Zone-based RSS Reporting for Location Fingerprinting
DEFF Research Database (Denmark)
Kjærgaard, Mikkel Baun; Treu, Georg; Linnhoff–Popien, Claudia
2007-01-01
In typical location fingerprinting systems a tracked terminal reports sampled Received Signal Strength (RSS) values to a location server, which estimates its position based on a database of pre-recorded RSS fingerprints. So far, poll-based and periodic RSS reporting has been proposed. However......, for supporting proactive Location-based Services (LBSs), triggered by pre-defined spatial events, the periodic protocol is inefficient. Hence, this paper introduces zone-based RSS reporting: the location server translates geographical zones defined by the LBS into RSS-based representations, which are dynamically...
RSS (http://www.iaees.org/publications/journals/arthropods/rss.xml
Directory of Open Access Journals (Sweden)
Arthropods (ISSN 2224-4255
Full Text Available Arthropods ISSN 2224-4255 URL: http://www.iaees.org/publications/journals/arthropods/online-version.asp RSS: http://www.iaees.org/publications/journals/arthropods/rss.xml E-mail: arthropods@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope ARTHROPODS (ISSN 2224-4255 is an international journal devoted to the publication of articles on various aspects of arthropods, e.g., ecology, biogeography, systematics, biodiversity (species diversity, genetic diversity, et al., conservation, control, etc. The journal provides a forum for examining the importance of arthropods in biosphere (both terrestrial and marine ecosystems and human life in such fields as agriculture, forestry, fishery, environmental management and human health. The scope of Arthropods is wide and embraces all arthropods-insects, arachnids, crustaceans, centipedes, millipedes, and other arthropods. Articles/short communications on new taxa (species, genus, families, orders, etc. and new records of arthropods are particularly welcome. Authors can submit their works to the email box of this journal, arthropods@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal. Authors are asked to read Author Guidelines before submitting manuscripts. In addition to free submissions from authors around the world, special issues are also accepted. The organizer of a special issue can collect submissions (yielded from a research project, a research group, etc. on a specific research topic, or submissions of a scientific conference for publication of special issue.
Mobile robot trajectory tracking using noisy RSS measurements: an RFID approach.
Miah, M Suruz; Gueaieb, Wail
2014-03-01
Most RF beacons-based mobile robot navigation techniques rely on approximating line-of-sight (LOS) distances between the beacons and the robot. This is mostly performed using the robot's received signal strength (RSS) measurements from the beacons. However, accurate mapping between the RSS measurements and the LOS distance is almost impossible to achieve in reverberant environments. This paper presents a partially-observed feedback controller for a wheeled mobile robot where the feedback signal is in the form of noisy RSS measurements emitted from radio frequency identification (RFID) tags. The proposed controller requires neither an accurate mapping between the LOS distance and the RSS measurements, nor the linearization of the robot model. The controller performance is demonstrated through numerical simulations and real-time experiments. ©2013 Published by ISA. All rights reserved.
Application of RSS in Special Libraries
Directory of Open Access Journals (Sweden)
Shima Moradi
2007-07-01
Full Text Available Despite of ever increasing scope and volume of online information content and the constant need for easy accessibility to these contents, experts in various subject matters always face time constraints when searching for information or looking up their intended resource. Meanwhile, special libraries are faced with diminishing resources, time and human resource needed for providing services and meeting the information need of the said experts. Nowadays Push Technologies, in form of RSS could be used to speed up on-time information dissemination. RSS feeds could spontaneously deliver information to the users. These could be posted on webpages or read by RSS readers. RSS has numerous applications such as web page content update, reading lists, table of contents, current awareness, guides etc. The present paper while outlining RSS as one of the next generation web tools, would point out its various advantages and applications in the new generation of libraries (Lib 2.0,particularly the special libraries. It would also offer pointers to its application in meeting the information needs of experts and users in such libraries.
LANSCE radiation security system (RSS)
International Nuclear Information System (INIS)
Gallegos, F.R.
1996-01-01
The Radiation Security System (RSS) is an engineered safety system which automatically terminates transmission of accelerated ion beams in response to pre-defined abnormal conditions. It is one of the four major mechanisms used to protect people from radiation hazards induced by accelerated pulsed ion beams at the Los Alamos Neutron Science Center (LANSCE). The others are shielding, administrative policies and procedures, and qualified, trained personnel. Prompt radiation hazards at the half-mile long LANSCE accelerator exist due to average beam intensities ranging from 1 milli-amp for H + beam to 100 micro-amps for the high intensity H - beam. Experimental programs are supplied with variable energy (maximum 800 MeV), pulse-width (maximum 1 msec), and pulse frequency (maximum 120 Hz) ion beams. The RSS includes personnel access control systems, beam spill monitoring systems, and beam current level limiting systems. It is a stand-alone system with redundant logic chains. A fault of the RSS will cause the insertion of fusible beam plugs in the accelerator low energy beam transport. The design philosophy, description, and operation of the RSS are described in this paper
PubMed Informer: Monitoring MEDLINE/PubMed through E-mail Alerts, SMS, PDA downloads and RSS feeds
Muin, Michael; Fontelo, Paul; Ackerman, Michael
2005-01-01
Summary PubMed Informer is a Web-based monitoring tool for topics of interest from MEDLINE/PubMed primarily designed for healthcare professionals. Five tracking methods are available: Web access, e-mail, Short Message Service (SMS), PDA downloads and RSS feeds. PubMed Informer delivers focused search updates and specific information to users with varying information-seeking practices. PMID:16779344
Amplify Your Professional Knowledge through RSS
Stephens, Wendy
2012-01-01
In the championship playoffs of professional learning tools, this author contends that there is a clear-cut victor. Customizable, platform-agnostic, able to circumvent filters--both browser and network-imposed--RSS is the best professional learning tool. Reading sites via RSS has appeal for those who want the raw information. With a well-honed…
Theoretical Bound of CRLB for Energy Efficient Technique of RSS-Based Factor Graph Geolocation
Kahar Aziz, Muhammad Reza; Heriansyah; Saputra, EfaMaydhona; Musa, Ardiansyah
2018-03-01
To support the increase of wireless geolocation development as the key of the technology in the future, this paper proposes theoretical bound derivation, i.e., Cramer Rao lower bound (CRLB) for energy efficient of received signal strength (RSS)-based factor graph wireless geolocation technique. The theoretical bound derivation is crucially important to evaluate whether the energy efficient technique of RSS-based factor graph wireless geolocation is effective as well as to open the opportunity to further innovation of the technique. The CRLB is derived in this paper by using the Fisher information matrix (FIM) of the main formula of the RSS-based factor graph geolocation technique, which is lied on the Jacobian matrix. The simulation result shows that the derived CRLB has the highest accuracy as a bound shown by its lowest root mean squared error (RMSE) curve compared to the RMSE curve of the RSS-based factor graph geolocation technique. Hence, the derived CRLB becomes the lower bound for the efficient technique of RSS-based factor graph wireless geolocation.
The Remote Security Station (RSS) final report
International Nuclear Information System (INIS)
Pletta, J.B.; Amai, W.A.; Klarer, P.; Frank, D.; Carlson, J.; Byrne, R.
1992-10-01
The Remote Security Station (RSS) was developed by Sandia National Laboratories for the Defense Nuclear Agency to investigate issues pertaining to robotics and sensor fusion in physical security systems. This final report documents the status of the RSS program at its completion in April 1992. The RSS system consists of the Man Portable Security Station (MaPSS) and the Telemanaged Mobile Security Station (TMSS), which are integrated by the Operator's Control Unit (OCU) into a flexible exterior perimeter security system. The RSS system uses optical, infrared, microwave, and acoustic intrusion detection sensors in conjunction with sensor fusion techniques to increase the probability of detection and to decrease the nuisance alarm rate of the system. Major improvements to the system developed during the final year are an autonomous patrol capability, which allows TMSS to execute security patrols with limited operator interaction, and a neural network approach to sensor fusion, which significantly improves the system's ability to filter out nuisance alarms due to adverse weather conditions
Woodman, Mark
2006-01-01
The little orange feed icons are everywhere on the web. From search engines to shopping sites to blogs, Really Simple Syndication (RSS 2.0) has become one of the hottest web technologies going. RSS 2.0 is a powerful - yet surprisingly easy - way to distributing timely content to a web-based audience. This Short Cut will give you the hands-on knowledge you need to build an RSS 2.0 feed. Along the way you'll learn not only the mechanics of building a feed, but industry-accepted best practices for creating feeds that perform well in various situations. Are you ready? Roll up your sleeves, c
RSS-based localization of isotropically decaying source with unknown power and pathloss factor
International Nuclear Information System (INIS)
Sun, Shunyuan; Sun, Li; Ding, Zhiguo
2016-01-01
This paper addresses the localization of an isotropically decaying source based on the received signal strength (RSS) measurements that are collected from nearby active sensors that are position-known and wirelessly connected, and it propose a novel iterative algorithm for RSS-based source localization in order to improve the location accuracy and realize real-time location and automatic monitoring for hospital patients and medical equipment in the smart hospital. In particular, we consider the general case where the source power and pathloss factor are both unknown. For such a source localization problem, we propose an iterative algorithm, in which the unknown source position and two other unknown parameters (i.e. the source power and pathloss factor) are estimated in an alternating way based on each other, with our proposed sub-optimum initial estimate on source position obtained based on the RSS measurements that are collected from a few (closest) active sensors with largest RSS values. Analysis and simulation study show that our proposed iterative algorithm guarantees globally convergence to the least-squares (LS) solution, where for our suitably assumed independent and identically distributed (i.i.d.) zero-mean Gaussian RSS measurement errors the converged localization performance achieves the optimum that corresponds to the Cramer–Rao lower bound (CRLB).
