at energies not yet explored by current experiments and to constrain specific models.......We introduce new sum rules allowing to determine universal properties of the unknown component of the cosmic rays and show how it can be used to predict the positron fraction at energies not yet explored by current experiments and to constrain specific models....

  20. Nutritional status, lipid profile and HOMA-IR in post-liver transplant patients.

    Science.gov (United States)

    Da Silva Alves, Vanessa; Hack Mendes, Roberta; Pinto Kruel, Cleber Dario

    2014-05-01

    A high prevalence of overweight, obesity, diabetes and dyslipidemia has been reported following liver transplantation (LT). Although these conditions are known to induce an increased risk for cardiovascular events, which are among the major causes of death in post-LT patients, much debate remains in the literature regarding the applicability of different nutritional assessments methods to this population. To assess the nutritional status, lipid profile, homeostatic model assessment of insulin resistance (HOMA-IR) and dietary intake adequacy in the post-LT period. Cross-sectional study of patients after a maximum of 2 years post-LT, involving the assessment of body mass index (BMI), percent weight loss, arm (AC) and arm muscle circumference (AMC), triceps skinfold (TSF), neck (NC) and waist (WC) circumference, lipid profile, HOMA-IR and percent adequacy of dietary intake. In the group of 36 patients, 61.1% were male, mean age 53.2 years (± 10.6). Severe weight loss was noted in 66.7% of patients. Most individuals were eutrophic according to BMI, AC and AMC, while TSF showed malnutrition, NC demonstrated overweight and WC showed metabolic risk. Dyslipidemia was diagnosed in 87.5% of patients, and insulin resistance in 57% of the patients. Most patients had adequate dietary intake, although the time since transplant was positively correlated with AC (r = 0.353; p = 0.035) and negatively correlated with vitamin A intake (r = - 0.382; p = 0.022), with the caloric adequacy (r = -0.338; p = 0.044) and vitamin A adequacy (r = -0.382; p = 0.021). Although anthropometry provided somewhat variable nutritional diagnoses, when combined with biochemical tests, findings showed the prevalence of cardiovascular risk. As such, patients should be provided with transdisciplinary assistance, and strategies should be developed so as to reduce the risk factors recorded in this population. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

  1. Circularly polarized infrared and visible sum-frequency-generation spectroscopy: Vibrational optical activity measurement

    International Nuclear Information System (INIS)

    Cheon, Sangheon; Cho, Minhaeng

    2005-01-01

    Vibrational optical activity spectroscopies utilizing either circularly polarized ir or circularly polarized visible beams were theoretically investigated by considering the infrared and visible sum-frequency-generation (IV-SFG) schemes. In addition to the purely electric dipole-allowed chiral component of the IV-SFG susceptibility, the polarizability-electric quadrupole hyperpolarizability term also contributes to the vibrationally resonant IV-SFG susceptibility. The circular-intensity-difference signal is shown to be determined by the interferences between the all-electric dipole-allowed chiral component and the polarizability-electric-dipole or electric-dipole-electric-quadrupole Raman optical activity tensor components. The circularly polarized SFG methods are shown to be potentially useful coherent spectroscopic tools for determining absolute configurations of chiral molecules in condensed phases

  2. Decompounding random sums: A nonparametric approach

    DEFF Research Database (Denmark)

    Hansen, Martin Bøgsted; Pitts, Susan M.

    Observations from sums of random variables with a random number of summands, known as random, compound or stopped sums arise within many areas of engineering and science. Quite often it is desirable to infer properties of the distribution of the terms in the random sum. In the present paper we...... review a number of applications and consider the nonlinear inverse problem of inferring the cumulative distribution function of the components in the random sum. We review the existing literature on non-parametric approaches to the problem. The models amenable to the analysis are generalized considerably...

  3. Alkoholio ir tabako pasiūlos ir paklausos teisinio reguliavimo raida Lietuvos Respublikoje: problemos ir sprendimai

    OpenAIRE

    Mockevičius, Arminas

    2014-01-01

    Viešosios teisės magistro studijų programos studento Armino Mockevičiaus buvo parašytas magistro baigiamasis darbas „Alkoholio ir tabako pasiūlos ir paklausos teisinio reguliavimo raida Lietuvos Respublikoje: problemos ir sprendimai“. Šis darbas parašytas Vilniuje, 2014 metais, Mykolo Romerio universiteto Teisės fakulteto Konstitucinės ir administracinės teisės institute, vadovaujant dr. Gintautui Vilkeliui, apimtis 98 p. Darbo tikslas yra atskleisti alkoholio ir tabako pasiūlos ir paklau...

  4. Momentum sum rules for fragmentation functions

    International Nuclear Information System (INIS)

    Meissner, S.; Metz, A.; Pitonyak, D.

    2010-01-01

    Momentum sum rules for fragmentation functions are considered. In particular, we give a general proof of the Schaefer-Teryaev sum rule for the transverse momentum dependent Collins function. We also argue that corresponding sum rules for related fragmentation functions do not exist. Our model-independent analysis is supplemented by calculations in a simple field-theoretical model.

  5. Multiparty symmetric sum types

    DEFF Research Database (Denmark)

    Nielsen, Lasse; Yoshida, Nobuko; Honda, Kohei

    2010-01-01

    This paper introduces a new theory of multiparty session types based on symmetric sum types, by which we can type non-deterministic orchestration choice behaviours. While the original branching type in session types can represent a choice made by a single participant and accepted by others...... determining how the session proceeds, the symmetric sum type represents a choice made by agreement among all the participants of a session. Such behaviour can be found in many practical systems, including collaborative workflow in healthcare systems for clinical practice guidelines (CPGs). Processes...... with the symmetric sums can be embedded into the original branching types using conductor processes. We show that this type-driven embedding preserves typability, satisfies semantic soundness and completeness, and meets the encodability criteria adapted to the typed setting. The theory leads to an efficient...

  6. Current algebra sum rules for Reggeons

    CERN Document Server

    Carlitz, R

    1972-01-01

    The interplay between the constraints of chiral SU/sub 2/*SU/sub 2/ symmetry and Regge asymptotic behaviour is investigated. The author reviews the derivation of various current algebra sum rules in a study of the reaction pi + alpha to pi + beta . These sum rules imply that all particles may be classified in multiplets of SU/sub 2/*SU/sub 2/ and that each of these multiplets may contain linear combinations of an infinite number of physical states. Extending his study to the reaction pi + alpha to pi + pi + beta , he derives new sum rules involving commutators of the axial charge with the reggeon coupling matrices of the rho and f Regge trajectories. Some applications of these new sum rules are noted, and the general utility of these and related sum rules is discussed. (17 refs).

  7. Sum rules for quasifree scattering of hadrons

    Science.gov (United States)

    Peterson, R. J.

    2018-02-01

    The areas d σ /d Ω of fitted quasifree scattering peaks from bound nucleons for continuum hadron-nucleus spectra measuring d2σ /d Ω d ω are converted to sum rules akin to the Coulomb sums familiar from continuum electron scattering spectra from nuclear charge. Hadronic spectra with or without charge exchange of the beam are considered. These sums are compared to the simple expectations of a nonrelativistic Fermi gas, including a Pauli blocking factor. For scattering without charge exchange, the hadronic sums are below this expectation, as also observed with Coulomb sums. For charge exchange spectra, the sums are near or above the simple expectation, with larger uncertainties. The strong role of hadron-nucleon in-medium total cross sections is noted from use of the Glauber model.

  8. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  9. Sum rules for collisional processes

    International Nuclear Information System (INIS)

    Oreg, J.; Goldstein, W.H.; Bar-Shalom, A.; Klapisch, M.

    1991-01-01

    We derive level-to-configuration sum rules for dielectronic capture and for collisional excitation and ionization. These sum rules give the total transition rate from a detailed atomic level to an atomic configuration. For each process, we show that it is possible to factor out the dependence on continuum-electron wave functions. The remaining explicit level dependence of each rate is then obtained from the matrix element of an effective operator acting on the bound orbitals only. In a large class of cases, the effective operator reduces to a one-electron monopole whose matrix element is proportional to the statistical weight of the level. We show that even in these cases, nonstatistical level dependence enters through the dependence of radial integrals on continuum orbitals. For each process, explicit analytic expressions for the level-to-configuration sum rules are given for all possible cases. Together with the well-known J-file sum rule for radiative rates [E. U. Condon and G. H. Shortley, The Theory of Atomic Spectra (University Press, Cambridge, 1935)], the sum rules offer a systematic and efficient procedure for collapsing high-multiplicity configurations into ''effective'' levels for the purpose of modeling the population kinetics of ionized heavy atoms in plasma

  10. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  11. QCD Sum Rules, a Modern Perspective

    CERN Document Server

    Colangelo, Pietro; Colangelo, Pietro; Khodjamirian, Alexander

    2001-01-01

    An introduction to the method of QCD sum rules is given for those who want to learn how to use this method. Furthermore, we discuss various applications of sum rules, from the determination of quark masses to the calculation of hadronic form factors and structure functions. Finally, we explain the idea of the light-cone sum rules and outline the recent development of this approach.

  12. On Learning Ring-Sum-Expansions

    DEFF Research Database (Denmark)

    Fischer, Paul; Simon, H. -U.

    1992-01-01

    The problem of learning ring-sum-expansions from examples is studied. Ring-sum-expansions (RSE) are representations of Boolean functions over the base {#123;small infinum, (+), 1}#125;, which reflect arithmetic operations in GF(2). k-RSE is the class of ring-sum-expansions containing only monomials...... of length at most k:. term-RSE is the class of ring-sum-expansions having at most I: monomials. It is shown that k-RSE, k>or=1, is learnable while k-term-RSE, k>2, is not learnable if RPnot=NP. Without using a complexity-theoretical hypothesis, it is proven that k-RSE, k>or=1, and k-term-RSE, k>or=2 cannot...... be learned from positive (negative) examples alone. However, if the restriction that the hypothesis which is output by the learning algorithm is also a k-RSE is suspended, then k-RSE is learnable from positive (negative) examples only. Moreover, it is proved that 2-term-RSE is learnable by a conjunction...

  13. Sums and products of sets and estimates of rational trigonometric sums in fields of prime order

    Energy Technology Data Exchange (ETDEWEB)

    Garaev, Mubaris Z [National Autonomous University of Mexico, Institute of Mathematics (Mexico)

    2010-11-16

    This paper is a survey of main results on the problem of sums and products of sets in fields of prime order and their applications to estimates of rational trigonometric sums. Bibliography: 85 titles.

  14. Sum formulas for reductive algebraic groups

    DEFF Research Database (Denmark)

    Andersen, Henning Haahr; Kulkarni, Upendra

    2008-01-01

    \\supset V^1 \\cdots \\supset V^r = 0$. The sum of the positive terms in this filtration satisfies a well known sum formula. If $T$ denotes a tilting module either for $G$ or $U_q$ then we can similarly filter the space $\\Hom_G(V,T)$, respectively $\\Hom_{U_q}(V,T)$ and there is a sum formula for the positive...... terms here as well. We give an easy and unified proof of these two (equivalent) sum formulas. Our approach is based on an Euler type identity which we show holds without any restrictions on $p$ or $l$. In particular, we get rid of previous such restrictions in the tilting module case....

  15. Observation of sum-frequency-generation-induced cascaded four-wave mixing using two crossing femtosecond laser pulses in a 0.1 mm beta-barium-borate crystal.

    Science.gov (United States)

    Liu, Weimin; Zhu, Liangdong; Fang, Chong

    2012-09-15

    We demonstrate the simultaneous generation of multicolor femtosecond laser pulses spanning the wavelength range from UV to near IR in a 0.1 mm Type I beta-barium borate crystal from 800 nm fundamental and weak IR super-continuum white light (SCWL) pulses. The multicolor broadband laser pulses observed are attributed to two concomitant cascaded four-wave mixing (CFWM) processes as corroborated by calculation: (1) directly from the two incident laser pulses; (2) by the sum-frequency generation (SFG) induced CFWM process (SFGFWM). The latter signal arises from the interaction between the frequency-doubled fundamental pulse (400 nm) and the SFG pulse generated in between the fundamental and IR-SCWL pulses. The versatility and simplicity of this spatially dispersed multicolor self-compressed laser pulse generation offer compact and attractive methods to conduct femtosecond stimulated Raman spectroscopy and time-resolved multicolor spectroscopy.

  16. Study of QCD medium by sum rules

    Energy Technology Data Exchange (ETDEWEB)

    Mallik, S [Saha Institute of Nuclear Physics, Calcutta (India)

    1998-08-01

    Though it has no analogue in condensed matter physics, the thermal QCD sum rules can, nevertheless, answer questions of condensed matter type about the QCD medium. The ingredients needed to write such sum rules, viz. the operator product expansion and the spectral representation at finite temperature, are reviewed in detail. The sum rules are then actually written for the case of correlation function of two vector currents. Collecting information on the thermal average of the higher dimension operators from other sources, we evaluate these sum rules for the temperature dependent {rho}-meson parameters. Possibility of extracting more information from the combined set of all sum rules from different correlation functions is also discussed. (author) 30 refs., 2 figs.

  17. Coloring sums of extensions of certain graphs

    Directory of Open Access Journals (Sweden)

    Johan Kok

    2017-12-01

    Full Text Available We recall that the minimum number of colors that allow a proper coloring of graph $G$ is called the chromatic number of $G$ and denoted $\\chi(G$. Motivated by the introduction of the concept of the $b$-chromatic sum of a graph the concept of $\\chi'$-chromatic sum and $\\chi^+$-chromatic sum are introduced in this paper. The extended graph $G^x$ of a graph $G$ was recently introduced for certain regular graphs. This paper furthers the concepts of $\\chi'$-chromatic sum and $\\chi^+$-chromatic sum to extended paths and cycles. Bipartite graphs also receive some attention. The paper concludes with patterned structured graphs. These last said graphs are typically found in chemical and biological structures.

  18. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  19. Robinson's radiation damping sum rule: Reaffirmation and extension

    International Nuclear Information System (INIS)

    Mane, S.R.

    2011-01-01

    Robinson's radiation damping sum rule is one of the classic theorems of accelerator physics. Recently Orlov has claimed to find serious flaws in Robinson's proof of his sum rule. In view of the importance of the subject, I have independently examined the derivation of the Robinson radiation damping sum rule. Orlov's criticisms are without merit: I work through Robinson's derivation and demonstrate that Orlov's criticisms violate well-established mathematical theorems and are hence not valid. I also show that Robinson's derivation, and his damping sum rule, is valid in a larger domain than that treated by Robinson himself: Robinson derived his sum rule under the approximation of a small damping rate, but I show that Robinson's sum rule applies to arbitrary damping rates. I also display more concise derivations of the sum rule using matrix differential equations. I also show that Robinson's sum rule is valid in the vicinity of a parametric resonance.

  20. Mid-IR femtosecond frequency conversion by soliton-probe collision in phase-mismatched quadratic nonlinear crystals

    DEFF Research Database (Denmark)

    Liu, Xing; Zhou, Binbin; Guo, Hairun

    2015-01-01

    in a quadratic nonlinear crystal (beta-barium borate) in the normal dispersion regime due to cascaded (phase-mismatched) second-harmonic generation, and the mid-IR converted wave is formed in the anomalous dispersion regime between. lambda = 2.2-2.4 mu m as a resonant dispersive wave. This process relies...... on nondegenerate four-wave mixing mediated by an effective negative cross-phase modulation term caused by cascaded soliton-probe sum-frequency generation. (C) 2015 Optical Society of America...

  1. Model dependence of energy-weighted sum rules

    International Nuclear Information System (INIS)

    Kirson, M.W.

    1977-01-01

    The contribution of the nucleon-nucleon interaction to energy-weighted sum rules for electromagnetic multipole transitions is investigated. It is found that only isoscalar electric transitions might have model-independent energy-weighted sum rules. For these transitions, explicit momentum and angular momentum dependence of the nuclear force give rise to corrections to the sum rule which are found to be negligibly small, thus confirming the model independence of these specific sum rules. These conclusions are unaffected by correlation effects. (author)

  2. Electronuclear sum rules for the lightest nuclei

    International Nuclear Information System (INIS)

    Efros, V.D.

    1992-01-01

    It is shown that the model-independent longitudinal electronuclear sum rules for nuclei with A = 3 and A = 4 have an accuracy on the order of a percent in the traditional single-nucleon approximation with free nucleons for the nuclear charge-density operator. This makes it possible to test this approximation by using these sum rules. The longitudinal sum rules for A = 3 and A = 4 are calculated using the wave functions of these nuclei corresponding to a large set of realistic NN interactions. The values of the model-independent sum rules lie in the range of values calculated by this method. Model-independent expressions are obtained for the transverse sum rules for nuclei with A = 3 and A = 4. These sum rules are calculated using a large set of realistic wave functions of these nuclei. The contribution of the convection current and the changes in the results for different versions of realistic NN forces are given. 29 refs., 4 tabs

  3. Extremum uncertainty product and sum states

    Energy Technology Data Exchange (ETDEWEB)

    Mehta, C L; Kumar, S [Indian Inst. of Tech., New Delhi. Dept. of Physics

    1978-01-01

    The extremum product states and sum states of the uncertainties in non-commuting observables have been examined. These are illustrated by two specific examples of harmonic oscillator and the angular momentum states. It shows that the coherent states of the harmonic oscillator are characterized by the minimum uncertainty sum <(..delta..q)/sup 2/>+<(..delta..p)/sup 2/>. The extremum values of the sums and products of the uncertainties of the components of the angular momentum are also obtained.

  4. Inverse-moment chiral sum rules

    International Nuclear Information System (INIS)

    Golowich, E.; Kambor, J.

    1996-01-01

    A general class of inverse-moment sum rules was previously derived by the authors in a chiral perturbation theory (ChPT) study at two-loop order of the isospin and hypercharge vector-current propagators. Here, we address the evaluation of the inverse-moment sum rules in terms of existing data and theoretical constraints. Two kinds of sum rules are seen to occur: those which contain as-yet undetermined O(q 6 ) counterterms and those free of such quantities. We use the former to obtain phenomenological evaluations of two O(q 6 ) counterterms. Light is shed on the important but difficult issue regarding contributions of higher orders in the ChPT expansion. copyright 1996 The American Physical Society

  5. Two-dimensional sum-frequency generation (2D SFG) reveals structure and dynamics of a surface-bound peptide

    Science.gov (United States)

    Laaser, Jennifer E.; Skoff, David R.; Ho, Jia-Jung; Joo, Yongho; Serrano, Arnaldo L.; Steinkruger, Jay D.; Gopalan, Padma; Gellman, Samuel H.; Zanni, Martin T.

    2014-01-01

    Surface-bound polypeptides and proteins are increasingly used to functionalize inorganic interfaces such as electrodes, but their structural characterization is exceedingly difficult with standard technologies. In this paper, we report the first two-dimensional sum-frequency generation (2D SFG) spectra of a peptide monolayer, which is collected by adding a mid-IR pulse shaper to a standard femtosecond SFG spectrometer. On a gold surface, standard FTIR spectroscopy is inconclusive about the peptide structure because of solvation-induced frequency shifts, but the 2D lineshapes, anharmonic shifts, and lifetimes obtained from 2D SFG reveal that the peptide is largely α-helical and upright. Random coil residues are also observed, which do not themselves appear in SFG spectra due to their isotropic structural distribution, but which still absorb infrared light and so can be detected by cross-peaks in 2D SFG spectra. We discuss these results in the context of peptide design. Because of the similar way in which the spectra are collected, these 2D SFG spectra can be directly compared to 2D IR spectra, thereby enabling structural interpretations of surface-bound peptides and biomolecules based on the well-studied structure/2D IR spectra relationships established from soluble proteins. PMID:24372101

  6. Low Offset AC Correlator.

    Science.gov (United States)

    This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

  7. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  8. 7 CFR 42.132 - Determining cumulative sum values.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Determining cumulative sum values. 42.132 Section 42... Determining cumulative sum values. (a) The parameters for the on-line cumulative sum sampling plans for AQL's... 3 1 2.5 3 1 2 1 (b) At the beginning of the basic inspection period, the CuSum value is set equal to...

  9. Harmonic sums and polylogarithms generated by cyclotomic polynomials

    Energy Technology Data Exchange (ETDEWEB)

    Ablinger, Jakob; Schneider, Carsten [Johannes Kepler Univ., Linz (Austria). Research Inst. for Symbolic Computation; Bluemlein, Johannes [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)

    2011-05-15

    The computation of Feynman integrals in massive higher order perturbative calculations in renormalizable Quantum Field Theories requires extensions of multiply nested harmonic sums, which can be generated as real representations by Mellin transforms of Poincare-iterated integrals including denominators of higher cyclotomic polynomials. We derive the cyclotomic harmonic polylogarithms and harmonic sums and study their algebraic and structural relations. The analytic continuation of cyclotomic harmonic sums to complex values of N is performed using analytic representations. We also consider special values of the cyclotomic harmonic polylogarithms at argument x=1, resp., for the cyclotomic harmonic sums at N{yields}{infinity}, which are related to colored multiple zeta values, deriving various of their relations, based on the stuffle and shuffle algebras and three multiple argument relations. We also consider infinite generalized nested harmonic sums at roots of unity which are related to the infinite cyclotomic harmonic sums. Basis representations are derived for weight w=1,2 sums up to cyclotomy l=20. (orig.)

  10. Design, development and implementation of the IR signaling techniques for monitoring ambient and body temperature

    International Nuclear Information System (INIS)

    Baqai, A.

    2014-01-01

    Healthcare systems such as hospitals, homecare, telemedicine, and physical rehabilitation are expected to be revolutionized by WBAN (Wireless Body Area Networks). This research work aims to investigate, design, optimize, and demonstrate the applications of IR (Infra-Red) communication systems in WBAN. It is aimed to establish a prototype WBAN system capable of measuring Ambient and Body Temperature using LM35 as temperature sensor and transmitting and receiving the data using optical signals. The corresponding technical challenges that have to be faced are also discussed in this paper. Investigations are carried out to efficiently design the hardware using low-cost and low power optical transceivers. The experimental results reveal the successful transmission and reception of Ambient and Body Temperatures over short ranges i.e. up to 3-4 meters. A simple IR transceiver with an LED (Light Emitting Diodes), TV remote control IC and Arduino microcontroller is designed to perform the transmission with sufficient accuracy and ease. Experiments are also performed to avoid interference from other sources like AC and TV remote control signals by implementing IR tags. (author)

  11. Design, development and implementation of the IR signaling techniques for monitoring ambient and body temperature

    Energy Technology Data Exchange (ETDEWEB)

    Baqai, A. [Mehran Univ. of Engineering and Technology, Jamshoro (Pakistan). Dept. of Information and Communication Technology

    2014-07-15

    Healthcare systems such as hospitals, homecare, telemedicine, and physical rehabilitation are expected to be revolutionized by WBAN (Wireless Body Area Networks). This research work aims to investigate, design, optimize, and demonstrate the applications of IR (Infra-Red) communication systems in WBAN. It is aimed to establish a prototype WBAN system capable of measuring Ambient and Body Temperature using LM35 as temperature sensor and transmitting and receiving the data using optical signals. The corresponding technical challenges that have to be faced are also discussed in this paper. Investigations are carried out to efficiently design the hardware using low-cost and low power optical transceivers. The experimental results reveal the successful transmission and reception of Ambient and Body Temperatures over short ranges i.e. up to 3-4 meters. A simple IR transceiver with an LED (Light Emitting Diodes), TV remote control IC and Arduino microcontroller is designed to perform the transmission with sufficient accuracy and ease. Experiments are also performed to avoid interference from other sources like AC and TV remote control signals by implementing IR tags. (author)

  12. QCD sum-rules for V-A spectral functions

    International Nuclear Information System (INIS)

    Chakrabarti, J.; Mathur, V.S.

    1980-01-01

    The Borel transformation technique of Shifman et al is used to obtain QCD sum-rules for V-A spectral functions. In contrast to the situation in the original Weinberg sum-rules and those of Bernard et al, the problem of saturating the sum-rules by low lying resonances is brought under control. Furthermore, the present sum-rules, on saturation, directly determine useful phenomenological parameters

  13. Some Finite Sums Involving Generalized Fibonacci and Lucas Numbers

    Directory of Open Access Journals (Sweden)

    E. Kılıç

    2011-01-01

    Full Text Available By considering Melham's sums (Melham, 2004, we compute various more general nonalternating sums, alternating sums, and sums that alternate according to (−12+1 involving the generalized Fibonacci and Lucas numbers.

  14. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  15. Sum rules for nuclear collective excitations

    International Nuclear Information System (INIS)

    Bohigas, O.

    1978-07-01

    Characterizations of the response function and of integral properties of the strength function via a moment expansion are discussed. Sum rule expressions for the moments in the RPA are derived. The validity of these sum rules for both density independent and density dependent interactions is proved. For forces of the Skyrme type, analytic expressions for the plus one and plus three energy weighted sum rules are given for isoscalar monopole and quadrupole operators. From these, a close relationship between the monopole and quadrupole energies is shown and their dependence on incompressibility and effective mass is studied. The inverse energy weighted sum rule is computed numerically for the monopole operator, and an upper bound for the width of the monopole resonance is given. Finally the reliability of moments given by the RPA with effective interactions is discussed using simple soluble models for the hamiltonian, and also by comparison with experimental data

  16. Sum rules in the response function method

    International Nuclear Information System (INIS)

    Takayanagi, Kazuo

    1990-01-01

    Sum rules in the response function method are studied in detail. A sum rule can be obtained theoretically by integrating the imaginary part of the response function over the excitation energy with a corresponding energy weight. Generally, the response function is calculated perturbatively in terms of the residual interaction, and the expansion can be described by diagrammatic methods. In this paper, we present a classification of the diagrams so as to clarify which diagram has what contribution to which sum rule. This will allow us to get insight into the contributions to the sum rules of all the processes expressed by Goldstone diagrams. (orig.)

  17. Is HOMA-IR a potential screening test for non-alcoholic fatty liver disease in adults with type 2 diabetes?

    Science.gov (United States)

    Gutierrez-Buey, Gala; Núñez-Córdoba, Jorge M; Llavero-Valero, María; Gargallo, Javier; Salvador, Javier; Escalada, Javier

    2017-06-01

    Non-alcoholic fatty liver disease (NAFLD) is the commonest hepatic disease in many parts of the World, with particularly high prevalence in patients with type 2 diabetes (T2DM). However, a good screening test for NAFLD in T2DM has not been established. Insulin resistance (IR) has been associated with NAFLD, and homeostatic model assessment of insulin resistance (HOMA-IR), a good proxy for IR, may represent an affordable predictive test which could be easily applied in routine clinical practice. We aimed to evaluate the diagnostic accuracy of HOMA-IR for NAFLD in T2DM and sought to estimate an optimal cut-off value for discriminating NAFLD from non-NAFLD cases. We conducted a retrospective analysis of 56 well-controlled patients with T2DM (HbAc1HOMA-IR and NAFLD was found (OR 1.5; 95% CI: 1.03-2.1; p=0.033), independently of transaminases, fat percentage, BMI and triglyceride levels. The AUROC curve of HOMA-IR for identifying NAFLD was 80.7% (95% CI: 68.9-92.5). A value of HOMA-IR of 4.5 was estimated to be an optimal threshold for discriminating NAFLD from non-NAFLD cases. HOMA-IR is independently associated with the presence of NAFLD in adults with T2DM, and might potentially be applied in clinical practice as a screen for this condition. Copyright © 2017 European Federation of Internal Medicine. Published by Elsevier B.V. All rights reserved.

  18. Removal kinetics of organic compounds and sum parameters under field conditions for managed aquifer recharge.

    Science.gov (United States)

    Wiese, Bernd; Massmann, Gudrun; Jekel, Martin; Heberer, Thomas; Dünnbier, Uwe; Orlikowski, Dagmar; Grützmacher, Gesche

    2011-10-15

    Managed aquifer recharge (MAR) provides efficient removal for many organic compounds and sum parameters. However, observed in situ removal efficiencies tend to scatter and cannot be predicted easily. In this paper, a method is introduced which allows to identify and eliminate biased samples and to quantify simultaneously the impact of (i) redox conditions (ii) kinetics (iii) residual threshold values below which no removal occurs and (iv) field site specifics. It enables to rule out spurious correlations between these factors and therefore improves the predictive power. The method is applied to an extensive database from three MAR field sites which was compiled in the NASRI project (2002-2005, Berlin, Germany). Removal characteristics for 38 organic parameters are obtained, of which 9 are analysed independently in 2 different laboratories. Out of these parameters, mainly pharmaceutically active compounds (PhAC) but also sum parameters and industrial chemicals, four compounds are shown to be readily removable whereas six are persistent. All partly removable compounds show a redox dependency and most of them reveal either kinetic dependencies or residual threshold values, which are determined. Differing removal efficiencies at different field sites can usually be explained by characteristics (i) to (iii). Copyright © 2011 Elsevier Ltd. All rights reserved.

  19. 'Sum rules' for preequilibrium reactions

    International Nuclear Information System (INIS)

    Hussein, M.S.

    1981-03-01

    Evidence that suggests a correct relationship between the optical transmission matrix, P, and the several correlation widths, gamma sub(n), found in nsmission matrix, P, and the several correlation widths, n, found in multistep compound (preequilibrium) nuclear reactions, is presented. A second sum rule is also derived within the shell model approach to nuclear reactions. Indications of the potential usefulness of the sum rules in preequilibrium studies are given. (Author) [pt

  20. QCD sum rules in a Bayesian approach

    International Nuclear Information System (INIS)

    Gubler, Philipp; Oka, Makoto

    2011-01-01

    A novel technique is developed, in which the Maximum Entropy Method is used to analyze QCD sum rules. The main advantage of this approach lies in its ability of directly generating the spectral function of a given operator. This is done without the need of making an assumption about the specific functional form of the spectral function, such as in the 'pole + continuum' ansatz that is frequently used in QCD sum rule studies. Therefore, with this method it should in principle be possible to distinguish narrow pole structures form continuum states. To check whether meaningful results can be extracted within this approach, we have first investigated the vector meson channel, where QCD sum rules are traditionally known to provide a valid description of the spectral function. Our results exhibit a significant peak in the region of the experimentally observed ρ-meson mass, which agrees with earlier QCD sum rules studies and shows that the Maximum Entropy Method is a useful tool for analyzing QCD sum rules.

  1. Eight years' experience with a Medical Education Journal Club in Mexico: a quasi-experimental one-group study.

    Science.gov (United States)

    Sánchez-Mendiola, Melchor; Morales-Castillo, Daniel; Torruco-García, Uri; Varela-Ruiz, Margarita

    2015-12-14

    A time-honored strategy for keeping up to date in medicine and improving critical appraisal skills is the Journal Club (JC). There are several reports of its use in medicine and allied health sciences but almost no reports of JC focused on medical education. The purpose of the study is to describe and evaluate an eight years' experience with a medical education Journal Club (MEJC). We started a monthly medical education JC in 2006 at UNAM Faculty of Medicine in Mexico City. Its goal is to provide faculty with continuing professional development in medical education. A discussion guide and a published paper were sent 2 weeks before sessions. We reviewed the themes and publication types of the papers used in the sessions, and in June-July 2014 administered a retrospective post-then-pre evaluation questionnaire to current participants that had been regular attendees to the JC for more than 2 years. The retrospective post-then-pre comparisons were analyzed with Wilcoxon signed-rank test. Effect sizes were calculated for the pre-post comparisons with Cohen's r. There have been 94 MEJC sessions until July 2014. Average attendance is 20 persons, a mix of clinicians, educators, psychologists and a sociologist. The articles were published in 32 different journals, and covered several medical education themes (curriculum, faculty development, educational research methodology, learning methods, assessment, residency education). 22 Attendees answered the evaluation instrument. The MEJC had a positive evaluation from good to excellent, and there was an improvement in self-reported competencies in medical education literature critical appraisal and behaviors related to the use of evidence in educational practice, with a median effect size higher than 0.5. The evaluation instrument had a Cronbach's alpha of 0.96. A periodic Medical Education Journal Club can improve critical appraisal of the literature, and be maintained long-term using evidence-based strategies. This activity

  2. Critical Dispersion-Theory Tests of Silicon's IR Refractive Index

    Science.gov (United States)

    Karstens, William; Smith, D. Y.

    Silicon strongly absorbs both visible and UV light, but is highly transparent in the IR. Hence, it is a common choice for infrared windows and lenses. However, optical design is hindered by literature index values that disagree by up to 1%. In contrast optical-glass indices are known to 0.01% or better. The most widely available silicon IR indices are based on bulk measurements using either Snell's-Law refraction by a prism or channel-spectra interference of front- and backsurface reflections from a planar sample. To test the physical acceptability of these data, we have developed criteria based on a Taylor expansion of the Kramers-Kronig relation for the index at energies below strong inter-band transitions. These tests require that the coefficients of the series in powers of energy squared must be positive within the region of transparency. This is satisfied by essentially all prism measurements; their small scatter arises primarily from impurities and doping. In contrast, channel-spectra data fail in the second and third coefficients. A review of the experimental analysis indicates three problems besides purity: incorrect channel number arising from a channel-spectra model that neglects spectrum distortion by the weak lattice absorption; use of a series expansion of mixed parity in photon energy to describe the even-parity index; and use of an incorrect absorption energy in the Li-Sellmeier dispersion formula. Recommendations for IR index values for pure silicon will be discussed. Supported in part by the US Department of Energy, Office of Science, Office of Nuclear Physics under contract DE-AC02-06CH11357.

  3. FLUIDIC AC AMPLIFIERS.

    Science.gov (United States)

    Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

  4. Harmonic sums, polylogarithms, special numbers, and their generalizations

    International Nuclear Information System (INIS)

    Ablinger, Jakob

    2013-04-01

    In these introductory lectures we discuss classes of presently known nested sums, associated iterated integrals, and special constants which hierarchically appear in the evaluation of massless and massive Feynman diagrams at higher loops. These quantities are elements of stuffle and shuffle algebras implying algebraic relations being widely independent of the special quantities considered. They are supplemented by structural relations. The generalizations are given in terms of generalized harmonic sums, (generalized) cyclotomic sums, and sums containing in addition binomial and inverse-binomial weights. To all these quantities iterated integrals and special numbers are associated. We also discuss the analytic continuation of nested sums of different kind to complex values of the external summation bound N.

  5. Harmonic sums, polylogarithms, special numbers, and their generalizations

    Energy Technology Data Exchange (ETDEWEB)

    Ablinger, Jakob [Johannes Kepler Univ., Linz (Austria). Research Inst. for Symbolic Computation; Bluemlein, Johannes [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)

    2013-04-15

    In these introductory lectures we discuss classes of presently known nested sums, associated iterated integrals, and special constants which hierarchically appear in the evaluation of massless and massive Feynman diagrams at higher loops. These quantities are elements of stuffle and shuffle algebras implying algebraic relations being widely independent of the special quantities considered. They are supplemented by structural relations. The generalizations are given in terms of generalized harmonic sums, (generalized) cyclotomic sums, and sums containing in addition binomial and inverse-binomial weights. To all these quantities iterated integrals and special numbers are associated. We also discuss the analytic continuation of nested sums of different kind to complex values of the external summation bound N.

  6. Transition sum rules in the shell model

    Science.gov (United States)

    Lu, Yi; Johnson, Calvin W.

    2018-03-01

    An important characterization of electromagnetic and weak transitions in atomic nuclei are sum rules. We focus on the non-energy-weighted sum rule (NEWSR), or total strength, and the energy-weighted sum rule (EWSR); the ratio of the EWSR to the NEWSR is the centroid or average energy of transition strengths from an nuclear initial state to all allowed final states. These sum rules can be expressed as expectation values of operators, which in the case of the EWSR is a double commutator. While most prior applications of the double commutator have been to special cases, we derive general formulas for matrix elements of both operators in a shell model framework (occupation space), given the input matrix elements for the nuclear Hamiltonian and for the transition operator. With these new formulas, we easily evaluate centroids of transition strength functions, with no need to calculate daughter states. We apply this simple tool to a number of nuclides and demonstrate the sum rules follow smooth secular behavior as a function of initial energy, as well as compare the electric dipole (E 1 ) sum rule against the famous Thomas-Reiche-Kuhn version. We also find surprising systematic behaviors for ground-state electric quadrupole (E 2 ) centroids in the s d shell.

  7. Time-domain SFG spectroscopy using mid-IR pulse shaping: practical and intrinsic advantages.

    Science.gov (United States)

    Laaser, Jennifer E; Xiong, Wei; Zanni, Martin T

    2011-03-24

    Sum-frequency generation (SFG) spectroscopy is a ubiquitous tool in the surface sciences. It provides infrared transition frequencies and line shapes that probe the structure and environment of molecules at interfaces. In this article, we apply techniques learned from the multidimensional spectroscopy community to SFG spectroscopy. We implement balanced heterodyne detection to remove scatter and the local oscillator background. Heterodyning also separates the resonant and nonresonant signals by acquiring both the real and imaginary parts of the spectrum. We utilize mid-IR pulse shaping to control the phase and delay of the mid-IR pump pulse. Pulse shaping allows phase cycling for data collection in the rotating frame and additional background subtraction. We also demonstrate time-domain data collection, which is a Fourier transform technique, and has many advantages in signal throughput, frequency resolution, and line shape accuracy over existing frequency domain methods. To demonstrate time-domain SFG spectroscopy, we study an aryl isocyanide on gold, and find that the system has an inhomogeneous structural distribution, in agreement with computational results, but which was not resolved by previous frequency-domain SFG studies. The ability to rapidly and actively manipulate the mid-IR pulse in an SFG pules sequence makes possible new experiments and more accurate spectra. © 2011 American Chemical Society

  8. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

  9. The TApIR experiment. IR absorption spectra of liquid hydrogen isotopologues; Das TApIR Experiment IR-Absorptionsspektren fluessiger Wasserstoffisotopologe

    Energy Technology Data Exchange (ETDEWEB)

    Groessle, Robin

    2015-11-27

    The scope of the thesis is the infrared absorption spectroscopy of liquid hydrogen isotopologues with the tritium absorption infrared spectroscopy (TApIR) experiment at the tritium laboratory Karlsruhe (TLK). The calibration process from the sample preparation to the reference measurements are described. A further issue is the classical evaluation of FTIR absorption spectra and the extension using the rolling circle filter (RCF) including the effects on statistical and systematical errors. The impact of thermal and nuclear spin temperature on the IR absorption spectra is discussed. An empirical based modeling for the IR absorption spectra of liquid hydrogen isotopologues is performed.