RSS (http://www.iaees.org/publications/journals/environsc/rss.xml
Directory of Open Access Journals (Sweden)
Environmental Skeptics and Critics (ISSN 2224-4263
Full Text Available Environmental Skeptics and Critics ISSN 2224-4263 URL: http://www.iaees.org/publications/journals/environsc/online-version.asp RSS: http://www.iaees.org/publications/journals/environsc/rss.xml E-mail: environsc@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope The more truth is debated, the clearer it becomes. Science will not proceed without debate and controversy. Wide and in-depth debate and controversy on human's knowledge, attitudes, policies and practices on the environment determines the future of our planet. There are numerous controversial and potentially controversial issues on environmental sciences and practices. ENVIRONMENTAL SKEPTICS and CRITICS (ISSN 2224-4263 is an international journal devoted to the publication of skeptical and critical articles/short communications/letters on theories, viewpoints, methodologies, practices, policies, etc., in ecological and environmental areas. The journal provides a forum for questioning, disputing, arguing, challenging, criticizing and judging known theories, methdologies, practices, and policies, etc., or presenting different ideas. The scope of Environmental Skeptics and Critics is wide and embraces all controversial, non-conclusive or unexplained issues in ecological and environmental areas. Authors can submit their works to the email box of this journal, environsc@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal. Authors are asked to read Author Guidelines before submitting manuscripts. In addition to free submissions from authors around the world, special issues are also accepted. The organizer of a special issue can collect submissions (yielded from a research project, a research group, etc. on a specific research topic, or submissions of a scientific conference for publication of special issue.
Cleaning and Processing RSS measurements for Location Fingerprinting
DEFF Research Database (Denmark)
Kjærgaard, Mikkel Baun
2007-01-01
Handling variations in sampled Received Signal Strength (RSS) is neassary for achieving robust location fingerprinting (LF). Current research has only proposed limited system-specific models for how to handle the cleaning of RSS variations. However, this paper propose a novel model for both...
A disseminação seletiva da informação e a tecnologia RSS nas bibliotecas de Tribunais em Brasília
Directory of Open Access Journals (Sweden)
Thiago Gomes Eirão
2015-09-01
Full Text Available A pesquisa teve como objetivo verificar a utilização do serviço de disseminação seletiva da informação (DSI e a tecnologia RSS em bibliotecas de Tribunais em Brasília. Esse estudo foi proposto para identificar como os serviços de referência de tais bibliotecas veem a validade do serviço de disseminação seletiva e mais especificamente a tecnologia RSS como instrumentos para o desenvolvimento de novos produtos e serviços de informação com o foco nas necessidades do usuário. Ao todo foram visitadas seis instituições do poder Judiciário que possuem sede em Brasília. A amostra dos respondentes foi composta por doze profissionais formados em Biblioteconomia, que atuavam no serviço de referência dos respectivos órgãos. A técnica de pesquisa utilizada foi a entrevista semiaberta. Para obtenção das respostas foi utilizado um roteiro de perguntas que permitia ao entrevistador aprofundar as questões a partir das respostas concedidas pelos entrevistados. Os resultados obtidos demonstraram que os profissionais ainda veem utilidade do serviço de DSI, apesar de apenas duas das bibliotecas visitadas o utilizarem. Também foi possível verificar que os profissionais vislumbram a utilização da tecnologia RSS nos serviços de referência, apesar de nenhuma biblioteca visitada já ter pensado na utilização da tecnologia e os sites dessas bibliotecas ainda possuírem uma baixa disponibilização de serviços e utilização.
RssAB signaling coordinates early development of surface multicellularity in Serratia marcescens.
Directory of Open Access Journals (Sweden)
Yu-Huan Tsai
Full Text Available Bacteria can coordinate several multicellular behaviors in response to environmental changes. Among these, swarming and biofilm formation have attracted significant attention for their correlation with bacterial pathogenicity. However, little is known about when and where the signaling occurs to trigger either swarming or biofilm formation. We have previously identified an RssAB two-component system involved in the regulation of swarming motility and biofilm formation in Serratia marcescens. Here we monitored the RssAB signaling status within single cells by tracing the location of the translational fusion protein EGFP-RssB following development of swarming or biofilm formation. RssAB signaling is specifically activated before surface migration in swarming development and during the early stage of biofilm formation. The activation results in the release of RssB from its cognate inner membrane sensor kinase, RssA, to the cytoplasm where the downstream gene promoters are located. Such dynamic localization of RssB requires phosphorylation of this regulator. By revealing the temporal activation of RssAB signaling following development of surface multicellular behavior, our findings contribute to an improved understanding of how bacteria coordinate their lifestyle on a surface.
Technical Evaluation Report 58: RSS Windows Editors: First impressions
Directory of Open Access Journals (Sweden)
Steve Swettenham
2006-12-01
Full Text Available An RSS feed is a list of topics made available from a webpage via a standard XML file format known as RSS, an abbreviation of either Really Simple Syndication or Rich Site Summary (Wikipedia, 2006. The end-user subscribes to their favorite Internet content site via RSS-aware software. Once subscribed, announcements with appropriate links are “pushed” from the publishing site whenever new material is added to that site (see Figure 1. This allows notification of new content of possible interest, fed with anonymity to subscribers, and reduces email clutter.
Directory of Open Access Journals (Sweden)
Juliana Burges Sbicigo
2010-12-01
Full Text Available O objetivo deste estudo foi investigar as propriedades psicométricas da Escala de Autoestima de Rosenberg (EAR para adolescentes. Participaram 4.757 adolescentes, com idades entre 14 e 18 anos (M=15,77; DP=1,22, de nove cidades brasileiras. Os participantes responderam a uma versão da EAR adaptada para o Brasil. A análise fatorial exploratória apontou uma estrutura bidimensional, com 51.4% da variância explicada, que foi sustentada pela análise fatorial confirmatória. As análises de consistência interna realizadas por meio do coeficiente alfa de Cronbach, confiabilidade composta e variância extraída indicaram bons valores de fidedignidade. Diferenças nos escores de autoestima em função do sexo e da idade não foram encontradas. Conclui-se que a EAR apresenta qualidades psicométricas satisfatórias, mostrando-se um instrumento confiável para medir autoestima em adolescentes brasileiros.The aim of this study was to investigate the psychometrics properties of the Rosenberg Self-Esteem Scale (RSS for adolescents. The sample was composed of 4.757 adolescents, with ages between 14 and 18 years old (M=15.77; SD=1.22 in nine Brazilian cities. Participants responded to an adapted version of the RSS for Brazil. Exploratory factorial analysis showed a bidimensional structure, with 51.4% of explained variance. This result was supported by confirmatory factor analysis. The internal consistency analysis by Cronbach alpha coefficient, composite reliability and extracted variance indicated good reliability. Differences in self-esteem for gender and age were not found. These findings show that RSS has satisfactory psychometric qualities and it's a reliable instrument to assess self-esteem in Brazilian adolescents.
Using GeoRSS feeds to distribute house renting and selling information based on Google map
Nong, Yu; Wang, Kun; Miao, Lei; Chen, Fei
2007-06-01
Geographically Encoded Objects RSS (GeoRSS) is a way to encode location in RSS feeds. RSS is a widely supported format for syndication of news and weblogs, and is extendable to publish any sort of itemized data. When Weblogs explode since RSS became new portals, Geo-tagged feed is necessary to show the location that story tells. Geographically Encoded Objects adopts the core of RSS framework, making itself the map annotations specified in the RSS XML format. The case studied illuminates that GeoRSS could be maximally concise in representation and conception, so it's simple to manipulate generation and then mashup GeoRSS feeds with Google Map through API to show the real estate information with other attribute in the information window. After subscribe to feeds of concerned subjects, users could easily check for new bulletin showing on map through syndication. The primary design goal of GeoRSS is to make spatial data creation as easy as regular Web content development. However, it does more for successfully bridging the gap between traditional GIS professionals and amateurs, Web map hackers, and numerous services that enable location-based content for its simplicity and effectiveness.
RSS (http://www.iaees.org/publications/journals/nb/rss.xml
Directory of Open Access Journals (Sweden)
Network Biology (ISSN 2220-8879
Full Text Available Network Biology ISSN 2220-8879 URL: http://www.iaees.org/publications/journals/nb/online-version.asp RSS: http://www.iaees.org/publications/journals/nb/rss.xml E-mail: networkbiology@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope NETWORK BIOLOGY (ISSN 2220-8879; CODEN NBEICS is an open access, peer-reviewed international journal that considers scientific articles in all different areas of network biology. It is the transactions of the International Society of Network Biology. It dedicates to the latest advances in network biology. The goal of this journal is to keep a record of the state-of-the-art research and promote the research work in these fast moving areas. The topics to be covered by Network Biology include, but are not limited to: •Theories, algorithms and programs of network analysis •Innovations and applications of biological networks •Ecological networks, food webs and natural equilibrium •Co-evolution, co-extinction, biodiversity conservation •Metabolic networks, protein-protein interaction networks, biochemical reaction networks, gene networks, transcriptional regulatory networks, cell cycle networks, phylogenetic networks, network motifs •Physiological networks •Network regulation of metabolic processes, human diseases and ecological systems •Social networks, epidemiological networks •System complexity, self-organized systems, emergence of biological systems, agent-based modeling, individual-based modeling, neural network modeling, and other network-based modeling, etc. We are also interested in short communications that clearly address a specific issue or completely present a new ecological network, food web, or metabolic or gene network, etc. Authors can submit their works to the email box of this journal, networkbiology@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal
The remote security station (RSS)
International Nuclear Information System (INIS)
Pletta, J.B.
1991-01-01
This paper reports that, as an outgrowth of research into physical security systems, Sandia is investigating robotic technologies for improving physical security performance and flexibility. Robotic systems have the potential to allow more effective utilization of security personnel, especially in scenarios where they might be exposed to harm. They also can supplement fixed site installations where sensors have failed or where transient assets are present. The Remote Security Station (RSS) program for the defense Nuclear Agency is developing a proof-of-principle robotic system which will be used to evaluate the role, and associated cost, of robotic technologies in exterior physical security systems. The RSS consists of three primary elements: a fixed but quickly moveable tripod with intrusion detection sensors and assessment camera; a mobile robotic platform with a functionally identical security module; and a control console which allows an operator to perform security functions and teleoperate the mobile platform
Directory of Open Access Journals (Sweden)
Jackeline Neres dos Santos
2013-09-01
Full Text Available O desenvolvimento da sociedade moderna nas últimas décadas principalmente nos quesitos tecnológico e industrial trouxe um conjunto de melhorias significativas à população no âmbito da saúde, infraestrutura, educação, saneamento básico entre outras. No entanto, o mesmo desenvolvimento que alavanca a qualidade de vida da população, proporciona novos desafios à sociedade moderna como, por exemplo, a grande produção e o gerenciamento dos Resíduos de Serviços de Saúde – RSS. O presente trabalho teve como principal objetivo realizar um levantamento do atual estado da arte sobre o tema sustentabilidade na gestão de Resíduos de Serviços de Saúde (RSS em instituições de saúde brasileiras destacando o papel do enfermeiro junto a equipes multidisciplinares no tratamento do tema. Foram consultadas fontes bibliográficas consolidadas tais como ivros, revistas, teses, dissertações, monografias e publicações científicas obtidas via repertórios científicos como Web Of Science, Scientific Electronic Library Online (SciELO, Google Acadêmico, Biblioteca Virtual em Saúde (BVS e Literatura Latino-Americana e do Caribe em Ciências da Saúde (LILACS, desde 2005. Temas como: (i Legislação Vigente para Área; (ii Atual Panorama dos RSS no Brasil; (iii Discussão sobre o Papel do Enfermeiro no Gerenciamento dos RSS – Aspectos gerais, Papel do enfermeiro à luz da Teoria Ambientalista de Florence Nightingale, Gerenciamento dos RSS: papel do enfermeiro versus custo; (iv Destinação e Eliminação Adequada para os RSS; e (v Sustentabilidade Ambiental no Gerenciamento dos RSS foram levantados, investigados e discutidos.
46 CFR 164.006-3 - Construction, materials, and workmanship.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Construction, materials, and workmanship. 164.006-3..., CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL MATERIALS Deck Coverings for Merchant Vessels § 164.006-3 Construction, materials, and workmanship. (a) It is the intent of this specification to obtain a...
Compressed RSS Measurement for Communication and Sensing in the Internet of Things
Directory of Open Access Journals (Sweden)
Yanchao Zhao
2017-01-01
Full Text Available The receiving signal strength (RSS is crucial for the Internet of Things (IoT, as it is the key foundation for communication resource allocation, localization, interference management, sensing, and so on. Aside from its significance, the measurement process could be tedious, time consuming, inaccurate, and involving human operations. The state-of-the-art works usually applied the fashion of “measure a few, predict many,” which use measurement calibrated models to generate the RSS for the whole networks. However, this kind of methods still cannot provide accurate results in a short duration with low measurement cost. In addition, they also require careful scheduling of the measurement which is vulnerable to measurement conflict. In this paper, we propose a compressive sensing- (CS- based RSS measurement solution, which is conflict-tolerant, time-efficient, and accuracy-guaranteed without any model-calibrate operation. The CS-based solution takes advantage of compressive sensing theory to enable simultaneous measurement in the same channel, which reduces the time cost to the level of O(logN (where N is the network size and works well for sparse networks. Extensive experiments based on real data trace are conducted to show the efficiency of the proposed solutions.
RSS (http://www.iaees.org/publications/journals/ces/rss.xml
Directory of Open Access Journals (Sweden)
Computational Ecology and Software (ISSN 2220-721X
Full Text Available Computational Ecology and Software ISSN 2220-721X URL: http://www.iaees.org/publications/journals/ces/online-version.asp RSS: http://www.iaees.org/publications/journals/ces/rss.xml E-mail: ces@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope COMPUTATIONAL ECOLOGY AND SOFTWARE (ISSN 2220-721X is an open access, peer-reviewed online journal that considers scientific articles in all different areas of computational ecology. It is the transactions of the International Society of Computational Ecology. The journal is concerned with the ecological researches, constructions and applications of theories and methods of computational sciences including computational mathematics, computational statistics and computer science. It features the simulation, approximation, prediction, recognition, and classification of ecological issues. Intensive computation is one of the major stresses of the journal. The journal welcomes research articles, short communications, review articles, perspectives, and book reviews. The journal also supports the activities of the International Society of Computational Ecology. The topics to be covered by CES include, but are not limited to: •Computation intensive methods, numerical and optimization methods, differential and difference equation modeling and simulation, prediction, recognition, classification, statistical computation (Bayesian computing, randomization, bootstrapping, Monte Carlo techniques, stochastic process, etc., agent-based modeling, individual-based modeling, artificial neural networks, knowledge based systems, machine learning, genetic algorithms, data exploration, network analysis and computation, databases, ecological modeling and computation using Geographical Information Systems, satellite imagery, and other computation intensive theories and methods. •Artificial ecosystems, artificial life, complexity of ecosystems and virtual reality. •The development, evaluation and validation of software and
Parasuraman, Ramviyas; Fabry, Thomas; Molinari, Luca; Kershaw, Keith; Di Castro, Mario; Masi, Alessandro; Ferre, Manuel
2014-01-01
The reliability of wireless communication in a network of mobile wireless robot nodes depends on the received radio signal strength (RSS). When the robot nodes are deployed in hostile environments with ionizing radiations (such as in some scientific facilities), there is a possibility that some electronic components may fail randomly (due to radiation effects), which causes problems in wireless connectivity. The objective of this paper is to maximize robot mission capabilities by maximizing the wireless network capacity and to reduce the risk of communication failure. Thus, in this paper, we consider a multi-node wireless tethering structure called the “server-relay-client” framework that uses (multiple) relay nodes in between a server and a client node. We propose a robust stochastic optimization (RSO) algorithm using a multi-sensor-based RSS sampling method at the relay nodes to efficiently improve and balance the RSS between the source and client nodes to improve the network capacity and to provide redundant networking abilities. We use pre-processing techniques, such as exponential moving averaging and spatial averaging filters on the RSS data for smoothing. We apply a receiver spatial diversity concept and employ a position controller on the relay node using a stochastic gradient ascent method for self-positioning the relay node to achieve the RSS balancing task. The effectiveness of the proposed solution is validated by extensive simulations and field experiments in CERN facilities. For the field trials, we used a youBot mobile robot platform as the relay node, and two stand-alone Raspberry Pi computers as the client and server nodes. The algorithm has been proven to be robust to noise in the radio signals and to work effectively even under non-line-of-sight conditions. PMID:25615734
Directory of Open Access Journals (Sweden)
Ramviyas Parasuraman
2014-12-01
Full Text Available The reliability of wireless communication in a network of mobile wireless robot nodes depends on the received radio signal strength (RSS. When the robot nodes are deployed in hostile environments with ionizing radiations (such as in some scientific facilities, there is a possibility that some electronic components may fail randomly (due to radiation effects, which causes problems in wireless connectivity. The objective of this paper is to maximize robot mission capabilities by maximizing the wireless network capacity and to reduce the risk of communication failure. Thus, in this paper, we consider a multi-node wireless tethering structure called the “server-relay-client” framework that uses (multiple relay nodes in between a server and a client node. We propose a robust stochastic optimization (RSO algorithm using a multi-sensor-based RSS sampling method at the relay nodes to efficiently improve and balance the RSS between the source and client nodes to improve the network capacity and to provide redundant networking abilities. We use pre-processing techniques, such as exponential moving averaging and spatial averaging filters on the RSS data for smoothing. We apply a receiver spatial diversity concept and employ a position controller on the relay node using a stochastic gradient ascent method for self-positioning the relay node to achieve the RSS balancing task. The effectiveness of the proposed solution is validated by extensive simulations and field experiments in CERN facilities. For the field trials, we used a youBot mobile robot platform as the relay node, and two stand-alone Raspberry Pi computers as the client and server nodes. The algorithm has been proven to be robust to noise in the radio signals and to work effectively even under non-line-of-sight conditions.
Rotating Shadowband Spectroradiometer (RSS) Handbook
Energy Technology Data Exchange (ETDEWEB)
Kiedron, P; Schlemmer, J; Klassen, M
2005-01-01
The rotating shawdowband spectroradiometer (RSS) implements the same automated shadowbanding technique used by the multifilter rotating shadowband radiometer (MFRSR), and so it too provides spectrally-resolved, direct-normal, diffuse-horizontal, and total-horizontal irradiances, and can be calibrated in situ via Langley regression. The irradiance spectra are measured simultaneously at all spectral elements (pixels) in 360-nm to 1050-nm range.
Complete (γ,2e) experiments at 0.1 eV above threshold
International Nuclear Information System (INIS)
Rond, F.; Mazeau, J.; Huetz, A.
1999-01-01
Here we report on a new experiment which has been designed to perform (γ,2e) experiments extremely close to threshold, in an energy range which is inaccessible to conventional electron analysers. The angular and energy resolutions of this new technique are illustrated by measuring electrons issued from resonant single ionization of argon. First results on double ionization of argon for the 3p 4 3 P e J=2 final state of Ar ++ are also presented. The contribution of an indirect process producing 20 meV Auger electrons, which was suspected from previous experiments, is clearly observed in addition to the direct process. (orig.)
Benefits and Impact of Joint Metric of AOA/RSS/TOF on Indoor Localization Error
Directory of Open Access Journals (Sweden)
Qing Jiang
2016-10-01
Full Text Available The emerging techniques in the Fifth Generation (5G communication system, like the millimeter-Wave (mmWave and massive Multiple Input Multiple Output (MIMO, make it possible to measure the Angle-Of-arrival (AOA, Receive Signal Strength (RSS and Time-Of-flight (TOF by using various types of mobile devices. At the same time, there is always significant interest in the high-precision localization techniques based on the joint metric of AOA/RSS/TOF, which enable one to overcome the drawback of the single metric-based localization. Motivated by this concern, we rely on the Cramer–Rao Lower Bound (CRLB to analyze the localization errors of RSS/AOA, RSS/TOF, AOA/TOF and the Joint Metric of AOA/RSS/TOF (JMART-based localization. The error bounds derived in this paper can be selected as the benchmarking results to evaluate the indoor localization performance. Finally, extensive simulations are conducted to support our claim.