  10. Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

    International Nuclear Information System (INIS)

    Fang Minggang; Nie, Yingchao; Theilmann, David A.

    2009-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

  11. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  12. Fixed mass and scaling sum rules

    International Nuclear Information System (INIS)

    Ward, B.F.L.

    1975-01-01

    Using the correspondence principle (continuity in dynamics), the approach of Keppell-Jones-Ward-Taha to fixed mass and scaling current algebraic sum rules is extended so as to consider explicitly the contributions of all classes of intermediate states. A natural, generalized formulation of the truncation ideas of Cornwall, Corrigan, and Norton is introduced as a by-product of this extension. The formalism is illustrated in the familiar case of the spin independent Schwinger term sum rule. New sum rules are derived which relate the Regge residue functions of the respective structure functions to their fixed hadronic mass limits for q 2 → infinity. (Auth.)

  13. Shapley Value for Constant-sum Games

    NARCIS (Netherlands)

    Khmelnitskaya, A.B.

    2002-01-01

    It is proved that Young's axiomatization for the Shapley value by marginalism, efficiency, and symmetry is still valid for the Shapley value defined on the class of nonnegative constant-sum games and on the entire class of constant-sum games as well. To support an interest to study the class of

  14. Tarptautinio turizmo raida ir vystymo prognozės Lietuvoje ir Lenkijoje

    OpenAIRE

    Veličkaitė, Dalia

    2009-01-01

    Išanalizuota ir įvertinta Lietuvos ir Lenkijos atvykstamojo turizmo raida 2000- 2007m., užsienio turistų srautai, apgyvendinimo paslaugų paklausa, turistų tikslai ir kelionių transporto pasirinkimas, turistų išlaidos ir šalių turizmo pajamos, iškeltos atvykstamojo turizmo problemos bei pateikti jų sprendimo siūlymai.paskutinėje darbo dalyje buvo atliktos 2008- 2015metų Lietuvos ir Lenkijos turizmo raidos prognozės. In the final master work Lithuanian and Poland arriving tourism development...

  15. A Bayesian analysis of QCD sum rules

    International Nuclear Information System (INIS)

    Gubler, Philipp; Oka, Makoto

    2011-01-01

    A new technique has recently been developed, in which the Maximum Entropy Method is used to analyze QCD sum rules. This approach has the virtue of being able to directly generate the spectral function of a given operator, without the need of making an assumption about its specific functional form. To investigate whether useful results can be extracted within this method, we have first studied the vector meson channel, where QCD sum rules are traditionally known to provide a valid description of the spectral function. Our results show a significant peak in the region of the experimentally observed ρ-meson mass, which is in agreement with earlier QCD sum rules studies and suggests that the Maximum Entropy Method is a strong tool for analyzing QCD sum rules.

  16. SUMS Counts-Related Projects

    Data.gov (United States)

    Social Security Administration — Staging Instance for all SUMs Counts related projects including: Redeterminations/Limited Issue, Continuing Disability Resolution, CDR Performance Measures, Initial...

  17. Electronic structure, local magnetism, and spin-orbit effects of Ir(IV)-, Ir(V)-, and Ir(VI)-based compounds

    Energy Technology Data Exchange (ETDEWEB)

    Laguna-Marco, M. A.; Kayser, P.; Alonso, J. A.; Martínez-Lope, M. J.; van Veenendaal, M.; Choi, Y.; Haskel, D.

    2015-06-01

    Element- and orbital-selective x-ray absorption and magnetic circular dichroism measurements are carried out to probe the electronic structure and magnetism of Ir 5d electronic states in double perovskite Sr2MIrO6 (M = Mg, Ca, Sc, Ti, Ni, Fe, Zn, In) and La2NiIrO6 compounds. All the studied systems present a significant influence of spin-orbit interactions in the electronic ground state. In addition, we find that the Ir 5d local magnetic moment shows different character depending on the oxidation state despite the net magnetization being similar for all the compounds. Ir carries an orbital contribution comparable to the spin contribution for Ir4+ (5d(5)) and Ir5+ (5d(4)) oxides, whereas the orbital contribution is quenched for Ir6+ (5d(3)) samples. Incorporation of a magnetic 3d atom allows getting insight into the magnetic coupling between 5d and 3d transition metals. Together with previous susceptibility and neutron diffractionmeasurements, the results indicate that Ir carries a significant local magnetic moment even in samples without a 3d metal. The size of the (small) net magnetization of these compounds is a result of predominant antiferromagnetic interactions between local moments coupled with structural details of each perovskite structure

  18. IR-IR Conformation Specific Spectroscopy of Na+(Glucose) Adducts

    Science.gov (United States)

    Voss, Jonathan M.; Kregel, Steven J.; Fischer, Kaitlyn C.; Garand, Etienne

    2018-01-01

    We report an IR-IR double resonance study of the structural landscape present in the Na+(glucose) complex. Our experimental approach involves minimal modifications to a typical IR predissociation setup, and can be carried out via ion-dip or isomer-burning methods, providing additional flexibility to suit different experimental needs. In the current study, the single-laser IR predissociation spectrum of Na+(glucose), which clearly indicates contributions from multiple structures, was experimentally disentangled to reveal the presence of three α-conformers and five β-conformers. Comparisons with calculations show that these eight conformations correspond to the lowest energy gas-phase structures with distinctive Na+ coordination. [Figure not available: see fulltext.

  19. PKCδ-mediated IRS-1 Ser24 phosphorylation negatively regulates IRS-1 function

    International Nuclear Information System (INIS)

    Greene, Michael W.; Ruhoff, Mary S.; Roth, Richard A.; Kim, Jeong-a; Quon, Michael J.; Krause, Jean A.

    2006-01-01

    The IRS-1 PH and PTB domains are essential for insulin-stimulated IRS-1 Tyr phosphorylation and insulin signaling, while Ser/Thr phosphorylation of IRS-1 disrupts these signaling events. To investigate consensus PKC phosphorylation sites in the PH-PTB domains of human IRS-1, we changed Ser24, Ser58, and Thr191 to Ala (3A) or Glu (3E), to block or mimic phosphorylation, respectively. The 3A mutant abrogated the inhibitory effect of PKCδ on insulin-stimulated IRS-1 Tyr phosphorylation, while reductions in insulin-stimulated IRS-1 Tyr phosphorylation, cellular proliferation, and Akt activation were observed with the 3E mutant. When single Glu mutants were tested, the Ser24 to Glu mutant had the greatest inhibitory effect on insulin-stimulated IRS-1 Tyr phosphorylation. PKCδ-mediated IRS-1 Ser24 phosphorylation was confirmed in cells with PKCδ catalytic domain mutants and by an RNAi method. Mechanistic studies revealed that IRS-1 with Ala and Glu point mutations at Ser24 impaired phosphatidylinositol-4,5-bisphosphate binding. In summary, our data are consistent with the hypothesis that Ser24 is a negative regulatory phosphorylation site in IRS-1

  20. 7 CFR 1726.205 - Multiparty lump sum quotations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Multiparty lump sum quotations. 1726.205 Section 1726....205 Multiparty lump sum quotations. The borrower or its engineer must contact a sufficient number of... basis of written lump sum quotations, the borrower will select the supplier or contractor based on the...

  1. Near-IR search for lensed supernovae behind galaxy clusters. II. First detection and future prospects

    OpenAIRE

    Goobar, A.; Paech, K.; Stanishev, V.; Amanullah, R.; Dahlén, T.; Jönsson, J.; Kneib, J. P.; Lidman, C.; Limousin, M.; Mörtsell, E.; Nobili, S.; Richard, J.; Riehm, T.; von Strauss, M.

    2009-01-01

    Aims. Powerful gravitational telescopes in the form of massive galaxy clusters can be used to enhance the light collecting power over a limited field of view by about an order of magnitude in flux. This effect is exploited here to increase the depth of a survey for lensed supernovae at near-IR wavelengths. Methods. We present a pilot supernova search programme conducted with the ISAAC camera at VLT. Lensed galaxies behind the massive clusters A1689, A1835, and AC114 were observed for a tot...

  2. Adler Function, DIS sum rules and Crewther Relations

    International Nuclear Information System (INIS)

    Baikov, P.A.; Chetyrkin, K.G.; Kuehn, J.H.

    2010-01-01

    The current status of the Adler function and two closely related Deep Inelastic Scattering (DIS) sum rules, namely, the Bjorken sum rule for polarized DIS and the Gross-Llewellyn Smith sum rule are briefly reviewed. A new result is presented: an analytical calculation of the coefficient function of the latter sum rule in a generic gauge theory in order O(α s 4 ). It is demonstrated that the corresponding Crewther relation allows to fix two of three colour structures in the O(α s 4 ) contribution to the singlet part of the Adler function.

  3. Sum rules for neutrino oscillations

    International Nuclear Information System (INIS)

    Kobzarev, I.Yu.; Martemyanov, B.V.; Okun, L.B.; Schepkin, M.G.

    1981-01-01

    Sum rules for neutrino oscillations are obtained. The derivation of the general form of the s matrix for two stage process lsub(i)sup(-)→ν→lsub(k)sup(+-) (where lsub(i)sup(-)e, μ, tau, ... are initial leptons with flavor i and lsub(k)sup(+-) is final lepton) is presented. The consideration of two stage process lsub(i)sup(-)→ν→lsub(k)sup(+-) gives the possibility to take into account neutrino masses and to obtain the expressions for the oscillating cross sections. In the case of Dirac and left-handed Majorana neutrino is obtained the sum rule for the quantities 1/Vsub(K)σ(lsub(i)sup(-)→lsub(K)sup(+-)), (where Vsub(K) is a velocity of lsub(K)). In the left-handed Majorana neutrino case there is an additional antineutrino admixture leading to lsub(i)sup(-)→lsub(K)sup(+) process. Both components (neutrino and antineutrino) oscillate independently. The sums Σsub(K)1/Vsub(k)σ(lsub(i)sup(-) - lsub(K)sup(+-) then oscillate due to the presence of left-handed antineutrinos and right-handed neutrinos which do not take part in weak interactions. If right-handed currents are added sum rules analogous to considered above may be obtained. All conclusions are valid in the general case when CP is not conserved [ru

  4. Succinct partial sums and fenwick trees

    DEFF Research Database (Denmark)

    Bille, Philip; Christiansen, Anders Roy; Prezza, Nicola

    2017-01-01

    We consider the well-studied partial sums problem in succint space where one is to maintain an array of n k-bit integers subject to updates such that partial sums queries can be efficiently answered. We present two succint versions of the Fenwick Tree – which is known for its simplicity...... and practicality. Our results hold in the encoding model where one is allowed to reuse the space from the input data. Our main result is the first that only requires nk + o(n) bits of space while still supporting sum/update in O(logbn)/O(blogbn) time where 2 ≤ b ≤ log O(1)n. The second result shows how optimal...... time for sum/update can be achieved while only slightly increasing the space usage to nk + o(nk) bits. Beyond Fenwick Trees, the results are primarily based on bit-packing and sampling – making them very practical – and they also allow for simple optimal parallelization....

  5. Isospin sum rules for inclusive cross-sections

    NARCIS (Netherlands)

    Rotelli, P.; Suttorp, L.G.

    1972-01-01

    A systematic analysis of isospin sum rules is presented for the distribution functions of strong, electromagnetic weak inclusive processes. The general expression for these sum rules is given and some new examples are presented.

  6. Over 8 W high peak power UV laser with a high power Q-switched Nd:YVO4 oscillator and the compact extra-cavity sum-frequency mixing

    International Nuclear Information System (INIS)

    Yan, X P; Liu, Q; Gong, M; Wang, D S; Fu, X

    2009-01-01

    A 8.2 W UV laser was reported with the compact extra-cavity sum-frequency mixing. The IR fundamental frequency source was a high power and high beam quality Q-switched Nd:YVO 4 oscillator. 38 W fundamental frequency laser at 1064 nm was obtained at the pulse repetition rate of 450 kHz with the beam quality factors of M 2 x = 1.27, M 2 y = 1.21. The type I and type II phase-matched LBO crystals were used as the extra-cavity frequency doubling and mixing crystals respectively. At 38 kHz, 8.2 W UV laser at 355 nm was achieved with the pulse duration of 8 ns corresponding to the pulse peak power as high as 27 kW, and the optical-optical conversion efficiency from IR to UV was 25.6%. The output characteristics of the IR and the harmonic generations varying with the pulse repetition rate were also investigated detailedly

  7. Gauss Sum Factorization with Cold Atoms

    International Nuclear Information System (INIS)

    Gilowski, M.; Wendrich, T.; Mueller, T.; Ertmer, W.; Rasel, E. M.; Jentsch, Ch.; Schleich, W. P.

    2008-01-01

    We report the first implementation of a Gauss sum factorization algorithm by an internal state Ramsey interferometer using cold atoms. A sequence of appropriately designed light pulses interacts with an ensemble of cold rubidium atoms. The final population in the involved atomic levels determines a Gauss sum. With this technique we factor the number N=263193

  8. Where Does Latin "Sum" Come From?

    Science.gov (United States)

    Nyman, Martti A.

    1977-01-01

    The derivation of Latin "sum,""es(s),""est" from Indo-European "esmi,""est,""esti" involves methodological problems. It is claimed here that the development of "sum" from "esmi" is related to the origin of the variation "est-st" (less than"esti"). The study is primarily concerned with this process, but chronological suggestions are also made. (CHK)

  9. Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

    Science.gov (United States)

    Luczak, Susan E; Rosen, I Gary

    2014-08-01

    Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

  10. The End of Academia?: From "Cogito Ergo Sum" to "Consumo Ergo Sum" Germany and Malaysia in Comparison

    Science.gov (United States)

    Lim, Kim-Hui,; Har, Wai-Mun

    2008-01-01

    The lack of academic and thinking culture is getting more worried and becomes a major challenge to our academia society this 21st century. Few directions that move academia from "cogito ergo sum" to "consumo ergo sum" are actually leading us to "the end of academia". Those directions are: (1) the death of dialectic;…

  11. Gottfried sum rule and mesonic exchanges in deuteron

    International Nuclear Information System (INIS)

    Kaptari, L.P.

    1991-01-01

    Recent NMC data on the experimental value of the Gottfried Sum are discussed. It is shown that the Gottfried Sum is sensitive to the nuclear structure corrections, viz. themesonic exchanges and binding effects. A new estimation of the Gottfried Sum is given. The obtained result is close to the quark-parton prediction of 1/3. 11 refs.; 2 figs

  12. Statistical sums of strings on hyperellyptic surfaces

    International Nuclear Information System (INIS)

    Lebedev, D.; Morozov, A.

    1987-01-01

    Contributions of hyperellyptic surfaces to statistical sums of string theories are presented. Available results on hyperellyptic surface give the apportunity to check factorization of three-loop statsum. Some remarks on the vanishing statistical sum are presented

  13. A new generalization of Hardy–Berndt sums

    Indian Academy of Sciences (India)

    4,11,18]. Berndt and Goldberg [4] found analytic properties of these sums and established infinite trigonometric series representations for them. The most important properties of Hardy–. Berndt sums are reciprocity theorems due to Berndt [3] ...

  14. A Numerical Simulation Of The Pulse Sequence Reconstruction in AC Biased TESs With a β Source

    International Nuclear Information System (INIS)

    Ferrari, Lorenza; Vaccarone, Renzo

    2009-01-01

    We study the response of micro-calorimeters based on Ir/Au TESs biased by an AC voltage in the MHz range to the power input generated by beta emission in a Re source thermally connected to the calorimeter itself. The micro-calorimeter is assumed to work at -80 mK, and the energy pulses corresponding to the beta emission have an energy distributed between zero and 2.58 KeV. In this numerical simulation the TES is inserted in a RLC resonating circuit, with a low quality factor. The thermal conductivities between the source and the calorimeter and that from the calorimeter to the heat sink are non-linear. The superconducting to normal transition of the TES is described by a realistic non-linear model. The AC current at the carrier frequency, modulated by the changing resistance of the TES, is demodulated and the output is filtered. The resulting signal is analyzed to deduce the attainable time resolution and the linearity of the response.

  15. Zero-sum bias: perceived competition despite unlimited resources.

    Science.gov (United States)

    Meegan, Daniel V

    2010-01-01

    Zero-sum bias describes intuitively judging a situation to be zero-sum (i.e., resources gained by one party are matched by corresponding losses to another party) when it is actually non-zero-sum. The experimental participants were students at a university where students' grades are determined by how the quality of their work compares to a predetermined standard of quality rather than to the quality of the work produced by other students. This creates a non-zero-sum situation in which high grades are an unlimited resource. In three experiments, participants were shown the grade distribution after a majority of the students in a course had completed an assigned presentation, and asked to predict the grade of the next presenter. When many high grades had already been given, there was a corresponding increase in low grade predictions. This suggests a zero-sum bias, in which people perceive a competition for a limited resource despite unlimited resource availability. Interestingly, when many low grades had already been given, there was not a corresponding increase in high grade predictions. This suggests that a zero-sum heuristic is only applied in response to the allocation of desirable resources. A plausible explanation for the findings is that a zero-sum heuristic evolved as a cognitive adaptation to enable successful intra-group competition for limited resources. Implications for understanding inter-group interaction are also discussed.

  16. Design, Development and Implementation of the IR Signalling Techniques for Monitoring Ambient and Body Temperature in WBANs

    Directory of Open Access Journals (Sweden)

    Attiya Baqai

    2014-07-01

    Full Text Available Healthcare systems such as hospitals, homecare, telemedicine, and physical rehabilitation are expected to be revolutionized by WBAN (Wireless Body Area Networks. This research work aims to investigate, design, optimize, and demonstrate the applications of IR (Infra-Red communication systems in WBAN. It is aimed to establish a prototype WBAN system capable of measuring Ambient and Body Temperature using LM35 as temperature sensor and transmitting and receiving the data using optical signals. The corresponding technical challenges that have to be faced are also discussed in this paper. Investigations are carried out to efficiently design the hardware using low-cost and low power optical transceivers. The experimental results reveal the successful transmission and reception of Ambient and Body Temperatures over short ranges i.e. up to 3-4 meters. A simple IR transceiver with an LED (Light Emitting Diodes, TV remote control IC and Arduino microcontroller is designed to perform the transmission with sufficient accuracy and ease. Experiments are also performed to avoid interference from other sources like AC and TV remote control signals by implementing IR tags

  17. A bayesian approach to QCD sum rules

    International Nuclear Information System (INIS)

    Gubler, Philipp; Oka, Makoto

    2010-01-01

    QCD sum rules are analyzed with the help of the Maximum Entropy Method. We develop a new technique based on the Bayesion inference theory, which allows us to directly obtain the spectral function of a given correlator from the results of the operator product expansion given in the deep euclidean 4-momentum region. The most important advantage of this approach is that one does not have to make any a priori assumptions about the functional form of the spectral function, such as the 'pole + continuum' ansatz that has been widely used in QCD sum rule studies, but only needs to specify the asymptotic values of the spectral function at high and low energies as an input. As a first test of the applicability of this method, we have analyzed the sum rules of the ρ-meson, a case where the sum rules are known to work well. Our results show a clear peak structure in the region of the experimental mass of the ρ-meson. We thus demonstrate that the Maximum Entropy Method is successfully applied and that it is an efficient tool in the analysis of QCD sum rules. (author)

  18. The Eccentric-distance Sum of Some Graphs

    OpenAIRE

    P, Padmapriya; Mathad, Veena

    2017-01-01

    Let $G = (V,E)$ be a simple connected graph. Theeccentric-distance sum of $G$ is defined as$\\xi^{ds}(G) =\\ds\\sum_{\\{u,v\\}\\subseteq V(G)} [e(u)+e(v)] d(u,v)$, where $e(u)$ %\\dsis the eccentricity of the vertex $u$ in $G$ and $d(u,v)$ is thedistance between $u$ and $v$. In this paper, we establish formulaeto calculate the eccentric-distance sum for some graphs, namelywheel, star, broom, lollipop, double star, friendship, multi-stargraph and the join of $P_{n-2}$ and $P_2$.

  19. The eccentric-distance sum of some graphs

    Directory of Open Access Journals (Sweden)

    Padmapriya P

    2017-04-01

    Full Text Available Let $G = (V,E$ be a simple connected graph. Theeccentric-distance sum of $G$ is defined as$\\xi^{ds}(G =\\ds\\sum_{\\{u,v\\}\\subseteq V(G} [e(u+e(v] d(u,v$, where $e(u$ %\\dsis the eccentricity of the vertex $u$ in $G$ and $d(u,v$ is thedistance between $u$ and $v$. In this paper, we establish formulaeto calculate the eccentric-distance sum for some graphs, namelywheel, star, broom, lollipop, double star, friendship, multi-stargraph and the join of $P_{n-2}$ and $P_2$.

  20. QCD sum rules and applications to nuclear physics

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, T D [Maryland Univ., College Park, MD (United States). Dept. of Physics; [Washington Univ., Seattle, WA (United States). Dept. of Physics and Inst. for Nuclear Theory; Furnstahl, R J [Ohio State Univ., Columbus, OH (United States). Dept. of Physics; Griegel, D K [Maryland Univ., College Park, MD (United States). Dept. of Physics; [TRIUMF, Vancouver, BC (Canada); Xuemin, J

    1994-12-01

    Applications of QCD sum-rule methods to the physics of nuclei are reviewed, with an emphasis on calculations of baryon self-energies in infinite nuclear matter. The sum-rule approach relates spectral properties of hadrons propagating in the finite-density medium, such as optical potentials for quasinucleons, to matrix elements of QCD composite operators (condensates). The vacuum formalism for QCD sum rules is generalized to finite density, and the strategy and implementation of the approach is discussed. Predictions for baryon self-energies are compared to those suggested by relativistic nuclear physics phenomenology. Sum rules for vector mesons in dense nuclear matter are also considered. (author). 153 refs., 8 figs.

  1. QCD sum rules and applications to nuclear physics

    International Nuclear Information System (INIS)

    Cohen, T.D.; Xuemin, J.

    1994-12-01

    Applications of QCD sum-rule methods to the physics of nuclei are reviewed, with an emphasis on calculations of baryon self-energies in infinite nuclear matter. The sum-rule approach relates spectral properties of hadrons propagating in the finite-density medium, such as optical potentials for quasinucleons, to matrix elements of QCD composite operators (condensates). The vacuum formalism for QCD sum rules is generalized to finite density, and the strategy and implementation of the approach is discussed. Predictions for baryon self-energies are compared to those suggested by relativistic nuclear physics phenomenology. Sum rules for vector mesons in dense nuclear matter are also considered. (author)

  2. Deriving the Normalized Min-Sum Algorithm from Cooperative Optimization

    OpenAIRE

    Huang, Xiaofei

    2006-01-01

    The normalized min-sum algorithm can achieve near-optimal performance at decoding LDPC codes. However, it is a critical question to understand the mathematical principle underlying the algorithm. Traditionally, people thought that the normalized min-sum algorithm is a good approximation to the sum-product algorithm, the best known algorithm for decoding LDPC codes and Turbo codes. This paper offers an alternative approach to understand the normalized min-sum algorithm. The algorithm is derive...

  3. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  4. On poisson-stopped-sums that are mixed poisson

    OpenAIRE

    Valero Baya, Jordi; Pérez Casany, Marta; Ginebra Molins, Josep

    2013-01-01

    Maceda (1948) characterized the mixed Poisson distributions that are Poisson-stopped-sum distributions based on the mixing distribution. In an alternative characterization of the same set of distributions here the Poisson-stopped-sum distributions that are mixed Poisson distributions is proved to be the set of Poisson-stopped-sums of either a mixture of zero-truncated Poisson distributions or a zero-modification of it. Peer Reviewed

  5. Adding a dimension to the infrared spectra of interfaces using heterodyne detected 2D sum-frequency generation (HD 2D SFG) spectroscopy.

    Science.gov (United States)

    Xiong, Wei; Laaser, Jennifer E; Mehlenbacher, Randy D; Zanni, Martin T

    2011-12-27

    In the last ten years, two-dimensional infrared spectroscopy has become an important technique for studying molecular structures and dynamics. We report the implementation of heterodyne detected two-dimensional sum-frequency generation (HD 2D SFG) spectroscopy, which is the analog of 2D infrared (2D IR) spectroscopy, but is selective to noncentrosymmetric systems such as interfaces. We implement the technique using mid-IR pulse shaping, which enables rapid scanning, phase cycling, and automatic phasing. Absorptive spectra are obtained, that have the highest frequency resolution possible, from which we extract the rephasing and nonrephasing signals that are sometimes preferred. Using this technique, we measure the vibrational mode of CO adsorbed on a polycrystalline Pt surface. The 2D spectrum reveals a significant inhomogenous contribution to the spectral line shape, which is quantified by simulations. This observation indicates that the surface conformation and environment of CO molecules is more complicated than the simple "atop" configuration assumed in previous work. Our method can be straightforwardly incorporated into many existing SFG spectrometers. The technique enables one to quantify inhomogeneity, vibrational couplings, spectral diffusion, chemical exchange, and many other properties analogous to 2D IR spectroscopy, but specifically for interfaces.

  6. Volume sums of polar Blaschke–Minkowski homomorphisms

    Indian Academy of Sciences (India)

    In this article, we establish Minkowski and Aleksandrov–Fenchel type inequalities for the volume sum of polars of Blaschke–Minkowski homomorphisms. Keywords. Blaschke–Minkowski homomorphism; volume differences; volume sum; projection body operator. 2010 Mathematics Subject Classification. 52A40, 52A30. 1.

  7. Gaussian sum rules for optical functions

    International Nuclear Information System (INIS)

    Kimel, I.

    1981-12-01

    A new (Gaussian) type of sum rules (GSR) for several optical functions, is presented. The functions considered are: dielectric permeability, refractive index, energy loss function, rotatory power and ellipticity (circular dichroism). While reducing to the usual type of sum rules in a certain limit, the GSR contain in general, a Gaussian factor that serves to improve convergence. GSR might be useful in analysing experimental data. (Author) [pt

  8. The Gross-Llewellyn Smith sum rule

    International Nuclear Information System (INIS)

    Scott, W.G.

    1981-01-01

    We present the most recent data on the Gross-Llewellyn Smith sum rule obtained from the combined BEBC Narrow Band Neon and GGM-PS Freon neutrino/antineutrino experiments. The data for the Gross-Llewellyn Smith sum rule as a function of q 2 suggest a smaller value for the QCD coupling constant parameter Λ than is obtained from the analysis of the higher moments. (author)

  9. Zero-sum bias: perceived competition despite unlimited resources

    Directory of Open Access Journals (Sweden)

    Daniel V Meegan

    2010-11-01

    Full Text Available Zero-sum bias describes intuitively judging a situation to be zero-sum (i.e., resources gained by one party are matched by corresponding losses to another party when it is actually non-zero-sum. The experimental participants were students at a university where students’ grades are determined by how the quality of their work compares to a predetermined standard of quality rather than to the quality of the work produced by other students. This creates a non-zero-sum situation in which high grades are an unlimited resource. In three experiments, participants were shown the grade distribution after a majority of the students in a course had completed an assigned presentation, and asked to predict the grade of the next presenter. When many high grades had already been given, there was a corresponding increase in low grade predictions. This suggests a zero-sum bias, in which people perceive a competition for a limited resource despite unlimited resource availability. Interestingly, when many low grades had already been given, there was not a corresponding increase in high grade predictions. This suggests that a zero-sum heuristic is only applied in response to the allocation of desirable resources. A plausible explanation for the findings is that a zero-sum heuristic evolved as a cognitive adaptation to enable successful intra-group competition for limited resources. Implications for understanding inter-group interaction are also discussed.

  10. Compound sums and their applications in finance

    NARCIS (Netherlands)

    R. Helmers (Roelof); B. Tarigan

    2003-01-01

    textabstractCompound sums arise frequently in insurance (total claim size in a portfolio) and in accountancy (total error amount in audit populations). As the normal approximation for compound sums usually performs very badly, one may look for better methods for approximating the distribution of a

  11. Superconvergent sum rules for the normal reflectivity

    International Nuclear Information System (INIS)

    Furuya, K.; Zimerman, A.H.; Villani, A.

    1976-05-01

    Families of superconvergent relations for the normal reflectivity function are written. Sum rules connecting the difference of phases of the reflectivities of two materials are also considered. Finally superconvergence relations and sum rules for magneto-reflectivity in the Faraday and Voigt regimes are also studied

  12. Singular f-sum rule for superfluid 4He

    International Nuclear Information System (INIS)

    Wong, V.K.

    1979-01-01

    The validity and applicability to inelastic neutron scattering of a singular f-sum rule for superfluid helium, proposed by Griffin to explain the rhosub(s) dependence in S(k, ω) as observed by Woods and Svensson, are examined in the light of similar sum rules rigorously derived for anharmonic crystals and Bose liquids. It is concluded that the singular f-sum rules are only of microscopic interest. (Auth,)

  13. Lattice QCD evaluation of baryon magnetic moment sum rules

    International Nuclear Information System (INIS)

    Leinweber, D.B.

    1991-05-01

    Magnetic moment combinations and sum rules are evaluated using recent results for the magnetic moments of octet baryons determined in a numerical simulation of quenched QCD. The model-independent and parameter-free results of the lattice calculations remove some of the confusion and contradiction surrounding past magnetic moment sum rule analyses. The lattice results reveal the underlying quark dynamics investigated by magnetic moment sum rules and indicate the origin of magnetic moment quenching for the non-strange quarks in Σ. In contrast to previous sum rule analyses, the magnetic moments of nonstrange quarks in Ξ are seen to be enhanced in the lattice results. In most cases, the spin-dependent dynamics and center-of-mass effects giving rise to baryon dependence of the quark moments are seen to be sufficient to violate the sum rules in agreement with experimental measurements. In turn, the sum rules are used to further examine the results of the lattice simulation. The Sachs sum rule suggests that quark loop contributions not included in present lattice calculations may play a key role in removing the discrepancies between lattice and experimental ratios of magnetic moments. This is supported by other sum rules sensitive to quark loop contributions. A measure of the isospin symmetry breaking in the effective quark moments due to quark loop contributions is in agreement with model expectations. (Author) 16 refs., 2 figs., 2 tabs

  14. Unidirectional ring-laser operation using sum-frequency mixing

    DEFF Research Database (Denmark)

    Tidemand-Lichtenberg, Peter; Cheng, Haynes Pak Hay; Pedersen, Christian

    2010-01-01

    A technique enforcing unidirectional operation of ring lasers is proposed and demonstrated. The approach relies on sum-frequency mixing between a single-pass laser and one of the two counterpropagating intracavity fields of the ring laser. Sum-frequency mixing introduces a parametric loss for the...... where lossless second-order nonlinear materials are available. Numerical modeling and experimental demonstration of parametric-induced unidirectional operation of a diode-pumped solid-state 1342 nm cw ring laser are presented.......A technique enforcing unidirectional operation of ring lasers is proposed and demonstrated. The approach relies on sum-frequency mixing between a single-pass laser and one of the two counterpropagating intracavity fields of the ring laser. Sum-frequency mixing introduces a parametric loss...

  15. irGPU.proton.Net: Irregular strong charge interaction networks of protonatable groups in protein molecules--a GPU solver using the fast multipole method and statistical thermodynamics.

    Science.gov (United States)

    Kantardjiev, Alexander A

    2015-04-05

    A cluster of strongly interacting ionization groups in protein molecules with irregular ionization behavior is suggestive for specific structure-function relationship. However, their computational treatment is unconventional (e.g., lack of convergence in naive self-consistent iterative algorithm). The stringent evaluation requires evaluation of Boltzmann averaged statistical mechanics sums and electrostatic energy estimation for each microstate. irGPU: Irregular strong interactions in proteins--a GPU solver is novel solution to a versatile problem in protein biophysics--atypical protonation behavior of coupled groups. The computational severity of the problem is alleviated by parallelization (via GPU kernels) which is applied for the electrostatic interaction evaluation (including explicit electrostatics via the fast multipole method) as well as statistical mechanics sums (partition function) estimation. Special attention is given to the ease of the service and encapsulation of theoretical details without sacrificing rigor of computational procedures. irGPU is not just a solution-in-principle but a promising practical application with potential to entice community into deeper understanding of principles governing biomolecule mechanisms. © 2015 Wiley Periodicals, Inc.

  16. Voltage-probe-position dependence and magnetic-flux contribution to the measured voltage in ac transport measurements: which measuring circuit determines the real losses?

    International Nuclear Information System (INIS)

    Pe, T.; McDonald, J.; Clem, J.R.

    1995-01-01

    The voltage V ab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path C s through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path C s and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent ac loss (the time average of the product IV ab ) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) ac loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real ac losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit dimensions. Corresponding calculations also are presented for a sample of elliptical cross section

  17. Chiral corrections to the Adler-Weisberger sum rule

    Science.gov (United States)

    Beane, Silas R.; Klco, Natalie

    2016-12-01

    The Adler-Weisberger sum rule for the nucleon axial-vector charge, gA , offers a unique signature of chiral symmetry and its breaking in QCD. Its derivation relies on both algebraic aspects of chiral symmetry, which guarantee the convergence of the sum rule, and dynamical aspects of chiral symmetry breaking—as exploited using chiral perturbation theory—which allow the rigorous inclusion of explicit chiral symmetry breaking effects due to light-quark masses. The original derivations obtained the sum rule in the chiral limit and, without the benefit of chiral perturbation theory, made various attempts at extrapolating to nonvanishing pion masses. In this paper, the leading, universal, chiral corrections to the chiral-limit sum rule are obtained. Using PDG data, a recent parametrization of the pion-nucleon total cross sections in the resonance region given by the SAID group, as well as recent Roy-Steiner equation determinations of subthreshold amplitudes, threshold parameters, and correlated low-energy constants, the Adler-Weisberger sum rule is confronted with experimental data. With uncertainty estimates associated with the cross-section parametrization, the Goldberger-Treimann discrepancy, and the truncation of the sum rule at O (Mπ4) in the chiral expansion, this work finds gA=1.248 ±0.010 ±0.007 ±0.013 .

  18. The AC photovoltaic module is here!

    Science.gov (United States)

    Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

    1997-02-01

    This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

  19. Analytic and algorithmic aspects of generalized harmonic sums and polylogarithms

    International Nuclear Information System (INIS)

    Ablinger, Jakob; Schneider, Carsten

    2013-01-01

    In recent three-loop calculations of massive Feynman integrals within Quantum Chromodynamics (QCD) and, e.g., in recent combinatorial problems the so-called generalized harmonic sums (in short S-sums) arise. They are characterized by rational (or real) numerator weights also different from ±1. In this article we explore the algorithmic and analytic properties of these sums systematically. We work out the Mellin and inverse Mellin transform which connects the sums under consideration with the associated Poincare iterated integrals, also called generalized harmonic polylogarithms. In this regard, we obtain explicit analytic continuations by means of asymptotic expansions of the S-sums which started to occur frequently in current QCD calculations. In addition, we derive algebraic and structural relations, like differentiation w.r.t. the external summation index and different multi-argument relations, for the compactification of S-sum expressions. Finally, we calculate algebraic relations for infinite S-sums, or equivalently for generalized harmonic polylogarithms evaluated at special values. The corresponding algorithms and relations are encoded in the computer algebra package HarmonicSums.

  20. Analytic and algorithmic aspects of generalized harmonic sums and polylogarithms

    Energy Technology Data Exchange (ETDEWEB)

    Ablinger, Jakob; Schneider, Carsten [Johannes Kepler Univ., Linz (Austria). Research Inst. for Symbolic Computation; Bluemlein, Johannes [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)

    2013-01-15

    In recent three-loop calculations of massive Feynman integrals within Quantum Chromodynamics (QCD) and, e.g., in recent combinatorial problems the so-called generalized harmonic sums (in short S-sums) arise. They are characterized by rational (or real) numerator weights also different from {+-}1. In this article we explore the algorithmic and analytic properties of these sums systematically. We work out the Mellin and inverse Mellin transform which connects the sums under consideration with the associated Poincare iterated integrals, also called generalized harmonic polylogarithms. In this regard, we obtain explicit analytic continuations by means of asymptotic expansions of the S-sums which started to occur frequently in current QCD calculations. In addition, we derive algebraic and structural relations, like differentiation w.r.t. the external summation index and different multi-argument relations, for the compactification of S-sum expressions. Finally, we calculate algebraic relations for infinite S-sums, or equivalently for generalized harmonic polylogarithms evaluated at special values. The corresponding algorithms and relations are encoded in the computer algebra package HarmonicSums.

  1. Analytic and algorithmic aspects of generalized harmonic sums and polylogarithms

    Energy Technology Data Exchange (ETDEWEB)

    Ablinger, Jakob; Schneider, Carsten [Research Institute for Symbolic Computation (RISC), Johannes Kepler University, Altenbergerstraße 69, A-4040, Linz (Austria); Blümlein, Johannes [Deutsches Elektronen–Synchrotron, DESY, Platanenallee 6, D-15738 Zeuthen (Germany)

    2013-08-15

    In recent three-loop calculations of massive Feynman integrals within Quantum Chromodynamics (QCD) and, e.g., in recent combinatorial problems the so-called generalized harmonic sums (in short S-sums) arise. They are characterized by rational (or real) numerator weights also different from ±1. In this article we explore the algorithmic and analytic properties of these sums systematically. We work out the Mellin and inverse Mellin transform which connects the sums under consideration with the associated Poincaré iterated integrals, also called generalized harmonic polylogarithms. In this regard, we obtain explicit analytic continuations by means of asymptotic expansions of the S-sums which started to occur frequently in current QCD calculations. In addition, we derive algebraic and structural relations, like differentiation with respect to the external summation index and different multi-argument relations, for the compactification of S-sum expressions. Finally, we calculate algebraic relations for infinite S-sums, or equivalently for generalized harmonic polylogarithms evaluated at special values. The corresponding algorithms and relations are encoded in the computer algebra package HarmonicSums.

  2. Premium Pricing of Liability Insurance Using Random Sum Model

    Directory of Open Access Journals (Sweden)

    Mujiati Dwi Kartikasari

    2017-03-01

    Full Text Available Premium pricing is one of important activities in insurance. Nonlife insurance premium is calculated from expected value of historical data claims. The historical data claims are collected so that it forms a sum of independent random number which is called random sum. In premium pricing using random sum, claim frequency distribution and claim severity distribution are combined. The combination of these distributions is called compound distribution. By using liability claim insurance data, we analyze premium pricing using random sum model based on compound distribution

  3. Evaluation of the multi-sums for large scale problems

    International Nuclear Information System (INIS)

    Bluemlein, J.; Hasselhuhn, A.; Schneider, C.

    2012-02-01

    A big class of Feynman integrals, in particular, the coefficients of their Laurent series expansion w.r.t. the dimension parameter ε can be transformed to multi-sums over hypergeometric terms and harmonic sums. In this article, we present a general summation method based on difference fields that simplifies these multi--sums by transforming them from inside to outside to representations in terms of indefinite nested sums and products. In particular, we present techniques that assist in the task to simplify huge expressions of such multi-sums in a completely automatic fashion. The ideas are illustrated on new calculations coming from 3-loop topologies of gluonic massive operator matrix elements containing two fermion lines, which contribute to the transition matrix elements in the variable flavor scheme. (orig.)

  4. Evaluation of the multi-sums for large scale problems

    Energy Technology Data Exchange (ETDEWEB)

    Bluemlein, J.; Hasselhuhn, A. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Schneider, C. [Johannes Kepler Univ., Linz (Austria). Research Inst. for Symbolic Computation

    2012-02-15

    A big class of Feynman integrals, in particular, the coefficients of their Laurent series expansion w.r.t. the dimension parameter {epsilon} can be transformed to multi-sums over hypergeometric terms and harmonic sums. In this article, we present a general summation method based on difference fields that simplifies these multi--sums by transforming them from inside to outside to representations in terms of indefinite nested sums and products. In particular, we present techniques that assist in the task to simplify huge expressions of such multi-sums in a completely automatic fashion. The ideas are illustrated on new calculations coming from 3-loop topologies of gluonic massive operator matrix elements containing two fermion lines, which contribute to the transition matrix elements in the variable flavor scheme. (orig.)

  5. An electrophysiological signature of summed similarity in visual working memory.

    Science.gov (United States)

    van Vugt, Marieke K; Sekuler, Robert; Wilson, Hugh R; Kahana, Michael J

    2013-05-01

    Summed-similarity models of short-term item recognition posit that participants base their judgments of an item's prior occurrence on that item's summed similarity to the ensemble of items on the remembered list. We examined the neural predictions of these models in 3 short-term recognition memory experiments using electrocorticographic/depth electrode recordings and scalp electroencephalography. On each experimental trial, participants judged whether a test face had been among a small set of recently studied faces. Consistent with summed-similarity theory, participants' tendency to endorse a test item increased as a function of its summed similarity to the items on the just-studied list. To characterize this behavioral effect of summed similarity, we successfully fit a summed-similarity model to individual participant data from each experiment. Using the parameters determined from fitting the summed-similarity model to the behavioral data, we examined the relation between summed similarity and brain activity. We found that 4-9 Hz theta activity in the medial temporal lobe and 2-4 Hz delta activity recorded from frontal and parietal cortices increased with summed similarity. These findings demonstrate direct neural correlates of the similarity computations that form the foundation of several major cognitive theories of human recognition memory. PsycINFO Database Record (c) 2013 APA, all rights reserved.

  6. Agallamh Oisín agus Phádraig: léamha ón bparaitéacs

    Directory of Open Access Journals (Sweden)

    Síle Ní Mhurchú

    2016-10-01

    Full Text Available San aiste seo, baintear úsáid as coincheap an pharaitéacs le Gérard Genette chun anailís a dhéanamh ar na cóipeanna lámhscríbhinne d’Agallamh Oisín agus Phádraig. Léiríonn na paraitéacsanna seo go raibh níos mó i gceist le saothar an scríobhaí ná cóipeáil: rinne mórán acu machnamh dian ar an ábhar a bhí á scríobh acu agus thugadar freagra ar ghluaiseachtaí stairiúla agus intleachtúla a bhí ag dul i bhfeidhm orthu ina gcuid scríbhinní paraitéacsúla. Féachtar ar na hathruithe a rinneadh ar chur i láthair na dtéacsanna le himeacht na mblianta agus ar na scríbhinní paraitéacsúla éagsúla — teidil, réamhráite, gluaiseanna, aistriúcháin, agus téacsanna eile nach iad — a cuireadh leis an Agallamh. Thug an paraitéacs spás do scríobhaithe inar fhéad siad dul i gcion ar phátrúin agus ar léitheoirí eile agus is iad seo a leanas na príomhthéamaí a eascraíonn ó anailís ar pharaitéacsanna an Agallaimh: cuntais na scríobhaithe ar cheird na scríbhneoireachta; athruithe i leagan amach na dtéacsanna faoi thionchar an chlóphreasa; an Béarla sa pharaitéacs; tagairtí do shaothar James Macpherson; meath na Gaeilge. Ar deireadh, fiafraítear an dtugann na scríbhinní paraitéacsúla léargas dúinn ar na mothúcháin a mhúscail an tAgallamh ina léitheoirí agus ina éisteoirí.

  7. Extremal extensions for the sum of nonnegative selfadjoint relations

    NARCIS (Netherlands)

    Hassi, Seppo; Sandovici, Adrian; De Snoo, Henk; Winkler, Henrik

    2007-01-01

    The sum A + B of two nonnegative selfadjoint relations (multivalued operators) A and B is a nonnegative relation. The class of all extremal extensions of the sum A + B is characterized as products of relations via an auxiliary Hilbert space associated with A and B. The so-called form sum extension

  8. Compound Poisson Approximations for Sums of Random Variables

    OpenAIRE

    Serfozo, Richard F.

    1986-01-01

    We show that a sum of dependent random variables is approximately compound Poisson when the variables are rarely nonzero and, given they are nonzero, their conditional distributions are nearly identical. We give several upper bounds on the total-variation distance between the distribution of such a sum and a compound Poisson distribution. Included is an example for Markovian occurrences of a rare event. Our bounds are consistent with those that are known for Poisson approximations for sums of...

  9. Levitação acústica

    OpenAIRE

    Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

    2015-01-01

    A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

  10. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  11. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  12. 28 CFR 523.16 - Lump sum awards.

    Science.gov (United States)

    2010-07-01

    ... satisfactory performance of an unusually hazardous assignment; (c) An act which protects the lives of staff or... TRANSFER COMPUTATION OF SENTENCE Extra Good Time § 523.16 Lump sum awards. Any staff member may recommend... award is calculated. No seniority is accrued for such awards. Staff may recommend lump sum awards of...

  13. Systematics of strength function sum rules

    Directory of Open Access Journals (Sweden)

    Calvin W. Johnson

    2015-11-01

    Full Text Available Sum rules provide useful insights into transition strength functions and are often expressed as expectation values of an operator. In this letter I demonstrate that non-energy-weighted transition sum rules have strong secular dependences on the energy of the initial state. Such non-trivial systematics have consequences: the simplification suggested by the generalized Brink–Axel hypothesis, for example, does not hold for most cases, though it weakly holds in at least some cases for electric dipole transitions. Furthermore, I show the systematics can be understood through spectral distribution theory, calculated via traces of operators and of products of operators. Seen through this lens, violation of the generalized Brink–Axel hypothesis is unsurprising: one expects sum rules to evolve with excitation energy. Furthermore, to lowest order the slope of the secular evolution can be traced to a component of the Hamiltonian being positive (repulsive or negative (attractive.

  14. Vacuum structure and QCD sum rules

    International Nuclear Information System (INIS)

    Shifman, M.A.

    1992-01-01

    The method of the QCD sum rules was and still is one of the most productive tools in a wide range of problems associated with the hadronic phenomenology. Many heuristic ideas, computational devices, specific formulae which are useful to theorists working not only in hadronic physics, have been accumulated in this method. Some of the results and approaches which have originally been developed in connection with the QCD sum rules can be and are successfully applied in related fields, as supersymmetric gauge theories, nontraditional schemes of quarks and leptons, etc. The amount of literature on these and other more basic problems in hadronic physics has grown enormously in recent years. This volume presents a collection of papers which provide an overview of all basic elements of the sum rule approach and priority has been given to the works which seemed most useful from a pedagogical point of view

  15. Vacuum structure and QCD sum rules

    International Nuclear Information System (INIS)

    Shifman, M.A.

    1992-01-01

    The method of the QCD sum rules was and still is one of the most productive tools in a wide range of problems associated with the hadronic phenomenology. Many heuristic ideas, computational devices, specific formulae which are useful to theorists working not only in hadronic physics, have been accumulated in this method. Some of the results and approaches which have been originally developed in connection with the QCD sum rules can be and are successfully applied in related fields, such as supersymmetric gauge theories, nontraditional schemes of quarks and leptons, etc. The amount of literature on these and other more basic problems in hadronic physics has grown enormously in recent years. This collection of papers provides an overview of all basic elements of the sum rule approach. Priority has been given to those works which seemed most useful from a pedagogical point of view

  16. Moments of the weighted sum-of-digits function | Larcher ...

    African Journals Online (AJOL)

    The weighted sum-of-digits function is a slight generalization of the well known sum-of-digits function with the difference that here the digits are weighted by some weights. So for example in this concept also the alternated sum-of-digits function is included. In this paper we compute the first and the second moment of the ...

  17. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  18. Development of the modified sum-peak method and its application

    International Nuclear Information System (INIS)

    Ogata, Y.; Miyahara, H.; Ishihara, M.; Ishigure, N.; Yamamoto, S.; Kojima, S.

    2016-01-01

    As the sum-peak method requires the total count rate as well as the peak count rates and the sum peak count rate, this meets difficulties when a sample contains other radionuclides than the one to be measured. To solve the problem, a new method using solely the peak and the sum peak count rates was developed. The method was theoretically and experimentally confirmed using "6"0Co, "2"2Na and "1"3"4Cs. We demonstrate that the modified sum-peak method is quite simple and practical and is useful to measure multiple nuclides. - Highlights: • A modified sum-peak method for simple radioactivity measurement was developed. • The method solely requires the peak count rates and the sum peak count rate. • The method is applicable to multiple radionuclides.

  19. AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

    International Nuclear Information System (INIS)

    McCarthy, Christina B.; Theilmann, David A.

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

  20. Subset-sum phase transitions and data compression

    Science.gov (United States)

    Merhav, Neri

    2011-09-01

    We propose a rigorous analysis approach for the subset-sum problem in the context of lossless data compression, where the phase transition of the subset-sum problem is directly related to the passage between ambiguous and non-ambiguous decompression, for a compression scheme that is based on specifying the sequence composition. The proposed analysis lends itself to straightforward extensions in several directions of interest, including non-binary alphabets, incorporation of side information at the decoder (Slepian-Wolf coding), and coding schemes based on multiple subset sums. It is also demonstrated that the proposed technique can be used to analyze the critical behavior in a more involved situation where the sequence composition is not specified by the encoder.

  1. Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

    Energy Technology Data Exchange (ETDEWEB)

    Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

    2008-07-01

    Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

  2. Selective detection of crystalline cellulose in plant cell walls with sum-frequency-generation (SFG) vibration spectroscopy.

    Science.gov (United States)

    Barnette, Anna L; Bradley, Laura C; Veres, Brandon D; Schreiner, Edward P; Park, Yong Bum; Park, Junyeong; Park, Sunkyu; Kim, Seong H

    2011-07-11

    The selective detection of crystalline cellulose in biomass was demonstrated with sum-frequency-generation (SFG) vibration spectroscopy. SFG is a second-order nonlinear optical response from a system where the optical centrosymmetry is broken. In secondary plant cell walls that contain mostly cellulose, hemicellulose, and lignin with varying concentrations, only certain vibration modes in the crystalline cellulose structure can meet the noninversion symmetry requirements. Thus, SFG can be used to detect and analyze crystalline cellulose selectively in lignocellulosic biomass without extraction of noncellulosic species from biomass or deconvolution of amorphous spectra. The selective detection of crystalline cellulose in lignocellulosic biomass is not readily achievable with other techniques such as XRD, solid-state NMR, IR, and Raman analyses. Therefore, the SFG analysis presents a unique opportunity to reveal the cellulose crystalline structure in lignocellulosic biomass.

  3. Design and Calibration of a Dispersive Imaging Spectrometer Adaptor for a Fast IR Camera on NSTX-U

    Science.gov (United States)

    Reksoatmodjo, Richard; Gray, Travis; Princeton Plasma Physics Laboratory Team

    2017-10-01

    A dispersive spectrometer adaptor was designed, constructed and calibrated for use on a fast infrared camera employed to measure temperatures on the lower divertor tiles of the NSTX-U tokamak. This adaptor efficiently and evenly filters and distributes long-wavelength infrared photons between 8.0 and 12.0 microns across the 128x128 pixel detector of the fast IR camera. By determining the width of these separated wavelength bands across the camera detector, and then determining the corresponding average photon count for each photon wavelength, a very accurate measurement of the temperature, and thus heat flux, of the divertor tiles can be calculated using Plank's law. This approach of designing an exterior dispersive adaptor for the fast IR camera allows accurate temperature measurements to be made of materials with unknown emissivity. Further, the relative simplicity and affordability of this adaptor design provides an attractive option over more expensive, slower, dispersive IR camera systems. This work was made possible by funding from the Department of Energy for the Summer Undergraduate Laboratory Internship (SULI) program. This work is supported by the US DOE Contract No. DE-AC02-09CH11466.

  4. Spectral function sum rules in quantum chromodynamics. I. Charged currents sector

    International Nuclear Information System (INIS)

    Floratos, E.G.; Narison, Stephan; Rafael, Eduardo de.

    1978-07-01

    The Weinberg sum rules of the algebra of currents are reconsidered in the light of quantum chromodynamics (QCD). The authors derive new finite energy sum rules which replace the old Weinberg sum rules. The new sum rules are convergent and the rate of convergence is explicitly calculated in perturbative QCD at the one loop approximation. Phenomenological applications of these sum rules in the charged current sector are also discussed

  5. Structural relations between nested harmonic sums

    International Nuclear Information System (INIS)

    Bluemlein, J.

    2008-07-01

    We describe the structural relations between nested harmonic sums emerging in the description of physical single scale quantities up to the 3-loop level in renormalizable gauge field theories. These are weight w=6 harmonic sums. We identify universal basic functions which allow to describe a large class of physical quantities and derive their complex analysis. For the 3-loop QCD Wilson coefficients 35 basic functions are required, whereas a subset of 15 describes the 3-loop anomalous dimensions. (orig.)

  6. Structural relations between nested harmonic sums

    Energy Technology Data Exchange (ETDEWEB)

    Bluemlein, J.

    2008-07-15

    We describe the structural relations between nested harmonic sums emerging in the description of physical single scale quantities up to the 3-loop level in renormalizable gauge field theories. These are weight w=6 harmonic sums. We identify universal basic functions which allow to describe a large class of physical quantities and derive their complex analysis. For the 3-loop QCD Wilson coefficients 35 basic functions are required, whereas a subset of 15 describes the 3-loop anomalous dimensions. (orig.)

  7. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Science.gov (United States)

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  8. Spin orientations of the spin-half Ir(4+) ions in Sr3NiIrO6, Sr2IrO4, and Na2IrO3: Density functional, perturbation theory, and Madelung potential analyses.

    Science.gov (United States)

    Gordon, Elijah E; Xiang, Hongjun; Köhler, Jürgen; Whangbo, Myung-Hwan

    2016-03-21

    The spins of the low-spin Ir(4+) (S = 1/2, d(5)) ions at the octahedral sites of the oxides Sr3NiIrO6, Sr2IrO4, and Na2IrO3 exhibit preferred orientations with respect to their IrO6 octahedra. We evaluated the magnetic anisotropies of these S = 1/2 ions on the basis of density functional theory (DFT) calculations including spin-orbit coupling (SOC), and probed their origin by performing perturbation theory analyses with SOC as perturbation within the LS coupling scheme. The observed spin orientations of Sr3NiIrO6 and Sr2IrO4 are correctly predicted by DFT calculations, and are accounted for by the perturbation theory analysis. As for the spin orientation of Na2IrO3, both experimental studies and DFT calculations have not been unequivocal. Our analysis reveals that the Ir(4+) spin orientation of Na2IrO3 should have nonzero components along the c- and a-axis directions. The spin orientations determined by DFT calculations are sensitive to the accuracy of the crystal structures employed, which is explained by perturbation theory analyses when interactions between adjacent Ir(4+) ions are taken into consideration. There are indications implying that the 5d electrons of Na2IrO3 are less strongly localized compared with those of Sr3NiIrO6 and Sr2IrO4. This implication was confirmed by showing that the Madelung potentials of the Ir(4+) ions are less negative in Na2IrO3 than in Sr3NiIrO6 and Sr2IrO4. Most transition-metal S = 1/2 ions do have magnetic anisotropies because the SOC induces interactions among their crystal-field split d-states, and the associated mixing of the states modifies only the orbital parts of the states. This finding cannot be mimicked by a spin Hamiltonian because this model Hamiltonian lacks the orbital degree of freedom, thereby leading to the spin-half syndrome. The spin-orbital entanglement for the 5d spin-half ions Ir(4+) is not as strong as has been assumed.

  9. The α3S corrections to the Bjorken sum rule for polarized electro-production and to the Gross-Llewellyn Smith sum rule

    International Nuclear Information System (INIS)

    Larin, S.A.; Nationaal Inst. voor Kernfysica en Hoge-Energiefysica; Vermaseren, J.A.M.

    1990-01-01

    The next-next-to-leading order QCD corrections to the Gross-Llewellyn Smith sum rule for deep inelastic neutrino-nucleon scattering and to the Bjorken sum rule for polarized electron-nucleon scattering have been computed. This involved the proper treatment of γ 5 inside the loop integrals with dimensional regularization. It is found that the difference between the two sum rules are entirely due to a class of 6 three loop graphs and is of the order of 1% of the leading QCD term. Hence the Q 2 behavior of both sum rules should be the same if the physics is described adequately by the lower order terms of perturbative QCD. (author). 12 refs.; 2 figs.; 4 tabs

  10. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  11. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  12. Cosmic-ray sum rules

    International Nuclear Information System (INIS)

    Frandsen, Mads T.; Masina, Isabella; Sannino, Francesco

    2011-01-01

    We introduce new sum rules allowing to determine universal properties of the unknown component of the cosmic rays; we show how they can be used to predict the positron fraction at energies not yet explored by current experiments, and to constrain specific models.

  13. Experimental results of the betatron sum resonance

    International Nuclear Information System (INIS)

    Wang, Y.; Ball, M.; Brabson, B.

    1993-06-01

    The experimental observations of motion near the betatron sum resonance, ν x + 2ν z = 13, are presented. A fast quadrupole (Panofsky-style ferrite picture-frame magnet with a pulsed power supplier) producing a betatron tune shift of the order of 0.03 at rise time of 1 μs was used. This quadrupole was used to produce betatron tunes which jumped past and then crossed back through a betatron sum resonance line. The beam response as function of initial betatron amplitudes were recorded turn by turn. The correlated growth of the action variables, J x and J z , was observed. The phase space plots in the resonance frame reveal the features of particle motion near the nonlinear sum resonance region

  14. Sum rules for the quarkonium systems

    International Nuclear Information System (INIS)

    Burnel, A.; Caprasse, H.

    1980-01-01

    In the framework of the radial Schroedinger equation we derive in a very simple way sum rules relating the potential to physical quantities such as the energy eigenvalues and the square of the lth derivative of the eigenfunctions at the origin. These sum rules contain as particular cases well-known results such as the quantum version of the Clausius theorem in classical mechanics as well as Kramers's relations for the Coulomb potential. Several illustrations are given and the possibilities of applying them to the quarkonium systems are considered

  15. On contribution of instantons to nucleon sum rules

    International Nuclear Information System (INIS)

    Dorokhov, A.E.; Kochelev, N.I.

    1989-01-01

    The contribution of instantons to nucleon QCD sum rules is obtained. It is shown that this contribution does provide stabilization of the sum rules and leads to formation of a nucleon as a bound state of quarks in the instanton field. 17 refs.; 3 figs

  16. Compton scattering from nuclei and photo-absorption sum rules

    International Nuclear Information System (INIS)

    Gorchtein, Mikhail; Hobbs, Timothy; Londergan, J. Timothy; Szczepaniak, Adam P.

    2011-01-01

    We revisit the photo-absorption sum rule for real Compton scattering from the proton and from nuclear targets. In analogy with the Thomas-Reiche-Kuhn sum rule appropriate at low energies, we propose a new 'constituent quark model' sum rule that relates the integrated strength of hadronic resonances to the scattering amplitude on constituent quarks. We study the constituent quark model sum rule for several nuclear targets. In addition, we extract the α=0 pole contribution for both proton and nuclei. Using the modern high-energy proton data, we find that the α=0 pole contribution differs significantly from the Thomson term, in contrast with the original findings by Damashek and Gilman.

  17. Adler-Weisberger sum rule for WLWL→WLWL scattering

    International Nuclear Information System (INIS)

    Pham, T.N.

    1991-01-01

    We analyse the Adler-Weisberger sum rule for W L W L →W L W L scattering. We find that at some energy, the W L W L total cross section must be large to saturate the sum rule. Measurements at future colliders would be needed to check the sum rule and to obtain the decay rates Γ(H→W L W L , Z L Z L ) which would be modified by the existence of a P-wave vector meson resonance in the standard model with strongly interacting Higgs sector or in technicolour models. (orig.)

  18. Parity of Θ+(1540) from QCD sum rules

    International Nuclear Information System (INIS)

    Lee, Su Houng; Kim, Hungchong; Kwon, Youngshin

    2005-01-01

    The QCD sum rule for the pentaquark Θ + , first analyzed by Sugiyama, Doi and Oka, is reanalyzed with a phenomenological side that explicitly includes the contribution from the two-particle reducible kaon-nucleon intermediate state. The magnitude for the overlap of the Θ + interpolating current with the kaon-nucleon state is obtained by using soft-kaon theorem and a separate sum rule for the ground state nucleon with the pentaquark nucleon interpolating current. It is found that the K-N intermediate state constitutes only 10% of the sum rule so that the original claim that the parity of Θ + is negative remains valid

  19. sumé

    African Journals Online (AJOL)

    Tracie1

    sumé. L'activité traduisant est un processus très compliqué qui exige la connaissance extralinguistique chez le traducteur. Ce travail est basé sur la traduction littéraire. La traduction littéraire consistedes textes littéraires que comprennent la poésie, le théâtre, et la prose. La traduction littéraire a quelques problèmes ...

  20. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  1. Premium Pricing of Liability Insurance Using Random Sum Model

    OpenAIRE

    Kartikasari, Mujiati Dwi

    2017-01-01

    Premium pricing is one of important activities in insurance. Nonlife insurance premium is calculated from expected value of historical data claims. The historical data claims are collected so that it forms a sum of independent random number which is called random sum. In premium pricing using random sum, claim frequency distribution and claim severity distribution are combined. The combination of these distributions is called compound distribution. By using liability claim insurance data, we ...

  2. Coulomb sum rules in the relativistic Fermi gas model

    International Nuclear Information System (INIS)

    Do Dang, G.; L'Huillier, M.; Nguyen Giai, Van.

    1986-11-01

    Coulomb sum rules are studied in the framework of the Fermi gas model. A distinction is made between mathematical and observable sum rules. Differences between non-relativistic and relativistic Fermi gas predictions are stressed. A method to deduce a Coulomb response function from the longitudinal response is proposed and tested numerically. This method is applied to the 40 Ca data to obtain the experimental Coulomb sum rule as a function of momentum transfer

  3. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)

    LISTYA UTAMI KARMAWAN

    2009-03-01

    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  4. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  5. Suppression of superconductivity in Nb by IrMn in IrMn/Nb bilayers

    KAUST Repository

    Wu, B. L.

    2013-10-10

    Effect of antiferromagnet on superconductivity has been investigated in IrMn/Nb bilayers. Significant suppression of both transition temperature (Tc) and lower critical field (Hc1) of Nb is found in IrMn/Nb bilayers as compared to a single layer Nb of same thickness; the suppression effect is even stronger than that of a ferromagnet in NiFe/Nb bilayers. The addition of an insulating MgO layer at the IrMn-Nb interface nearly restores Tc to that of the single layer Nb, but Hc1 still remains suppressed. These results suggest that, in addition to proximity effect and magnetic impurity scattering, magnetostatic interaction also plays a role in suppressing superconductivity of Nb in IrMn/Nb bilayers. In addition to reduced Tc and Hc1, the IrMn layer also induces broadening in the transition temperature of Nb, which can be accounted for by a finite distribution of stray field from IrMn.

  6. A 2-categorical state sum model

    Energy Technology Data Exchange (ETDEWEB)

    Baratin, Aristide, E-mail: abaratin@uwaterloo.ca [Department of Applied Mathematics, University of Waterloo, 200 University Ave W, Waterloo, Ontario N2L 3G1 (Canada); Freidel, Laurent, E-mail: lfreidel@perimeterinstitute.ca [Perimeter Institute for Theoretical Physics, 31 Caroline Str. N, Waterloo, Ontario N2L 2Y5 (Canada)

    2015-01-15

    It has long been argued that higher categories provide the proper algebraic structure underlying state sum invariants of 4-manifolds. This idea has been refined recently, by proposing to use 2-groups and their representations as specific examples of 2-categories. The challenge has been to make these proposals fully explicit. Here, we give a concrete realization of this program. Building upon our earlier work with Baez and Wise on the representation theory of 2-groups, we construct a four-dimensional state sum model based on a categorified version of the Euclidean group. We define and explicitly compute the simplex weights, which may be viewed a categorified analogue of Racah-Wigner 6j-symbols. These weights solve a hexagon equation that encodes the formal invariance of the state sum under the Pachner moves of the triangulation. This result unravels the combinatorial formulation of the Feynman amplitudes of quantum field theory on flat spacetime proposed in A. Baratin and L. Freidel [Classical Quantum Gravity 24, 2027–2060 (2007)] which was shown to lead after gauge-fixing to Korepanov’s invariant of 4-manifolds.

  7. Methods for the analysis of complex fluorescence decays: sum of Becquerel functions versus sum of exponentials

    International Nuclear Information System (INIS)

    Menezes, Filipe; Fedorov, Alexander; Baleizão, Carlos; Berberan-Santos, Mário N; Valeur, Bernard

    2013-01-01

    Ensemble fluorescence decays are usually analyzed with a sum of exponentials. However, broad continuous distributions of lifetimes, either unimodal or multimodal, occur in many situations. A simple and flexible fitting function for these cases that encompasses the exponential is the Becquerel function. In this work, the applicability of the Becquerel function for the analysis of complex decays of several kinds is tested. For this purpose, decays of mixtures of four different fluorescence standards (binary, ternary and quaternary mixtures) are measured and analyzed. For binary and ternary mixtures, the expected sum of narrow distributions is well recovered from the Becquerel functions analysis, if the correct number of components is used. For ternary mixtures, however, satisfactory fits are also obtained with a number of Becquerel functions smaller than the true number of fluorophores in the mixture, at the expense of broadening the lifetime distributions of the fictitious components. The quaternary mixture studied is well fitted with both a sum of three exponentials and a sum of two Becquerel functions, showing the inevitable loss of information when the number of components is large. Decays of a fluorophore in a heterogeneous environment, known to be represented by unimodal and broad continuous distributions (as previously obtained by the maximum entropy method), are also measured and analyzed. It is concluded that these distributions can be recovered by the Becquerel function method with an accuracy similar to that of the much more complex maximum entropy method. It is also shown that the polar (or phasor) plot is not always helpful for ascertaining the degree (and kind) of complexity of a fluorescence decay. (paper)

  8. Sum rules for nuclear excitations with the Skyrme-Landau interaction

    International Nuclear Information System (INIS)

    Liu Kehfei; Luo Hongde; Ma Zhongyu; Feng Man; Shen Qingbiao

    1991-01-01

    The energy-weighted sum rules for electric, magnetic, Fermi and Gamow-Teller transitions with the Skyrme-Landau interaction are derived from the double commutators and numerically calculated in a HF + RPA formalism. As a numerical check of the Thouless theorem, our self-consistent calculations show that the calculated RPA strengths exhaust more than 85% of the sum rules in most cases. The well known non-energy-weighted sum rules for Fermi and Gamow-Teller transitions are also checked numerically. The sum rules are exhausted by more than 94% in these cases. (orig.)

  9. Partial sums of arithmetical functions with absolutely convergent ...

    Indian Academy of Sciences (India)

    Keywords. Ramanujan expansions; average order; error terms; sum-of-divisors functions; Jordan's totient functions. 2010 Mathematics Subject Classification. 11N37, 11A25, 11K65. 1. Introduction. The theory of Ramanujan sums and Ramanujan expansions has emerged from the seminal article [10] of Ramanujan. In 1918 ...

  10. Light cone sum rules in nonabelian gauge field theory

    Energy Technology Data Exchange (ETDEWEB)

    Mallik, S [Bern Univ. (Switzerland). Inst. fuer Theoretische Physik

    1981-03-24

    The author examines, in the context of nonabelian gauge field theory, the derivation of the light cone sum rules which were obtained earlier on the assumption of dominance of canonical singularity in the current commutator on the light cone. The retarded scaling functions appearing in the sum rules are numbers known in terms of the charges of the quarks and the number of quarks and gluons in the theory. Possible applications of the sum rules are suggested.

  11. Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

    Science.gov (United States)

    Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

    2012-01-01

    The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

  12. Light cone sum rules for single-pion electroproduction

    International Nuclear Information System (INIS)

    Mallik, S.

    1978-01-01

    Light cone dispersion sum rules (of low energy and superconvergence types) are derived for nucleon matrix elements of the commutator involving electromagnetic and divergence of axial vector currents. The superconvergence type sum rules in the fixed mass limit are rewritten without requiring the knowledge of Regge subtractions. The retarded scaling functions occurring in these sum rules are evaluated within the framework of quark light cone algebra of currents. Besides a general consistency check of the framework underlying the derivation, the author infers, on the basis of crude evaluation of scaling functions, an upper limit of 100 MeV for the bare mass of nonstrange quarks. (Auth.)

  13. Spectral sum rules for the three-body problem

    International Nuclear Information System (INIS)

    Bolle, D.; Osborn, T.A.

    1982-01-01

    This paper derives a number of sum rules for nonrelativistic three-body scattering. These rules are valid for any finite region μ in the six-dimensional coordinate space. They relate energy moments of the trace of the onshell time-delay operator to the energy-weighted probability for finding the three-body bound-state wave functions in the region μ. If μ is all of the six-dimensional space, the global form of the sum rules is obtained. In this form the rules constitute higher-order Levinson's theorems for the three-body problem. Finally, the sum rules are extended to allow the energy momtns have complex powers

  14. Moessbauer sum rules for use with synchrotron sources

    International Nuclear Information System (INIS)

    Lipkin, Harry J.

    1999-01-01

    The availability of tunable synchrotron radiation sources with millivolt resolution has opened new prospects for exploring dynamics of complex systems with Moessbauer spectroscopy. Early Moessbauer treatments and moment sum rules are extended to treat inelastic excitations measured in synchrotron experiments, with emphasis on the unique new conditions absent in neutron scattering and arising in resonance scattering: prompt absorption, delayed emission, recoil-free transitions and coherent forward scattering. The first moment sum rule normalizes the inelastic spectrum. New sum rules obtained for higher moments include the third moment proportional to the second derivative of the potential acting on the Moessbauer nucleus and independent of temperature in the the harmonic approximation

  15. Faraday effect revisited: sum rules and convergence issues

    DEFF Research Database (Denmark)

    Cornean, Horia; Nenciu, Gheorghe

    2010-01-01

    This is the third paper of a series revisiting the Faraday effect. The question of the absolute convergence of the sums over the band indices entering the Verdet constant is considered. In general, sum rules and traces per unit volume play an important role in solid-state physics, and they give...

  16. AcMNPV

    African Journals Online (AJOL)

    USER

    2010-08-16

    Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

  17. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  18. Statistical sum of bosonic string, compactified on an orbifold

    International Nuclear Information System (INIS)

    Morozov, A.; Ol'shanetskij, M.

    1986-01-01

    Expression for statistical sum of bosonic string, compactified on a singular orbifold, is presented. All the information about the orbifold is encoded the specific combination of theta-functions, which the statistical sum is expressed through

  19. Efficient yellow beam generation by intracavity sum frequency ...

    Indian Academy of Sciences (India)

    2014-02-06

    Feb 6, 2014 ... We present our studies on dual wavelength operation using a single Nd:YVO4 crystal and its intracavity sum frequency generation by considering the influence of the thermal lensing effect on the performance of the laser. A KTP crystal cut for type-II phase matching was used for intracavity sum frequency ...

  20. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  1. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  2. A set of sums for continuous dual q-2-Hahn polynomials

    International Nuclear Information System (INIS)

    Gade, R. M.

    2009-01-01

    An infinite set {τ (l) (y;r,z)} r,lisanelementofN 0 of linear sums of continuous dual q -2 -Hahn polynomials with prefactors depending on a complex parameter z is studied. The sums τ (l) (y;r,z) have an interpretation in context with tensor product representations of the quantum affine algebra U q ' (sl(2)) involving both a positive and a negative discrete series representation. For each l>0, the sum τ (l) (y;r,z) can be expressed in terms of the sum τ (0) (y;r,z), continuous dual q 2 -Hahn polynomials, and their associated polynomials. The sum τ (0) (y;r,z) is obtained as a combination of eight basic hypergeometric series. Moreover, an integral representation is provided for the sums τ (l) (y;r,z) with the complex parameter restricted by |zq| -2 -Hahn polynomials.

  3. Derivation of sum rules for quark and baryon fields

    International Nuclear Information System (INIS)

    Bongardt, K.

    1978-01-01

    In an analogous way to the Weinberg sum rules, two spectral-function sum rules for quark and baryon fields are derived by means of the concept of lightlike charges. The baryon sum rules are valid for the case of SU 3 as well as for SU 4 and the one-particle approximation yields a linear mass relation. This relation is not in disagreement with the normal linear GMO formula for the baryons. The calculated masses of the first resonance states agree very well with the experimental data

  4. Near-optimal order-reduced control for A/C (air-conditioning) system of EVs (electric vehicles)

    International Nuclear Information System (INIS)

    Chiu, Chien-Chin; Tsai, Nan-Chyuan; Lin, Chun-Chi

    2014-01-01

    This work is aimed to investigate the regulation problem for thermal comfortableness and propose control strategies for cabin environment of EVs (electric vehicles) by constructing a reduced-scale A/C (air-conditioning) system which mainly consists of two modules: ECB (environmental control box) and AHU (air-handling unit). Temperature and humidity in the ECB can be regulated by AHU via cooling, heating, mixing air streams and adjusting speed of fans. To synthesize the near-optimal controllers, the mathematical model for the system thermodynamics is developed by employing the equivalent lumped heat capacity approach, energy/mass conservation principle and the heat transfer theories. In addition, from the clustering pattern of system eigenvalues, the thermodynamics of the interested system can evidently be characterized by two-time-scale property. That is, the studied system can be decoupled into two subsystems, slow mode and fast mode, by singular perturbation technique. As to the optimal control strategies for EVs, by taking thermal comfortableness, humidity and energy consumption all into account, a series of optimal controllers is synthesized on the base of the order-reduced thermodynamic model. The feedback control loop for the experimental test rig is examined and realized by the aid of the control system development kit dSPACE DS1104 and the commercial software MATLAB/Simulink. To sum up, the intensive computer simulations and experimental results verify that the performance of the near-optimal order-reduced control law is almost as superior as that of standard LQR (Linear-Quadratic Regulator). - Highlights: • A reduced-scale test rig for A/C (air-conditioning) system to imitate the temperature/humidity of cabin in EV (electric vehicle) is constructed. • The non-linear thermodynamic model of A/C system can be decoupled by singular perturbation technique. • The temperature/humidity in cabin is regulated to the desired values by proposed optimal

  5. Least square regularized regression in sum space.

    Science.gov (United States)

    Xu, Yong-Li; Chen, Di-Rong; Li, Han-Xiong; Liu, Lu

    2013-04-01

    This paper proposes a least square regularized regression algorithm in sum space of reproducing kernel Hilbert spaces (RKHSs) for nonflat function approximation, and obtains the solution of the algorithm by solving a system of linear equations. This algorithm can approximate the low- and high-frequency component of the target function with large and small scale kernels, respectively. The convergence and learning rate are analyzed. We measure the complexity of the sum space by its covering number and demonstrate that the covering number can be bounded by the product of the covering numbers of basic RKHSs. For sum space of RKHSs with Gaussian kernels, by choosing appropriate parameters, we tradeoff the sample error and regularization error, and obtain a polynomial learning rate, which is better than that in any single RKHS. The utility of this method is illustrated with two simulated data sets and five real-life databases.

  6. On the Computation of Correctly Rounded Sums

    DEFF Research Database (Denmark)

    Kornerup, Peter; Lefevre, Vincent; Louvet, Nicolas

    2012-01-01

    This paper presents a study of some basic blocks needed in the design of floating-point summation algorithms. In particular, in radix-2 floating-point arithmetic, we show that among the set of the algorithms with no comparisons performing only floating-point additions/subtractions, the 2Sum...... algorithm introduced by Knuth is minimal, both in terms of number of operations and depth of the dependency graph. We investigate the possible use of another algorithm, Dekker's Fast2Sum algorithm, in radix-10 arithmetic. We give methods for computing, in radix 10, the floating-point number nearest...... the average value of two floating-point numbers. We also prove that under reasonable conditions, an algorithm performing only round-to-nearest additions/subtractions cannot compute the round-to-nearest sum of at least three floating-point numbers. Starting from an algorithm due to Boldo and Melquiond, we also...