ManA is regulated by RssAB signaling and promotes motility in Serratia marcescens.
Soo, Po-Chi; Horng, Yu-Tze; Chang, Yung-Lin; Tsai, Wei-Wen; Jeng, Wen-Yih; Lu, Chia-Chen; Lai, Hsin-Chih
2014-01-01
Serratia marcescens swarms on 0.8% LB agar at 30 °C but not at 37 °C. To understand the molecular mechanism regulating Serratia swarming, transposon mutagenesis was performed to screen for mutants that swarmed at 37 °C. In one mutant, S. marcescens WW100, the transposon was inserted in the upstream region of manA, which encodes mannose-6-phosphate isomerase, a type I phosphomannose isomerase. The transcriptional and translational levels of manA were higher in S. marcescens WW100 than in the wild-type strain. S. marcescens WW100 produced more serrawettin W1 (biosurfactant) than the wild-type, as detected by thin-layer chromatography, to promote surface motility by reducing surface tension. Serratia swarming was previously shown to be negatively regulated by the RssA-RssB two-component system. An electrophoretic mobility shift assay (EMSA) indicated that phosphorylated RssB (the response regulator) binds upstream of the transposon insertion site and manA in S. marcescens WW100. Analysis by real-time RT-PCR (qRT-PCR) revealed that, compared to the wild-type level, manA mRNA was increased in the rssA deletion mutant. The results indicated that RssA-RssB signaling directly represses the expression of manA and that overexpression of manA increases the production of serrawettin for Serratia swarming at 37 °C. Copyright © 2013 Institut Pasteur. All rights reserved.
48 CFR 235.006-70 - Manufacturing Technology Program.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Manufacturing Technology... CONTRACTING 235.006-70 Manufacturing Technology Program. In accordance with 10 U.S.C. 2521(d), for acquisitions under the Manufacturing Technology Program— (a) Award all contracts using competitive procedures...
Directory of Open Access Journals (Sweden)
Chen Zhu
2014-01-01
Full Text Available (K0.5Na0.51-xLixNb0.84Ta0.1Sb0.06O3 (KNLNTS lead free ceramics with different Li concentration were fabricated by conventional solid-state reaction method. By increasing Li ions in KNLNTS, the grains grow up and the crystal structure changes from orthorhombic to tetragonal. When 0.03 ≤ x ≤ 0.05, the ceramics structure lays in PPT region. Polarization versus electric field (P-E hysteresis loops at room temperature show good ferroelectric properties and the remnant polarization decreases by increasing Li content while coercive electric keeps almost unchanged. In PPT region, taking x = 0.04 as an example, the sample shows excellent dielectric properties: the dielectric constant is 1159 and loss tangent is 0.04, while the piezoelectric constant d33 is 245 pC/N and kp is 0.44 at room temperature, it is promising for (K0.5Na0.51-xLixNb0.84Ta0.1Sb0.06O3 with 4 at. % Li to substitute PZT.
Application of RSS in Special Libraries
Shima Moradi
2007-01-01
Despite of ever increasing scope and volume of online information content and the constant need for easy accessibility to these contents, experts in various subject matters always face time constraints when searching for information or looking up their intended resource. Meanwhile, special libraries are faced with diminishing resources, time and human resource needed for providing services and meeting the information need of the said experts. Nowadays Push Technologies, in form of RSS could b...
Kawasaki, Takeru; Satsuma, Hideki; Fujie, Makoto; Usami, Shoji; Yamada, Takashi
2007-12-01
A green fluorescent protein (GFP)-expressing plasmid was constructed from a filamentous bacteriophage phiRSS1 that infects the phytopathogen Ralstonia solanacearum. This plasmid designated as pRSS12 (4.7 kbp in size) consists of an approximately 2248 bp region of the phiRSS1 RF DNA, including ORF1-ORF3 and the intergenic region (IG), and a Km cassette in addition to the GFP gene. It was easily introduced by electroporation and stably maintained even without selective pressure in strains of R. solanacearum of different races and biovars. Strong green fluorescence emitted from pRSS12-transformed bacterial cells was easily monitored in tomato tissues (stem, petiole, and root) after infection as well as from soil samples. These results suggest that pRSS12 can serve as an easy-to-use GFP-tagging tool for any given strain of R. solanacearum in cytological as well as field studies.
Human-Induced Effects on RSS Ranging Measurements for Cooperative Positioning
DEFF Research Database (Denmark)
Della Rosa, Francescantonio; Pelosi, Mauro; Nurmi, Jari
2012-01-01
of human-induced perturbations for enhancing the final positioning accuracy through cooperative schemes has been assessed. It has been proved that the effect of cooperation is very limited if human factors are not taken into account when performing experimental activities.......We present experimental evaluations of human-induced perturbations on received-signal-strength-(RSS-) based ranging measurements for cooperative mobile positioning. To the best of our knowledge, this work is the first attempt to gain insight and understand the impact of both body loss and hand grip...... on the RSS for enhancing proximity measurements among neighbouring devices in cooperative scenarios. Our main contribution is represented by experimental investigations. Analysis of the errors introduced in the distance estimation using path-loss-based methods has been carried out. Moreover, the exploitation...
Visual Sentiment Analysis of RSS News Feeds Featuring the US Presidential Election in 2008
Wanner, Franz; Rohrdantz, Christian; Mansmann, Florian; Oelke, Daniela; Keim, Daniel A.
2009-01-01
The technology behind RSS feeds offers great possibilities to retrieve more news items than ever. In contrast to these technical developments, human capabilities to read all these news items have not increased likewise. To bridge this gap, this paper presents a visual analytics tool for conducting semi-automatic sentiment analysis of large news feeds. While the tool automatically retrieves and analyzes RSS feeds with respect to positive and negative opinion words, the more demanding news anal...
2015-05-21
www.ciaonet.org/pbei/csis/sam/sam55/. 32 Pathak, K. K. Of Jaswant Singh, the BJP and the RSS. Mumbai : The Rajaji Foundation, 2010. Accessed 10 August...common holy ground, a common blood and a common culture . It is also noteworthy to mention that Buddhists, Jains and Sikhs were included in this...martin-marty/hindu-fundamentalism _b_5352547.html . 71 Ibid. 72 Pathak, K. K. Of Jaswant Singh, the BJP and the RSS. Mumbai : The Rajaji
An RSS based location estimation technique for cognitive relay networks
Qaraqe, Khalid A.; Hussain, Syed Imtiaz; Ç elebi, Hasari Burak; Abdallah, Mohamed M.; Alouini, Mohamed-Slim
2010-01-01
In this paper, a received signal strength (RSS) based location estimation method is proposed for a cooperative wireless relay network where the relay is a cognitive radio. We propose a method for the considered cognitive relay network to determine
Fujie, Makoto; Takamoto, Hirofumi; Kawasaki, Takeru; Fujiwara, Akiko; Yamada, Takashi
2010-02-01
We monitored growth and movement of Ralstonia solanacearum harboring the plasmid pRSS12 in tomato seedlings. The plasmid contains a gene for green fluorescent protein (GFP) and is stably maintained in R. solanacearum cells without selection pressure. Bacteria harboring the plasmid can be tracked in planta by visualizing GFP fluorescence. Stems of seedlings were infected with R. solanacearum cells transformed with pRSS12, and bacterial growth and movement, particularly around the vascular bundles, were monitored for more than 7 days. Our results showed that vascular bundles are independent of each other within the stem, and that it takes a long time for R. solanacearum cells to migrate from one vascular bundle to another. For real-time monitoring of bacteria in planta, tomato seedlings were grown on agar medium and bacterial suspension was applied to the root apex. The bacterial invasion process was monitored by fluorescent microscopy. Bacteria invaded taproots within 6 h, and movement of the bacteria was observed until 144 h after inoculation. In susceptible tomato cultivars, strong GFP fluorescence was observed in hypocotyls and lateral roots as well as the taproot. In resistant cultivars, however, GFP fluorescence was rarely observed on lateral roots. Our results show that this monitoring system can be used to assess bacterial pathogenicity efficiently. Copyright (c) 2009 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
2010-10-01
... REQUIREMENTS CONTRACT FINANCING 32.006-4 Procedures. (a) In any case in which an agency's remedy coordination...) of this subsection. (e) Before making a decision to reduce or suspend further payments, the agency... determination and decision. (g) The agency shall retain in its files the written justification for each— (1...
Shen, Jiangchuan; Walsh, Brenna J C; Flores-Mireles, Ana Lidia; Peng, Hui; Zhang, Yifan; Zhang, Yixiang; Trinidad, Jonathan C; Hultgren, Scott J; Giedroc, David P
2018-05-17
Recent studies of hydrogen sulfide (H 2 S) signaling implicate low molecular weight (LMW) thiol persulfides and other reactive sulfur species (RSS) as signaling effectors. Here, we show that a CstR protein from the human pathogen Enterococcus faecalis ( E. faecalis), previously identified in Staphylococcus aureus ( S. aureus), is an RSS-sensing repressor that transcriptionally regulates a cst-like operon in response to both exogenous sulfide stress and Angeli's salt, a precursor of nitroxyl (HNO). E. faecalis CstR reacts with coenzyme A persulfide (CoASSH) to form interprotomer disulfide and trisulfide bridges between C32 and C61', which negatively regulate DNA binding to a consensus CstR DNA operator. A Δ cstR strain exhibits deficiency in catheter colonization in a catheter-associated urinary tract infection (CAUTI) mouse model, suggesting sulfide regulation and homeostasis is critical for pathogenicity. Cellular polysulfide metabolite profiling of sodium sulfide-stressed E. faecalis confirms an increase in both inorganic polysulfides and LMW thiols and persulfides sensed by CstR. The cst-like operon encodes two authentic thiosulfate sulfurtransferases and an enzyme we characterize here as an NADH and FAD-dependent coenzyme A (CoA) persulfide reductase (CoAPR) that harbors an N-terminal CoA disulfide reductase (CDR) domain and a C-terminal rhodanese homology domain (RHD). Both cysteines in the CDR (C42) and RHD (C508) domains are required for CoAPR activity and complementation of a sulfide-induced growth phenotype of a S. aureus strain lacking cstB, encoding a nonheme Fe II persulfide dioxygenase. We propose that S. aureus CstB and E. faecalis CoAPR employ orthogonal chemistries to lower CoASSH that accumulates under conditions of cellular sulfide toxicity and signaling.