  7. Mesoporous silica nanoparticle supported PdIr bimetal catalyst for selective hydrogenation, and the significant promotional effect of Ir

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hui; Huang, Chao; Yang, Fan [The Key Laboratory of Fuel Cell Technology of Guangdong Province, School of Chemistry and Chemical Engineering, South China University of Technology, Guangzhou 510641 (China); Yang, Xu [Key Laboratory of Renewable Energy, Guangzhou Institute of Energy Conversion, Chinese Academy of Sciences, Guangzhou (China); Du, Li [The Key Laboratory of Fuel Cell Technology of Guangdong Province, School of Chemistry and Chemical Engineering, South China University of Technology, Guangzhou 510641 (China); Key Laboratory of Renewable Energy, Guangzhou Institute of Energy Conversion, Chinese Academy of Sciences, Guangzhou (China); Liao, Shijun, E-mail: chsjliao@scut.edu.cn [The Key Laboratory of Fuel Cell Technology of Guangdong Province, School of Chemistry and Chemical Engineering, South China University of Technology, Guangzhou 510641 (China); Key Laboratory of Renewable Energy, Guangzhou Institute of Energy Conversion, Chinese Academy of Sciences, Guangzhou (China)

    2015-12-01

    Graphical abstract: A mesoporous silica nanoparticle (MSN) supported bimetal catalyst, PdIr/MSN, was prepared by a facile impregnation and hydrogen reduction method. The strong promotional effect of Ir was observed and thoroughly investigated. At the optimal molar ratio of Ir to Pd (N{sub Ir}/N{sub Pd} = 0.1), the activity of PdIr{sub 0.1}/MSN was up to eight times and 28 times higher than that of monometallic Pd/MSN and Ir/MSN, respectively. The catalysts were characterized comprehensively by X-ray diffraction, transmission electron microscopy, X-ray photoelectron spectroscopy, and hydrogen temperature programmed reduction, which revealed that the promotional effect of Ir may be due to the enhanced dispersion of active components on the MSN, and to the intensified Pd–Ir electronic interaction caused by the addition of Ir. - Highlights: • Mesoporous nanoparticles were synthesized and used as support for metal catalyst. • PdIr bimetallic catalyst exhibited significantly improved hydrogenation activity. • The strong promotion of Ir was recognized firstly and investigated intensively. • PdIr exhibits 18 times higher activity than Pd to the hydrogenation of nitrobenzene. - Abstract: A mesoporous silica nanoparticle (MSN) supported bimetal catalyst, PdIr/MSN, was prepared by a facile impregnation and hydrogen reduction method. The strong promotional effect of Ir was observed and thoroughly investigated. At the optimal molar ratio of Ir to Pd (N{sub Ir}/N{sub Pd} = 0.1), the activity of PdIr{sub 0.1}/MSN was up to eight times and 28 times higher than that of monometallic Pd/MSN and Ir/MSN, respectively. The catalysts were characterized comprehensively by X-ray diffraction, transmission electron microscopy, X-ray photoelectron spectroscopy, and hydrogen temperature programmed reduction, which revealed that the promotional effect of Ir may be due to the enhanced dispersion of active components on the MSN, and to the intensified Pd–Ir electronic interaction

  8. 29 CFR 4044.75 - Other lump sum benefits.

    Science.gov (United States)

    2010-07-01

    ... sum benefits. The value of a lump sum benefit which is not covered under § 4044.73 or § 4044.74 is equal to— (a) The value under the qualifying bid, if an insurer provides the benefit; or (b) The present value of the benefit as of the date of distribution, determined using reasonable actuarial assumptions...

  9. New QCD sum rules for nucleon axial-vector coupling constants

    International Nuclear Information System (INIS)

    Lee, F.X.; Leinweber, D.B.; Jin, X.

    1997-01-01

    Two new sets of QCD sum rules for the nucleon axial-vector coupling constants are derived using the external-field technique and generalized interpolating fields. An in-depth study of the predicative ability of these sum rules is carried out using a Monte Carlo based uncertainty analysis. The results show that the standard implementation of the QCD sum rule method has only marginal predicative power for the nucleon axial-vector coupling constants, as the relative errors are large. The errors range from approximately 50% to 100% compared to the nucleon mass obtained from the same method, which has only a 10%- 25% error. The origin of the large errors is examined. Previous analyses of these coupling constants are based on sum rules that have poor operator product expansion convergence and large continuum contributions. Preferred sum rules are identified and their predictions are obtained. We also investigate the new sum rules with an alternative treatment of the problematic transitions which are not exponentially suppressed in the standard treatment. The alternative treatment provides exponential suppression of their contributions relative to the ground state. Implications for other nucleon current matrix elements are also discussed. copyright 1997 The American Physical Society

  10. BOOTES-IR: near IR follow-up GRB observations by a robotic system

    International Nuclear Information System (INIS)

    Castro-Tirado, A.J.; Postrigo, A. de Ugarte; Jelinek, M.

    2005-01-01

    BOOTES-IR is the extension of the BOOTES experiment, which operates in Southern Spain since 1998, to the near IR (NIR). The goal is to follow up the early stage of the gamma ray burst (GRB) afterglow emission in the NIR, alike BOOTES does already at optical wavelengths. The scientific case that drives the BOOTES-IR performance is the study of GRBs with the support of spacecraft like INTEGRAL, SWIFT and GLAST. Given that the afterglow emission in both, the NIR and the optical, in the instances immediately following a GRB, is extremely bright (reached V = 8.9 in one case), it should be possible to detect this prompt emission at NIR wavelengths too. The combined observations by BOOTES-IR and BOOTES-1 and BOOTES-2 will allow for real time identification of trustworthy candidates to have a high redshift (z > 5). It is expected that, few minutes after a GRB, the IR magnitudes be H ∼ 7-10, hence very high quality spectra can be obtained for objects as far as z = 10 by larger instruments

  11. Development of Cytoplasmic Male Sterile IR24 and IR64 Using CW-CMS/Rf17 System.

    Science.gov (United States)

    Toriyama, Kinya; Kazama, Tomohiko

    2016-12-01

    A wild-abortive-type (WA) cytoplasmic male sterility (CMS) has been almost exclusively used for breeding three-line hybrid rice. Many indica cultivars are known to carry restorer genes for WA-CMS lines and cannot be used as maintainer lines. Especially elite indica cultivars IR24 and IR64 are known to be restorer lines for WA-CMS lines, and are used as male parents for hybrid seed production. If we develop CMS IR24 and CMS IR64, the combination of F1 pairs in hybrid rice breeding programs will be greatly broadened. For production of CMS lines and restorer lines of IR24 and IR64, we employed Chinese wild rice (CW)-type CMS/Restorer of fertility 17 (Rf17) system, in which fertility is restored by a single nuclear gene, Rf17. Successive backcrossing and marker-assisted selection of Rf17 succeeded to produce completely male sterile CMS lines and fully restored restorer lines of IR24 and IR64. CW-cytoplasm did not affect agronomic characteristics. Since IR64 is one of the most popular mega-varieties and used for breeding of many modern varieties, the CW-CMS line of IR64 will be useful for hybrid rice breeding.

  12. The TApIR experiment. IR absorption spectra of liquid hydrogen isotopologues

    International Nuclear Information System (INIS)

    Groessle, Robin

    2015-01-01

    The scope of the thesis is the infrared absorption spectroscopy of liquid hydrogen isotopologues with the tritium absorption infrared spectroscopy (TApIR) experiment at the tritium laboratory Karlsruhe (TLK). The calibration process from the sample preparation to the reference measurements are described. A further issue is the classical evaluation of FTIR absorption spectra and the extension using the rolling circle filter (RCF) including the effects on statistical and systematical errors. The impact of thermal and nuclear spin temperature on the IR absorption spectra is discussed. An empirical based modeling for the IR absorption spectra of liquid hydrogen isotopologues is performed.

  13. Spectrally- and Time-Resolved Sum Frequency Generation (STiR-SFG): a new tool for ultrafast hydrogen bond dynamics at interfaces.

    Science.gov (United States)

    Benderskii, Alexander; Bordenyuk, Andrey; Weeraman, Champika

    2006-03-01

    The recently developed spectrally- and time-resolved Sum Frequency Generation (STiR-SFG) is a surface-selective 3-wave mixing (IR+visible) spectroscopic technique capable of measuring ultrafast spectral evolution of vibrational coherences. A detailed description of this measurement will be presented, and a noniterative method or deconvolving the laser pulses will be introduced to obtain the molecular response function. STiR-SFG, combined with the frequency-domain SFG spectroscopy, was applied to study hydrogen bonding dynamics at aqueous interfaces (D2O/CaF2). Spectral dynamics of the OD-stretch on the 50-150 fs time scale provides real-time observation of ultrafast H-bond rearrangement. Tuning the IR wavelength to the blue or red side of the OD-stretch transition, we selectively monitor the dynamics of different sub-ensembles in the distribution of the H-bond structures. The blue-side excitation (weaker H-bonding) shows monotonic red-shift of the OD-frequency. In contrast, the red-side excitation (stronger H-bonding structures) produces a blue-shift and a recursion, which may indicate the presence of an underdamped intermolecular mode of interfacial water. Effect of electrolyte concentration on the H-bond dynamics will be discussed.

  14. On the Laplace transform of the Weinberg type sum rules

    International Nuclear Information System (INIS)

    Narison, S.

    1981-09-01

    We consider the Laplace transform of various sum rules of the Weinberg type including the leading non-perturbative effects. We show from the third type Weinberg sum rules that 7.5 to 8.9 1 coupling to the W boson, while the second sum rule gives an upper bound on the A 1 mass (Msub(A 1 ) < or approx. 1.25 GeV). (author)

  15. Low ac loss geometries in YBCO coated conductors

    International Nuclear Information System (INIS)

    Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

  16. Low ac loss geometries in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

    2007-10-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

  17. Proximinality in generalized direct sums

    Directory of Open Access Journals (Sweden)

    Darapaneni Narayana

    2004-01-01

    Full Text Available We consider proximinality and transitivity of proximinality for subspaces of finite codimension in generalized direct sums of Banach spaces. We give several examples of Banach spaces where proximinality is transitive among subspaces of finite codimension.

  18. Measurement sum theory and application - Application to low level measurements

    International Nuclear Information System (INIS)

    Puydarrieux, S.; Bruel, V.; Rivier, C.; Crozet, M.; Vivier, A.; Manificat, G.; Thaurel, B.; Mokili, M.; Philippot, B.; Bohaud, E.

    2015-09-01

    In laboratories, most of the Total Sum methods implemented today use substitution or censure methods for nonsignificant or negative values, and thus create biases which can sometimes be quite large. They are usually positive, and generate, for example, becquerel (Bq) counting or 'administrative' quantities of materials (= 'virtual'), thus artificially falsifying the records kept by the laboratories under regulatory requirements (environment release records, waste records, etc.). This document suggests a methodology which will enable the user to avoid such biases. It is based on the following two fundamental rules: - The Total Sum of measurement values must be established based on all the individual measurement values, even those considered non-significant including the negative values. Any modification of these values, under the pretext that they are not significant, will inevitably lead to biases in the accumulated result and falsify the evaluation of its uncertainty. - In Total Sum operations, the decision thresholds are arrived at in a similar way to the approach used for uncertainties. The document deals with four essential aspects of the notion of 'measurement Total Sums': - The expression of results and associated uncertainties close to Decision Thresholds, and Detection or Quantification Limits, - The Total Sum of these measurements: sum or mean, - The calculation of the uncertainties associated with the Total Sums, - Result presentation (particularly when preparing balance sheets or reports, etc.) Several case studies arising from different situations are used to illustrate the methodology: environmental monitoring reports, release reports, and chemical impurity Total Sums for the qualification of a finished product. The special case of material balances, in which the measurements are usually all significant and correlated (the covariance term cannot then be ignored) will be the subject of a future second document. This

  19. Integrals of Lagrange functions and sum rules

    Energy Technology Data Exchange (ETDEWEB)

    Baye, Daniel, E-mail: dbaye@ulb.ac.be [Physique Quantique, CP 165/82, Universite Libre de Bruxelles, B 1050 Bruxelles (Belgium); Physique Nucleaire Theorique et Physique Mathematique, CP 229, Universite Libre de Bruxelles, B 1050 Bruxelles (Belgium)

    2011-09-30

    Exact values are derived for some matrix elements of Lagrange functions, i.e. orthonormal cardinal functions, constructed from orthogonal polynomials. They are obtained with exact Gauss quadratures supplemented by corrections. In the particular case of Lagrange-Laguerre and shifted Lagrange-Jacobi functions, sum rules provide exact values for matrix elements of 1/x and 1/x{sup 2} as well as for the kinetic energy. From these expressions, new sum rules involving Laguerre and shifted Jacobi zeros and weights are derived. (paper)

  20. Luttinger and Hubbard sum rules: are they compatible?

    International Nuclear Information System (INIS)

    Matho, K.

    1992-01-01

    A so-called Hubbard sum rule determines the weight of a satellite in fermionic single-particle excitations with strong local repulsion (U→∞). Together with the Luttinger sum rule, this imposes two different energy scales on the remaining finite excitations. In the Hubbard chain, this has been identified microscopically as being due to a separation of spin and charge. (orig.)

  1. A Shuttle Upper Atmosphere Mass Spectrometer /SUMS/ experiment

    Science.gov (United States)

    Blanchard, R. C.; Duckett, R. J.; Hinson, E. W.

    1982-01-01

    A magnetic mass spectrometer is currently being adapted to the Space Shuttle Orbiter to provide repeated high altitude atmosphere data to support in situ rarefied flow aerodynamics research, i.e., in the high velocity, low density flight regime. The experiment, called Shuttle Upper Atmosphere Mass Spectrometer (SUMS), is the first attempt to design mass spectrometer equipment for flight vehicle aerodynamic data extraction. The SUMS experiment will provide total freestream atmospheric quantitites, principally total mass density, above altitudes at which conventional pressure measurements are valid. Experiment concepts, the expected flight profile, tradeoffs in the design of the total system and flight data reduction plans are discussed. Development plans are based upon a SUMS first flight after the Orbiter initial development flights.

  2. Use of exp(iS[x]) in the sum over histories

    International Nuclear Information System (INIS)

    Anderson, A.

    1994-01-01

    The use of tsumexp(iS[x]) is the generic form for a sum over histories in configuration space is discussed critically and placed in its proper context. The standard derivation of the sum over paths by discretizing the paths is reviewed, and it is shown that the form tsumexp(iS[x]) is justified only for Schroedinger-type systems which are at most second order in the momenta. Extending this derivation to the relativistic free particle, the causal Green's function is expressed as a sum over timelike paths, and the Feynman Green's function is expressed both as a sum over paths which only go one way in time and as a sum over paths which move forward and backward in time. The weighting of the paths is shown not to be exp(iS[x]) is any of these cases. The role of the inner product and the operator ordering of the wave equation in defining the sum over histories is discussed

  3. Inclusive sum rules and spectra of neutrons at the ISR

    International Nuclear Information System (INIS)

    Grigoryan, A.A.

    1975-01-01

    Neutron spectra in pp collisions at ISR energies are studied in the framework of sum rules for inclusive processes. The contributions of protons, π- and E- mesons to the energy sum rule are calculated at √5 = 53 GeV. It is shown by means of this sum rule that the spectra of neutrons at the ISR are in contradiction with the spectra of other particles also measured at the ISR

  4. AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

    Science.gov (United States)

    El-Nahass, M. M.; Ali, H. A. M.

    2012-06-01

    AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

  5. Energy-weighted sum rules for mesons in hot and dense matter

    NARCIS (Netherlands)

    Cabrera, D.; Polls, A.; Ramos, A.; Tolos Rigueiro, Laura

    2009-01-01

    We study energy-weighted sum rules of the pion and kaon propagator in nuclear matter at finite temperature. The sum rules are obtained from matching the Dyson form of the meson propagator with its spectral Lehmann representation at low and high energies. We calculate the sum rules for specific

  6. Standardization of I-125. Sum-Peak Coincidence Counting

    International Nuclear Information System (INIS)

    Grau Carles, A.; Grau Malonda, A.

    2011-01-01

    I-125 is a nuclide which presents difficulties for standardization. The sum-peak method is one of the procedures used to standardize this radionuclide. Initially NaI (Tl)detectors and then the semiconductor detectors with higher resolution have been used.This paper describes the different methods based on the sum-peak procedure and the different expressions used to calculate the activity are deduced. We describe a general procedure for obtaining all of the above equations and many more. We analyze the influence of uncertainties in the used parameters in the uncertainty of the activity. We give a complete example of the transmission of uncertainty and the effects of correlations in the uncertainty of the activity of the sample. High-resolution spectra show an unresolved doublet of 62.0 keV and 62.8 keV. The paper presents two approaches to solve this problem. One is based on the calculation of area ratio and the sum of peak areas obtained from atomic and nuclear data, in the other we modify the equations so that the sum of the peak areas doublet, rather than its components, is present. (Author) 19 refs.

  7. Standardization of I-125. Sum-Peak Coincidence Counting

    Energy Technology Data Exchange (ETDEWEB)

    Grau Carles, A.; Grau Malonda, A.

    2011-07-01

    I-125 is a nuclide which presents difficulties for standardization. The sum-peak method is one of the procedures used to standardize this radionuclide. Initially NaI (Tl)detectors and then the semiconductor detectors with higher resolution have been used.This paper describes the different methods based on the sum-peak procedure and the different expressions used to calculate the activity are deduced. We describe a general procedure for obtaining all of the above equations and many more. We analyze the influence of uncertainties in the used parameters in the uncertainty of the activity. We give a complete example of the transmission of uncertainty and the effects of correlations in the uncertainty of the activity of the sample. High-resolution spectra show an unresolved doublet of 62.0 keV and 62.8 keV. The paper presents two approaches to solve this problem. One is based on the calculation of area ratio and the sum of peak areas obtained from atomic and nuclear data, in the other we modify the equations so that the sum of the peak areas doublet, rather than its components, is present. (Author) 19 refs.

  8. Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

    Science.gov (United States)

    Han, Xiaomin; Li, Guojing; Zhang, Shuqun

    2017-01-01

    Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

  9. Light-cone sum rules: A SCET-based formulation

    CERN Document Server

    De Fazio, F; Hurth, Tobias; Feldmann, Th.

    2007-01-01

    We describe the construction of light-cone sum rules (LCSRs) for exclusive $B$-meson decays into light energetic hadrons from correlation functions within soft-collinear effective theory (SCET). As an example, we consider the SCET sum rule for the $B \\to \\pi$ transition form factor at large recoil, including radiative corrections from hard-collinear loop diagrams at first order in the strong coupling constant.

  10. Complex-energy approach to sum rules within nuclear density functional theory

    Science.gov (United States)

    Hinohara, Nobuo; Kortelainen, Markus; Nazarewicz, Witold; Olsen, Erik

    2015-04-01

    Background: The linear response of the nucleus to an external field contains unique information about the effective interaction, the correlations governing the behavior of the many-body system, and the properties of its excited states. To characterize the response, it is useful to use its energy-weighted moments, or sum rules. By comparing computed sum rules with experimental values, the information content of the response can be utilized in the optimization process of the nuclear Hamiltonian or the nuclear energy density functional (EDF). But the additional information comes at a price: compared to the ground state, computation of excited states is more demanding. Purpose: To establish an efficient framework to compute energy-weighted sum rules of the response that is adaptable to the optimization of the nuclear EDF and large-scale surveys of collective strength, we have developed a new technique within the complex-energy finite-amplitude method (FAM) based on the quasiparticle random-phase approximation (QRPA). Methods: To compute sum rules, we carry out contour integration of the response function in the complex-energy plane. We benchmark our results against the conventional matrix formulation of the QRPA theory, the Thouless theorem for the energy-weighted sum rule, and the dielectric theorem for the inverse-energy-weighted sum rule. Results: We derive the sum-rule expressions from the contour integration of the complex-energy FAM. We demonstrate that calculated sum-rule values agree with those obtained from the matrix formulation of the QRPA. We also discuss the applicability of both the Thouless theorem about the energy-weighted sum rule and the dielectric theorem for the inverse-energy-weighted sum rule to nuclear density functional theory in cases when the EDF is not based on a Hamiltonian. Conclusions: The proposed sum-rule technique based on the complex-energy FAM is a tool of choice when optimizing effective interactions or energy functionals. The method

  11. Inhibition of PTP1B Restores IRS1-Mediated Hepatic Insulin Signaling in IRS2-Deficient Mice

    Science.gov (United States)

    González-Rodríguez, Águeda; Gutierrez, Jose A. Mas; Sanz-González, Silvia; Ros, Manuel; Burks, Deborah J.; Valverde, Ángela M.

    2010-01-01

    OBJECTIVE Mice with complete deletion of insulin receptor substrate 2 (IRS2) develop hyperglycemia, impaired hepatic insulin signaling, and elevated gluconeogenesis, whereas mice deficient for protein tyrosine phosphatase (PTP)1B display an opposing hepatic phenotype characterized by increased sensitivity to insulin. To define the relationship between these two signaling pathways in the regulation of liver metabolism, we used genetic and pharmacological approaches to study the effects of inhibiting PTP1B on hepatic insulin signaling and expression of gluconeogenic enzymes in IRS2−/− mice. RESEARCH DESIGN AND METHODS We analyzed glucose homeostasis and insulin signaling in liver and isolated hepatocytes from IRS2−/− and IRS2−/−/PTP1B−/− mice. Additionally, hepatic insulin signaling was assessed in control and IRS2−/− mice treated with resveratrol, an antioxidant present in red wine. RESULTS In livers of hyperglycemic IRS2−/− mice, the expression levels of PTP1B and its association with the insulin receptor (IR) were increased. The absence of PTP1B in the double-mutant mice restored hepatic IRS1-mediated phosphatidylinositol (PI) 3-kinase/Akt/Foxo1 signaling. Moreover, resveratrol treatment of hyperglycemic IRS2−/− mice decreased hepatic PTP1B mRNA and inhibited PTP1B activity, thereby restoring IRS1-mediated PI 3-kinase/Akt/Foxo1 signaling and peripheral insulin sensitivity. CONCLUSIONS By regulating the phosphorylation state of IR, PTB1B determines sensitivity to insulin in liver and exerts a unique role in the interplay between IRS1 and IRS2 in the modulation of hepatic insulin action. PMID:20028942

  12. Validation of the thermal code of RadTherm-IR, IR-Workbench, and F-TOM

    Science.gov (United States)

    Schwenger, Frédéric; Grossmann, Peter; Malaplate, Alain

    2009-05-01

    System assessment by image simulation requires synthetic scenarios that can be viewed by the device to be simulated. In addition to physical modeling of the camera, a reliable modeling of scene elements is necessary. Software products for modeling of target data in the IR should be capable of (i) predicting surface temperatures of scene elements over a long period of time and (ii) computing sensor views of the scenario. For such applications, FGAN-FOM acquired the software products RadTherm-IR (ThermoAnalytics Inc., Calumet, USA; IR-Workbench (OKTAL-SE, Toulouse, France). Inspection of the accuracy of simulation results by validation is necessary before using these products for applications. In the first step of validation, the performance of both "thermal solvers" was determined through comparison of the computed diurnal surface temperatures of a simple object with the corresponding values from measurements. CUBI is a rather simple geometric object with well known material parameters which makes it suitable for testing and validating object models in IR. It was used in this study as a test body. Comparison of calculated and measured surface temperature values will be presented, together with the results from the FGAN-FOM thermal object code F-TOM. In the second validation step, radiances of the simulated sensor views computed by RadTherm-IR and IR-Workbench will be compared with radiances retrieved from the recorded sensor images taken by the sensor that was simulated. Strengths and weaknesses of the models RadTherm-IR, IR-Workbench and F-TOM will be discussed.

  13. Adaptive Dynamic Programming for Discrete-Time Zero-Sum Games.

    Science.gov (United States)

    Wei, Qinglai; Liu, Derong; Lin, Qiao; Song, Ruizhuo

    2018-04-01

    In this paper, a novel adaptive dynamic programming (ADP) algorithm, called "iterative zero-sum ADP algorithm," is developed to solve infinite-horizon discrete-time two-player zero-sum games of nonlinear systems. The present iterative zero-sum ADP algorithm permits arbitrary positive semidefinite functions to initialize the upper and lower iterations. A novel convergence analysis is developed to guarantee the upper and lower iterative value functions to converge to the upper and lower optimums, respectively. When the saddle-point equilibrium exists, it is emphasized that both the upper and lower iterative value functions are proved to converge to the optimal solution of the zero-sum game, where the existence criteria of the saddle-point equilibrium are not required. If the saddle-point equilibrium does not exist, the upper and lower optimal performance index functions are obtained, respectively, where the upper and lower performance index functions are proved to be not equivalent. Finally, simulation results and comparisons are shown to illustrate the performance of the present method.

  14. The Subset Sum game.

    Science.gov (United States)

    Darmann, Andreas; Nicosia, Gaia; Pferschy, Ulrich; Schauer, Joachim

    2014-03-16

    In this work we address a game theoretic variant of the Subset Sum problem, in which two decision makers (agents/players) compete for the usage of a common resource represented by a knapsack capacity. Each agent owns a set of integer weighted items and wants to maximize the total weight of its own items included in the knapsack. The solution is built as follows: Each agent, in turn, selects one of its items (not previously selected) and includes it in the knapsack if there is enough capacity. The process ends when the remaining capacity is too small for including any item left. We look at the problem from a single agent point of view and show that finding an optimal sequence of items to select is an [Formula: see text]-hard problem. Therefore we propose two natural heuristic strategies and analyze their worst-case performance when (1) the opponent is able to play optimally and (2) the opponent adopts a greedy strategy. From a centralized perspective we observe that some known results on the approximation of the classical Subset Sum can be effectively adapted to the multi-agent version of the problem.

  15. RNA interference suppression of mucin 5AC (MUC5AC reduces the adhesive and invasive capacity of human pancreatic cancer cells

    Directory of Open Access Journals (Sweden)

    Yamada Nobuya

    2010-05-01

    Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.

  16. Gamma-irradiation produces active chlorine species (ACS) in physiological solutions: Secoisolariciresinol diglucoside (SDG) scavenges ACS - A novel mechanism of DNA radioprotection.

    Science.gov (United States)

    Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo

    2016-09-01

    Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged

  17. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  18. Sums of Generalized Harmonic Series

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 9. Sums of Generalized Harmonic Series: For Kids from Five to Fifteen. Zurab Silagadze. General Article Volume 20 Issue 9 September 2015 pp 822-843. Fulltext. Click here to view fulltext PDF. Permanent link:

  19. STATYBINIŲ MEDŽIAGŲ KONKURENCINGUMAS IR TENDENCIJOS

    OpenAIRE

    Kontrimas, Robertas

    2010-01-01

    Darbe analizuojamas statybinių medžiagų konkurencingumas, nustatyti statybinių medžiagų konkurencingumą įtakojantys veiksniai ir pateikti pasiūlymai rinkos gerinimui. Pasitvirtino hipotezė, kad statybinių medžiagų paklausą ir kainas įtakoja klientų poreikiai ir jų finansinės galimybės, tačiau pasaulinės krizės įtaka yra labai ženkli,. Atlikta darbuotojų ir pirkėjų apklausa padėjo nustatyti, kokios statybinės medžiagos dažniausiai yra perkamos, kaip klientai ir darbuotojai vertina įmonę ir jos...

  20. 3He electron scattering sum rules

    International Nuclear Information System (INIS)

    Kim, Y.E.; Tornow, V.

    1982-01-01

    Electron scattering sum rules for 3 He are derived with a realistic ground-state wave function. The theoretical results are compared with the experimentally measured integrated cross sections. (author)

  1. Transport AC losses in YBCO coated conductors

    Energy Technology Data Exchange (ETDEWEB)

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  2. A toolbox for Harmonic Sums and their analytic continuations

    Energy Technology Data Exchange (ETDEWEB)

    Ablinger, Jakob; Schneider, Carsten [RISC, J. Kepler University, Linz (Austria); Bluemlein, Johannes [DESY, Zeuthen (Germany)

    2010-07-01

    The package HarmonicSums implemented in the computer algebra system Mathematica is presented. It supports higher loop calculations in QCD and QED to represent single-scale quantities like anomalous dimensions and Wilson coefficients. The package allows to reduce general harmonic sums due to their algebraic and different structural relations. We provide a general framework for these reductions and the explicit representations up to weight w=8. For the use in experimental analyzes we also provide an analytic formalism to continue the harmonic sums form their integer arguments into the complex plane, which includes their recursions and asymptotic representations. The main ideas are illustrated by specific examples.

  3. Discrimination of Chinese Sauce liquor using FT-IR and two-dimensional correlation IR spectroscopy

    Science.gov (United States)

    Sun, Su-Qin; Li, Chang-Wen; Wei, Ji-Ping; Zhou, Qun; Noda, Isao

    2006-11-01

    We applied the three-step IR macro-fingerprint identification method to obtain the IR characteristic fingerprints of so-called Chinese Sauce liquor (Moutai liquor and Kinsly liquor) and a counterfeit Moutai. These fingerprints can be used for the identification and discrimination of similar liquor products. The comparison of their conventional IR spectra, as the first step of identification, shows that the primary difference in Sauce liquor is the intensity of characteristic peaks at 1592 and 1225 cm -1. The comparison of the second derivative IR spectra, as the second step of identification, shows that the characteristic absorption in 1400-1800 cm -1 is substantially different. The comparison of 2D-IR correlation spectra, as the third and final step of identification, can discriminate the liquors from another direction. Furthermore, the method was successfully applied to the discrimination of a counterfeit Moutai from the genuine Sauce liquor. The success of the three-step IR macro-fingerprint identification to provide a rapid and effective method for the identification of Chinese liquor suggests the potential extension of this technique to the identification and discrimination of other wine and spirits, as well.

  4. A Linear Time Algorithm for the k Maximal Sums Problem

    DEFF Research Database (Denmark)

    Brodal, Gerth Stølting; Jørgensen, Allan Grønlund

    2007-01-01

     k maximal sums problem. We use this algorithm to obtain algorithms solving the two-dimensional k maximal sums problem in O(m 2·n + k) time, where the input is an m ×n matrix with m ≤ n. We generalize this algorithm to solve the d-dimensional problem in O(n 2d − 1 + k) time. The space usage of all......Finding the sub-vector with the largest sum in a sequence of n numbers is known as the maximum sum problem. Finding the k sub-vectors with the largest sums is a natural extension of this, and is known as the k maximal sums problem. In this paper we design an optimal O(n + k) time algorithm for the...... the algorithms can be reduced to O(n d − 1 + k). This leads to the first algorithm for the k maximal sums problem in one dimension using O(n + k) time and O(k) space....

  5. Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

    Directory of Open Access Journals (Sweden)

    Pijar Riza Anugerah

    2015-10-01

    Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

  6. Counter-ions at single charged wall: Sum rules.

    Science.gov (United States)

    Samaj, Ladislav

    2013-09-01

    For inhomogeneous classical Coulomb fluids in thermal equilibrium, like the jellium or the two-component Coulomb gas, there exists a variety of exact sum rules which relate the particle one-body and two-body densities. The necessary condition for these sum rules is that the Coulomb fluid possesses good screening properties, i.e. the particle correlation functions or the averaged charge inhomogeneity, say close to a wall, exhibit a short-range (usually exponential) decay. In this work, we study equilibrium statistical mechanics of an electric double layer with counter-ions only, i.e. a globally neutral system of equally charged point-like particles in the vicinity of a plain hard wall carrying a fixed uniform surface charge density of opposite sign. At large distances from the wall, the one-body and two-body counter-ion densities go to zero slowly according to the inverse-power law. In spite of the absence of screening, all known sum rules are shown to hold for two exactly solvable cases of the present system: in the weak-coupling Poisson-Boltzmann limit (in any spatial dimension larger than one) and at a special free-fermion coupling constant in two dimensions. This fact indicates an extended validity of the sum rules and provides a consistency check for reasonable theoretical approaches.

  7. Moessbauer sum rules for use with synchrotron sources

    International Nuclear Information System (INIS)

    Lipkin, H.J.

    1995-01-01

    The availability of tunable synchrotron radiation sources with millivolt resolution has opened prospects for exploring dynamics of complex systems with Moessbauer spectroscopy. Early Moessbauer treatments and moment sum rules are extended to treat inelastic excitations measured in synchrotron experiments, with emphasis on the unique conditions absent in neutron scattering and arising in resonance scattering: prompt absorption, delayed emission, recoilfree transitions, and coherent forward scattering. The first moment sum rule normalizes the inelastic spectrum. Sum rules obtained for higher moments include the third moment proportional to the second derivative of the potential acting on the Moessbauer nucleus and independent of temperature in the harmonic approximation. Interesting information may be obtained on the behavior of the potential acting on this nucleus in samples not easily investigated with neutron scattering, e.g., small samples, thin films, time-dependent structures, and amorphous-metallic high pressure phases

  8. QCD sum rule for nucleon in nuclear matter

    International Nuclear Information System (INIS)

    Mallik, S.; Sarkar, Sourav

    2010-01-01

    We consider the two-point function of nucleon current in nuclear matter and write a QCD sum rule to analyse the residue of the nucleon pole as a function of nuclear density. The nucleon self-energy needed for the sum rule is taken as input from calculations using phenomenological N N potential. Our result shows a decrease in the residue with increasing nuclear density, as is known to be the case with similar quantities. (orig.)

  9. GDH sum rule measurement at low Q2

    International Nuclear Information System (INIS)

    Bianchi, N.

    1996-01-01

    The Gerasimov-Drell-Hearn (GDH) sum rule is based on a general dispersive relation for the forward Compton scattering. Multipole analysis suggested the possible violation of the sum rule. Some propositions have been made to modify the original GDH expression. An effort is now being made in several laboratories to shred some light on this topic. The purposes of the different planned experiments are briefly presented according to their Q 2 range

  10. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  11. Structural relations of harmonic sums and Mellin transforms up to weight w=5

    Energy Technology Data Exchange (ETDEWEB)

    Bluemlein, Johannes

    2009-01-15

    We derive the structural relations between the Mellin transforms of weighted Nielsen integrals emerging in the calculation of massless or massive single-scale quantities in QED and QCD, such as anomalous dimensions and Wilson coefficients, and other hard scattering cross sections depending on a single scale. The set of all multiple harmonic sums up to weight five cover the sums needed in the calculation of the 3-loop anomalous dimensions. The relations extend the set resulting from the quasi-shuffle product between harmonic sums studied earlier. Unlike the shuffle relations, they depend on the value of the quantities considered. Up to weight w=5, 242 nested harmonic sums contribute. In the present physical applications it is sufficient to consider the sub-set of harmonic sums not containing an index i=-1, which consists out of 69 sums. The algebraic relations reduce this set to 30 sums. Due to the structural relations a final reduction of the number of harmonic sums to 15 basic functions is obtained. These functions can be represented in terms of factorial series, supplemented by harmonic sums which are algebraically reducible. Complete analytic representations are given for these 15 meromorphic functions in the complex plane deriving their asymptotic- and recursion relations. A general outline is presented on the way nested harmonic sums and multiple zeta values emerge in higher order calculations of zero- and single scale quantities. (orig.)

  12. THERMIONIC AC GENERATION

    Science.gov (United States)

    is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

  13. The Introduction of an Undergraduate Interventional Radiology (IR) Curriculum: Impact on Medical Student Knowledge and Interest in IR

    International Nuclear Information System (INIS)

    Shaikh, M.; Shaygi, B.; Asadi, H.; Thanaratnam, P.; Pennycooke, K.; Mirza, M.; Lee, M.

    2016-01-01

    IntroductionInterventional radiology (IR) plays a vital role in modern medicine, with increasing demand for services, but with a shortage of experienced interventionalists. The aim of this study was to determine the impact of a recently introduced IR curriculum on perception, knowledge, and interest of medical students regarding various aspects of IR.MethodsIn 2014, an anonymous web-based questionnaire was sent to 309 4th year medical students in a single institution within an EU country, both before and after delivery of a 10-h IR teaching curriculum.ResultsSeventy-six percent (236/309) of the respondents participated in the pre-IR module survey, while 50 % (157/309) responded to the post-IR module survey. While 62 % (147/236) of the respondents reported poor or no knowledge of IR compared to other medical disciplines in the pre-IR module survey, this decreased to 17 % (27/157) in the post-IR module survey. The correct responses regarding knowledge of selected IR procedures improved from 70 to 94 % for venous access, 78 to 99 % for uterine fibroid embolization, 75 to 97 % for GI bleeding embolization, 60 to 92 % for trauma embolization, 71 to 92 % for tumor ablation, and 81 to 94 % for angioplasty and stenting in peripheral arterial disease. With regard to knowledge of IR clinical roles, responses improved from 42 to 59 % for outpatient clinic review of patients and having inpatient beds, 63–76 % for direct patient consultation, and 43–60 % for having regular ward rounds. The number of students who would consider a career in IR increased from 60 to 73 %.ConclusionDelivering an undergraduate IR curriculum increased the knowledge and understanding of various aspects of IR and also the general enthusiasm for pursuing this specialty as a future career choice.