Robinson, Judas; de Lusignan, Simon; Kostkova, Patty; Madge, Bruce; Marsh, A; Biniaris, C
2006-01-01
Rich Site Summary (RSS) feeds are a method for disseminating and syndicating the contents of a website using extensible mark-up language (XML). The Primary Care Electronic Library (PCEL) distributes recent additions to the site in the form of an RSS feed. When new resources are added to PCEL, they are manually assigned medical subject headings (MeSH terms), which are then automatically mapped to SNOMED-CT terms using the Unified Medical Language System (UMLS) Metathesaurus. The library is thus searchable using MeSH or SNOMED-CT. Our syndicate partner wished to have remote access to PCEL coronary heart disease (CHD) information resources based on SNOMED-CT search terms. To pilot the supply of relevant information resources in response to clinically coded requests, using RSS syndication for transmission between web servers. Our syndicate partner provided a list of CHD SNOMED-CT terms to its end-users, a list which was coded according to UMLS specifications. When the end-user requested relevant information resources, this request was relayed from our syndicate partner's web server to the PCEL web server. The relevant resources were retrieved from the PCEL MySQL database. This database is accessed using a server side scripting language (PHP), which enables the production of dynamic RSS feeds on the basis of Source Asserted Identifiers (CODEs) contained in UMLS. Retrieving resources using SNOMED-CT terms using syndication can be used to build a functioning application. The process from request to display of syndicated resources took less than one second. The results of the pilot illustrate that it is possible to exchange data between servers using RSS syndication. This method could be utilised dynamically to supply digital library resources to a clinical system with SNOMED-CT data used as the standard of reference.
CERN alerter-RSS based system for information broadcast to all CERN offices
International Nuclear Information System (INIS)
Otto, R
2008-01-01
Nearly every large organization uses a tool to broadcast messages and information across the internal campus (messages like alerts announcing interruption in services or just information about upcoming events). These tools typically allow administrators (operators) to send 'targeted' messages which are sent only to specific groups of users or computers, e/g only those located in a specified building or connected to a particular computing service. CERN has a long history of such tools: CERNVMS's SPM q uotMESSAGE command, Zephyr [2] and the most recent the NICE Alerter based on the NNTP protocol. The NICE Alerter used on all Windows-based computers had to be phased out as a consequence of phasing out NNTP at CERN. The new solution to broadcast information messages on the CERN campus continues to provide the service based on cross-platform technologies, hence minimizing custom developments and relying on commercial software as much as possible. The new system, called CERN Alerter, is based on RSS (Really Simple Syndication) [9] for the transport protocol and uses Microsoft SharePoint as the backend for database and posting interface. The windows-based client relies on Internet Explorer 7.0 with custom code to trigger the window pop-ups and the notifications for new events. Linux and Mac OS X clients could also rely on any RSS readers to subscribe to targeted notifications. The paper covers the architecture and implementation aspects of the new system
Parasuraman, Ramviyas; Molinari, Luca; Kershaw, Keith; Di Castro, Mario; Masi, Alessandro; Ferre, Manuel
2014-01-01
The reliability of wireless communication in a network of mobile wireless robot nodes depends on the received radio signal strength (RSS). When the robot nodes are deployed in hostile environments with ionizing radiations (such as in some scientific facilities), there is a possibility that some electronic components may fail randomly (due to radiation effects), which causes problems in wireless connectivity. The objective of this paper is to maximize robot mission capabilities by maximizing the wireless network capacity and to reduce the risk of communication failure. Thus, in this paper, we consider a multi-node wireless tethering structure called the “server-relay-client” framework that uses (multiple) relay nodes in between a server and a client node. We propose a robust stochastic optimization (RSO) algorithm using a multi-sensor-based RSS sampling method at the relay nodes to efficiently improve and balance the RSS between the source and client nodes to improve the network capacity and to provide red...
Fils RSS | CRDI - Centre de recherches pour le développement ...
International Development Research Centre (IDRC) Digital Library (Canada)
Cliquez sur le fil pour ajouter votre site ou votre lecteur RSS préféré Fil de financement du CRDI Fil des nouvelles du CRDI Fil des perspectives du CRDI Fil des projets du CRDI Fil des publications du CRDI.
Directory of Open Access Journals (Sweden)
Chairani Chairani
2015-05-01
Full Text Available Penelitian ini membahas tentang estimasi posisi (localization objek dalam gedung menggunakan jaringan wireless atau IEEE 802.11g dengan pendekatan Machine Learning. Metode pada pengukuran RSS menggunakan RSS-based fingerprint. Algoritma Machine Learning yang digunakan dalam memperkirakan lokasi dari pengukuran RSS-based menggunakan Naive Bayes. Localization dilakukan pada lantai 3 gedung Jurusan Teknik Elektro dan Teknologi Informasi (JTETI dengan luas 1969,68 m2 dan memiliki 5 buah titik penempatan access point (AP. Untuk membentuk peta fingerprint digunakan dimensi 1 m x 1 m sehingga terbentuk grid sebanyak 1893 buah. Dengan menggunakan software Net Surveyor terkumpul data kekuatan sinyal yang diterima (RSS dari jaringan wireless ke perangkat penerima (laptop sebanyak 86.980 record. Hasil nilai rata-rata error jarak estimasi untuk localization seluruh ruangan di lantai 3 dengan menggunakan algoritma Naive Bayes pada fase offline tahap learning adalah 6,29 meter. Untuk fase online dan tahap post learning diperoleh rata-rata error jarak estimasi sebesar 7,82 meter.
Radiation safety system (RSS) backbones: Design, engineering, fabrication and installation
International Nuclear Information System (INIS)
Wilmarth, J.E.; Sturrock, J.C.; Gallegos, F.R.
1998-01-01
The Radiation Safety System (RSS) Backbones are part of an electrical/electronic/mechanical system insuring safe access and exclusion of personnel to areas at the Los Alamos Neutron Science Center (LANSCE) accelerator. The RSS Backbones control the safety fusible beam plugs which terminate transmission of accelerated ion beams in response to predefined conditions. Any beam or access fault of the backbone inputs will cause insertion of the beam plugs in the low energy beam transport. The Backbones serve the function of tying the beam plugs to the access control systems, beam spill monitoring systems and current-level limiting systems. In some ways the Backbones may be thought of as a spinal column with beam plugs at the head and nerve centers along the spinal column. The two Linac Backbone segments and experimental area segments form a continuous cable plant over 3,500 feet from beam plugs to the tip on the longest tail. The Backbones were installed in compliance with current safety standards, such as installation of the two segments in separate conduits or tray. Monitoring for ground-faults and input wiring verification was an added enhancement to the system. The system has the capability to be tested remotely
RSS SSMIS OCEAN PRODUCT GRIDS DAILY FROM DMSP F17 NETCDF V7
National Aeronautics and Space Administration — The RSS SSMIS Ocean Product Grids Daily from DMSP F17 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...
RSS SSMIS OCEAN PRODUCT GRIDS DAILY FROM DMSP F16 NETCDF V7
National Aeronautics and Space Administration — The RSS SSMIS Ocean Product Grids Daily from DMSP F16 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...
RSS based CERN Alerter. Information broadcast to all CERN offices.
Otto, R
2007-01-01
Nearly every large organization uses a tool to broadcast messages and information across the internal campus (messages like alerts announcing interruption in services or just information about upcoming events). These tools typically allow administrators (operators) to send "targeted" messages which are sent only to specific groups of users or computers, e/g only those located in a specified building or connected to a particular computing service. CERN has a long history of such tools: CERNVMSÂÂs SPM_quotMESSAGE command, Zephyr and the most recent the NICE Alerter based on the NNTP protocol. The NICE Alerter used on all Windows-based computers had to be phased out as a consequence of phasing out NNTP at CERN. The new solution to broadcast information messages on the CERN campus continues to provide the service based on cross-platform technologies, hence minimizing custom developments and relying on commercial software as much as possible. The new system, called CERN Alerter, is based on RSS (Really Simpl...
Ge, H M; Song, Y C; Shan, C Y; Ye, Y H; Tan, R X
2005-11-01
In addition to 7-methoxy-2-methyl-3,4,5-trihydroxyanthraquinone (1), physcion (2), macrosporin (3), deoxybostrycin (4), altersolanol B (5) and dactylariol (6), a new hexahydroanthraquinone named pleospdione (7) was isolated from the culture of Pleospora sp . IFB-E006, an endophytic fungus residing in the normal stem of Imperata cylindrical (Gramineae). Structure determination of pleospdione was accomplished using IR, HR-ESI-MS, 1D and 2D NMR spectral analysis. Compounds 4 - 6 exhibited significant cytotoxic activity against human colon cancer (SW1116) and leukemia (K562) cell lines while compounds 1, 2 and 7 were only weakly or moderately active.
International Nuclear Information System (INIS)
Tian Qifeng; Zhang Yao; Wu Yuanxin
2009-01-01
The passive film composition of Mg 0.9-x Ti 0.1 Pd x Ni (x = 0.04, 0.06, 0.08, 0.1) hydrogen storage alloys after 40 charge-discharge cycles has been investigated by means of X-ray photoelectron spectroscopy (XPS) in combination with Ar + sputtering technology. With the XPSPEAK software, high resolution spectra of alloy elements and oxygen were deconvolved into individual peaks. Composites formed by metal elements and their relative contents were also deduced. It was found that the composites originated from Mg and Ni were mainly in the form of their oxides and hydroxides, which existed at the top surface of alloys. With the increase of sputtering depth, the hydroxides of Mg and Ni gradually disappeared while corresponding oxides dominated their passive products. According to the analysis results of oxygen spectra, the elemental segregation of Mg and Ni was influenced by the substitution of Pd because the addition of Pd slightly enhanced the surface energy of the alloys and suppressed the formation of Mg hydroxide and oxide. Ti and Pd presented multiple-oxides from the surface to the inner alloys and metallic Pd appeared in the sub-layers of the alloys' surface. The possible mechanisms of the formation of passive products were suggested on the basis of the discussion in the paper.
RSS SSM/I OCEAN PRODUCT GRIDS DAILY FROM DMSP F14 NETCDF V7
National Aeronautics and Space Administration — The RSS SSM/I Ocean Product Grids Daily from DMSP F14 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...
RSS SSM/I OCEAN PRODUCT GRIDS DAILY FROM DMSP F11 NETCDF V7
National Aeronautics and Space Administration — The RSS SSM/I Ocean Product Grids Daily from DMSP F11 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...
RSS SSM/I OCEAN PRODUCT GRIDS DAILY FROM DMSP F13 NETCDF V7
National Aeronautics and Space Administration — The RSS SSM/I Ocean Product Grids Daily from DMSP F13 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...
Use of RSS feeds for the implementation of clinical reminder.
Chi, Wen-Chou; Wen, Chia-Hsien; Lin, Chih-Yu; Poon, Sek-Kwong; Huang, Shih-Che
2012-06-01
A computer-based reminder system can help physicians get right information and make right decisions in daily clinical work in time. This study presents a RSS-based Clinical Reminding System (RCRS) designed for reminding clinicians to deal with their varied unfinished clinical works. The RCRS was implemented in a hospital to automatically generate messages for every clinician on the basis of clinical information gathered from the hospital information system (HIS) and send them by RSS feed. In order to allow all physicians to participate in the project, the RCRS was integrated with the Computerized Physician Order Entry (COPE) system to provide messages whenever a clinician logs in the HIS; the connection on screen lets the clinician easily make some response. The system can help clinicians focus on patient care without keeping track of the schedule of clinical chores stored in various systems. Two physicians, also directors from Clinical Informatics Research & Development Center (CIRD) who were appointed as project leaders of the RCRS project who went through the entire development process were chosen as interviewees to obtain a preliminary evaluation of the system. The results show the "Information Content" of this system was suggested to be modified, and "Information Accuracy", "Formats", "Ease of use" and "Timeliness" of the system were appropriate to meet the system design purposes.
Efficient Underwater RSS Value to Distance Inversion Using the Lambert Function
Directory of Open Access Journals (Sweden)
Majid Hosseini
2014-01-01
Full Text Available There are many applications for using wireless sensor networks (WSN in ocean science; however, identifying the exact location of a sensor by itself (localization is still a challenging problem, where global positioning system (GPS devices are not applicable underwater. Precise distance measurement between two sensors is a tool of localization and received signal strength (RSS, reflecting transmission loss (TL phenomena, is widely used in terrestrial WSNs for that matter. Underwater acoustic sensor networks have not been used (UASN, due to the complexity of the TL function. In this paper, we addressed these problems by expressing underwater TL via the Lambert W function, for accurate distance inversion by the Halley method, and compared this to Newton-Raphson inversion. Mathematical proof, MATLAB simulation, and real device implementation demonstrate the accuracy and efficiency of the proposed equation in distance calculation, with fewer iterations, computation stability for short and long distances, and remarkably short processing time. Then, the sensitivities of Lambert W function and Newton-Raphson inversion to alteration in TL were examined. The simulation results showed that Lambert W function is more stable to errors than Newton-Raphson inversion. Finally, with a likelihood method, it was shown that RSS is a practical tool for distance measurement in UASN.
RSS SSM/I OCEAN PRODUCT GRIDS MONTHLY AVERAGE FROM DMSP F15 NETCDF V7
National Aeronautics and Space Administration — The RSS SSM/I Ocean Product Grids Monthly Average from DMSP F15 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special...
RSS SSM/I OCEAN PRODUCT GRIDS WEEKLY AVERAGE FROM DMSP F15 NETCDF V7
National Aeronautics and Space Administration — The RSS SSM/I Ocean Product Grids Weekly Average from DMSP F15 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...
RSS SSMIS OCEAN PRODUCT GRIDS 3-DAY AVERAGE FROM DMSP F16 NETCDF V7
National Aeronautics and Space Administration — The RSS SSMIS Ocean Product Grids 3-Day Average from DMSP F16 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...
RSS SSM/I OCEAN PRODUCT GRIDS WEEKLY AVERAGE FROM DMSP F10 NETCDF V7
National Aeronautics and Space Administration — The RSS SSM/I Ocean Product Grids Weekly Average from DMSP F10 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...
RSS SSM/I OCEAN PRODUCT GRIDS WEEKLY AVERAGE FROM DMSP F8 NETCDF V7
National Aeronautics and Space Administration — The RSS SSM/I Ocean Products Grid Weekly Average from DMSP F8 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...
Multibeam smart antenna field trial experiments in mobile radio environments
Perini, Patrick
1996-01-01
Several types of high gain multibeam antennas were tested and compared to traditional sector and omni antennas in various mobile radio environments. A vehicle equipped with a mobile transmitter drove in several mobile radio environments while the received signal strength (RSS) was recorded on multiple antenna channels attached to multibeam, sector and omni directional antennas. The RSS data recorded included the fast (rayleigh) fading and was averaged into local means based on the mobile's position/speed. Description of the experiment and analysis of the gain improvement, average RSS, diversity gain are presented.
Wen, Xiaoyang; Tao, Wenyuan; Own, Chung-Ming; Pan, Zhenjiang
2016-08-15
Location data is one of the most widely used context data types in context-aware and ubiquitous computing applications. To support locating applications in indoor environments, numerous systems with different deployment costs and positioning accuracies have been developed over the past decade. One useful method, based on received signal strength (RSS), provides a set of signal transmission access points. However, compiling a remeasurement RSS database involves a high cost, which is impractical in dynamically changing environments, particularly in highly crowded areas. In this study, we propose a dynamic estimation resampling method for certain locations chosen from a set of remeasurement fingerprinting databases. Our proposed method adaptively applies different, newly updated and offline fingerprinting points according to the temporal and spatial strength of the location. To achieve accuracy within a simulated area, the proposed method requires approximately 3% of the feedback to attain a double correctness probability comparable to similar methods; in a real environment, our proposed method can obtain excellent 1 m accuracy errors in the positioning system.
Directory of Open Access Journals (Sweden)
Xiaoyang Wen
2016-08-01
Full Text Available Location data is one of the most widely used context data types in context-aware and ubiquitous computing applications. To support locating applications in indoor environments, numerous systems with different deployment costs and positioning accuracies have been developed over the past decade. One useful method, based on received signal strength (RSS, provides a set of signal transmission access points. However, compiling a remeasurement RSS database involves a high cost, which is impractical in dynamically changing environments, particularly in highly crowded areas. In this study, we propose a dynamic estimation resampling method for certain locations chosen from a set of remeasurement fingerprinting databases. Our proposed method adaptively applies different, newly updated and offline fingerprinting points according to the temporal and spatial strength of the location. To achieve accuracy within a simulated area, the proposed method requires approximately 3% of the feedback to attain a double correctness probability comparable to similar methods; in a real environment, our proposed method can obtain excellent 1 m accuracy errors in the positioning system.
NOAA Climate Data Record (CDR) of SSM/I and SSMIS Microwave Brightness Temperatures, RSS Version 7
National Oceanic and Atmospheric Administration, Department of Commerce — This Version 7 NOAA Fundamental Climate Data Record (CDR) from Remote Sensing Systems (RSS) contains brightness temperatures that have been inter-calibrated and...
Directory of Open Access Journals (Sweden)
Penny Setyowati
1997-12-01
Full Text Available The objective of this research is to find composision of rubber blend of RSS and JSR 0061 and Carbon black for preparation light rubber sole compound and stabile on high process temperature that give the best fisical properties and the best sole product at moulding vulcanization trial. The best rubber compound to be reached at the compound formulation R III with composision of RSS 90 phr, JSR 0061 10 phr dan carbon black 40 phr.
Experiment S006: Synoptic weather photography
Nagler, K. M.; Soules, S. D.
1971-01-01
A data gathering effort on a number of cloud systems is reported. On both manned and unmanned Mercury and Gemini 3 missions, a number of good pictures of cloud systems were obtained. Also, specific experiments were performed by the crewmembers in the Mercury missions. Those experiments involved some of the spectral reflectance characteristics of clouds, land, and water regions of the earth surface as viewed from outside the atmosphere. Pictures obtained on successive revolutions of a Gemini spacecraft were indicative of the changes in and the movements of clouds at approximately 90-min intervals at certain points beneath the track of the spacecraft. A series of such views explain the various meteorological phenomena.
The Primary Care Electronic Library: RSS feeds using SNOMED-CT indexing for dynamic content delivery
Directory of Open Access Journals (Sweden)
Judas Robinson
2006-12-01
Conclusion The results of the pilot illustrate that it is possible to exchange data between servers using RSS syndication. This method could be utilised dynamically to supply digital library resources to a clinical system with SNOMED-CTdata used as the standard of reference.
Uav Positioning and Collision Avoidance Based on RSS Measurements
Masiero, A.; Fissore, F.; Guarnieri, A.; Pirotti, F.; Vettore, A.