  14. The Introduction of an Undergraduate Interventional Radiology (IR) Curriculum: Impact on Medical Student Knowledge and Interest in IR

    Energy Technology Data Exchange (ETDEWEB)

    Shaikh, M. [Bradford Royal Infirmary, Department of Radiology, Bradford Teaching Hospital Foundation Trust (United Kingdom); Shaygi, B. [Royal Devon and Exeter Hospital, Interventional Radiology Department (United Kingdom); Asadi, H., E-mail: asadi.hamed@gmail.com; Thanaratnam, P.; Pennycooke, K.; Mirza, M.; Lee, M., E-mail: mlee@rcsi.ie [Beaumont Hospital, Interventional Radiology Service, Department of Radiology (Ireland)

    2016-04-15

    IntroductionInterventional radiology (IR) plays a vital role in modern medicine, with increasing demand for services, but with a shortage of experienced interventionalists. The aim of this study was to determine the impact of a recently introduced IR curriculum on perception, knowledge, and interest of medical students regarding various aspects of IR.MethodsIn 2014, an anonymous web-based questionnaire was sent to 309 4th year medical students in a single institution within an EU country, both before and after delivery of a 10-h IR teaching curriculum.ResultsSeventy-six percent (236/309) of the respondents participated in the pre-IR module survey, while 50 % (157/309) responded to the post-IR module survey. While 62 % (147/236) of the respondents reported poor or no knowledge of IR compared to other medical disciplines in the pre-IR module survey, this decreased to 17 % (27/157) in the post-IR module survey. The correct responses regarding knowledge of selected IR procedures improved from 70 to 94 % for venous access, 78 to 99 % for uterine fibroid embolization, 75 to 97 % for GI bleeding embolization, 60 to 92 % for trauma embolization, 71 to 92 % for tumor ablation, and 81 to 94 % for angioplasty and stenting in peripheral arterial disease. With regard to knowledge of IR clinical roles, responses improved from 42 to 59 % for outpatient clinic review of patients and having inpatient beds, 63–76 % for direct patient consultation, and 43–60 % for having regular ward rounds. The number of students who would consider a career in IR increased from 60 to 73 %.ConclusionDelivering an undergraduate IR curriculum increased the knowledge and understanding of various aspects of IR and also the general enthusiasm for pursuing this specialty as a future career choice.

  15. Magnetic and superconducting properties of Ir-doped EuFe2As2

    International Nuclear Information System (INIS)

    B Paramanik, U; Hossain, Z; L Paulose, P; Ramakrishnan, S; K Nigam, A; Geibel, C

    2014-01-01

    The magnetic and superconducting properties of 14% Ir-doped EuFe 2 As 2 are studied by means of dc and ac magnetic susceptibilities, electrical resistivity, specific heat and 151 Eu and 57 Fe Mössbauer spectroscopy (MS) measurements. Doping of Ir in EuFe 2 As 2 suppresses the Fe spin density wave transition and in turn gives rise to high temperature superconductivity below 22.5 K with a reentrant feature at lower temperature. Magnetization and 151 Eu Mössbauer data indicate that the Eu 2+ spins order magnetically below 18 K. 57 Fe MS studies show a line broadening in the absorption spectra below 18 K due to transferred hyperfine field from the magnetically ordered Eu sublattices. A pronounced λ-shape peak in the specific heat supports a second-order phase transition of Eu 2+ magnetic ordering with a strong ferromagnetic component, as confirmed by the magnetic field dependences of the transition. For a single crystal, the in-plane resistivity (ρ ab ) and out-of-plane susceptibility (χ c ) show superconducting transitions with zero resistance and diamagnetism, respectively. But the in-plane susceptibility (χ ab ) does not show any diamagnetic shielding against external fields. The observed non-zero resistance in the temperature range 10–17.5 K, below the superconducting transition temperature, suggests the possible existence of a spontaneous vortex state in this superconductor. (papers)

  16. Ion beam synthesis of IrSi3 by implantation of 2 MeV Ir ions

    International Nuclear Information System (INIS)

    Sjoreen, T.P.; Chisholm, M.F.; Hinneberg, H.J.

    1992-11-01

    Formation of a buried IrSi 3 layer in (111) oriented Si by ion implantation and annealing has been studied at an implantation energy of 2 MeV for substrate temperatures of 450--550C. Rutherford backscattering (RBS), ion channeling and cross-sectional transmission electron microscopy showed that a buried epitaxial IrSi 3 layer is produced at 550C by implanting ≥ 3.4 x 10 17 Ir/cm 2 and subsequently annealing for 1 h at 1000C plus 5 h at 1100C. At a dose of 3.4 x 10 17 Ir/cm 2 , the thickness of the layer varied between 120 and 190 nm and many large IrSi 3 precipitates were present above and below the film. Increasing the dose to 4.4 x 10 17 Ir/cm 2 improved the layer uniformity at the expense of increased lattice damage in the overlying Si. RBS analysis of layer formation as a function of substrate temperature revealed the competition between the mechanisms for optimizing surface crystallinity vs. IrSi 3 layer formation. Little apparent substrate temperature dependence was evident in the as-implanted state but after annealing the crystallinity of the top Si layer was observed to deteriorate with increasing substrate temperature while the precipitate coarsening and coalescence improved

  17. Smulkaus ir vidutinio verslo konkurencingumas Lietuvoje

    OpenAIRE

    Vijeikis, Juozas; Makštutis, Antanas

    2009-01-01

    Straipsnio mokslinė problema, naujumas ir aktualumas. Konkurencingumas kaip įmonių efektyvios veiklos reiškinys yra aktualus šalies verslo gyvenime vykdant darnios ekonominės plėtros politiką. Ši politika kaip problema smulkaus ir vidutinio verslo (SVV) plėtrai ir konkurencingumui didinti nėra sistemiškai ištirta ir aprašyta Lietuvos sąlygomis mokslinėje ir praktinėje literatūroje. Vienas svarbiausių veiksnių, siekiant spartaus ekonominio augimo, yra darnios verslininkystės plėtra Lietuvoje n...

  18. 338 Résumé

    African Journals Online (AJOL)

    ISONIC

    sumé. Cardisoma armatum, est une espèce de crabe de terre rencontrée en Afrique de l'ouest en particulier en ... optique suite au traitement histologique ont permis la mise en évidence de quelques critères d'identification de l'espèce et ...... En Côte d'Ivoire il n'est pas rare de voir durant les saisons propices. Cardisoma ...

  19. Structural, phase stability, electronic, elastic properties and hardness of IrN{sub 2} and zinc blende IrN: First-principles calculations

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Zhaobo [Key Laboratory of Advanced Materials of Yunnan Province & Key Laboratory of Advanced Materials of Non-Ferrous and Precious Rare Metals Ministry of Education, Kunming University of Science and Technology, Kunming 650093 (China); Zhou, Xiaolong, E-mail: kmzxlong@163.com [Key Laboratory of Advanced Materials of Yunnan Province & Key Laboratory of Advanced Materials of Non-Ferrous and Precious Rare Metals Ministry of Education, Kunming University of Science and Technology, Kunming 650093 (China); Zhang, Kunhua [State Key Laboratory of Rare Precious Metals Comprehensive Utilization of New Technologies, Kunming Institute of Precious Metals, Kunming 650106 (China)

    2016-12-15

    First-principle calculations were performed to investigate the structural, phase stability, electronic, elastic properties and hardness of monoclinic structure IrN{sub 2} (m-IrN{sub 2}), orthorhombic structure IrN{sub 2} (o-IrN{sub 2}) and zinc blende structure IrN (ZB IrN). The results show us that only m-IrN{sub 2} is both thermodynamic and dynamic stability. The calculated band structure and density of states (DOS) curves indicate that o-IrN{sub 2} and ZB Ir-N compounds we calculated have metallic behavior while m-IrN{sub 2} has a small band gap of ~0.3 eV, and exist a common hybridization between Ir-5d and N-2p states, which forming covalent bonding between Ir and N atoms. The difference charge density reveals the electron transfer from Ir atom to N atom for three Ir-N compounds, which forming strong directional covalent bonds. Notable, a strong N-N bond appeared in m-IrN{sub 2} and o-IrN{sub 2}. The ratio of bulk to shear modulus (B/G) indicate that three Ir-N compounds we calculated are ductile, and ZB IrN possesses a better ductility than two types IrN{sub 2}. m-IrN{sub 2} has highest Debye temperature (736 K), illustrating it possesses strongest covalent bonding. The hardness of three Ir-N compounds were also calculated, and the results reveal that m-IrN{sub 2} (18.23 GPa) and o-IrN{sub 2} (18.02 GPa) are ultraincompressible while ZB IrN has a negative value, which may be attributed to phase transition at ca. 1.98 GPa.

  20. 21 CFR 880.6320 - AC-powered medical examination light.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

  1. Evaluation of the convolution sum involving the sum of divisors function for 22, 44 and 52

    Directory of Open Access Journals (Sweden)

    Ntienjem Ebénézer

    2017-04-01

    \\end{array} $ where αβ = 22, 44, 52, is evaluated for all natural numbers n. Modular forms are used to achieve these evaluations. Since the modular space of level 22 is contained in that of level 44, we almost completely use the basis elements of the modular space of level 44 to carry out the evaluation of the convolution sums for αβ = 22. We then use these convolution sums to determine formulae for the number of representations of a positive integer by the octonary quadratic forms a(x12+x22+x32+x42+b(x52+x62+x72+x82, $a\\,(x_{1}^{2}+x_{2}^{2}+x_{3}^{2}+x_{4}^{2}+b\\,(x_{5}^{2}+x_{6}^{2}+x_{7}^{2}+x_{8}^{2},$ where (a, b = (1, 11, (1, 13.

  2. Protection of p+-n-Si Photoanodes by Sputter-Deposited Ir/IrOxThin Films

    DEFF Research Database (Denmark)

    Mei, Bastian Timo; Seger, Brian; Pedersen, Thomas

    2014-01-01

    Sputter deposition of Ir/IrOx on p+-n-Si without interfacial corrosion protection layers yielded photoanodes capable of efficient water oxidation (OER) in acidic media (1 M H2SO4). Stability of at least 18 h was shown by chronoamperomety at 1.23 V versus RHE (reversible hydrogen electrode) under 38...... density of 1 mA/cm2 at 1.05 V vs. RHE. Further improvement by heat treatment resulted in a cathodic shift of 40 mV and enabled a current density of 10 mA/cm2 (requirements for a 10% efficient tandem device) at 1.12 V vs. RHS under irradiation. Thus, the simple IrOx/Ir/p+-n-Si structures not only provide...

  3. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Gould, O.L.

    1996-01-01

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  4. Novel cross-talk between IGF-IR and DDR1 regulates IGF-IR trafficking, signaling and biological responses

    Science.gov (United States)

    Sacco, Antonella; Morcavallo, Alaide; Vella, Veronica; Voci, Concetta; Spatuzza, Michela; Xu, Shi-Qiong; Iozzo, Renato V.; Vigneri, Riccardo; Morrione, Andrea; Belfiore, Antonino

    2015-01-01

    The insulin-like growth factor-I receptor (IGF-IR), plays a key role in regulating mammalian development and growth, and is frequently deregulated in cancer contributing to tumor initiation and progression. Discoidin domain receptor 1 (DDR1), a collagen receptor tyrosine-kinase, is as well frequently overexpressed in cancer and implicated in cancer progression. Thus, we investigated whether a functional cross-talk between the IGF-IR and DDR1 exists and plays any role in cancer progression. Using human breast cancer cells we found that DDR1 constitutively associated with the IGF-IR. However, this interaction was enhanced by IGF-I stimulation, which promoted rapid DDR1 tyrosine-phosphorylation and co-internalization with the IGF-IR. Significantly, DDR1 was critical for IGF-IR endocytosis and trafficking into early endosomes, IGF-IR protein expression and IGF-I intracellular signaling and biological effects, including cell proliferation, migration and colony formation. These biological responses were inhibited by DDR1 silencing and enhanced by DDR1 overexpression. Experiments in mouse fibroblasts co-transfected with the human IGF-IR and DDR1 gave similar results and indicated that, in the absence of IGF-IR, collagen-dependent phosphorylation of DDR1 is impaired. These results demonstrate a critical role of DDR1 in the regulation of IGF-IR action, and identify DDR1 as a novel important target for breast cancers that overexpress IGF-IR. PMID:25840417

  5. Finding Sums for an Infinite Class of Alternating Series

    Science.gov (United States)

    Chen, Zhibo; Wei, Sheng; Xiao, Xuerong

    2012-01-01

    Calculus II students know that many alternating series are convergent by the Alternating Series Test. However, they know few alternating series (except geometric series and some trivial ones) for which they can find the sum. In this article, we present a method that enables the students to find sums for infinitely many alternating series in the…

  6. An abstract approach to some spectral problems of direct sum differential operators

    Directory of Open Access Journals (Sweden)

    Maksim S. Sokolov

    2003-07-01

    Full Text Available In this paper, we study the common spectral properties of abstract self-adjoint direct sum operators, considered in a direct sum Hilbert space. Applications of such operators arise in the modelling of processes of multi-particle quantum mechanics, quantum field theory and, specifically, in multi-interval boundary problems of differential equations. We show that a direct sum operator does not depend in a straightforward manner on the separate operators involved. That is, on having a set of self-adjoint operators giving a direct sum operator, we show how the spectral representation for this operator depends on the spectral representations for the individual operators (the coordinate operators involved in forming this sum operator. In particular it is shown that this problem is not immediately solved by taking a direct sum of the spectral properties of the coordinate operators. Primarily, these results are to be applied to operators generated by a multi-interval quasi-differential system studied, in the earlier works of Ashurov, Everitt, Gesztezy, Kirsch, Markus and Zettl. The abstract approach in this paper indicates the need for further development of spectral theory for direct sum differential operators.

  7. On QCD sum rules of the Laplace transform type and light quark masses

    International Nuclear Information System (INIS)

    Narison, S.

    1981-04-01

    We discuss the relation between the usual dispersion relation sum rules and the Laplace transform type sum rules in quantum chromodynamics. Two specific examples corresponding to the S-coupling constant sum rule and the light quark masses sum rules are considered. An interpretation, within QCD, of Leutwyler's formula for the current algebra quark masses is also given

  8. Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

    Directory of Open Access Journals (Sweden)

    Amir V. Tavakoli

    2017-09-01

    Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

  9. Wave functions constructed from an invariant sum over histories satisfy constraints

    International Nuclear Information System (INIS)

    Halliwell, J.J.; Hartle, J.B.

    1991-01-01

    Invariance of classical equations of motion under a group parametrized by functions of time implies constraints between canonical coordinates and momenta. In the Dirac formulation of quantum mechanics, invariance is normally imposed by demanding that physical wave functions are annihilated by the operator versions of these constraints. In the sum-over-histories quantum mechanics, however, wave functions are specified, directly, by appropriate functional integrals. It therefore becomes an interesting question whether the wave functions so specified obey the operator constraints of the Dirac theory. In this paper, we show for a wide class of theories, including gauge theories, general relativity, and first-quantized string theories, that wave functions constructed from a sum over histories are, in fact, annihilated by the constraints provided that the sum over histories is constructed in a manner which respects the invariance generated by the constraints. By this we mean a sum over histories defined with an invariant action, invariant measure, and an invariant class of paths summed over

  10. Symbolic methods for the evaluation of sum rules of Bessel functions

    International Nuclear Information System (INIS)

    Babusci, D.; Dattoli, G.; Górska, K.; Penson, K. A.

    2013-01-01

    The use of the umbral formalism allows a significant simplification of the derivation of sum rules involving products of special functions and polynomials. We rederive in this way known sum rules and addition theorems for Bessel functions. Furthermore, we obtain a set of new closed form sum rules involving various special polynomials and Bessel functions. The examples we consider are relevant for applications ranging from plasma physics to quantum optics

  11. Generalized harmonic, cyclotomic, and binomial sums, their polylogarithms and special numbers

    Energy Technology Data Exchange (ETDEWEB)

    Ablinger, J.; Schneider, C. [Johannes Kepler Univ., Linz (Austria). Research Inst. for Symbolic Computation (RISC); Bluemlein, J. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)

    2013-10-15

    A survey is given on mathematical structures which emerge in multi-loop Feynman diagrams. These are multiply nested sums, and, associated to them by an inverse Mellin transform, specific iterated integrals. Both classes lead to sets of special numbers. Starting with harmonic sums and polylogarithms we discuss recent extensions of these quantities as cyclotomic, generalized (cyclotomic), and binomially weighted sums, associated iterated integrals and special constants and their relations.

  12. Generalized harmonic, cyclotomic, and binomial sums, their polylogarithms and special numbers

    International Nuclear Information System (INIS)

    Ablinger, J.; Schneider, C.; Bluemlein, J.

    2013-10-01

    A survey is given on mathematical structures which emerge in multi-loop Feynman diagrams. These are multiply nested sums, and, associated to them by an inverse Mellin transform, specific iterated integrals. Both classes lead to sets of special numbers. Starting with harmonic sums and polylogarithms we discuss recent extensions of these quantities as cyclotomic, generalized (cyclotomic), and binomially weighted sums, associated iterated integrals and special constants and their relations.

  13. HOMA1-IR and HOMA2-IR indexes in identifying insulin resistance and metabolic syndrome: Brazilian Metabolic Syndrome Study (BRAMS).

    Science.gov (United States)

    Geloneze, Bruno; Vasques, Ana Carolina Junqueira; Stabe, Christiane França Camargo; Pareja, José Carlos; Rosado, Lina Enriqueta Frandsen Paez de Lima; Queiroz, Elaine Cristina de; Tambascia, Marcos Antonio

    2009-03-01

    To investigate cut-off values for HOMA1-IR and HOMA2-IR to identify insulin resistance (IR) and metabolic syndrome (MS), and to assess the association of the indexes with components of the MS. Nondiabetic subjects from the Brazilian Metabolic Syndrome Study were studied (n = 1,203, 18 to 78 years). The cut-off values for IR were determined from the 90th percentile in the healthy group (n = 297) and, for MS, a ROC curve was generated for the total sample. In the healthy group, HOMA-IR indexes were associated with central obesity, triglycerides and total cholesterol (p 2.7 and HOMA2-IR > 1.8; and, for MS were: HOMA1-IR > 2.3 (sensitivity: 76.8%; specificity: 66.7%) and HOMA2-IR > 1.4 (sensitivity: 79.2%; specificity: 61.2%). The cut-off values identified for HOMA1-IR and HOMA2-IR indexes have a clinical and epidemiological application for identifying IR and MS in Westernized admixtured multi-ethnic populations.

  14. Renormalization group summation of Laplace QCD sum rules for scalar gluon currents

    Directory of Open Access Journals (Sweden)

    Farrukh Chishtie

    2016-03-01

    Full Text Available We employ renormalization group (RG summation techniques to obtain portions of Laplace QCD sum rules for scalar gluon currents beyond the order to which they have been explicitly calculated. The first two of these sum rules are considered in some detail, and it is shown that they have significantly less dependence on the renormalization scale parameter μ2 once the RG summation is used to extend the perturbative results. Using the sum rules, we then compute the bound on the scalar glueball mass and demonstrate that the 3 and 4-Loop perturbative results form lower and upper bounds to their RG summed counterparts. We further demonstrate improved convergence of the RG summed expressions with respect to perturbative results.

  15. IOT Overview: IR Instruments

    Science.gov (United States)

    Mason, E.

    In this instrument review chapter the calibration plans of ESO IR instruments are presented and briefly reviewed focusing, in particular, on the case of ISAAC, which has been the first IR instrument at VLT and whose calibration plan served as prototype for the coming instruments.

  16. Sum-Trigger-II status and prospective physics

    Energy Technology Data Exchange (ETDEWEB)

    Dazzi, Francesco; Mirzoyan, Razmik; Schweizer, Thomas; Teshima, Masahiro [Max Planck Institut fuer Physik, Munich (Germany); Herranz, Diego; Lopez, Marcos [Universidad Complutense, Madrid (Spain); Mariotti, Mose [Universita degli Studi di Padova (Italy); Nakajima, Daisuke [The University of Tokio (Japan); Rodriguez Garcia, Jezabel [Max Planck Institut fuer Physik, Munich (Germany); Instituto Astrofisico de Canarias, Tenerife (Spain)

    2015-07-01

    MAGIC is a stereoscopic system of 2 Imaging Air Cherenkov Telescopes (IACTs) for very high energy gamma-ray astronomy, located at La Palma (Spain). Lowering the energy threshold of IACTs is crucial for the observation of Pulsars, high redshift AGNs and GRBs. A novel trigger strategy, based on the analogue sum of a patch of pixels, can lead to a lower threshold compared to conventional digital triggers. In the last years, a major upgrade of the MAGIC telescopes took place in order to optimize the performances, mainly in the low energy domain. The PMTs camera and the reflective surface of MAGIC-I, as well as both readout systems, have been deeply renovated. The last important milestone is the implementation of a new stereoscopic analogue trigger, dubbed Sum-Trigger-II. The installation successfully ended in 2014 and the first data set has been already taken. Currently the fine-tuning of the main parameters as well as the comparison with Monte Carlo studies is ongoing. In this talk the status of Sum-Trigger-II and the future prospective physics cases at very low energy are presented.

  17. B --> K$*\\gamma$ from hybrid sum rule

    CERN Document Server

    Narison, Stéphan

    1994-01-01

    Using the {\\it hybrid} moments-Laplace sum rule (HSR), which is well-defined for M_b \\rar \\infty, in contrast with the popular double Borel (Laplace) sum rule (DLSR), which blows up in this limit when applied to the heavy-to-light processes, we show that the form factor of the B \\rar K^* \\ \\gamma radiative transition is dominated by the light-quark condensate for M_b \\rar \\infty and behaves like \\sqrt M_b. The form factor is found to be F^{B\\rar K^*}_1(0) \\simeq (30.8 \\pm 1.3 \\pm 3.6 \\pm 0.6)\\times 10^{-2}, where the errors come respectively from the procedure in the sum rule analysis, the errors in the input and in the SU(3)_f-breaking parameters. This result leads to Br(B\\rar K^* \\ \\gamma) \\simeq (4.45 \\pm 1.12) \\times 10^{-5} in agreement with the recent CLEO data. Parametrization of the M_b-dependence of the form factor including the SU(3)_f-breaking effects is given in (26), which leads to F^{B\\rar K^*}_1(0)/ F^{B\\rar \\rho}_1(0) \\simeq (1.14 \\pm 0.02).

  18. Atom condensation on an atomically smooth surface: Ir, Re, W, and Pd on Ir(111)

    International Nuclear Information System (INIS)

    Wang, S.C.; Ehrlich, G.

    1991-01-01

    The distribution of condensing metal atoms over the two types of sites present on an atomically smooth Ir(111) has been measured in a field ion microscope. For Ir, Re, W, and Pd from a thermal source, condensing on Ir(111) at ∼20 K, the atoms are randomly distributed, as expected if they condense at the first site struck

  19. Inequalities for finite trigonometric sums. An interplay: with some series related to harmonic numbers

    Directory of Open Access Journals (Sweden)

    Omran Kouba

    2016-07-01

    Full Text Available Abstract An interplay between the sum of certain series related to harmonic numbers and certain finite trigonometric sums is investigated. This allows us to express the sum of these series in terms of the considered trigonometric sums, and permits us to find sharp inequalities bounding these trigonometric sums. In particular, this answers positively an open problem of Chen (Excursions in Classical Analysis, 2010.

  20. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

  1. Single-nucleotide polymorphism of INS, INSR, IRS1, IRS2, PPAR-G ...

    Indian Academy of Sciences (India)

    2017-03-02

    Mar 2, 2017 ... Abstract. Polycystic ovary syndrome (PCOS) is the most common and a complex female endocrine disorder, and is one of the leading cause of female infertility. Here, we aimed to investigate the association of single-nucleotide polymorphism of INS, INSR,. IRS1, IRS2, PPAR-G and CAPN10 gene in the ...

  2. Suppression of superconductivity in Nb by IrMn in IrMn/Nb bilayers

    KAUST Repository

    Wu, B. L.; Yang, Y. M.; Guo, Z. B.; Wu, Y. H.; Qiu, J. J.

    2013-01-01

    Effect of antiferromagnet on superconductivity has been investigated in IrMn/Nb bilayers. Significant suppression of both transition temperature (Tc) and lower critical field (Hc1) of Nb is found in IrMn/Nb bilayers as compared to a single layer Nb

  3. Chain hexagonal cacti with the extremal eccentric distance sum.

    Science.gov (United States)

    Qu, Hui; Yu, Guihai

    2014-01-01

    Eccentric distance sum (EDS), which can predict biological and physical properties, is a topological index based on the eccentricity of a graph. In this paper we characterize the chain hexagonal cactus with the minimal and the maximal eccentric distance sum among all chain hexagonal cacti of length n, respectively. Moreover, we present exact formulas for EDS of two types of hexagonal cacti.

  4. Direct and reverse inclusions for strongly multiple summing operators

    Indian Academy of Sciences (India)

    and strongly multiple summing operators under the assumption that the range has finite cotype. Keywords. .... multiple (q, p)-summing, if there exists a constant C ≥ 0 such that for every choice of systems (x j i j )1≤i j ≤m j ...... Ideals and their Applications in Theoretical Physics (1983) (Leipzig: Teubner-Texte) pp. 185–199.

  5. Path-sum calculations for rf current drive

    International Nuclear Information System (INIS)

    Belo, Jorge H.; Bizarro, Joao P.S.; Rodrigues, Paulo

    2001-01-01

    Path sums and Gaussian short-time propagators are used to solve two-dimensional Fokker-Planck models of lower-hybrid (LH) and electron-cyclotron (EC) current drive (CD), and are shown to be well suited to the two limiting situations where the rf quasilinear diffusion coefficient is either relatively small, D rf ≅0.1, or very large, D rf →∞, the latter case enabling a special treatment. Results are given for both LHCD and ECCD in the small D rf case, whereas the limiting situation is illustrated only for ECCD. To check the accuracy of path-sum calculations, comparisons with finite difference solutions are provided

  6. Ordering individuals with sum scores: the introduction of the nonparametric Rasch model

    NARCIS (Netherlands)

    Zwitser, R.J.; Maris, G.

    2016-01-01

    When a simple sum or number-correct score is used to evaluate the ability of individual testees, then, from an accountability perspective, the inferences based on the sum score should be the same as the inferences based on the complete response pattern. This requirement is fulfilled if the sum score

  7. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  8. A multi-channel AC power supply controller

    International Nuclear Information System (INIS)

    Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei

    2003-01-01

    A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system

  9. On formation mechanism of Pd-Ir bimetallic nanoparticles through thermal decomposition of [Pd(NH3)4][IrCl6

    Science.gov (United States)

    Asanova, Tatyana I.; Asanov, Igor P.; Kim, Min-Gyu; Gerasimov, Evgeny Yu.; Zadesenets, Andrey V.; Plyusnin, Pavel E.; Korenev, Sergey V.

    2013-10-01

    The formation mechanism of Pd-Ir nanoparticles during thermal decomposition of double complex salt [Pd(NH3)4][IrCl6] has been studied by in situ X-ray absorption (XAFS) and photoelectron (XPS) spectroscopies. The changes in the structure of the Pd and Ir closest to the surroundings and chemical states of Pd, Ir, Cl, and N atoms were traced in the range from room temperature to 420 °C in inert atmosphere. It was established that the thermal decomposition process is carried out in 5 steps. The Pd-Ir nanoparticles are formed in pyramidal/rounded Pd-rich (10-200 nm) and dendrite Ir-rich (10-50 nm) solid solutions. A d charge depletion at Ir site and a gain at Pd, as well as the intra-atomic charge redistribution between the outer d and s and p electrons of both Ir and Pd in Pd-Ir nanoparticles, were found to occur.

  10. On formation mechanism of Pd–Ir bimetallic nanoparticles through thermal decomposition of [Pd(NH3)4][IrCl6

    International Nuclear Information System (INIS)

    Asanova, Tatyana I.; Asanov, Igor P.; Kim, Min-Gyu; Gerasimov, Evgeny Yu.; Zadesenets, Andrey V.; Plyusnin, Pavel E.; Korenev, Sergey V.

    2013-01-01

    The formation mechanism of Pd–Ir nanoparticles during thermal decomposition of double complex salt [Pd(NH 3 ) 4 ][IrCl 6 ] has been studied by in situ X-ray absorption (XAFS) and photoelectron (XPS) spectroscopies. The changes in the structure of the Pd and Ir closest to the surroundings and chemical states of Pd, Ir, Cl, and N atoms were traced in the range from room temperature to 420 °C in inert atmosphere. It was established that the thermal decomposition process is carried out in 5 steps. The Pd–Ir nanoparticles are formed in pyramidal/rounded Pd-rich (10–200 nm) and dendrite Ir-rich (10–50 nm) solid solutions. A d charge depletion at Ir site and a gain at Pd, as well as the intra-atomic charge redistribution between the outer d and s and p electrons of both Ir and Pd in Pd–Ir nanoparticles, were found to occur.Graphical Abstract

  11. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  12. Analytical modelling of a thin liquid metal layer submitted to an ac magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Hinaje, M [Groupe de Recherche en Electrotechnique et Electronique de Nancy, 2 avenue de la Foret de Haye, 54516 Vandoeuvre-les-Nancy (France); Vinsard, G [Laboratoire d' Energetique et de Mecanique Theorique et Appliquee, 2 avenue de la Foret de Haye, 54516 Vandoeuvre-les-Nancy (France); Dufour, S [Laboratoire d' Energetique et de Mecanique Theorique et Appliquee, 2 avenue de la Foret de Haye, 54516 Vandoeuvre-les-Nancy (France)

    2006-07-07

    A cylindrical thin liquid metal layer is submitted to a uniform ac magnetic field. When the intensity of the electromagnetic field exceeds a critical value, an opening in the liquid is shaped from outside to inside. At a given intensity of the electromagnetic field, this opening is in a frozen state, that is, the liquid metal layer reaches a new equilibrium shape. In this paper, we show that this equilibrium corresponds to a minimum of the total energy of the system. This total energy is equal to the sum of the magnetic energy and the mechanical energy. The magnetic energy is computed by assuming that the induced eddy current flowing through the liquid metal layer is concentrated in the cross-section S{sub c} equal to the product of the skin depth and the thickness of the layer. This assumption leads us to study an equivalent electrical circuit. The mechanical energy is composed of the potential energy and the surface energy.

  13. Analytical modelling of a thin liquid metal layer submitted to an ac magnetic field

    International Nuclear Information System (INIS)

    Hinaje, M; Vinsard, G; Dufour, S

    2006-01-01

    A cylindrical thin liquid metal layer is submitted to a uniform ac magnetic field. When the intensity of the electromagnetic field exceeds a critical value, an opening in the liquid is shaped from outside to inside. At a given intensity of the electromagnetic field, this opening is in a frozen state, that is, the liquid metal layer reaches a new equilibrium shape. In this paper, we show that this equilibrium corresponds to a minimum of the total energy of the system. This total energy is equal to the sum of the magnetic energy and the mechanical energy. The magnetic energy is computed by assuming that the induced eddy current flowing through the liquid metal layer is concentrated in the cross-section S c equal to the product of the skin depth and the thickness of the layer. This assumption leads us to study an equivalent electrical circuit. The mechanical energy is composed of the potential energy and the surface energy

  14. Neutrino mass sum rules and symmetries of the mass matrix

    Energy Technology Data Exchange (ETDEWEB)

    Gehrlein, Julia [Karlsruhe Institute of Technology, Institut fuer Theoretische Teilchenphysik, Karlsruhe (Germany); Universidad Autonoma de Madrid, Departamento de Fisica Teorica, Madrid (Spain); Instituto de Fisica Teorica UAM/CSIC, Madrid (Spain); Spinrath, Martin [Karlsruhe Institute of Technology, Institut fuer Theoretische Teilchenphysik, Karlsruhe (Germany); National Center for Theoretical Sciences, Physics Division, Hsinchu (China)

    2017-05-15

    Neutrino mass sum rules have recently gained again more attention as a powerful tool to discriminate and test various flavour models in the near future. A related question which has not yet been discussed fully satisfactorily was the origin of these sum rules and if they are related to any residual or accidental symmetry. We will address this open issue here systematically and find previous statements confirmed. Namely, the sum rules are not related to any enhanced symmetry of the Lagrangian after family symmetry breaking but they are simply the result of a reduction of free parameters due to skillful model building. (orig.)

  15. Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

    2014-10-01

    Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

  16. Distinct signalling properties of insulin receptor substrate (IRS)-1 and IRS-2 in mediating insulin/IGF-1 action

    DEFF Research Database (Denmark)

    Rabiee, Atefeh; Krüger, Marcus; Ardenkjær-Larsen, Jacob

    2018-01-01

    Insulin/IGF-1 action is driven by a complex and highly integrated signalling network. Loss-of-function studies indicate that the major insulin/IGF-1 receptor substrate (IRS) proteins, IRS-1 and IRS-2, mediate different biological functions in vitro and in vivo, suggesting specific signalling...... properties despite their high degree of homology. To identify mechanisms contributing to the differential signalling properties of IRS-1 and IRS-2 in the mediation of insulin/IGF-1 action, we performed comprehensive mass spectrometry (MS)-based phosphoproteomic profiling of brown preadipocytes from wild type......, IRS-1-/-and IRS-2-/-mice in the basal and IGF-1-stimulated states. We applied stable isotope labeling by amino acids in cell culture (SILAC) for the accurate quantitation of changes in protein phosphorylation. We found ~10% of the 6262 unique phosphorylation sites detected to be regulated by IGF-1...

  17. Distinct signalling properties of insulin receptor substrate (IRS)-1 and IRS-2 in mediating insulin/IGF-1 action.

    Science.gov (United States)

    Rabiee, Atefeh; Krüger, Marcus; Ardenkjær-Larsen, Jacob; Kahn, C Ronald; Emanuelli, Brice

    2018-07-01

    Insulin/IGF-1 action is driven by a complex and highly integrated signalling network. Loss-of-function studies indicate that the major insulin/IGF-1 receptor substrate (IRS) proteins, IRS-1 and IRS-2, mediate different biological functions in vitro and in vivo, suggesting specific signalling properties despite their high degree of homology. To identify mechanisms contributing to the differential signalling properties of IRS-1 and IRS-2 in the mediation of insulin/IGF-1 action, we performed comprehensive mass spectrometry (MS)-based phosphoproteomic profiling of brown preadipocytes from wild type, IRS-1 -/- and IRS-2 -/- mice in the basal and IGF-1-stimulated states. We applied stable isotope labeling by amino acids in cell culture (SILAC) for the accurate quantitation of changes in protein phosphorylation. We found ~10% of the 6262 unique phosphorylation sites detected to be regulated by IGF-1. These regulated sites included previously reported substrates of the insulin/IGF-1 signalling pathway, as well as novel substrates including Nuclear Factor I X and Semaphorin-4B. In silico prediction suggests the protein kinase B (PKB), protein kinase C (PKC), and cyclin-dependent kinase (CDK) as the main mediators of these phosphorylation events. Importantly, we found preferential phosphorylation patterns depending on the presence of either IRS-1 or IRS-2, which was associated with specific sets of kinases involved in signal transduction downstream of these substrates such as PDHK1, MAPK3, and PKD1 for IRS-1, and PIN1 and PKC beta for IRS-2. Overall, by generating a comprehensive phosphoproteomic profile from brown preadipocyte cells in response to IGF-1 stimulation, we reveal both common and distinct insulin/IGF-1 signalling events mediated by specific IRS proteins. Copyright © 2018 Elsevier Inc. All rights reserved.

  18. Structural relations of harmonic sums and Mellin transformers at weight w=6

    Energy Technology Data Exchange (ETDEWEB)

    Bluemlein, Johannes

    2009-01-15

    We derive the structural relations between nested harmonic sums and the corresponding Mellin transforms of Nielsen integrals and harmonic polylogarithms at weight w=6. They emerge in the calculations of massless single-scale quantities in QED and QCD, such as anomalous dimensions and Wilson coefficients, to 3- and 4-loop order. We consider the set of the multiple harmonic sums at weight six without index {l_brace}-1{r_brace}. This restriction is sufficient for all known physical cases. The structural relations supplement the algebraic relations, due to the shuffle product between harmonic sums, studied earlier. The original amount of 486 possible harmonic sums contributing at weight w=6 reduces to 99 sums with no index {l_brace}-1{r_brace}. Algebraic and structural relations lead to a further reduction to 20 basic functions. These functions supplement the set of 15 basic functions up to weight w=5 derived formerly. We line out an algorithm to obtain the analytic representation of the basic sums in the complex plane. (orig.)

  19. An electrophysiological signature of summed similarity in visual working memory

    NARCIS (Netherlands)

    Van Vugt, Marieke K.; Sekuler, Robert; Wilson, Hugh R.; Kahana, Michael J.

    Summed-similarity models of short-term item recognition posit that participants base their judgments of an item's prior occurrence on that item's summed similarity to the ensemble of items on the remembered list. We examined the neural predictions of these models in 3 short-term recognition memory

  20. Spectral sum rule for time delay in R2

    International Nuclear Information System (INIS)

    Osborn, T.A.; Sinha, K.B.; Bolle, D.; Danneels, C.

    1985-01-01

    A local spectral sum rule for nonrelativistic scattering in two dimensions is derived for the potential class velement ofL 4 /sup // 3 (R 2 ). The sum rule relates the integral over all scattering energies of the trace of the time-delay operator for a finite region Σis contained inR 2 to the contributions in Σ of the pure point and singularly continuous spectra

  1. Dichromatic State Sum Models for Four-Manifolds from Pivotal Functors

    Science.gov (United States)

    Bärenz, Manuel; Barrett, John

    2017-11-01

    A family of invariants of smooth, oriented four-dimensional manifolds is defined via handle decompositions and the Kirby calculus of framed link diagrams. The invariants are parametrised by a pivotal functor from a spherical fusion category into a ribbon fusion category. A state sum formula for the invariant is constructed via the chain-mail procedure, so a large class of topological state sum models can be expressed as link invariants. Most prominently, the Crane-Yetter state sum over an arbitrary ribbon fusion category is recovered, including the nonmodular case. It is shown that the Crane-Yetter invariant for nonmodular categories is stronger than signature and Euler invariant. A special case is the four-dimensional untwisted Dijkgraaf-Witten model. Derivations of state space dimensions of TQFTs arising from the state sum model agree with recent calculations of ground state degeneracies in Walker-Wang models. Relations to different approaches to quantum gravity such as Cartan geometry and teleparallel gravity are also discussed.

  2. Polarizability sum rules in QED

    International Nuclear Information System (INIS)

    Llanta, E.; Tarrach, R.

    1978-01-01

    The well founded total photoproduction and the, assumed subtraction free, longitudinal photoproduction polarizability sum rules are checked in QED at the lowest non-trivial order. The first one is shown to hold, whereas the second one turns out to need a subtraction, which makes its usefulness for determining the electromagnetic polarizabilities of the nucleons quite doubtful. (Auth.)

  3. Density functional study of the L10-αIrV transition in IrV and RhV

    International Nuclear Information System (INIS)

    Mehl, Michael J.; Hart, Gus L.W.; Curtarolo, Stefano

    2011-01-01

    Research highlights: → The computational determination of the ground state of a material can be a difficult task, particularly if the ground state is uncommon and so not found in usual databases. In this paper we consider the alpha-IrV structure, a low temperature structure found only in two compounds, IrV and RhV. In both cases this structure can be considered as a distorted tetragonal structure, and the tetragonal 'L1 0 ' structure is the high temperature structure for both compounds. We show, however, that the logical path for the transition from the L1 0 to the alpha-IrV structure is energetically forbidden, and find a series of unstable and metastable structures which have a lower energy than the L1 0 phase, but are higher in energy than the alpha-IrV phase. We also consider the possibility of the alpha-IrV structure appearing in neighboring compounds. We find that both IrTi and RhTi are candidates. - Abstract: Both IrV and RhV crystallize in the αIrV structure, with a transition to the higher symmetry L1 0 structure at high temperature, or with the addition of excess Ir or Rh. Here we present evidence that this transition is driven by the lowering of the electronic density of states at the Fermi level of the αIrV structure. The transition has long been thought to be second order, with a simple doubling of the L1 0 unit cell due to an unstable phonon at the R point (0 1/2 1/2). We use first-principles calculations to show that all phonons at the R point are, in fact, stable, but do find a region of reciprocal space where the L1 0 structure has unstable (imaginary frequency) phonons. We use the frozen phonon method to examine two of these modes, relaxing the structures associated with the unstable phonon modes to obtain new structures which are lower in energy than L1 0 but still above αIrV. We examine the phonon spectra of these structures as well, looking for instabilities, and find further instabilities, and more relaxed structures, all of which have

  4. Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

    Directory of Open Access Journals (Sweden)

    Evi Ploumpidou

    2017-12-01

    Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

  5. A Bayesian analysis of the nucleon QCD sum rules

    International Nuclear Information System (INIS)

    Ohtani, Keisuke; Gubler, Philipp; Oka, Makoto

    2011-01-01

    QCD sum rules of the nucleon channel are reanalyzed, using the maximum-entropy method (MEM). This new approach, based on the Bayesian probability theory, does not restrict the spectral function to the usual ''pole + continuum'' form, allowing a more flexible investigation of the nucleon spectral function. Making use of this flexibility, we are able to investigate the spectral functions of various interpolating fields, finding that the nucleon ground state mainly couples to an operator containing a scalar diquark. Moreover, we formulate the Gaussian sum rule for the nucleon channel and find that it is more suitable for the MEM analysis to extract the nucleon pole in the region of its experimental value, while the Borel sum rule does not contain enough information to clearly separate the nucleon pole from the continuum. (orig.)

  6. PENDIDIKAN AKHLAK MUSLIMAT MELALUISYA’IR : ANALISIS GENDER ATAS AJARAN SYI’IR MUSLIMAT KARYA NYAI WANIFAH KUDUS

    Directory of Open Access Journals (Sweden)

    Nur Said

    2016-03-01

    Full Text Available Penelitian ini difokuskan pada tiga hal: (1 Apakah karakteristik lingkup isi Syi’ir Muslimat?, (2 Bagai-manakah kondisi sosial budaya pada saat naskah ditulis oleh penulis?, (3 Apa nilai-nilai pendidikan moral bagi perempuan Muslim di isi Syi’ir Muslimat dalam perspektif gender?. Penelitian ini menggunakan pendekatan filologi dengan meningkatkan penggunaan analisis gender. Hasil dari penelitian ini adalah: Pertama, Syi’ir Muslimat ditulis oleh Nyai Wanifah, seorang wanita yang hidup pada zaman kolonial Belanda dipesantren tradisi di Kudus, Jawa Tengah. Kedua, beberapa nilai pendidikan moral di Syi’ir Muslimatantara lain: (1 Pentingnya pendidikan moral, (2 Bahaya perempuan bodoh; (3 Pentingnya belajar bagi perempuan di usia dini, (4 Etika menghias diri; (5 Bahaya materialisme, (6 Etika hubungan keluarga; (7 Dari rumah untuk mencapai surga; (8 Berhati-hatilah dengan tipu iblis; (9 Hindari perzinahan; (10 yang penting dari penutupan aurot; (11 yang ditujukan kepada orang tua. Ketiga, meskipun ada beberapa senyawa yang bias gender dalam Syi’ir Muslimat misalnya: (a Ada penjelasan yang menunjukkan bahwa perempuan lebih rendah dibandingkan laki-laki dalam derajat, (2 Pernyataan bahwa wanita bicara dibandingkan laki-laki, (3 wanita hanya cocok di wilayah domestik; Namun secara umum nasihat di syi’ir masih sangat relafen dalam konteks sekarang, terutama untuk memberikan solusi alternatif dalam merespon krisis moral bangsa terutama pada wanita generasi muda. Kata kunci: Syi’ir Muslimat, Pendidikan Karakter, Analisis Gender. This study focused on three things: (1 What is the characteristics of the scope of contents of Syi’ir Muslimat?, (2 What is the socio-cultural conditions at the time the manuscript was written by the author?, (3 What are the moral education values for Muslim women in the content of Syi’ir Muslimat in the perspective of gender?. This research uses a philological approach with enhanced use of gender analysis. The

  7. Oscillating Finite Sums

    KAUST Repository

    Alabdulmohsin, Ibrahim M.

    2018-01-01

    In this chapter, we use the theory of summability of divergent series, presented earlier in Chap. 4, to derive the analogs of the Euler-Maclaurin summation formula for oscillating sums. These formulas will, in turn, be used to perform many remarkable deeds with ease. For instance, they can be used to derive analytic expressions for summable divergent series, obtain asymptotic expressions of oscillating series, and even accelerate the convergence of series by several orders of magnitude. Moreover, we will prove the notable fact that, as far as the foundational rules of summability calculus are concerned, summable divergent series behave exactly as if they were convergent.

  8. Oscillating Finite Sums

    KAUST Repository

    Alabdulmohsin, Ibrahim M.

    2018-03-07

    In this chapter, we use the theory of summability of divergent series, presented earlier in Chap. 4, to derive the analogs of the Euler-Maclaurin summation formula for oscillating sums. These formulas will, in turn, be used to perform many remarkable deeds with ease. For instance, they can be used to derive analytic expressions for summable divergent series, obtain asymptotic expressions of oscillating series, and even accelerate the convergence of series by several orders of magnitude. Moreover, we will prove the notable fact that, as far as the foundational rules of summability calculus are concerned, summable divergent series behave exactly as if they were convergent.

  9. ACS and STEMI treatment: gender-related issues.

    Science.gov (United States)

    Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude

    2012-08-01

    Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.

  10. Geometric optimization and sums of algebraic functions

    KAUST Repository

    Vigneron, Antoine E.

    2014-01-01

    We present a new optimization technique that yields the first FPTAS for several geometric problems. These problems reduce to optimizing a sum of nonnegative, constant description complexity algebraic functions. We first give an FPTAS for optimizing such a sum of algebraic functions, and then we apply it to several geometric optimization problems. We obtain the first FPTAS for two fundamental geometric shape-matching problems in fixed dimension: maximizing the volume of overlap of two polyhedra under rigid motions and minimizing their symmetric difference. We obtain the first FPTAS for other problems in fixed dimension, such as computing an optimal ray in a weighted subdivision, finding the largest axially symmetric subset of a polyhedron, and computing minimum-area hulls.

  11. Chiral symmetry breaking parameters from QCD sum rules

    Energy Technology Data Exchange (ETDEWEB)

    Mallik, S [Karlsruhe Univ. (T.H.) (Germany, F.R.). Inst. fuer Theoretische Kernphysik; Bern Univ. (Switzerland). Inst. fuer Theoretische Physik)

    1982-10-04

    We obtain new QCD sum rules by considering vacuum expectation values of two-point functions, taking all the five quark bilinears into account. These sum rules are employed to extract values of different chiral symmetry breaking parameters in QCD theory. We find masses of light quarks, m=1/2msub(u)+msub(d)=8.4+-1.2 MeV, msub(s)=205+-65 MeV. Further, we obtain corrections to certain soft pion (kaon) PCAC relations and the violation of SU(3) flavour symmetry by the non-strange and strange quark-antiquark vacuum condensate.

  12. The Asymptotic Joint Distribution of Self-Normalized Censored Sums and Sums of Squares

    OpenAIRE

    Hahn, Marjorie G.; Kuelbs, Jim; Weiner, Daniel C.

    1990-01-01

    Empirical versions of appropriate centering and scale constants for random variables which can fail to have second or even first moments are obtainable in various ways via suitable modifications of the summands in the partial sum. This paper discusses a particular modification, called censoring (which is a kind of winsorization), where the (random) number of summands altered tends to infinity but the proportion altered tends to zero as the number of summands increases. Some analytic advantage...

  13. Sum formula for SL2 over imaginary quadratic number fields

    NARCIS (Netherlands)

    Lokvenec-Guleska, H.

    2004-01-01

    The subject of this thesis is generalization of the classical sum formula of Bruggeman and Kuznetsov to the upper half-space H3. The derivation of the preliminary sum formula involves computation of the inner product of two specially chosen Poincar´e series in two different ways: the spectral

  14. The IRS-1 signaling system.

    Science.gov (United States)

    Myers, M G; Sun, X J; White, M F

    1994-07-01

    Insulin-receptor substrate 1 (IRS-1) is a principal substrate of the receptor tyrosine kinase for insulin and insulin-like growth factor 1, and a substrate for a tyrosine kinase activated by interleukin 4. IRS-1 undergoes multisite tyrosine phosphorylation and mediates downstream signals by 'docking' various proteins that contain Src homology 2 domains. IRS-1 appears to be a unique molecule; however, 4PS, a protein found mainly in hemopoietic cells, may represent another member of this family.

  15. Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys

    Science.gov (United States)

    Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming

    One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.

  16. An exact formulation of the time-ordered exponential using path-sums

    International Nuclear Information System (INIS)

    Giscard, P.-L.; Lui, K.; Thwaite, S. J.; Jaksch, D.

    2015-01-01

    We present the path-sum formulation for the time-ordered exponential of a time-dependent matrix. The path-sum formulation gives the time-ordered exponential as a branched continued fraction of finite depth and breadth. The terms of the path-sum have an elementary interpretation as self-avoiding walks and self-avoiding polygons on a graph. Our result is based on a representation of the time-ordered exponential as the inverse of an operator, the mapping of this inverse to sums of walks on a graphs, and the algebraic structure of sets of walks. We give examples demonstrating our approach. We establish a super-exponential decay bound for the magnitude of the entries of the time-ordered exponential of sparse matrices. We give explicit results for matrices with commonly encountered sparse structures

  17. An exact formulation of the time-ordered exponential using path-sums

    Science.gov (United States)

    Giscard, P.-L.; Lui, K.; Thwaite, S. J.; Jaksch, D.

    2015-05-01

    We present the path-sum formulation for the time-ordered exponential of a time-dependent matrix. The path-sum formulation gives the time-ordered exponential as a branched continued fraction of finite depth and breadth. The terms of the path-sum have an elementary interpretation as self-avoiding walks and self-avoiding polygons on a graph. Our result is based on a representation of the time-ordered exponential as the inverse of an operator, the mapping of this inverse to sums of walks on a graphs, and the algebraic structure of sets of walks. We give examples demonstrating our approach. We establish a super-exponential decay bound for the magnitude of the entries of the time-ordered exponential of sparse matrices. We give explicit results for matrices with commonly encountered sparse structures.

  18. Forward Compton scattering with weak neutral current: Constraints from sum rules

    Directory of Open Access Journals (Sweden)

    Mikhail Gorchtein

    2015-07-01

    Full Text Available We generalize forward real Compton amplitude to the case of the interference of the electromagnetic and weak neutral current, formulate a low-energy theorem, relate the new amplitudes to the interference structure functions and obtain a new set of sum rules. We address a possible new sum rule that relates the product of the axial charge and magnetic moment of the nucleon to the 0th moment of the structure function g5(ν,0. For the dispersive γZ-box correction to the proton's weak charge, the application of the GDH sum rule allows us to reduce the uncertainty due to resonance contributions by a factor of two. The finite energy sum rule helps addressing the uncertainty in that calculation due to possible duality violations.

  19. Should fee-for-service be for all guideline-advocated acute coronary syndrome (ACS) care? Observations from the Snapshot ACS study.

    Science.gov (United States)

    Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P

    2015-09-01

    The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.

  20. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, G [Jefferson Lab (United States)

    2014-07-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  1. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  2. pH Mapping on Tooth Surfaces for Quantitative Caries Diagnosis Using Micro Ir/IrOx pH Sensor.

    Science.gov (United States)

    Ratanaporncharoen, Chindanai; Tabata, Miyuki; Kitasako, Yuichi; Ikeda, Masaomi; Goda, Tatsuro; Matsumoto, Akira; Tagami, Junji; Miyahara, Yuji

    2018-04-03

    A quantitative diagnostic method for dental caries would improve oral health, which directly affects the quality of life. Here we describe the preparation and application of Ir/IrOx pH sensors, which are used to measure the surface pH of dental caries. The pH level is used as an indicator to distinguish between active and arrested caries. After a dentist visually inspected and defined 18 extracted dentinal caries at various positions as active or arrested caries, the surface pH values of sound and caries areas were directly measured with an Ir/IrOx pH sensor with a diameter of 300 μm as a dental explorer. The average pH values of the sound root, the arrested caries, and active caries were 6.85, 6.07, and 5.30, respectively. The pH obtained with an Ir/IrOx sensor was highly correlated with the inspection results by the dentist, indicating that the types of caries were successfully categorized. This caries testing technique using a micro Ir/IrOx pH sensor provides an accurate quantitative caries evaluation and has potential in clinical diagnosis.

  3. Pentaquarks in QCD Sum Rule Approach

    International Nuclear Information System (INIS)

    Rodrigues da Silva, R.; Matheus, R.D.; Navarra, F.S.; Nielsen, M.

    2004-01-01

    We estimate the mass of recently observed pentaquak staes Ξ- (1862) and Θ+(1540) using two kinds of interpolating fields, containing two highly correlated diquarks, in the QCD sum rule approach. We obtained good agreement with the experimental value, using standard continuum threshold

  4. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  5. Ac irreversibility line of bismuth-based high temperature superconductors

    International Nuclear Information System (INIS)

    Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.

    1997-01-01

    We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society

  6. Semiempirical search for oxide superconductors based on bond valence sums

    International Nuclear Information System (INIS)

    Tanaka, S.; Fukushima, N.; Niu, H.; Ando, K.

    1992-01-01

    Relationships between crystal structures and electronic states of layered transition-metal oxides are analyzed in the light of bond valence sums. Correlations between the superconducting transition temperature T c and the bond-valence-sum parameters are investigated for the high-T c cuprate compounds. Possibility of making nonsuperconducting oxides superconducting is discussed. (orig.)

  7. Closed-form summations of Dowker's and related trigonometric sums

    Science.gov (United States)

    Cvijović, Djurdje; Srivastava, H. M.

    2012-09-01

    Through a unified and relatively simple approach which uses complex contour integrals, particularly convenient integration contours and calculus of residues, closed-form summation formulas for 12 very general families of trigonometric sums are deduced. One of them is a family of cosecant sums which was first summed in closed form in a series of papers by Dowker (1987 Phys. Rev. D 36 3095-101 1989 J. Math. Phys. 30 770-3 1992 J. Phys. A: Math. Gen. 25 2641-8), whose method has inspired our work in this area. All of the formulas derived here involve the higher-order Bernoulli polynomials. This article is part of a special issue of Journal of Physics A: Mathematical and Theoretical in honour of Stuart Dowker's 75th birthday devoted to ‘Applications of zeta functions and other spectral functions in mathematics and physics’.

  8. ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching

    Science.gov (United States)

    Taylor, Terri

    2009-05-01

    In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.

  9. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  10. Quark-spin isospin sum rules and the Adler-Weisberger relation in nuclei

    International Nuclear Information System (INIS)

    Delorme, J.; Ericson, M.

    1982-01-01

    We use a quark model to extend the classical Gamow-Teller sum rule for the difference of the β - and β + strengths to excitations of the nucleon (mainly the Δ isobar). A schematic model illustrates the realization of the new sum rule when a particle-hole force is introduced. We discuss the connection of our result with the model-independent Adler-Weisberger sum rule. (orig.)

  11. Sum-frequency generation from molecular monolayers using 14 μm radiation from the FELIX free-electron laser

    International Nuclear Information System (INIS)

    Van der Ham, E.W.M.; Vrehen, Q.H.F.; Eliel, E.R.

    1995-01-01

    Sum-frequency generation (SFG) has developed into a widely applied tool for study of surfaces and interfaces where molecules are present. It combines the surface specificity of a second-order nonlinear optical technique with the power of a spectroscopic method, and it can be used under widely varying experimental conditions ranging from UHV to electrochemical cells. The important characteristic of SFG is that it allows one to study the average spatial orientation of a molecular bond in a monolayer of molecules at an interface. Until recently SFG measurements were confined to the frequency interval Y μ > 1700 cm -1 because of a lack of suitable laser sources at wave-lengths λ > 6 μm. So for most molecules only a few vibrational modes and thus intramolecular bonds can be studied. We have developed a universal sum-frequency spectrometer around the FELIX free-electron law that covers the complete molecular fingerprint since we can generate any IR wavelength between 2.75 and 110 fμ at the FELIX facility. We have used this setup for a series of exploratory SFG experiments in a frequency range that was hitherto unexplored in the study of molecular monolayers. We have studied thiol monolayers chemisorbed on a variety of noble metals (Au, Ag, Pt) where we focussed on the C-S stretch vibration at ν = 702 cm -1 (λ = 14.3 μm). We have found spectroscopic features revealing the presence of both the trane and gauche conformers of the adsorbed molecules. The present measurements open a whole new wavelength range for nonlinear optical studies of interfaces

  12. Summing skyrmions

    International Nuclear Information System (INIS)

    Jackson, A.D.; Weiss, C.; Wirzba, A.

    1990-01-01

    The Skyrme model has the same high density behavior as a free quark gas. However, the inclusion of higher-order terms spoils this agreement. We consider the all-order sum of a class of chiral invariant Lagrangians of even order in L μ suggested by Marleau. We prove Marleau's conjecture that these terms are of second order in the derivatives of the chiral angle for the hedgehog case and show the terms are unique under the additional condition that, for each order, the identity map on the 3-sphere S 3 (L) is a solution. The general form of the summation can be restricted by physical constraints leading to stable results. Under the assumption that the Lagrangian scales like the non-linear sigma model at low densities and like the free quark gas at high densities, we prove that a chiral phase transition must occur. (orig.)

  13. Comment on QCD sum rules and weak bottom decays

    International Nuclear Information System (INIS)

    Guberina, B.; Machet, B.

    1982-07-01

    QCD sum rules derived by Bourrely et al. are applied to B-decays to get a lower and an upper bound for the decay rate. The sum rules are shown to be essentially controlled by the large mass scales involved in the process. These bounds combined with the experimental value of BR (B→eνX) provide an upper bound for the lifetime of the B + meson. A comparison is made with D-meson decays

  14. On the general Dedekind sums and its reciprocity formula

    Indian Academy of Sciences (India)

    if x is an integer. The various properties of S(h, q) were investigated by many authors. Maybe the most famous property of Dedekind sums is the reciprocity formula (see [2–4]):. S(h, q) + S(q, h) = h2 + q2 + 1. 12hq. −. 1. 4. (1) for all (h, q) = 1,q > 0,h> 0. The main purpose of this paper is to introduce a general. Dedekind sum:.

  15. Magnetic irreversibility in granular superconductors: ac susceptibility study

    International Nuclear Information System (INIS)

    Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.

    1991-01-01

    Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)

  16. Control of hybrid AC/DC microgrid under islanding operational conditions

    DEFF Research Database (Denmark)

    Ding, G.; Gao, F.; Zhang, S.

    2014-01-01

    This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....

  17. Ac irreversibility line of bismuth-based high temperature superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)

    1997-09-01

    We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}

  18. Successful synthesis and thermal stability of immiscible metal Au-Rh, Au-Ir andAu-Ir-Rh nanoalloys

    Science.gov (United States)

    Shubin, Yury; Plyusnin, Pavel; Sharafutdinov, Marat; Makotchenko, Evgenia; Korenev, Sergey

    2017-05-01

    We successfully prepared face-centred cubic nanoalloys in systems of Au-Ir, Au-Rh and Au-Ir-Rh, with large bulk miscibility gaps, in one-run reactions under thermal decomposition of specially synthesised single-source precursors, namely, [AuEn2][Ir(NO2)6], [AuEn2][Ir(NO2)6] х [Rh(NO2)6]1-х and [AuEn2][Rh(NO2)6]. The precursors employed contain all desired metals ‘mixed’ at the atomic level, thus providing significant advantages for obtaining alloys. The observations using high-resolution transmission electron microscopy show that the nanoalloy structures are composed of well-dispersed aggregates of crystalline domains with a mean size of 5 ± 3 nm. Еnergy dispersive x-ray spectroscopy and x-ray powder diffraction (XRD) measurements confirm the formation of AuIr, AuRh, AuIr0.75Rh0.25, AuIr0.50Rh0.50 and AuIr0.25Rh0.75 metastable solid solutions. In situ high-temperature synchrotron XRD (HTXRD) was used to study the formation mechanism of nanoalloys. The observed transformations are described by the ‘conversion chemistry’ mechanism characterised by the primary development of particles comprising atoms of only one type, followed by a chemical reaction resulting in the final formation of a nanoalloy. The obtained metastable nanoalloys exhibit essential thermal stability. Exposure to 180 °C for 30 h does not cause any dealloying process.

  19. Galvijų ovocitų gyvybingumo tyrimai, modifikuojant subrandinimo sąlygas ir užšaldant vitrifikacijos būdu

    OpenAIRE

    Nainienė, Rasa; Urbšys, Algirdas; Kutra, Jonas; Pileckas, Vidmantas; Šiukščius, Artūras

    2004-01-01

    Buvo tiriamas subrandinimo sąlygų poveikis galvijų ovocitų gyvybingumui po užšaldymo vitrifikacijos būdu. Nustatyta, kad kumuliuso ląstelės teigiamai veikė ovocitų subrendimą ir apsivaisinimą: su-brendo 3,4%, o apsivaisino 25,1% daugiau tų ovocitų, kurie buvo kultivuoti su kumuliusu. Kumuliuso ląstelės pagerino ovocitų išgyvenimą po vitrifikacijos: subrendo 35 iš 68 (51,5%), o apsivaisino 20 iš 35 (29,4%) ovocitų, užšaldytų su kumuliusu. Kumuliuso ląstelių pašalinimas ovocitų subrandinimą sum...

  20. Characteristics of Ir/Au transition edge sensor

    International Nuclear Information System (INIS)

    Kunieda, Yuichi; Ohno, Masashi; Nakazawa, Masaharu; Takahashi, Hiroyuki; Fukuda, Daiji; Ohkubo, Masataka

    2004-01-01

    A new type of microcalorimeter has been developed using a transition edge sensor (TES) and an electro-thermal feedback (ETF) method to achieve higher energy resolution and higher count rate. We are developing a superconducting Ir-based transition edge sensor (TES) microcalorimeters. To improve thermal conductivity and achieve higher energy resolution with an Ir-TES, we fabricated an Ir/Au bilayer TES by depositing gold on Ir and investigated the influence of intermediate between superconducting and normal states at the transition edge for signal responses by microscopic observation in the Ir/Au-TES. (T. Tanaka)

  1. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  2. Limiting law excess sum rule for polyelectrolytes.

    Science.gov (United States)

    Landy, Jonathan; Lee, YongJin; Jho, YongSeok

    2013-11-01

    We revisit the mean-field limiting law screening excess sum rule that holds for rodlike polyelectrolytes. We present an efficient derivation of this law that clarifies its region of applicability: The law holds in the limit of small polymer radius, measured relative to the Debye screening length. From the limiting law, we determine the individual ion excess values for single-salt electrolytes. We also consider the mean-field excess sum away from the limiting region, and we relate this quantity to the osmotic pressure of a dilute polyelectrolyte solution. Finally, we consider numerical simulations of many-body polymer-electrolyte solutions. We conclude that the limiting law often accurately describes the screening of physical charged polymers of interest, such as extended DNA.

  3. Jaunesnių ir vyresnių klasių mokinių konfliktų ir jų sprendimų ypatumai

    OpenAIRE

    Stočkutė, Jovita

    2012-01-01

    Tyrimo objektas – jaunesnių ir vyresnių klasių mokinių konfliktai ir jų sprendimų ypatumai. Tyrimo tikslas – išanalizuoti jaunesnių ir vyresnių klasių mokinių konfliktus ir jų sprendimų ypatumus. Hipotezės – keliame prielaidas, kad - vyresnių klasių mokiniai konfliktuoti pamokose linkę labiau, nei jaunesnių klasių mokiniai. - vyresnių klasių mokiniai naudoja įvairesnes konflikto sprendimo strategijas nei jaunesnių klasių mokiniai. Tyrimo uždaviniai: 1. Atskleisti jaune...

  4. Plasma and tissue insulin-like growth factor-I receptor (IGF-IR) as a prognostic marker for prostate cancer and anti-IGF-IR agents as novel therapeutic strategy for refractory cases: a review.

    Science.gov (United States)

    Ozkan, Emine Elif

    2011-09-15

    Cancer database analysis indicates that prostate cancer is one of the most seen cancers in men meanwhile composing the leading cause of morbidity and mortality among developed countries. Current available therapies are surgery, radiotherapy and androgene ablation for prostate carcinoma. The response rate is as high nearly 90% however, most of these recur or become refractory and androgene independent (AI). Therefore recent studies intensified on molecular factors playing role on development of prostate carcinoma and novel treatment strategies targetting these factors and their receptors. Insulin-like growth factor-I (IGF-I) and its primary receptor insulin-like growth factor receptor-I (IGF-IR) are among these factors. Biologic functions and role in malign progression are primarily achieved via IGF-IR which is a type 2 tyrosine kinase receptor. IGF-IR plays an important role in mitogenesis, angiogenesis, transformation, apoptosis and cell motility. It also generates intensive proliferative signals leading to carcinogenesis in prostate tissue. So IGF-IR and its associated signalling system have provoked considerable interest over recent years as a novel therapeutic target in cancer. In this paper it is aimed to sum up the lately published literature searching the relation of IGF-IR and prostate cancer in terms of incidence, pathologic features, and prognosis. This is followed by a discussion of the different possible targets within the IGF-1R system, and drugs developed to interact at each target. A systems-based approach is then used to review the in vitro and in vivo data in the published literature of the following compounds targeting IGF-1R components using specific examples: growth hormone releasing hormone antagonists (e.g. JV-1-38), growth hormone receptor antagonists (e.g. pegvisomant), IGF-1R antibodies (e.g. CP-751,871, AVE1642/EM164, IMC-A12, SCH-717454, BIIB022, AMG 479, MK-0646/h7C10), and IGF-1R tyrosine kinase inhibitors (e.g. BMS-536942, BMS-554417

  5. Lindhard's polarization parameter and atomic sum rules in the local plasma approximation

    DEFF Research Database (Denmark)

    Cabrera-Trujillo, R.; Apell, P.; Oddershede, J.

    2017-01-01

    In this work, we analyze the effects of Lindhard polarization parameter, χ, on the sum rule, Sp, within the local plasma approximation (LPA) as well as on the logarithmic sum rule Lp = dSp/dp, in both cases for the system in an initial excited state. We show results for a hydrogenic atom with nuc......In this work, we analyze the effects of Lindhard polarization parameter, χ, on the sum rule, Sp, within the local plasma approximation (LPA) as well as on the logarithmic sum rule Lp = dSp/dp, in both cases for the system in an initial excited state. We show results for a hydrogenic atom...... in terms of a screened charge Z* for the ground state. Our study shows that by increasing χ, the sum rule for p0 it increases, and the value p=0 provides the normalization/closure relation which remains fixed to the number of electrons for the same initial state. When p is fixed...

  6. A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

    Science.gov (United States)

    Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

    2017-05-01

    Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

  7. Teaching IR to Medical Students: A Call to Action.

    Science.gov (United States)

    Lee, Aoife M; Lee, Michael J

    2018-02-01

    Interventional radiology (IR) has grown rapidly over the last 20 years and is now an essential component of modern medicine. Despite IR's increasing penetration and reputation in healthcare systems, IR is poorly taught, if taught at all, in most medical schools. Medical students are the referrers of tomorrow and potential IR recruits and deserve to be taught IR by expert IRs. The lack of formal IR teaching curricula in many medical schools needs to be addressed urgently for the continued development and dissemination of, particularly acute, IR services throughout Europe. We call on IRs to take up the baton to teach IR to the next generation of doctors.

  8. Iridium Interfacial Stack - IrIS

    Science.gov (United States)

    Spry, David

    2012-01-01

    Iridium Interfacial Stack (IrIS) is the sputter deposition of high-purity tantalum silicide (TaSi2-400 nm)/platinum (Pt-200 nm)/iridium (Ir-200 nm)/platinum (Pt-200 nm) in an ultra-high vacuum system followed by a 600 C anneal in nitrogen for 30 minutes. IrIS simultaneously acts as both a bond metal and a diffusion barrier. This bondable metallization that also acts as a diffusion barrier can prevent oxygen from air and gold from the wire-bond from infiltrating silicon carbide (SiC) monolithically integrated circuits (ICs) operating above 500 C in air for over 1,000 hours. This TaSi2/Pt/Ir/Pt metallization is easily bonded for electrical connection to off-chip circuitry and does not require extra anneals or masking steps. There are two ways that IrIS can be used in SiC ICs for applications above 500 C: it can be put directly on a SiC ohmic contact metal, such as Ti, or be used as a bond metal residing on top of an interconnect metal. For simplicity, only the use as a bond metal is discussed. The layer thickness ratio of TaSi2 to the first Pt layer deposited thereon should be 2:1. This will allow Si from the TaSi2 to react with the Pt to form Pt2Si during the 600 C anneal carried out after all layers have been deposited. The Ir layer does not readily form a silicide at 600 C, and thereby prevents the Si from migrating into the top-most Pt layer during future anneals and high-temperature IC operation. The second (i.e., top-most) deposited Pt layer needs to be about 200 nm to enable easy wire bonding. The thickness of 200 nm for Ir was chosen for initial experiments; further optimization of the Ir layer thickness may be possible via further experimentation. Ir itself is not easily wire-bonded because of its hardness and much higher melting point than Pt. Below the iridium layer, the TaSi2 and Pt react and form desired Pt2Si during the post-deposition anneal while above the iridium layer remains pure Pt as desired to facilitate easy and strong wire-bonding to the Si

  9. Small-Signal Analysis of Single-Phase and Three-phase DC/AC and AC/DC PWM Converters with the Frequency-Shift Technique

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Aquila, A. Dell’; Liserre, Marco

    2004-01-01

    of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....

  10. OH/IR stars in the Galaxy

    International Nuclear Information System (INIS)

    Baud, B.

    1978-01-01

    Radio astronomical observations leading to the discovery of 71 OH/IR sources are described in this thesis. These OH/IR sources are characterized by their double peaked OH emission profile at a wavelength of 18 cm and by their strong IR infrared emission. An analysis of the distribution and radial velocities of a number of previously known and new OH/IR sources was performed. The parameter ΔV (the velocity separation between two emission peaks of the 18 cm line profile) was found to be a good criterion for a population classification with respect to stellar age

  11. 21 CFR 880.5100 - AC-powered adjustable hospital bed.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...

  12. Nonlinear AC susceptibility, surface and bulk shielding

    Science.gov (United States)

    van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.

    1996-02-01

    We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.

  13. An Algorithm to Solve the Equal-Sum-Product Problem

    OpenAIRE

    Nyblom, M. A.; Evans, C. D.

    2013-01-01

    A recursive algorithm is constructed which finds all solutions to a class of Diophantine equations connected to the problem of determining ordered n-tuples of positive integers satisfying the property that their sum is equal to their product. An examination of the use of Binary Search Trees in implementing the algorithm into a working program is given. In addition an application of the algorithm for searching possible extra exceptional values of the equal-sum-product problem is explored after...

  14. A Quantum Approach to Subset-Sum and Similar Problems

    OpenAIRE

    Daskin, Ammar

    2017-01-01

    In this paper, we study the subset-sum problem by using a quantum heuristic approach similar to the verification circuit of quantum Arthur-Merlin games. Under described certain assumptions, we show that the exact solution of the subset sum problem my be obtained in polynomial time and the exponential speed-up over the classical algorithms may be possible. We give a numerical example and discuss the complexity of the approach and its further application to the knapsack problem.

  15. AC BREAKDOWN IN GASES

    Science.gov (United States)

    electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.

  16. Closed-form summations of Dowker's and related trigonometric sums

    International Nuclear Information System (INIS)

    Cvijović, Djurdje; Srivastava, H M

    2012-01-01

    Through a unified and relatively simple approach which uses complex contour integrals, particularly convenient integration contours and calculus of residues, closed-form summation formulas for 12 very general families of trigonometric sums are deduced. One of them is a family of cosecant sums which was first summed in closed form in a series of papers by Dowker (1987 Phys. Rev. D 36 3095–101; 1989 J. Math. Phys. 30 770–3; 1992 J. Phys. A: Math. Gen. 25 2641–8), whose method has inspired our work in this area. All of the formulas derived here involve the higher-order Bernoulli polynomials. This article is part of a special issue of Journal of Physics A: Mathematical and Theoretical in honour of Stuart Dowker's 75th birthday devoted to ‘Applications of zeta functions and other spectral functions in mathematics and physics’. (paper)

  17. Power loss analysis in altered tooth-sum spur gearing

    Directory of Open Access Journals (Sweden)

    Sachidananda H. K.

    2018-01-01

    Full Text Available The main cause of power loss or dissipation of heat in case of meshed gears is due to friction existing between gear tooth mesh and is a major concern in low rotational speed gears, whereas in case of high operating speed the power loss taking place due to compression of air-lubricant mixture (churning losses and windage losses due to aerodynamic trial of air lubricant mixture which controls the total efficiency needs to be considered. Therefore, in order to improve mechanical efficiency it is necessary for gear designer during gear tooth optimization to consider these energy losses. In this research paper the power loss analysis for a tooth-sum of 100 altered by ±4% operating between a specified center distance is considered. The results show that negative altered tooth-sum gearing performs better as compared to standard and positive altered tooth-sum gearing.

  18. Ramanujan sums via generalized Möbius functions and applications

    Directory of Open Access Journals (Sweden)

    Vichian Laohakosol

    2006-01-01

    Full Text Available A generalized Ramanujan sum (GRS is defined by replacing the usual Möbius function in the classical Ramanujan sum with the Souriau-Hsu-Möbius function. After collecting basic properties of a GRS, mostly containing existing ones, seven aspects of a GRS are studied. The first shows that the unique representation of even functions with respect to GRSs is possible. The second is a derivation of the mean value of a GRS. The third establishes analogues of the remarkable Ramanujan's formulae connecting divisor functions with Ramanujan sums. The fourth gives a formula for the inverse of a GRS. The fifth is an analysis showing when a reciprocity law exists. The sixth treats the problem of dependence. Finally, some characterizations of completely multiplicative function using GRSs are obtained and a connection of a GRS with the number of solutions of certain congruences is indicated.

  19. First-principles study on cubic pyrochlore iridates Y2Ir2O7 and Pr2Ir2O7

    International Nuclear Information System (INIS)

    Ishii, Fumiyuki; Mizuta, Yo Pierre; Kato, Takehiro; Ozaki, Taisuke; Weng Hongming; Onoda, Shigeki

    2015-01-01

    Fully relativistic first-principles electronic structure calculations based on a noncollinear local spin density approximation (LSDA) are performed for pyrochlore iridates Y 2 Ir 2 O 7 and Pr 2 Ir 2 O 7 . The all-in, all-out antiferromagnetic (AF) order is stablized by the on-site Coulomb repulsion U > U c in the LSDA+U scheme, with U c ∼ 1.1 eV and 1.3 eV for Y 2 Ir 2 O 7 and Pr 2 Ir 2 O 7 , respectively. AF semimetals with and without Weyl points and then a topologically trivial AF insulator successively appear with further increasing U. For U = 1.3 eV, Y 2 Ir 2 O 7 is a topologically trivial narrow-gap AF insulator having an ordered local magnetic moment ∼0.5μ B /Ir, while Pr 2 Ir 2 O 7 is barely a paramagnetic semimetal with electron and hole concentrations of 0.016/Ir, in overall agreements with experiments. With decreasing oxygen position parameter x describing the trigonal compression of IrO 6 octahedra, Pr 2 Ir 2 O 7 is driven through a non-Fermi-liquid semimetal having only an isolated Fermi point of Γ 8 + , showing a quadratic band touching, to a Z 2 topological insulator. (author)

  20. Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus

    Science.gov (United States)

    Dougherty, Laura; Zhu, Yuandi; Xu, Kenong

    2016-01-01

    Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553

  1. Radioluminescence dating: the IR emission of feldspar

    International Nuclear Information System (INIS)

    Schilles, Thomas.; Habermann, Jan

    2000-01-01

    A new luminescence reader for radioluminescence (RL) measurements is presented. The system allows detection of RL emissions in the near infrared region (IR). Basic bleaching properties of the IR-RL emission of feldspars are investigated. Sunlight-bleaching experiments as a test for sensitivity changes are presented. IR-bleaching experiments were carried out to obtain information about the underlying physical processes of the IR-RL emission

  2. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  3. Pamokslo ir eseistikos sąveika Juliaus Sasnausko ir Giedrės Kazlauskaitės eseistikoje

    OpenAIRE

    Skirmantienė, Daiva

    2010-01-01

    Jaunosios kartos rašytojų kunigo pamokslininko Juliaus Sasnausko ir pasaulietės Giedrės Kazlauskaitės kūrybos semantinį ir įdėjinį lauką padeda suprasti teologinės literatūros ir literatūrinės teologijos sąveika. Teologinių prasmių paieška jų tekstuose atliepia šiuolaikinio žmogaus pastangas per literatūrą, skelbiančią gyvenamojo laikotarpio aktualijas, rasti kelią į tam tikras krikščioniškąsias tiesas ir bandyti reflektuoti savo tikėjimą bei analizuoti išganymo istoriją. Autorių kūryo...