2015-08-01
In recent years, Unmanned Aerial Vehicles (UAVs) are attracting more and more attention in both the research and industrial communities: indeed, the possibility to use them in a wide range of remote sensing applications makes them a very flexible and attractive solution in both civil and commercial cases (e.g. precision agriculture, security and control, monitoring of sites, exploration of areas difficult to reach). Most of the existing UAV positioning systems rely on the use of the GPS signal. Despite this can be a satisfactory solution in open environments where the GPS signal is available, there are several operating conditions of interest where it is unavailable or unreliable (e.g. close to high buildings, or mountains, in indoor environments). Consequently, a different approach has to be adopted in these cases. This paper considers the use ofWiFi measurements in order to obtain position estimations of the device of interest. More specifically, to limit the costs for the devices involved in the positioning operations, an approach based on radio signal strengths (RSS) measurements is considered. Thanks to the use of a Kalman filter, the proposed approach takes advantage of the temporal dynamic of the device of interest in order to improve the positioning results initially provided by means of maximum likelihood estimations. The considered UAVs are assumed to be provided with communication devices, which can allow them to communicate with each other in order to improve their cooperation abilities. In particular, the collision avoidance problem is examined in this work.
Ionization of small molecules by state-selected neon (3P0, 3P2) metastable atoms in the 0.06
Berg, van den F.T.M.; Schonenberg, J.H.M.; Beijerinck, H.C.W.
1987-01-01
The velocity dependence and absolute values of the total ionisation cross section for the molecules H2, N2, O2, NO, CO, N2O, CO2, and CH4 by metastable Ne* (3P0) and Ne* (3P2) atoms at collision energies ranging from 0.06 to 6.0 eV have been measured in a crossed beam experiment. State selection of
RSS SSM/I OCEAN PRODUCT GRIDS 3-DAY AVERAGE FROM DMSP F14 NETCDF V7
National Aeronautics and Space Administration — The RSS SSM/I Ocean Product Grids 3-Day Average from DMSP F14 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...
RSS SSM/I OCEAN PRODUCT GRIDS 3-DAY AVERAGE FROM DMSP F10 NETCDF V7
National Aeronautics and Space Administration — The RSS SSM/I Ocean Product Grids 3-Day Average from DMSP F10 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...
Observation of the rare {eta}{yields}e{sup +}e{sup -}e{sup +}e{sup -} decay with the KLOE experiment
Energy Technology Data Exchange (ETDEWEB)
Ambrosino, F. [Dipartimento di Scienze Fisiche dell' Universita ' Federico II' , Napoli (Italy); INFN Sezione di Napoli, Napoli (Italy); Antonelli, A.; Antonelli, M. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Archilli, F. [Dipartimento di Fisica dell' Universita ' Tor Vergata, Roma (Italy); INFN Sezione di Roma Tor Vergata, Roma (Italy); Balwierz, I. [Institute of Physics, Jagiellonian University, Krakow (Poland); Bencivenni, G. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Bini, C. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy); Bloise, C. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Bocchetta, S. [Dipartimento di Fisica dell' Universita ' Roma Tre' , Roma (Italy); INFN Sezione di Roma Tre, Roma (Italy); Bossi, F. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Branchini, P. [INFN Sezione di Roma Tre, Roma (Italy); Capon, G.; Capussela, T. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Ceradini, F. [Dipartimento di Fisica dell' Universita ' Roma Tre' , Roma (Italy); INFN Sezione di Roma Tre, Roma (Italy); Ciambrone, P.; Czerwinski, E.; De Lucia, E. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); De Santis, A. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy); De Simone, P. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); De Zorzi, G. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy)
2011-08-26
We report the first observation of the rare {eta}{yields}e{sup +}e{sup -}e{sup +}e{sup -}({gamma}) decay based on 1.7 fb{sup -1} collected by the KLOE experiment at the DA{Phi}NE {phi}-factory. The selection of the e{sup +}e{sup -}e{sup +}e{sup -} final state is fully inclusive of radiation. We have identified 362{+-}29 events resulting in a branching ratio of (2.4{+-}0.2{sub stat}+bckg{+-}0.1{sub syst})x10{sup -5}.
Recent results on charm from Fermilab experiment E-687
International Nuclear Information System (INIS)
Buchholz, D.; Gourlay, S.; Moroni, L.; Ratti, S.P.; Shephard, W.D.
1990-12-01
About 10 4 charm decays have been reconstructed from first-run data of Fermilab experiment E687 using the Fermilab Wide-Band Photon Spectrometer with the world's highest energy photon beam. The success of techniques for isolating and reconstructing charm event samples based on two complementary vertexing strategies is illustrated. Preliminary results are presented. These include lifetime value of (0.50 ± 0.06 ± 0.03)ps for the D s + , and (0.20 ± 0.03 ± 0.03)ps for the Λ c + . Preliminary values for the D + and D 0 lifetimes are consistent with currently accepted world averages. Signals for the Cabibbo-suppressed decays D 0 → π + π - π + π - , D + → K + K - π + , and D + → φπ + are shown; for B(D 0 → π + π - π + π - )/B(D 0 → K - π + π + π - ) our preliminary value is 0.10 ± 0.02 ± 0.02. Preliminary values for ratios B(D 0 → Kstring 0 K + K - )/B(D 0 → Kstring 0 π + π - ) and B(D 0 → Kstring 0 φ)/B(D 0 → Kstring 0 π + π - ) are 0.20 ± 0.06 and 0.16 ± 0.06. Preliminary results are given for cross sections of D* ± and D ± photoproduction on a Be target for the p 2 τ dependence of D minus-plus photoproduction and for the ratios D double-prime/D* + and D* - /D minus-plus . The energy dependence of the total open charm photoproduction cross section is compared with model predictions for photon energies up to 350 GeV. 18 refs., 5 figs
BOREAS RSS-7 Landsat TM LAI IMages of the SSA and NSA
Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Chen, Jing; Cihlar, Josef
2000-01-01
The BOReal Ecosystem-Atmosphere Study Remote Sensing Science (BOREAS RSS-7) team used Landsat Thematic Mapper (TM) images processed at CCRS to produce images of Leaf Area Index (LAI) for the BOREAS study areas. Two images acquired on 06-Jun and 09-Aug-1991 were used for the SSA, and one image acquired on 09-Jun-1994 was used for the NSA. The LAI images are based on ground measurements and Landsat TM Reduced Simple Ratio (RSR) images. The data are stored in binary image-format files.
An RSS based location estimation technique for cognitive relay networks
Qaraqe, Khalid A.
2010-11-01
In this paper, a received signal strength (RSS) based location estimation method is proposed for a cooperative wireless relay network where the relay is a cognitive radio. We propose a method for the considered cognitive relay network to determine the location of the source using the direct and the relayed signal at the destination. We derive the Cramer-Rao lower bound (CRLB) expressions separately for x and y coordinates of the location estimate. We analyze the effects of cognitive behaviour of the relay on the performance of the proposed method. We also discuss and quantify the reliability of the location estimate using the proposed technique if the source is not stationary. The overall performance of the proposed method is presented through simulations. ©2010 IEEE.
BOREAS RSS-20 POLDER C-130 Measurements of Surface BRDF
Leroy, Marc; Hall, Forrest G. (Editor); Nickerson, Jaime (Editor); Smith, David E. (Technical Monitor)
2000-01-01
This Boreal Ecosystem-Atmosphere Study (BOREAS) Remote Sensing Science (RSS)-20 data set contains measurements of surface bidirectional reflectance distribution function (BRDF) made by the polarization and Directionality of Earth reflectances (POLDER) instrument over several surface types (pine, spruce, fen) of the BOREAS southern study area (SSA) during the 1994 intensive field campaigns (IFCs). Single-point BRDF values were acquired either from the NASA Ames Research Center (ARC) C-130 aircraft or from a NASA Wallops Flight Facility (WFF) helicopter. A related data set collected from the helicopter platform is available as is POLDER imagery acquired from the C-130. The data are stored in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884) or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
Directory of Open Access Journals (Sweden)
Penny Setyowati
2004-07-01
Full Text Available The aim of the research was to study the influence of utilization of sulphur and reclaim rubber on the characteristics of ebonite rubber, and also to determine the optimum utilization of reclaim rubber and sulphur which yield good physical properties. Ebonite rubber was made by special natural rubber of RSS I (Ribbed Smoke Sheet I mixed with reclaimed rubber at ratio 80/20, 70/30 and 60/40 part hundred rubber/part hundred rubber (phr/phr and utilization of sulphur 30, 40, and 50 phr and also additives respectively. Mixing was done by using open mill, and vulcanization was conducted at early temperature 1200C for 2 hours, and it was continued by post curing at temperature 1500C for 2 hours. The physical properties such as tensile strength, elongation at break, D shore hardness, and izod impact of ebonite rubber vulcanized were determined. The result indicated that characteristics of ebonite rubber was significantly influenced by the amount of added sulphur and 40 phr reclaim rubber or at ratio of RSS I to reclaim rubber 60 to 40 phr/phr. However, the physical properties of ebonite rubber was able to meet the standard quality of group 2 regarding to Classification Hard Rubber issued by ASTM D 2135
TRIO-01 experiment: in-situ tritium-recovery results
International Nuclear Information System (INIS)
Clemmer, R.G.; Finn, P.A.; Billone, M.C.
1983-08-01
The TRIO-01 experiment is a test of in-situ tritium recovery from γ-LiAlO 2 with test conditions chosen to simulate those anticipated in fusion power reactors. A status report is presented which describes qualitatively the results observed during the irradiation phase of the experiment. Both the rate of tritium release and the chemical forms of tritium were measured using a helium sweep gas which flowed past the breeder material to a gas analysis system
TRIO-01 experiment: in-situ tritium recovery results
International Nuclear Information System (INIS)
Clemmer, R.G.; Finn, P.A.; Billone, M.C.