  4. Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

    Directory of Open Access Journals (Sweden)

    Rudy Ariyanto

    2017-11-01

    Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

  5. Magnetic susceptibility and M1 transitions in /sup 208/Pb. [Sum rules

    Energy Technology Data Exchange (ETDEWEB)

    Traini, M; Lipparini, E; Orlandini, G; Stringari, S [Dipartimento di Matematica e Fisica, Universita di Trento, Italy

    1979-04-16

    M1 transitions in /sup 208/Pb are studied by evaluating energy-weighted and inverse energy-weighted sum-rules. The role of the nuclear interaction is widely discussed. It is shown that the nuclear potential increases the energy-weighted sum rule and lowers the inverse energy-weighted sum rule, with respect to the prediction of the pure shell model. Values of strengths and excitation energies are compared with experimental results and other theoretical calculations.

  6. Sum rules for the real parts of nonforward current-particle scattering amplitudes

    International Nuclear Information System (INIS)

    Abdel-Rahman, A.M.M.

    1976-01-01

    Extending previous work, using Taha's refined infinite-momentum method, new sum rules for the real parts of nonforward current-particle scattering amplitudes are derived. The sum rules are based on covariance, casuality, scaling, equal-time algebra and unsubtracted dispersion relations for the amplitudes. A comparison with the corresponding light-cone approach is made, and it is shown that the light-cone sum rules would also follow from the assumptions underlying the present work

  7. Sum rule approach to nuclear vibrations

    International Nuclear Information System (INIS)

    Suzuki, T.

    1983-01-01

    Velocity field of various collective states is explored by using sum rules for the nuclear current. It is shown that an irrotational and incompressible flow model is applicable to giant resonance states. Structure of the hydrodynamical states is discussed according to Tomonaga's microscopic theory for collective motions. (author)

  8. QCD sum rule studies at finite density and temperature

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Youngshin

    2010-01-21

    In-medium modifications of hadronic properties have a strong connection to the restoration of chiral symmetry in hot and/or dense medium. The in-medium spectral functions for vector and axial-vector mesons are of particular interest in this context, considering the experimental dilepton production data which signal the in-medium meson properties. In this thesis, finite energy sum rules are employed to set constraints for the in-medium spectral functions of vector and axial-vector mesons. Finite energy sum rules for the first two moments of the spectral functions are investigated with emphasis on the role of a scale parameter related to the spontaneous chiral symmetry breaking in QCD. It is demonstrated that these lowest moments of vector current spectral functions do permit an accurate sum rule analysis with controlled inputs, such as the QCD condensates of lowest dimensions. In contrast, the higher moments contain uncertainties from the higher dimensional condensates. It turns out that the factorization approximation for the four-quark condensate is not applicable in any of the cases studied in this work. The accurate sum rules for the lowest two moments of the spectral functions are used to clarify and classify the properties of vector meson spectral functions in a nuclear medium. Possible connections with the Brown-Rho scaling hypothesis are also discussed. (orig.)

  9. Successful enrichment of the ubiquitous freshwater acI Actinobacteria.

    Science.gov (United States)

    Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk

    2014-02-01

    Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

  10. RF tissue-heating near metallic implants during magnetic resonance examinations: an approach in the ac limit.

    Science.gov (United States)

    Ballweg, Verena; Eibofner, Frank; Graf, Hansjorg

    2011-10-01

    State of the art to access radiofrequency (RF) heating near implants is computer modeling of the devices and solving Maxwell's equations for the specific setup. For a set of input parameters, a fixed result is obtained. This work presents a theoretical approach in the alternating current (ac) limit, which can potentially render closed formulas for the basic behavior of tissue heating near metallic structures. Dedicated experiments were performed to support the theory. For the ac calculations, the implant was modeled as an RLC parallel circuit, with L being the secondary of a transformer and the RF transmission coil being its primary. Parameters influencing coupling, power matching, and specific absorption rate (SAR) were determined and formula relations were established. Experiments on a copper ring with a radial gap as capacitor for inductive coupling (at 1.5 T) and on needles for capacitive coupling (at 3 T) were carried out. The temperature rise in the embedding dielectric was observed as a function of its specific resistance using an infrared (IR) camera. Closed formulas containing the parameters of the setup were obtained for the frequency dependence of the transmitted power at fixed load resistance, for the calculation of the resistance for optimum power transfer, and for the calculation of the transmitted power in dependence of the load resistance. Good qualitative agreement was found between the course of the experimentally obtained heating curves and the theoretically determined power curves. Power matching revealed as critical parameter especially if the sample was resonant close to the Larmor frequency. The presented ac approach to RF heating near an implant, which mimics specific values for R, L, and C, allows for closed formulas to estimate the potential of RF energy transfer. A first reference point for worst-case determination in MR testing procedures can be obtained. Numerical approaches, necessary to determine spatially resolved heating maps, can

  11. A sum rule description of giant resonances at finite temperature

    International Nuclear Information System (INIS)

    Meyer, J.; Quentin, P.; Brack, M.

    1983-01-01

    A generalization of the sum rule approach to collective motion at finite temperature is presented. The m 1 and msub(-1) sum rules for the isovector dipole and the isoscalar monopole electric modes have been evaluated with the modified SkM force for the 208 Pb nucleus. The variation of the resulting giant resonance energies with temperature is discussed. (orig.)

  12. Root and Critical Point Behaviors of Certain Sums of Polynomials

    Indian Academy of Sciences (India)

    13

    There is an extensive literature concerning roots of sums of polynomials. Many papers and books([5], [6],. [7]) have written about these polynomials. Perhaps the most immediate question of sums of polynomials,. A + B = C, is “given bounds for the roots of A and B, what bounds can be given for the roots of C?” By. Fell [3], if ...

  13. β-Isocyanoalanine as an IR probe: comparison of vibrational dynamics between isonitrile and nitrile-derivatized IR probes.

    Science.gov (United States)

    Maj, Michał; Ahn, Changwoo; Kossowska, Dorota; Park, Kwanghee; Kwak, Kyungwon; Han, Hogyu; Cho, Minhaeng

    2015-05-07

    An infrared (IR) probe based on isonitrile (NC)-derivatized alanine 1 was synthesized and the vibrational properties of its NC stretching mode were investigated using FTIR and femtosecond IR pump-probe spectroscopy. It is found that the NC stretching mode is very sensitive to the hydrogen-bonding ability of solvent molecules. Moreover, its transition dipole strength is larger than that of nitrile (CN) in nitrile-derivatized IR probe 2. The vibrational lifetime of the NC stretching mode is found to be 5.5 ± 0.2 ps in both D2O and DMF solvents, which is several times longer than that of the azido (N3) stretching mode in azido-derivatized IR probe 3. Altogether these properties suggest that the NC group can be a very promising sensing moiety of IR probes for studying the solvation structure and dynamics of biomolecules.

  14. Sum rules for baryonic vertex functions and the proton wave function in QCD

    International Nuclear Information System (INIS)

    Lavelle, M.J.

    1985-01-01

    We consider light-cone sum rules for vertex functions involving baryon-meson couplings. These sum rules relate the non-perturbative, and experimentally known, coupling constants to the moments of the wave function of the proton state. Our results for these moments are consistent with those obtained from QCD sum rules for two-point functions. (orig.)

  15. An Efficient Algorithm to Calculate the Minkowski Sum of Convex 3D Polyhedra

    NARCIS (Netherlands)

    Bekker, Henk; Roerdink, Jos B.T.M.

    2001-01-01

    A new method is presented to calculate the Minkowski sum of two convex polyhedra A and B in 3D. These graphs are given edge attributes. From these attributed graphs the attributed graph of the Minkowski sum is constructed. This graph is then transformed into the Minkowski sum of A and B. The running

  16. Sum rules for the spontaneous chiral symmetry breaking parameters of QCD

    International Nuclear Information System (INIS)

    Craigie, N.S.; Stern, J.

    1981-03-01

    We discuss in the spirit of the work of Shifman, Vainshtein and Zakharov (SVZ), sum rules involving current-current vacuum correlation functions, whose Wilson expansion starts off with the operators anti qq or (anti qq) 2 , and thus provide information about the chiral symmetry breaking parameters of QCD. We point out that under the type of crude approximations made by SVZ, a value of sub(vac) (250MeV) 3 is obtained from one of these sum rules, in agreement with current expectations. Further we show that a Borel transformed version of the Weinberg sum rule, for VV - AA, current products seem only to make sense for an A 1 mass close to 1.3GeV and it makes little sense with the current algebra mass Msub(A)=anti 2M. We also give an estimate for the chiral symmetry breaking parameters μ 1 6 =2 2 (anti qsub(L) lambda sup(a)γsub(μ)qsub(L))(anti qsub(R) lambdasup(a) γsup(μ)qsub(R)) >sub(vac) entering in the Weinberg sum rules and μ 2 6 =g 2 sub(vac) entering in a new sum rule we propose involving antisymmetric tensor currents J=anti q σsub(μnu) q. (author)

  17. Status of the new Sum-Trigger system for the MAGIC telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Garcia, Jezabel; Schweizer, Thomas; Nakajima, Daisuke [Max Planck Institute for Physics, Muenchen (Germany); Dazzi, Francesco [Dipartimento di Fisica dell' Universita di Udine (Italy); INFN, sez. di Trieste (Italy)

    2013-07-01

    MAGIC is a stereoscopic system of two 17 meters Imaging Air Cherenkov Telescopes for gamma-ray astronomy operating in stereo mode. The telescopes are located at about 2.200 metres above sea level in the Observatorio del Roque de los Muchachos (ORM), in the Canary island of La Palma. Lowering the energy threshold of Cherenkov Telescopes is crucial for the observation of Pulsars, High redshift AGNs and GRBs. The Sum-Trigger, based on the analogue sum of a patch of pixels has a lower threshold compared to conventional digital triggers. The Sum-Trigger principle has been proven experimentally in 2007 by decreasing the energy threshold of the first Magic telescope (Back then operating in mono mode) from 55 GeV down to 25 GeV. The first VHE detection for the Crab Pulsar was achieved due to this low threshold. After the upgrade of the MAGIC I and MAGIC II cameras and readout systems, we are planning to install a new Sum-Trigger system in both telescopes in Summer 2013. This trigger system will be operated for the first time in stereo mode. At the conference we report about the status and the performance of the new Sum-Trigger-II system.

  18. The black hole interior and a curious sum rule

    International Nuclear Information System (INIS)

    Giveon, Amit; Itzhaki, Nissan; Troost, Jan

    2014-01-01

    We analyze the Euclidean geometry near non-extremal NS5-branes in string theory, including regions beyond the horizon and beyond the singularity of the black brane. The various regions have an exact description in string theory, in terms of cigar, trumpet and negative level minimal model conformal field theories. We study the worldsheet elliptic genera of these three superconformal theories, and show that their sum vanishes. We speculate on the significance of this curious sum rule for black hole physics

  19. Dispersion relations and sum rules for natural optical activity

    International Nuclear Information System (INIS)

    Thomaz, M.T.; Nussenzveig, H.M.

    1981-06-01

    Dispersion relations and sum rules are derived for the complex rotatory power of an arbitrary linear (nonmagnetic) isotropic medium showing natural optical activity. Both previously known dispersion relations and sum rules as well as new ones are obtained. It is shown that the Rosenfeld-Condon dispersion formula is inconsistent with the expected asymptotic behavior at high frequencies. A new dispersion formula based on quantum eletro-dynamics removes this inconsistency; however, it still requires modification in the low-frequency limit. (Author) [pt

  20. The black hole interior and a curious sum rule

    Energy Technology Data Exchange (ETDEWEB)

    Giveon, Amit [Racah Institute of Physics, The Hebrew University,Jerusalem, 91904 (Israel); Itzhaki, Nissan [Physics Department, Tel-Aviv University,Ramat-Aviv, 69978 (Israel); Troost, Jan [Laboratoire de Physique Théorique,Unité Mixte du CRNS et de l’École Normale Supérieure,associée à l’Université Pierre et Marie Curie 6,UMR 8549 École Normale Supérieure,24 Rue Lhomond Paris 75005 (France)

    2014-03-12

    We analyze the Euclidean geometry near non-extremal NS5-branes in string theory, including regions beyond the horizon and beyond the singularity of the black brane. The various regions have an exact description in string theory, in terms of cigar, trumpet and negative level minimal model conformal field theories. We study the worldsheet elliptic genera of these three superconformal theories, and show that their sum vanishes. We speculate on the significance of this curious sum rule for black hole physics.

  1. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

  2. Joint IAEA/NEA IRS guidelines

    International Nuclear Information System (INIS)

    1997-01-01

    The Incident Reporting System (IRS) is an international system jointly operated by the International Atomic Energy Agency (IAEA) and the Nuclear Energy Agency of the Organization for Economic Cooperation and Development (OECD/NEA). The fundamental objective of the IRS is to contribute to improving the safety of commercial nuclear power plants (NPPs) which are operated worldwide. This objective can be achieved by providing timely and detailed information on both technical and human factors related to events of safety significance which occur at these plants. The purpose of these guidelines, which supersede the previous IAEA Safety Series No. 93 (Part II) and the NEA IRS guidelines, is to describe the system and to give users the necessary background and guidance to enable them to produce IRS reports meeting a high standard of quality while retaining the high efficiency of the system expected by all Member States operating nuclear power plants

  3. Design and synthesis of 225Ac radioimmunopharmaceuticals

    International Nuclear Information System (INIS)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.

    2002-01-01

    The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans

  4. A Finer Classification of the Unit Sum Number of the Ring of Integers ...

    Indian Academy of Sciences (India)

    Here we introduce a finer classification for the unit sum number of a ring and in this new classification we completely determine the unit sum number of the ring of integers of a quadratic field. Further we obtain some results on cubic complex fields which one can decide whether the unit sum number is or ∞. Then we ...

  5. Nuclear structure of 231Ac

    International Nuclear Information System (INIS)

    Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

    2008-01-01

    The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

  6. Sums of two-dimensional spectral triples

    DEFF Research Database (Denmark)

    Christensen, Erik; Ivan, Cristina

    2007-01-01

    construct a sum of two dimensional modules which reflects some aspects of the topological dimensions of the compact metric space, but this will only give the metric back approximately. At the end we make an explicit computation of the last module for the unit interval in. The metric is recovered exactly...

  7. Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly

    International Nuclear Information System (INIS)

    Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi

    2008-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production

  8. Marketingová komunikace AC Sparta Praha

    OpenAIRE

    Fanta, Jan

    2016-01-01

    Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...

  9. Sums over geometries and improvements on the mean field approximation

    International Nuclear Information System (INIS)

    Sacksteder, Vincent E. IV

    2007-01-01

    The saddle points of a Lagrangian due to Efetov are analyzed. This Lagrangian was originally proposed as a tool for calculating systematic corrections to the Bethe approximation, a mean-field approximation which is important in statistical mechanics, glasses, coding theory, and combinatorial optimization. Detailed analysis shows that the trivial saddle point generates a sum over geometries reminiscent of dynamically triangulated quantum gravity, which suggests new possibilities to design sums over geometries for the specific purpose of obtaining improved mean-field approximations to D-dimensional theories. In the case of the Efetov theory, the dominant geometries are locally treelike, and the sum over geometries diverges in a way that is similar to quantum gravity's divergence when all topologies are included. Expertise from the field of dynamically triangulated quantum gravity about sums over geometries may be able to remedy these defects and fulfill the Efetov theory's original promise. The other saddle points of the Efetov Lagrangian are also analyzed; the Hessian at these points is nonnormal and pseudo-Hermitian, which is unusual for bosonic theories. The standard formula for Gaussian integrals is generalized to nonnormal kernels

  10. CCD and IR array controllers

    Science.gov (United States)

    Leach, Robert W.; Low, Frank J.

    2000-08-01

    A family of controllers has bene developed that is powerful and flexible enough to operate a wide range of CCD and IR focal plane arrays in a variety of ground-based applications. These include fast readout of small CCD and IR arrays for adaptive optics applications, slow readout of large CCD and IR mosaics, and single CCD and IR array operation at low background/low noise regimes as well as high background/high speed regimes. The CCD and IR controllers have a common digital core based on user- programmable digital signal processors that are used to generate the array clocking and signal processing signals customized for each application. A fiber optic link passes image data and commands to VME or PCI interface boards resident in a host computer to the controller. CCD signal processing is done with a dual slope integrator operating at speeds of up to one Megapixel per second per channel. Signal processing of IR arrays is done either with a dual channel video processor or a four channel video processor that has built-in image memory and a coadder to 32-bit precision for operating high background arrays. Recent developments underway include the implementation of a fast fiber optic data link operating at a speed of 12.5 Megapixels per second for fast image transfer from the controller to the host computer, and supporting image acquisition software and device drivers for the PCI interface board for the Sun Solaris, Linux and Windows 2000 operating systems.

  11. Įvairialyčiai lantano ir mangano oksido ir multiferoinio bismuto ferito heterodariniai

    Directory of Open Access Journals (Sweden)

    Bonifacas VENGALIS

    2011-11-01

    Full Text Available Pastaruoju metu naujų elektronikos prietaisų gamyboje buvo pasiekta didelė pažanga auginant, tyrinėjant ir pritaikant plonasluoksnes struktūras, sudarytas iš įvairių daugiakomponenčių funkcinių oksidų. Šiai oksidų grupei priklauso superlaidieji kupratai, mangano oksidai (manganitai, pasižymintys magnetovaržos reiškiniu, taip pat kiti feromagnetiniai, feroelektriniai, multiferoiniai oksidai. Manganitams (jų bendra formulė Ln1-xAxMnO3, kur Ln = La, Nd,..., o A - dvivalentis katijonas, toks kaip Ba, Sr ar Ca skiriama daug dėmesio dėl jų įdomių elektrinių savybių bei tinkamumo įvairiems spintronikos prietaisams kurti. Multiferoikai  (feroelektriniai feromagnetai pasižymi magnetoelektriniu efektu, duodančiu unikalią galimybę elektrinėms ir magnetinėms medžiagos savybėms valdyti panaudoti elektrinius ir magnetinius laukus. Bismuto feritas BiFeO3 (BFO, turintis romboedriškai deformuotą perovskito struktūrą, šiuo metu yra vienas labiausiai tyrinėjamų šios klasės junginių. Organiniai puslaidininkiai (OP taip pat atveria daug naujų galimybių elektronikai. Jų pranašumas yra didelė organinių junginių įvairovė ir palyginti paprasta ir pigi plonų sluoksnių gamybos technologija. Be to, OP pasižymi neįprastai didelėmis sukinių relaksacijos laiko vertėmis, todėl ateityje jie gali būti naudojami naujiems spintronikos prietaisams gaminti. Šiame straipsnyje apžvelgiami pastarųjų metų darbo autorių ir jų kolegų atlikti anksčiau minėtų medžiagų tyrimai. Daugiausia dėmesio skiriama magnetovaržinėmis savybėmis pasižyminčių lantano ir mangano oksidų (manganitų bei multiferoinio  BiFeO3 (BFO junginio plonųjų sluoksnių ir heterodarinių auginimui, tarpfazinių ribų tarp minėtų oksidų, laidžiojo SrTiO3 ir organinio puslaidininkio (Alq3 sudarymui, taip pat elektrinėms heterodarinių savybėms. Plonieji La2/3A1/3MnO3 (A = Ca, Sr, Ba, Ce sluoksniai, kurių storis d

  12. Limit theorems for multi-indexed sums of random variables

    CERN Document Server

    Klesov, Oleg

    2014-01-01

    Presenting the first unified treatment of limit theorems for multiple sums of independent random variables, this volume fills an important gap in the field. Several new results are introduced, even in the classical setting, as well as some new approaches that are simpler than those already established in the literature. In particular, new proofs of the strong law of large numbers and the Hajek-Renyi inequality are detailed. Applications of the described theory include Gibbs fields, spin glasses, polymer models, image analysis and random shapes. Limit theorems form the backbone of probability theory and statistical theory alike. The theory of multiple sums of random variables is a direct generalization of the classical study of limit theorems, whose importance and wide application in science is unquestionable. However, to date, the subject of multiple sums has only been treated in journals. The results described in this book will be of interest to advanced undergraduates, graduate students and researchers who ...

  13. Convergence problems of Coulomb and multipole sums in crystals

    International Nuclear Information System (INIS)

    Kholopov, Evgenii V

    2004-01-01

    Different ways of calculating Coulomb and dipole sums over crystal lattices are analyzed comparatively. It is shown that the currently alleged disagreement between various approaches originates in ignoring the requirement for the self-consistency of surface conditions, which are of fundamental importance due to the long-range nature of the bulk interactions that these sums describe. This is especially true of surfaces arising when direct sums for infinite translation-invariant structures are truncated. The charge conditions for actual surfaces being self-consistently adjusted to the bulk state are formally the same as those on the truncation surface, consistent with the concept of the thermodynamic limit for the bulk-state absolute equilibrium and with the fact that the surface energy contribution in this case is, naturally, statistically small compared to the bulk contribution. Two-point multipole expansions are briefly discussed, and the problems associated with the boundary of their convergence circle are pointed out. (reviews of topical problems)

  14. New Results On the Sum of Two Generalized Gaussian Random Variables

    KAUST Repository

    Soury, Hamza

    2015-01-01

    We propose in this paper a new method to compute the characteristic function (CF) of generalized Gaussian (GG) random variable in terms of the Fox H function. The CF of the sum of two independent GG random variables is then deduced. Based on this results, the probability density function (PDF) and the cumulative distribution function (CDF) of the sum distribution are obtained. These functions are expressed in terms of the bivariate Fox H function. Next, the statistics of the distribution of the sum, such as the moments, the cumulant, and the kurtosis, are analyzed and computed. Due to the complexity of bivariate Fox H function, a solution to reduce such complexity is to approximate the sum of two independent GG random variables by one GG random variable with suitable shape factor. The approximation method depends on the utility of the system so three methods of estimate the shape factor are studied and presented.

  15. New Results on the Sum of Two Generalized Gaussian Random Variables

    KAUST Repository

    Soury, Hamza

    2016-01-06

    We propose in this paper a new method to compute the characteristic function (CF) of generalized Gaussian (GG) random variable in terms of the Fox H function. The CF of the sum of two independent GG random variables is then deduced. Based on this results, the probability density function (PDF) and the cumulative distribution function (CDF) of the sum distribution are obtained. These functions are expressed in terms of the bivariate Fox H function. Next, the statistics of the distribution of the sum, such as the moments, the cumulant, and the kurtosis, are analyzed and computed. Due to the complexity of bivariate Fox H function, a solution to reduce such complexity is to approximate the sum of two independent GG random variables by one GG random variable with suitable shape factor. The approximation method depends on the utility of the system so three methods of estimate the shape factor are studied and presented [1].

  16. New Results on the Sum of Two Generalized Gaussian Random Variables

    KAUST Repository

    Soury, Hamza; Alouini, Mohamed-Slim

    2016-01-01

    We propose in this paper a new method to compute the characteristic function (CF) of generalized Gaussian (GG) random variable in terms of the Fox H function. The CF of the sum of two independent GG random variables is then deduced. Based on this results, the probability density function (PDF) and the cumulative distribution function (CDF) of the sum distribution are obtained. These functions are expressed in terms of the bivariate Fox H function. Next, the statistics of the distribution of the sum, such as the moments, the cumulant, and the kurtosis, are analyzed and computed. Due to the complexity of bivariate Fox H function, a solution to reduce such complexity is to approximate the sum of two independent GG random variables by one GG random variable with suitable shape factor. The approximation method depends on the utility of the system so three methods of estimate the shape factor are studied and presented [1].

  17. c-axis ac susceptibility in high-Tc superconductors

    International Nuclear Information System (INIS)

    Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.

    1996-01-01

    We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

  18. Fast electric dipole transitions in Ra-Ac nuclei

    International Nuclear Information System (INIS)

    Ahmad, I.

    1985-01-01

    Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs

  19. Sum Rules of Charm CP Asymmetries beyond the SU(3)_{F} Limit.

    Science.gov (United States)

    Müller, Sarah; Nierste, Ulrich; Schacht, Stefan

    2015-12-18

    We find new sum rules between direct CP asymmetries in D meson decays with coefficients that can be determined from a global fit to branching ratio data. Our sum rules eliminate the penguin topologies P and PA, which cannot be determined from branching ratios. In this way, we can make predictions about direct CP asymmetries in the standard model without ad hoc assumptions on the sizes of penguin diagrams. We consistently include first-order SU(3)_{F} breaking in the topological amplitudes extracted from the branching ratios. By confronting our sum rules with future precise data from LHCb and Belle II, one will identify or constrain new-physics contributions to P or PA. The first sum rule correlates the CP asymmetries a_{CP}^{dir} in D^{0}→K^{+}K^{-}, D^{0}→π^{+}π^{-}, and D^{0}→π^{0}π^{0}. We study the region of the a_{CP}^{dir}(D^{0}→π^{+}π^{-})-a_{CP}^{dir}(D^{0}→π^{0}π^{0}) plane allowed by current data and find that our sum rule excludes more than half of the allowed region at 95% C.L. Our second sum rule correlates the direct CP asymmetries in D^{+}→K[over ¯]^{0}K^{+}, D_{s}^{+}→K^{0}π^{+}, and D_{s}^{+}→K^{+}π^{0}.

  20. General report IRS-literature 1965-1976

    International Nuclear Information System (INIS)

    Schulz, W.

    1976-12-01

    The Institut fuer Reaktorsicherheit der TUeV e.V. (IRS) is of central importance in matters of licensing. It was jointly founded in 1965 by the eleven TUeVs of the Federal Republic of Germany and West-Berlin, by the Germanischer Lloyd and the then Federal Ministry for Scientific Research. After 12 sucsessful years the IRS will terminate its activities on December 31st, 1976, and together with the Laboratorium fuer Reaktorregelung und Anlagensicherung (LRA) at the TU Munich, Garching, it will be from January 1st, 1977 onwards part of the Gesellschaft fuer Reaktorsicherheit (GRS) mbH, a newly founded corporation. The activities of IRS and LRA will be continued by the GRS starting from January 1st, 1977. All IRS' report series and information services listed in this report are thus running out. The new corporation will build up its publications on the basis of the experience gained by IRS and LRA. (orig.) [de

  1. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  2. Efficient simulation of tail probabilities of sums of correlated lognormals

    DEFF Research Database (Denmark)

    Asmussen, Søren; Blanchet, José; Juneja, Sandeep

    We consider the problem of efficient estimation of tail probabilities of sums of correlated lognormals via simulation. This problem is motivated by the tail analysis of portfolios of assets driven by correlated Black-Scholes models. We propose two estimators that can be rigorously shown to be eff......We consider the problem of efficient estimation of tail probabilities of sums of correlated lognormals via simulation. This problem is motivated by the tail analysis of portfolios of assets driven by correlated Black-Scholes models. We propose two estimators that can be rigorously shown...... optimize the scaling parameter of the covariance. The second estimator decomposes the probability of interest in two contributions and takes advantage of the fact that large deviations for a sum of correlated lognormals are (asymptotically) caused by the largest increment. Importance sampling...

  3. Using neural networks to represent potential surfaces as sums of products.

    Science.gov (United States)

    Manzhos, Sergei; Carrington, Tucker

    2006-11-21

    By using exponential activation functions with a neural network (NN) method we show that it is possible to fit potentials to a sum-of-products form. The sum-of-products form is desirable because it reduces the cost of doing the quadratures required for quantum dynamics calculations. It also greatly facilitates the use of the multiconfiguration time dependent Hartree method. Unlike potfit product representation algorithm, the new NN approach does not require using a grid of points. It also produces sum-of-products potentials with fewer terms. As the number of dimensions is increased, we expect the advantages of the exponential NN idea to become more significant.

  4. A single-phase embedded Z-source DC-AC inverter.

    Science.gov (United States)

    Kim, Se-Jin; Lim, Young-Cheol

    2014-01-01

    In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.

  5. Second harmonic generation and sum frequency generation

    International Nuclear Information System (INIS)

    Pellin, M.J.; Biwer, B.M.; Schauer, M.W.; Frye, J.M.; Gruen, D.M.

    1990-01-01

    Second harmonic generation and sum frequency generation are increasingly being used as in situ surface probes. These techniques are coherent and inherently surface sensitive by the nature of the mediums response to intense laser light. Here we will review these two techniques using aqueous corrosion as an example problem. Aqueous corrosion of technologically important materials such as Fe, Ni and Cr proceeds from a reduced metal surface with layer by layer growth of oxide films mitigated by compositional changes in the chemical makeup of the growing film. Passivation of the metal surface is achieved after growth of only a few tens of atomic layers of metal oxide. Surface Second Harmonic Generation and a related nonlinear laser technique, Sum Frequency Generation have demonstrated an ability to probe the surface composition of growing films even in the presence of aqueous solutions. 96 refs., 4 figs

  6. Rao-Blackwellization for Adaptive Gaussian Sum Nonlinear Model Propagation

    Science.gov (United States)

    Semper, Sean R.; Crassidis, John L.; George, Jemin; Mukherjee, Siddharth; Singla, Puneet

    2015-01-01

    When dealing with imperfect data and general models of dynamic systems, the best estimate is always sought in the presence of uncertainty or unknown parameters. In many cases, as the first attempt, the Extended Kalman filter (EKF) provides sufficient solutions to handling issues arising from nonlinear and non-Gaussian estimation problems. But these issues may lead unacceptable performance and even divergence. In order to accurately capture the nonlinearities of most real-world dynamic systems, advanced filtering methods have been created to reduce filter divergence while enhancing performance. Approaches, such as Gaussian sum filtering, grid based Bayesian methods and particle filters are well-known examples of advanced methods used to represent and recursively reproduce an approximation to the state probability density function (pdf). Some of these filtering methods were conceptually developed years before their widespread uses were realized. Advanced nonlinear filtering methods currently benefit from the computing advancements in computational speeds, memory, and parallel processing. Grid based methods, multiple-model approaches and Gaussian sum filtering are numerical solutions that take advantage of different state coordinates or multiple-model methods that reduced the amount of approximations used. Choosing an efficient grid is very difficult for multi-dimensional state spaces, and oftentimes expensive computations must be done at each point. For the original Gaussian sum filter, a weighted sum of Gaussian density functions approximates the pdf but suffers at the update step for the individual component weight selections. In order to improve upon the original Gaussian sum filter, Ref. [2] introduces a weight update approach at the filter propagation stage instead of the measurement update stage. This weight update is performed by minimizing the integral square difference between the true forecast pdf and its Gaussian sum approximation. By adaptively updating

  7. Hadronic final states and sum rules in deep inelastic processes

    International Nuclear Information System (INIS)

    Pal, B.K.

    1977-01-01

    In order to get maximum information on the hadronic final states and sum rules in deep inelastic processes, Regge phenomenology and quarks parton model have been used. The unified picture for the production of hadrons of type i as a function of Bjorken and Feyman variables with only one adjustable parameter is formulated. The results of neutrino experiments and the production of charm particles are discussed in sum rules. (author)

  8. High-frequency effects in antiferromagnetic Sr3Ir2O7

    Science.gov (United States)

    Williamson, Morgan; Seinige, Heidi; Shen, Shida; Wang, Cheng; Cao, Gang; Zhou, Jianshi; Goodenough, John; Tsoi, Maxim

    Antiferromagnetic (AFM) spintronics is one of many promising routes for `beyond the CMOS' technologies where unique properties of AFM materials are exploited to achieve new and improved functionalities. AFMs are especially interesting for high-speed memory applications thanks to their high natural frequencies. Here we report the effects of high-frequency (microwave) currents on transport properties of antiferromagnetic Mott insulator Sr3Ir2O7. The microwaves at 3-7 GHz were found to affect the material's current-voltage characteristic and produce resonance-like features that we tentatively associate with the dissipationless magnonics recently predicted to occur in antiferromagnetic insulators subject to ac electric fields. Our observations support the potential of antiferromagnetic materials for high-speed/high-frequency spintronic applications. This work was supported in part by C-SPIN, one of six centers of STARnet, a Semiconductor Research Corporation program, sponsored by MARCO and DARPA, by NSF Grants DMR-1207577, DMR-1265162, DMR-1600057, and DMR-1122603, and by the King Abdullah University of Science and Technology (KAUST) Office of Sponsored Research (OSR) under Award No. OSR-2015-CRG4-2626.

  9. A zero-sum monetary system, interest rates, and implications

    OpenAIRE

    Hanley, Brian P.

    2015-01-01

    To the knowledge of the author, this is the first time it has been shown that interest rates that are extremely high by modern standards (100% and higher) are necessary within a zero-sum monetary system, and not just driven by greed. Extreme interest rates that appeared in various places and times reinforce the idea that hard money may have contributed to high rates of interest. Here a model is presented that examines the interest rate required to succeed as an investor in a zero-sum fixed qu...

  10. dc Arc Fault Effect on Hybrid ac/dc Microgrid

    Science.gov (United States)

    Fatima, Zahra

    The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

  11. On formation mechanism of Pd-Ir bimetallic nanoparticles through thermal decomposition of [Pd(NH{sub 3}){sub 4}][IrCl{sub 6}

    Energy Technology Data Exchange (ETDEWEB)

    Asanova, Tatyana I., E-mail: nti@niic.nsc.ru; Asanov, Igor P. [Nikolaev Institute of Inorganic Chemistry SB RAS (Russian Federation); Kim, Min-Gyu [Pohang University of Science and Technology, Beamline Research Division (Korea, Republic of); Gerasimov, Evgeny Yu. [Boreskov Institute of Catalysis SB RAS (Russian Federation); Zadesenets, Andrey V.; Plyusnin, Pavel E.; Korenev, Sergey V. [Nikolaev Institute of Inorganic Chemistry SB RAS (Russian Federation)

    2013-10-15

    The formation mechanism of Pd-Ir nanoparticles during thermal decomposition of double complex salt [Pd(NH{sub 3}){sub 4}][IrCl{sub 6}] has been studied by in situ X-ray absorption (XAFS) and photoelectron (XPS) spectroscopies. The changes in the structure of the Pd and Ir closest to the surroundings and chemical states of Pd, Ir, Cl, and N atoms were traced in the range from room temperature to 420 Degree-Sign C in inert atmosphere. It was established that the thermal decomposition process is carried out in 5 steps. The Pd-Ir nanoparticles are formed in pyramidal/rounded Pd-rich (10-200 nm) and dendrite Ir-rich (10-50 nm) solid solutions. A d charge depletion at Ir site and a gain at Pd, as well as the intra-atomic charge redistribution between the outer d and s and p electrons of both Ir and Pd in Pd-Ir nanoparticles, were found to occur.Graphical Abstract.

  12. 29 CFR Appendix A to Part 4022 - Lump Sum Mortality Rates

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Lump Sum Mortality Rates A Appendix A to Part 4022 Labor Regulations Relating to Labor (Continued) PENSION BENEFIT GUARANTY CORPORATION COVERAGE AND BENEFITS BENEFITS PAYABLE IN TERMINATED SINGLE-EMPLOYER PLANS Pt. 4022, App. A Appendix A to Part 4022—Lump Sum Mortality...

  13. Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.

    Science.gov (United States)

    Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong

    2018-05-01

    Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.

  14. Apple MdACS6 Regulates Ethylene Biosynthesis During Fruit Development Involving Ethylene-Responsive Factor.

    Science.gov (United States)

    Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide

    2015-10-01

    Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  15. Activity uniformity of Ir-192 seeds

    International Nuclear Information System (INIS)

    Ling, C.C.; Gromadzki, Z.C.

    1981-01-01

    A simple device that uses materials and apparatus commonly available in a radiotherapy department has been designed, fabricated and used in routine quality control relative to the activity uniformity of clinical Ir-192 seeds in ribbons. Detailed evaluation indicated that this system is easy to use and can yield relative activity measurements of individual Ir-192 seeds accurate to within 2%. With this device, activity uniformity of commercial Ir-192 seeds from two manufacturers has been assessed. For the seven shipments of Ir-192 seeds studied, the root mean square variations of individual seed strength from the average of each shipment ranged from 3.4 to 7.1%. Variation in seed activity by more than +- 10% from the average is not uncommon

  16. A Novel Noncircular MUSIC Algorithm Based on the Concept of the Difference and Sum Coarray.

    Science.gov (United States)

    Chen, Zhenhong; Ding, Yingtao; Ren, Shiwei; Chen, Zhiming

    2018-01-25

    In this paper, we propose a vectorized noncircular MUSIC (VNCM) algorithm based on the concept of the coarray, which can construct the difference and sum (diff-sum) coarray, for direction finding of the noncircular (NC) quasi-stationary sources. Utilizing both the NC property and the concept of the Khatri-Rao product, the proposed method can be applied to not only the ULA but also sparse arrays. In addition, we utilize the quasi-stationary characteristic instead of the spatial smoothing method to solve the coherent issue generated by the Khatri-Rao product operation so that the available degree of freedom (DOF) of the constructed virtual array will not be reduced by half. Compared with the traditional NC virtual array obtained in the NC MUSIC method, the diff-sum coarray achieves a higher number of DOFs as it comprises both the difference set and the sum set. Due to the complementarity between the difference set and the sum set for the coprime array, we choose the coprime array with multiperiod subarrays (CAMpS) as the array model and summarize the properties of the corresponding diff-sum coarray. Furthermore, we develop a diff-sum coprime array with multiperiod subarrays (DsCAMpS) whose diff-sum coarray has a higher DOF. Simulation results validate the effectiveness of the proposed method and the high DOF of the diff-sum coarray.

  17. A Novel Noncircular MUSIC Algorithm Based on the Concept of the Difference and Sum Coarray

    Science.gov (United States)

    Chen, Zhenhong; Ding, Yingtao; Chen, Zhiming

    2018-01-01

    In this paper, we propose a vectorized noncircular MUSIC (VNCM) algorithm based on the concept of the coarray, which can construct the difference and sum (diff–sum) coarray, for direction finding of the noncircular (NC) quasi-stationary sources. Utilizing both the NC property and the concept of the Khatri–Rao product, the proposed method can be applied to not only the ULA but also sparse arrays. In addition, we utilize the quasi-stationary characteristic instead of the spatial smoothing method to solve the coherent issue generated by the Khatri–Rao product operation so that the available degree of freedom (DOF) of the constructed virtual array will not be reduced by half. Compared with the traditional NC virtual array obtained in the NC MUSIC method, the diff–sum coarray achieves a higher number of DOFs as it comprises both the difference set and the sum set. Due to the complementarity between the difference set and the sum set for the coprime array, we choose the coprime array with multiperiod subarrays (CAMpS) as the array model and summarize the properties of the corresponding diff–sum coarray. Furthermore, we develop a diff–sum coprime array with multiperiod subarrays (DsCAMpS) whose diff–sum coarray has a higher DOF. Simulation results validate the effectiveness of the proposed method and the high DOF of the diff–sum coarray. PMID:29370138

  18. A Novel Noncircular MUSIC Algorithm Based on the Concept of the Difference and Sum Coarray

    Directory of Open Access Journals (Sweden)

    Zhenhong Chen

    2018-01-01

    Full Text Available In this paper, we propose a vectorized noncircular MUSIC (VNCM algorithm based on the concept of the coarray, which can construct the difference and sum (diff–sum coarray, for direction finding of the noncircular (NC quasi-stationary sources. Utilizing both the NC property and the concept of the Khatri–Rao product, the proposed method can be applied to not only the ULA but also sparse arrays. In addition, we utilize the quasi-stationary characteristic instead of the spatial smoothing method to solve the coherent issue generated by the Khatri–Rao product operation so that the available degree of freedom (DOF of the constructed virtual array will not be reduced by half. Compared with the traditional NC virtual array obtained in the NC MUSIC method, the diff–sum coarray achieves a higher number of DOFs as it comprises both the difference set and the sum set. Due to the complementarity between the difference set and the sum set for the coprime array, we choose the coprime array with multiperiod subarrays (CAMpS as the array model and summarize the properties of the corresponding diff–sum coarray. Furthermore, we develop a diff–sum coprime array with multiperiod subarrays (DsCAMpS whose diff–sum coarray has a higher DOF. Simulation results validate the effectiveness of the proposed method and the high DOF of the diff–sum coarray.

  19. Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte

    International Nuclear Information System (INIS)

    García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.

    2016-01-01

    The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.

  20. Derivation of sum rules for quark and baryon fields. [light-like charges

    Energy Technology Data Exchange (ETDEWEB)

    Bongardt, K [Karlsruhe Univ. (TH) (Germany, F.R.). Inst. fuer Theoretische Kernphysik

    1978-08-21

    In an analogous way to the Weinberg sum rules, two spectral-function sum rules for quark and baryon fields are derived by means of the concept of lightlike charges. The baryon sum rules are valid for the case of SU/sub 3/ as well as for SU/sub 4/ and the one-particle approximation yields a linear mass relation. This relation is not in disagreement with the normal linear GMO formula for the baryons. The calculated masses of the first resonance states agree very well with the experimental data.

  1. Superconducting three element synchronous ac machine

    International Nuclear Information System (INIS)

    Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

    1975-01-01

    There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

  2. A Global Optimization Algorithm for Sum of Linear Ratios Problem

    OpenAIRE

    Yuelin Gao; Siqiao Jin

    2013-01-01

    We equivalently transform the sum of linear ratios programming problem into bilinear programming problem, then by using the linear characteristics of convex envelope and concave envelope of double variables product function, linear relaxation programming of the bilinear programming problem is given, which can determine the lower bound of the optimal value of original problem. Therefore, a branch and bound algorithm for solving sum of linear ratios programming problem is put forward, and the c...

  3. Sum rules for four-spinon dynamic structure factor in XXX model

    International Nuclear Information System (INIS)

    Si Lakhal, B.; Abada, A.

    2005-01-01

    In the context of the antiferromagnetic spin 12 Heisenberg quantum spin chain (XXX model), we estimate the contribution of the exact four-spinon dynamic structure factor S 4 by calculating a number of sum rules the total dynamic structure factor S is known to satisfy exactly. These sum rules are: the static susceptibility, the integrated intensity, the total integrated intensity, the first frequency moment and the nearest-neighbor correlation function. We find that the contribution of S 4 is between 1% and 2.5%, depending on the sum rule, whereas the contribution of the exact two-spinon dynamic structure factor S 2 is between 70% and 75%. The calculations are numerical and Monte Carlo based. Good statistics are obtained

  4. Nontrivial ac spin response in the effective Luttinger model

    International Nuclear Information System (INIS)

    Hu Liangbin; Zhong Jiansong; Hu Kaige

    2006-01-01

    Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before

  5. Thermal-to-visible transducer (TVT) for thermal-IR imaging

    Science.gov (United States)

    Flusberg, Allen; Swartz, Stephen; Huff, Michael; Gross, Steven

    2008-04-01

    We have been developing a novel thermal-to-visible transducer (TVT), an uncooled thermal-IR imager that is based on a Fabry-Perot Interferometer (FPI). The FPI-based IR imager can convert a thermal-IR image to a video electronic image. IR radiation that is emitted by an object in the scene is imaged onto an IR-absorbing material that is located within an FPI. Temperature variations generated by the spatial variations in the IR image intensity cause variations in optical thickness, modulating the reflectivity seen by a probe laser beam. The reflected probe is imaged onto a visible array, producing a visible image of the IR scene. This technology can provide low-cost IR cameras with excellent sensitivity, low power consumption, and the potential for self-registered fusion of thermal-IR and visible images. We will describe characteristics of requisite pixelated arrays that we have fabricated.

  6. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...

  7. Incorporating X–ray summing into gamma–gamma signature quantification

    International Nuclear Information System (INIS)

    Britton, R.; Jackson, M.J.; Davies, A.V.

    2016-01-01

    A method for quantifying coincidence signatures has been extended to incorporate the effects of X–ray summing, and tested using a high–efficiency γ–γ system. An X–ray library has been created, allowing all possible γ, X–ray and conversion electron cascades to be generated. The equations for calculating efficiency and cascade summing corrected coincidence signature probabilities have also been extended from a two γ, two detector ‘special case’ to an arbitrarily large system. The coincidence library generated is fully searchable by energy, nuclide, coincidence pair, γ multiplicity, cascade probability and the half–life of the cascade, allowing the user to quickly identify coincidence signatures of interest. The method and software described is inherently flexible, as it only requires evaluated nuclear data, an X–ray library, and accurate efficiency characterisations to quickly and easily calculate coincidence signature probabilities for a variety of systems. Additional uses for the software include the fast identification of γ coincidence signals with required multiplicities and branching ratios, identification of the optimal coincidence signatures to measure for a particular system, and the calculation of cascade summing corrections for single detector systems. - Highlights: • Method for incorporating X-ray summing into coincidence measurements developed. • Calculation routines have been extended to an arbitrarily large detector system, and re-written to take advantage of multiple computing cores. • Data collected in list-mode with all events timestamped for offline coincidence analysis. • Coincidence analysis of environmental samples will dramatically improve the detection sensitivity achievable.

  8. Isolated Gramicidin Peptides Probed by IR Spectroscopy

    NARCIS (Netherlands)

    Rijs, A. M.; Kabelac, M.; Abo-Riziq, A.; Hobza, P.; de Vries, M. S.

    2011-01-01

    We report double-resonant IR/UV ion-dip spectroscopy of neutral gramicidin peptides in the gas phase. The IR spectra of gramicidin A and C, recorded in both the 1000 cm(-1) to 1800 cm(-1) and the 2700 to 3750 cm(-1) region, allow structural analysis. By studying this broad IR range, various local

  9. Simulations of charge summing and threshold dispersion effects in Medipix3

    International Nuclear Information System (INIS)

    Pennicard, D.; Ballabriga, R.; Llopart, X.; Campbell, M.; Graafsma, H.

    2011-01-01

    A novel feature of the Medipix3 photon-counting pixel readout chip is inter-pixel communication. By summing together the signals from neighbouring pixels at a series of 'summing nodes', and assigning each hit to the node with the highest signal, the chip can compensate for charge-sharing effects. However, previous experimental tests have demonstrated that the node-to-node variation in the detector's response is very large. Using computer simulations, it is shown that this variation is due to threshold dispersion, which results in many hits being assigned to whichever summing node in the vicinity has the lowest threshold level. A reduction in threshold variation would attenuate but not solve this issue. A new charge summing and hit assignment process is proposed, where the signals in individual pixels are used to determine the hit location, and then signals from neighbouring pixels are summed to determine whether the total photon energy is above threshold. In simulation, this new mode accurately assigns each hit to the pixel with the highest pulse height without any losses or double counting. - Research highlights: → Medipix3 readout chip compensates charge sharing using inter-pixel communication. → In initial production run, the flat-field response is unexpectedly nonuniform. → This effect is reproduced in simulation, and is caused by threshold dispersion. → A new inter-pixel communication process is proposed. → Simulations demonstrate the new process should give much better uniformity.

  10. Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers

    Directory of Open Access Journals (Sweden)

    Abdul Sattar Larik

    2011-01-01

    Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.

  11. Braškių 'Senga Sengana' prisitaikymas prie diferencijuoto ir kompleksinio UV-B spinduliuotės ir ozono poveikio

    OpenAIRE

    Brazaitytė, Aušra; Sakalauskaitė, Jurga; Duchovskis, Pavelas; Šikšnianienė, Jūratė Bronė; Samuolienė, Giedrė; Ulinskaitė, Raimonda; Baranauskis, Kęstutis; Urbonavičiūtė, Akvilė; Šabajevienė, Gintarė; Gelvonauskis, Bronislovas; Uselis, Nobertas; Vagusevičienė, Ilona

    2007-01-01

    2005 m. Lietuvos sodininkystės ir daržininkystės instituto fitotrono komplekse nustatytas diferencijuotas ir kompleksinis UV-B spinduliuotės bei ozono poveikis braškių augimui ir fotosintezės pigmentų pokyčiams bei jų prisitaikymo prie šių stresorių galimybės. Poveikis stresą sukeliančiais veiksniais buvo skirstomas į du laikotarpius: adaptacijos ir pagrindinį. Ozono koncentracija adaptacijos laikotarpiu buvo 80 µg m-3, o pagrindinio poveikio – 240 µg m-3. Tokia koncentracija buvo palaikoma 7...

  12. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  13. THE ACS NEARBY GALAXY SURVEY TREASURY

    International Nuclear Information System (INIS)

    Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  14. Predicting AC loss in practical superconductors

    International Nuclear Information System (INIS)

    Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P

    2006-01-01

    Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time

  15. Convolutional Codes with Maximum Column Sum Rank for Network Streaming

    OpenAIRE

    Mahmood, Rafid; Badr, Ahmed; Khisti, Ashish

    2015-01-01

    The column Hamming distance of a convolutional code determines the error correction capability when streaming over a class of packet erasure channels. We introduce a metric known as the column sum rank, that parallels column Hamming distance when streaming over a network with link failures. We prove rank analogues of several known column Hamming distance properties and introduce a new family of convolutional codes that maximize the column sum rank up to the code memory. Our construction invol...

  16. Semi-direct sums of Lie algebras and continuous integrable couplings

    International Nuclear Information System (INIS)

    Ma Wenxiu; Xu Xixiang; Zhang Yufeng

    2006-01-01

    A relation between semi-direct sums of Lie algebras and integrable couplings of continuous soliton equations is presented, and correspondingly, a feasible way to construct integrable couplings is furnished. A direct application to the AKNS spectral problem leads to a novel hierarchy of integrable couplings of the AKNS hierarchy of soliton equations. It is also indicated that the study of integrable couplings using semi-direct sums of Lie algebras is an important step towards complete classification of integrable systems

  17. Generalizations of some zero sum theorems

    Indian Academy of Sciences (India)

    Let G be an abelian group of order n, written additively. The Davenport constant D(G) is defined to be the smallest natural number t such that any sequence of length t over G has a non-empty subsequence whose sum is zero. Another combinatorial invariant E(G). (known as the EGZ constant) is the smallest natural number t ...

  18. A practical comparison of methods to assess sum-of-products

    International Nuclear Information System (INIS)

    Rauzy, A.; Chatelet, E.; Dutuit, Y.; Berenguer, C.

    2003-01-01

    Many methods have been proposed in the literature to assess the probability of a sum-of-products. This problem has been shown computationally hard (namely no. P-hard). Therefore, algorithms can be compared only from a practical point of view. In this article, we propose first an efficient implementation of the pivotal decomposition method. This kind of algorithms is widely used in the Artificial Intelligence framework. It is unfortunately almost never considered in the reliability engineering framework, but as a pedagogical tool. We report experimental results that show that this method is in general much more efficient than classical methods that rewrite the sum-of-products under study into an equivalent sum of disjoint products. Then, we derive from our method a factorization algorithm to be used as a preprocessing method for binary decision diagrams. We show by means of experimental results that this latter approach outperforms the formers

  19. Dynamical local field, compressibility, and frequency sum rules for quasiparticles

    International Nuclear Information System (INIS)

    Morawetz, Klaus

    2002-01-01

    The finite temperature dynamical response function including the dynamical local field is derived within a quasiparticle picture for interacting one-, two-, and three-dimensional Fermi systems. The correlations are assumed to be given by a density-dependent effective mass, quasiparticle energy shift, and relaxation time. The latter one describes disorder or collisional effects. This parametrization of correlations includes local-density functionals as a special case and is therefore applicable for density-functional theories. With a single static local field, the third-order frequency sum rule can be fulfilled simultaneously with the compressibility sum rule by relating the effective mass and quasiparticle energy shift to the structure function or pair-correlation function. Consequently, solely local-density functionals without taking into account effective masses cannot fulfill both sum rules simultaneously with a static local field. The comparison to the Monte Carlo data seems to support such a quasiparticle picture

  20. Demonstration of a Quantum Nondemolition Sum Gate

    DEFF Research Database (Denmark)

    Yoshikawa, J.; Miwa, Y.; Huck, Alexander

    2008-01-01

    The sum gate is the canonical two-mode gate for universal quantum computation based on continuous quantum variables. It represents the natural analogue to a qubit C-NOT gate. In addition, the continuous-variable gate describes a quantum nondemolition (QND) interaction between the quadrature...

  1. A fast summation method for oscillatory lattice sums

    Science.gov (United States)

    Denlinger, Ryan; Gimbutas, Zydrunas; Greengard, Leslie; Rokhlin, Vladimir

    2017-02-01

    We present a fast summation method for lattice sums of the type which arise when solving wave scattering problems with periodic boundary conditions. While there are a variety of effective algorithms in the literature for such calculations, the approach presented here is new and leads to a rigorous analysis of Wood's anomalies. These arise when illuminating a grating at specific combinations of the angle of incidence and the frequency of the wave, for which the lattice sums diverge. They were discovered by Wood in 1902 as singularities in the spectral response. The primary tools in our approach are the Euler-Maclaurin formula and a steepest descent argument. The resulting algorithm has super-algebraic convergence and requires only milliseconds of CPU time.

  2. Vartotojų lojalumas : formavimas ir valdymas

    OpenAIRE

    Zikienė, Kristina

    2010-01-01

    Vienas iš esminių daugelio organizacijų tikslų, garantuojančių tolesnį sėkmingą konkuravimą nuolat besikeičiančiame verslo pasaulyje, yra vartotojų lojalumo įgijimas ir išlaikymas. Įvairios lojalumo formavimo ir valdymo problemos plačiai ir detaliai analizuojamos šioje mokomojoje knygoje. Knyga pradedama vartotojų lojalumo analize marketingo mokslo raidos kontekste. Tolesnis dėmesys skiriamas vartotojų lojalumo vadybinio aspekto analizei, atskleidžiant vartotojų lojalumo koncepcijos teorines ...

  3. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  4. Broilerienos paklausa ir pasiūla Lietuvoje

    OpenAIRE

    Paškauskienė, Kristina

    2008-01-01

    Labai svarbu ir savalaikiškai ištirti vartotojų poreikį broilerienai, aktualu nustatyti vartotojų požiūrį į Lietuvoje užauginamą produkciją bei importuotą. ir kokia yra priklausomybė vyrų bei moterų tarpe, ir nuo gaunamo atlyginimo. Vartotojų tyrimai rodo, kad auga paklausa lengvai virškinamiems, greitai paruošiamiems, aukštos maistinės kokybės gyvulininkystės produktams. Darbo tikslas - Išsiaiškinti broilerienos paklausą ir pasiūlą Lietuvoje, įvertinti broilerienos suvartojimo tendencija...

  5. Tomato leaf curl Kerala virus (ToLCKeV AC3 protein forms a higher order oligomer and enhances ATPase activity of replication initiator protein (Rep/AC1

    Directory of Open Access Journals (Sweden)

    Mukherjee Sunil K

    2010-06-01

    Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.

  6. Aumann and Serrano’s economic index of risk for sums of gambles

    Directory of Open Access Journals (Sweden)

    Minqiang Li

    2014-12-01

    Full Text Available We study Aumann and Serrano’s (2008 risk index for sums of gambles that are not dependent. If the dependent parts are similarly ordered, then the risk index of the sum is always larger than the minimum of the risk indices of the two gambles. For negative dependence, the risk index of the sum is always smaller than the maximum. The above results agree with our intuitions of risk diversification well. These result points out another attractive property of Aumann and Serrano’s risk index. These properties are potentially useful for risk assessment purposes of financial securities.

  7. Preliminary study on AC superconducting machines

    International Nuclear Information System (INIS)

    Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

    1988-01-01

    This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

  8. 40 CFR 35.910-5 - Additional allotments of previously withheld sums.

    Science.gov (United States)

    2010-07-01

    ...-Clean Water Act § 35.910-5 Additional allotments of previously withheld sums. (a) A total sum of $9... Kansas 53,794,200 Kentucky 90,430,800 Louisiana 71,712,250 Maine 78,495,200 Maryland 297,705,300... Montana 12,378,200 Nebraska 38,539,500 Nevada 31,839,800 New Hampshire 77,199,350 New Jersey 660,830,500...

  9. On the divergence of triangular and eccentric spherical sums of double Fourier series

    Energy Technology Data Exchange (ETDEWEB)

    Karagulyan, G A [Institute of Mathematics, National Academy of Sciences of Armenia, Yerevan (Armenia)

    2016-01-31

    We construct a continuous function on the torus with almost everywhere divergent triangular sums of double Fourier series. We also prove an analogous theorem for eccentric spherical sums. Bibliography: 14 titles.

  10. On the divergence of triangular and eccentric spherical sums of double Fourier series

    International Nuclear Information System (INIS)

    Karagulyan, G A

    2016-01-01

    We construct a continuous function on the torus with almost everywhere divergent triangular sums of double Fourier series. We also prove an analogous theorem for eccentric spherical sums. Bibliography: 14 titles

  11. Continuum contributions to dipole oscillator-strength sum rules for hydrogen in finite basis sets

    DEFF Research Database (Denmark)

    Oddershede, Jens; Ogilvie, John F.; Sauer, Stephan P. A.

    2017-01-01

    Calculations of the continuum contributions to dipole oscillator sum rules for hydrogen are performed using both exact and basis-set representations of the stick spectra of the continuum wave function. We show that the same results are obtained for the sum rules in both cases, but that the conver......Calculations of the continuum contributions to dipole oscillator sum rules for hydrogen are performed using both exact and basis-set representations of the stick spectra of the continuum wave function. We show that the same results are obtained for the sum rules in both cases......, but that the convergence towards the final results with increasing excitation energies included in the sum over states is slower in the basis-set cases when we use the best basis. We argue also that this conclusion most likely holds also for larger atoms or molecules....

  12. Visualizing Infrared (IR) Spectroscopy with Computer Animation

    Science.gov (United States)

    Abrams, Charles B.; Fine, Leonard W.

    1996-01-01

    IR Tutor, an interactive, animated infrared (IR) spectroscopy tutorial has been developed for Macintosh and IBM-compatible computers. Using unique color animation, complicated vibrational modes can be introduced to beginning students. Rules governing the appearance of IR absorption bands become obvious because the vibrational modes can be visualized. Each peak in the IR spectrum is highlighted, and the animation of the corresponding normal mode can be shown. Students can study each spectrum stepwise, or click on any individual peak to see its assignment. Important regions of each spectrum can be expanded and spectra can be overlaid for comparison. An introduction to the theory of IR spectroscopy is included, making the program a complete instructional package. Our own success in using this software for teaching and research in both academic and industrial environments will be described. IR Tutor consists of three sections: (1) The 'Introduction' is a review of basic principles of spectroscopy. (2) 'Theory' begins with the classical model of a simple diatomic molecule and is expanded to include larger molecules by introducing normal modes and group frequencies. (3) 'Interpretation' is the heart of the tutorial. Thirteen IR spectra are analyzed in detail, covering the most important functional groups. This section features color animation of each normal mode, full interactivity, overlay of related spectra, and expansion of important regions. This section can also be used as a reference.

  13. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

  14. QCD and power corrections to sum rules in deep-inelastic lepton-nucleon scattering

    International Nuclear Information System (INIS)

    Ravindran, V.; Neerven, W.L. van

    2001-01-01

    In this paper we study QCD and power corrections to sum rules which show up in deep-inelastic lepton-hadron scattering. Furthermore we will make a distinction between fundamental sum rules which can be derived from quantum field theory and those which are of a phenomenological origin. Using current algebra techniques the fundamental sum rules can be expressed into expectation values of (partially) conserved (axial-)vector currents sandwiched between hadronic states. These expectation values yield the quantum numbers of the corresponding hadron which are determined by the underlying flavour group SU(n) F . In this case one can show that there exist an intimate relation between the appearance of power and QCD corrections. The above features do not hold for phenomenological sum rules, hereafter called non-fundamental. They have no foundation in quantum field theory and they mostly depend on certain assumptions made for the structure functions like super-convergence relations or the parton model. Therefore only the fundamental sum rules provide us with a stringent test of QCD

  15. Second-moment sum rules for correlation functions in a classical ionic mixture

    NARCIS (Netherlands)

    Suttorp, L.G.; Ebeling, W.

    1992-01-01

    The complete set of second-moment sum rules for the correlation functions of arbitrarily high order describing a classical multi-component ionic mixture in equilibrium is derived from the grand-canonical ensemble. The connection of these sum rules with the large-scale behaviour of fluctuations in an

  16. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  17. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  18. Fibonacci Identities via the Determinant Sum Property

    Science.gov (United States)

    Spivey, Michael

    2006-01-01

    We use the sum property for determinants of matrices to give a three-stage proof of an identity involving Fibonacci numbers. Cassini's and d'Ocagne's Fibonacci identities are obtained at the ends of stages one and two, respectively. Catalan's Fibonacci identity is also a special case.

  19. Computation and theory of Euler sums of generalized hyperharmonic numbers

    OpenAIRE

    Xu, Ce

    2017-01-01

    Recently, Dil and Boyadzhiev \\cite{AD2015} proved an explicit formula for the sum of multiple harmonic numbers whose indices are the sequence $\\left( {{{\\left\\{ 0 \\right\\}}_r},1} \\right)$. In this paper we show that the sums of multiple harmonic numbers whose indices are the sequence $\\left( {{{\\left\\{ 0 \\right\\}}_r,1};{{\\left\\{ 1 \\right\\}}_{k-1}}} \\right)$ can be expressed in terms of (multiple) zeta values, multiple harmonic numbers and Stirling numbers of the first kind, and give an explic...

  20. Role of IRS-2 in insulin and cytokine signalling.

    Science.gov (United States)

    Sun, X J; Wang, L M; Zhang, Y; Yenush, L; Myers, M G; Glasheen, E; Lane, W S; Pierce, J H; White, M F

    1995-09-14

    The protein IRS-1 acts as an interface between signalling proteins with Src-homology-2 domains (SH2 proteins) and the receptors for insulin, IGF-1, growth hormone, several interleukins (IL-4, IL-9, IL-13) and other cytokines. It regulates gene expression and stimulates mitogenesis, and appears to mediate insulin/IGF-1-stimulated glucose transport. Thus, survival of the IRS-1-/- mouse with only mild resistance to insulin was surprising. This dilemma is provisionally resolved with our discovery of a second IRS-signalling protein. We purified and cloned a likely candidate called 4PS from myeloid progenitor cells and, because of its resemblance to IRS-1, we designate it IRS-2. Alignment of the sequences of IRS-2 and IRS-1 revealed a highly conserved amino terminus containing a pleckstrin-homology domain and a phosphotyrosine-binding domain, and a poorly conserved carboxy terminus containing several tyrosine phosphorylation motifs. IRS-2 is expressed in many cells, including tissues from IRS-1-/- mice, and may be essential for signalling by several receptor systems.

  1. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...

  2. AC power flow importance measures considering multi-element failures

    International Nuclear Information System (INIS)

    Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

    2017-01-01

    Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

  3. Fast Inference with Min-Sum Matrix Product.

    Science.gov (United States)

    Felzenszwalb, Pedro F; McAuley, Julian J

    2011-12-01

    The MAP inference problem in many graphical models can be solved efficiently using a fast algorithm for computing min-sum products of n × n matrices. The class of models in question includes cyclic and skip-chain models that arise in many applications. Although the worst-case complexity of the min-sum product operation is not known to be much better than O(n(3)), an O(n(2.5)) expected time algorithm was recently given, subject to some constraints on the input matrices. In this paper, we give an algorithm that runs in O(n(2) log n) expected time, assuming that the entries in the input matrices are independent samples from a uniform distribution. We also show that two variants of our algorithm are quite fast for inputs that arise in several applications. This leads to significant performance gains over previous methods in applications within computer vision and natural language processing.

  4. NaIrO3-A pentavalent post-perovskite

    International Nuclear Information System (INIS)

    Bremholm, M.; Dutton, S.E.; Stephens, P.W.; Cava, R.J.

    2011-01-01

    Sodium iridium (V) oxide, NaIrO 3, was synthesized by a high pressure solid state method and recovered to ambient conditions. It is found to be isostructural with CaIrO 3 , the much-studied structural analog of the high-pressure post-perovskite phase of MgSiO 3 . Among the oxide post-perovskites, NaIrO 3 is the first example with a pentavalent cation. The structure consists of layers of corner- and edge-sharing IrO 6 octahedra separated by layers of NaO 8 bicapped trigonal prisms. NaIrO 3 shows no magnetic ordering and resistivity measurements show non-metallic behavior. The crystal structure, electrical and magnetic properties are discussed and compared to known post-perovskites and pentavalent perovskite metal oxides. -- Graphical abstract: Sodium iridium(V) oxide, NaIrO 3 , synthesized by a high pressure solid state method and recovered to ambient conditions is found to crystallize as the post-perovskite structure and is the first example of a pentavalent ABO 3 post-perovskite. Research highlights: → NaIrO 3 post-perovskite stabilized by pressure. → First example of a pentavalent oxide post-perovskite. → Non-metallic and non-magnetic behavior of NaIrO 3 .

  5. Systémový pohled na klub AC Sparta

    OpenAIRE

    Čečák, František

    2015-01-01

    Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...

  6. How to remedy Eurocentrism in IR?

    DEFF Research Database (Denmark)

    Bilgin, Pinar

    2016-01-01

    While IR's Eurocentric limits are usually acknowledged, what those limits mean for theorizing about the international is seldom clarified. In The Global Transformation, Buzan and Lawson offer a 'composite approach' that goes some way towards addressing IR's Eurocentrism, challenging existing myth...

  7. Endurance test on IR rig for RI production

    International Nuclear Information System (INIS)

    Chung, Heung June; Youn, Y. J.; Han, H. S.; Hong, S. B.; Cho, Y. G.; Ryu, J. S.

    2000-12-01

    This report presents the pressure drop, vibration and endurance test results for IR rig for RI production which were desigened and fabricated by KAERI. From the pressure drop test results, it is noted that the flow rate through the IR rig corresponding to the pressure drop of 200 kPa is measured to be about 3.12 kg/sec. Vibration frequency for the IR rig ranges from 13 to 17 Hz. RMS(Root Mean Square) displacement for the IR rig is less than 30 μm, and the maximum displacement is less than 110μm. These experimental results show that the design criteria of IR rig meet the HANARO limit conditions. Endurance test results show that the appreciable fretting wear for the IR rig does not occur, however tiny trace of wear between contact points is observed

  8. Study on IR Properties of Reduced Graphene Oxide

    Science.gov (United States)

    Ma, Deyue; Li, Xiaoxia; Guo, Yuxiang; Zeng, Yurun

    2018-01-01

    Firstly, the reduced graphene oxide was prepared by modified hummer method and characterized. Then, the complex refractive index of reduced graphene oxide in IR band was tested and its IR absorption and radiation properties were researched by correlated calculation. The results show that reduced graphene oxide prepared by hummer method are multilayered graphene with defects and functional groups on its surface. Its absorption in near and far IR bands is strong, but it’s weaker in middle IR band. At the IR atmosphere Window, its normal spectral emissivity decreases with wavelength increasing, and its total normal spectral emissivity in 3 ∼ 5μm and 8 ∼ 14μm are 0.75 and 0.625, respectively. Therefore, reduced graphene oxide can be used as IR absorption and coating materials and have a great potential in microwave and infrared compatible materials.

  9. Use of HOMA-IR in hepatitis C.

    Science.gov (United States)

    Eslam, M; Kawaguchi, T; Del Campo, J A; Sata, M; Khattab, M Abo-Elneen; Romero-Gomez, M

    2011-10-01

    Chronic infection with hepatitis C virus (HCV) can induce insulin resistance (IR) in a genotype-dependent manner and contributes to steatosis, progression of fibrosis and resistance to interferon plus ribavirin therapy. Our understanding of HCV-induced IR has improved considerably over the years, but certain aspects concerning its evaluation still remain elusive to clinical researchers. One of the most important issues is elucidating the ideal method for assessment of IR in the setting of hepatitis C. The hyperinsulinaemic euglycaemic clamp is the gold standard method for determining insulin sensitivity, but is impractical as it is labour intensive and time-consuming. To date, all human studies except for four where IR was evaluated in the HCV setting, an estimation of IR has been used rather than direct measurements of insulin-mediated glucose uptake. The most commonly used estimation in the HCV population is the homeostasis model assessment of insulin resistance (HOMA-IR) which is calculated from a single measurement of fasting insulin and glucose. In this article, we review the use and reporting of HOMA in the literature and provide guidance on its appropriate as well as inappropriate use in the hepatitis setting. © 2011 Blackwell Publishing Ltd.

  10. Ac system interruption analysis of an orthogonal-core type dc-ac converter. Koryu keito shadanji no chokko jishinkei dc-ac renkeiyo henkanki no dosa kaiseki

    Energy Technology Data Exchange (ETDEWEB)

    Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College

    1991-04-30

    This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.

  11. Aragonite coating solutions (ACS) based on artificial seawater

    Science.gov (United States)

    Tas, A. Cuneyt

    2015-03-01

    Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  12. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  13. A linear programming approach to max-sum problem: a review.

    Science.gov (United States)

    Werner, Tomás

    2007-07-01

    The max-sum labeling problem, defined as maximizing a sum of binary (i.e., pairwise) functions of discrete variables, is a general NP-hard optimization problem with many applications, such as computing the MAP configuration of a Markov random field. We review a not widely known approach to the problem, developed by Ukrainian researchers Schlesinger et al. in 1976, and show how it contributes to recent results, most importantly, those on the convex combination of trees and tree-reweighted max-product. In particular, we review Schlesinger et al.'s upper bound on the max-sum criterion, its minimization by equivalent transformations, its relation to the constraint satisfaction problem, the fact that this minimization is dual to a linear programming relaxation of the original problem, and the three kinds of consistency necessary for optimality of the upper bound. We revisit problems with Boolean variables and supermodular problems. We describe two algorithms for decreasing the upper bound. We present an example application for structural image analysis.

  14. Suppression of the Second Harmonic Subgroup Injected by an AC EAF: Design Considerations and Performance Estimation of a Shunt APF

    Directory of Open Access Journals (Sweden)

    Emre Durna

    2018-04-01

    Full Text Available This paper proposes a design methodology for an active power filter (APF system to suppress the second harmonic subgroup injected by an AC electric arc furnace (EAF to the utility grid. The APF system is composed of identical parallel units connected to the utility grid via a specially-designed coupling transformer. Each APF converter is a three-phase three-wire two-level voltage source converter (VSC. The number of parallel APF units, coupling transformer MVA rating, and turns ratio are optimized in the view of the ratings of commercially-available high voltage (HV IGBTs. In this research work, line current waveforms sampled at 25.6-kS/s on the medium voltage (MV side of a 65-MVA EAF transformer are then used to extract the second harmonic subgroup, 95-, 100-, and 105-Hz current components, by multiple synchronous reference frame (MSRF analysis, which was previously proposed to decompose EAF current interharmonics and harmonics in real-time. By summing up this digital data of the second harmonic subgroup, the reference current signal for the APF system is produced in real-time. A detailed model of the APF system is then run on EMTDC/PSCAD to follow the produced reference current signal according to hysteresis band control philosophy. The simulation results show that the proposed APF system can successfully suppress the second harmonic subgroup of an AC EAF.

  15. The Sum of the Parts

    DEFF Research Database (Denmark)

    Gross, Fridolin; Green, Sara

    2017-01-01

    Systems biologists often distance themselves from reductionist approaches and formulate their aim as understanding living systems “as a whole”. Yet, it is often unclear what kind of reductionism they have in mind, and in what sense their methodologies offer a more comprehensive approach. To addre......-up”. Specifically, we point out that system-level properties constrain lower-scale processes. Thus, large-scale modeling reveals how living systems at the ​same time ​ are ​more and ​less than the sum of the parts....

  16. Quantification of crystalline cellulose in lignocellulosic biomass using sum frequency generation (SFG) vibration spectroscopy and comparison with other analytical methods.

    Science.gov (United States)

    Barnette, Anna L; Lee, Christopher; Bradley, Laura C; Schreiner, Edward P; Park, Yong Bum; Shin, Heenae; Cosgrove, Daniel J; Park, Sunkyu; Kim, Seong H

    2012-07-01

    The non-centrosymmetry requirement of sum frequency generation (SFG) vibration spectroscopy allows the detection and quantification of crystalline cellulose in lignocellulose biomass without spectral interferences from hemicelluloses and lignin. This paper shows a correlation between the amount of crystalline cellulose in biomass and the SFG signal intensity. Model biomass samples were prepared by mixing commercially available cellulose, xylan, and lignin to defined concentrations. The SFG signal intensity was found sensitive to a wide range of crystallinity, but varied non-linearly with the mass fraction of cellulose in the samples. This might be due to the matrix effects such as light scattering and absorption by xylan and lignin, as well as the non-linear density dependence of the SFG process itself. Comparison with other techniques such as XRD, FT-Raman, FT-IR and NMR demonstrate that SFG can be a complementary and sensitive tool to assess crystalline cellulose in biomass. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. Simulation approach to coincidence summing in {gamma}-ray spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Dziri, S., E-mail: samir.dziri@iphc.cnrs.fr [Groupe RaMsEs, Institut Pluridisciplinaire Hubert Curien (IPHC), University of Strasbourg, CNRS, IN2P3, UMR 7178, 23 rue de Loess, BP 28, 67037 Strasbourg Cedex 2 (France); Nourreddine, A.; Sellam, A.; Pape, A.; Baussan, E. [Groupe RaMsEs, Institut Pluridisciplinaire Hubert Curien (IPHC), University of Strasbourg, CNRS, IN2P3, UMR 7178, 23 rue de Loess, BP 28, 67037 Strasbourg Cedex 2 (France)

    2012-07-15

    Some of the radionuclides used for efficiency calibration of a HPGe spectrometer are subject to coincidence-summing (CS) and account must be taken of the phenomenon to obtain quantitative results when counting samples to determine their activity. We have used MCNPX simulations, which do not take CS into account, to obtain {gamma}-ray peak intensities that were compared to those observed experimentally. The loss or gain of a measured peak intensity relative to the simulated peak is attributed to CS. CS correction factors are compared with those of ETNA and GESPECOR. Application to a test sample prepared with known radionuclides gave values close to the published activities. - Highlights: Black-Right-Pointing-Pointer Coincidence summing occurs when the solid angle is increased. Black-Right-Pointing-Pointer The loss of counts gives rise to an approximative efficiency curves, this means a wrong quantitative data. Black-Right-Pointing-Pointer To overcome this problem we need mono-energetic source, otherwise, the MCNPX simulation allows by comparison with the experiment data to get the coincidence summing correction factors. Black-Right-Pointing-Pointer By multiplying these factors by the approximative efficiency, we obtain the accurate efficiency.

  18. Hermann agreement updates IRS guidelines for incentives.

    Science.gov (United States)

    Broccolo, B M; Peregrine, M W

    1995-01-01

    The October 1994 agreement between the Internal Revenue Service (IRS) and Hermann Hospital of Houston, Texas, elucidates current IRS policy on physician recruitment incentives. The IRS distinguishes between the recruiting and the retention of physicians and perimts incentives beyond reasonable compensation in the former but not the latter circumstance. This new agreement, while not legally precedential, nevertheless provides guidance for healthcare organizations seeking safe harbor protection.

  19. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  20. Sum rule limitations of kinetic particle-production models

    International Nuclear Information System (INIS)

    Knoll, J.; CEA Centre d'Etudes Nucleaires de Grenoble, 38; Guet, C.

    1988-04-01

    Photoproduction and absorption sum rules generalized to systems at finite temperature provide a stringent check on the validity of kinetic models for the production of hard photons in intermediate energy nuclear collisions. We inspect such models for the case of nuclear matter at finite temperature employed in a kinetic regime which copes those encountered in energetic nuclear collisions, and find photon production rates which significantly exceed the limits imposed by the sum rule even under favourable concession. This suggests that coherence effects are quite important and the production of photons cannot be considered as an incoherent addition of individual NNγ production processes. The deficiencies of present kinetic models may also apply for the production of probes such as the pion which do not couple perturbatively to the nuclear currents. (orig.)