1983-10-01
The TRIO-01 experiment is a test of in-situ tritium recovery from γ-LiAlO 2 with test conditions chosen to simulate those anticipated in fusion power reactors. A status report is presented which describes qualitatively the results observed during the irradiation phase of the experiment. Both the rate of tritium release and the chemical forms of tritium were measured using a helium sweep gas which flowed past the breeder material to a gas analysis system
48 CFR 432.006-4 - Procedures.
2010-10-01
... REQUIREMENTS CONTRACT FINANCING 432.006-4 Procedures. (a) Immediately upon submittal of the referral described... decision making process. (c) The OIG will determine the need for and the extent of an investigation. (d...
Study of the semileptonic decay D+→K-π+e+νe with the BaBar experiment
International Nuclear Information System (INIS)
Firmino da Costa, J.
2009-07-01
We use 347.5 fb -1 of data recorded by the BaBar detector at the PEP-II electron-positron collider to study the D + → K - π + e + ν e decay channel. The hadronic final state is described by the sum of S and P-waves. Using the LASS parameterization for the S-wave phase, we measure the scattering length parameter a S and the effective range term b S . In this fit the other parameters entering this parameterization as the mass and width of the K 0 * (1430)) are fixed to the values provided by LASS. We find a S equals (1.78 ± 0.15 ± 0.19) (GeV/c) -1 and b S equals (-1.93 ± 0.69 ± 0.69) (GeV/c) -1 . We have in this fit parameterized the S-wave amplitude until the K 0 * (1430) using a linear expression and have fitted both terms of the expansion (r S and r S * ). We find r S = (0.477 ± 0.025 ± 0.022) and r S * = (0.15 ± 0.06 ± 0.06. In the same fit, we obtain also the K *0 (892) parameters (mass, width and barrier factor) as well as the form factor ratios at q 2 = 0 (r V = V(0)/A 1 (0), r 2 = A 2 (0)/A 1 (0)) and the value of the axial-vector pole mass parameterizing A 1 and A 2 . We find m(K *0 (892)) = (895.0 ± 0.1 ± 0.5) MeV/c 2 , Γ(K *0 (892)) equals (45.79 ± 0.23 ± 0.21) MeV/c 2 , r BW = (4.20 ± 0.23 ± 0.39) GeV/c, r V 1.480 ± 0.016 ± 0.026, r 2 = 0.824 ± 0.020 ± 0.020 and m A equals (2.68 +0.11 -0.10 ± 0.16) GeV/c 2 . We determine B(D + → K - π + e + ν e ) equals (4.03 ± 0.03 ± 0.04 ± 0.09) * 10 -2 , B(D + → K -*0 e + ν e ) * B(K -*0 → K - π + ) (3.81 ± 0.03 ± 0.04 ± 0.09) * 10 -2 . The S-wave contribution to the K - π + e + ν e decay channel is equal to (5.68 ± 0.21 ± 0.24 %). The value of the hadronic form factor A 1 at q 2 = 0 is A 1 (0) equals 0.6270 ± 0.0027 ± 0.0032 ± 0.0076. In a second approach, we measure the S-wave phase variation from threshold up to 1.6 GeV/c 2 for several values of the Kπ mass. We also fit parameters for a signal model where the S-wave amplitude is proportional to the Kπ elastic
Effect of Mono and Di-rhamnolipids on Biofilms Pre-formed by Bacillus subtilis BBK006.
De Rienzo, Mayri A Díaz; Martin, Peter J
2016-08-01
Different microbial inhibition strategies based on the planktonic bacterial physiology have been known to have limited efficacy on the growth of biofilms communities. This problem can be exacerbated by the emergence of increasingly resistant clinical strains. Biosurfactants have merited renewed interest in both clinical and hygienic sectors due to their potential to disperse microbial biofilms. In this work, we explore the aspects of Bacillus subtilis BBK006 biofilms and examine the contribution of biologically derived surface-active agents (rhamnolipids) to the disruption or inhibition of microbial biofilms produced by Bacillus subtilis BBK006. The ability of mono-rhamnolipids (Rha-C10-C10) produced by Pseudomonas aeruginosa ATCC 9027 and the di-rhamnolipids (Rha-Rha-C14-C14) produced by Burkholderia thailandensis E264, and phosphate-buffered saline to disrupt biofilm of Bacillus subtilis BBK006 was evaluated. The biofilm produced by Bacillus subtilis BBK006 was more sensitive to the di-rhamnolipids (0.4 g/L) produced by Burkholderia thailandensis than the mono-rhamnolipids (0.4 g/L) produced by Pseudomonas aeruginosa ATCC 9027. Rhamnolipids are biologically produced compounds safe for human use. This makes them ideal candidates for use in new generations of bacterial dispersal agents and useful for use as adjuvants for existing microbial suppression or eradication strategies.
International Nuclear Information System (INIS)
Gupta, Ashutosh K.; Malhotra, Poonam; Singh, Praveen K.; Chhachhia, Neha; Singh, Shravan K.; Kumar, Raj
2014-01-01
Ionizing radiation is known to cause oxidative damage in biological system primarily by generating reactive oxygen species (ROS). Gastrointestinal system is considered one of the most radiosensitive biological systems. The most radiosensitive cells type found in the intestine are continuously proliferative crypt cells. Damage to intestinal crypt cells lead to gastrointestinal functions impairment that contribute to mortality. In the present study, whole body radioprotective efficacy of bacterial secondary metabolite RK-IP-006.G was evaluated in C57BL/6 male mice. To determine free radical scavenging properties of RK-IP-006.G 2',7'-dichlorodihydrofluorescein diacetate (DCFDA) assay was performed. Radiation induced lipid peroxidation and its inhibition by RK-IP-006.G pretreatment was assessed in intestinal tissue homogenate. To find out cellular antioxidant status of the irradiated and RK-IP- 006.G treated mice, SOD, Catalase, and Glutathion-S-Transferase activity were estimated in intestinal tissue homogenate. Anti-apoptotic and mitochondrial membrane hypopolarization effect of the RK-IP-006.G was also analyzed using fluorescent probes Acridine Orange and Rhodamine123 respectively. Results of the study demonstrated that, RK-IP-006.G pretreatment (∼2h; 150 mg/kg.b.wt. oral administration) to the lethally irradiated (9 Gy) C57BL/6 male mice contributes to >83% whole body radioprotection in mice. Significant (P>0.05%) inhibition in lipid peroxidation was observed in intestinal tissue of irradiated mice pretreated with RK-IP-006.G compared to only irradiated controls. Significant (P>0.05%) increase in antioxidant enzyme i.e. Catalase, SOD and GST activities was reported in irradiated mice pretreated with RK-IP-006.G compared to irradiated control groups. RK-IP-006.G pretreatment also found to be instrumental in inhibiting radiation induced apoptosis and mitochondrial membrane hyperpolarization. In conclusion, present study revealed that bacterial secondary
46 CFR 161.006-1 - Applicable specifications.
2010-10-01
... Nickel Plus Chromium and Nickel Plus Chromium—161.006-4 You may obtain these standards from The American...) Underwriters' Laboratories, Inc.: Standard for flexible cord and fixture wire, third edition, October, 1935. (b...
Post test analysis of the LOBI BT01 experiment
International Nuclear Information System (INIS)
Hozer, Z.; Takacs, A.
1994-12-01
The LOBI experimental facility and the BT01 experiment is described. The experiment represents a small break transient in the secondary side (steam line) followed by special conditions for the establishment of pressurized thermal shock and accident management procedures. The computational analysis has been performed by the CATHARE thermal hydraulic system code. The results of calculations are in satisfactory agreement with the experimental values. A comparison has been made with a secondary side break test performed on the PMK-2 facility. (author). 14 refs., 26 figs., 6 tabs
NCBI nr-aa BLAST: CBRC-TTRU-01-1013 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-1013 ref|YP_003097082.1| NADH dehydrogenase subunit 5 [Rhopalomyia pom...um] gb|ACT80211.1| NADH dehydrogenase subunit 5 [Rhopalomyia pomum] YP_003097082.1 0.006 23% ...
40 CFR 600.006-86 - Data and information requirements for fuel economy vehicles.
2010-07-01
... fuel economy vehicles. 600.006-86 Section 600.006-86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-General Provisions § 600.006-86 Data and...
40 CFR 600.006-89 - Data and information requirements for fuel economy vehicles.
2010-07-01
... fuel economy vehicles. 600.006-89 Section 600.006-89 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-General Provisions § 600.006-89 Data and...
R2NA: Received Signal Strength (RSS Ratio-Based Node Authentication for Body Area Network
Directory of Open Access Journals (Sweden)
Yang Wu
2013-12-01
Full Text Available The body area network (BAN is an emerging branch of wireless sensor networks for personalized applications. The services in BAN usually have a high requirement on security, especially for the medical diagnosis. One of the fundamental directions to ensure security in BAN is how to provide node authentication. Traditional research using cryptography relies on prior secrets shared among nodes, which leads to high resource cost. In addition, most existing non-cryptographic solutions exploit out-of-band (OOB channels, but they need the help of additional hardware support or significant modifications to the system software. To avoid the above problems, this paper presents a proximity-based node authentication scheme, which only uses wireless modules equipped on sensors. With only one sensor and one control unit (CU in BAN, we could detect a unique physical layer characteristic, namely, the difference between the received signal strength (RSS measured on different devices in BAN. Through the above-mentioned particular difference, we can tell whether the sender is close enough to be legitimate. We validate our scheme through both theoretical analysis and experiments, which are conducted on the real Shimmer nodes. The results demonstrate that our proposed scheme has a good security performance.
CompTIA network+ study guide exam N10-006
Lammle, Todd
2015-01-01
All-star N10-006 prep, fully updated for the new exam The CompTIA Network+ Study Guide is your one-stop comprehensive resource in preparing for exam N10-006 Bestselling author and networking Guru Todd Lammle guides you through 100% of all exam objectives detailing the fundamental concepts you will need to know to prepare for the exam. Coverage includes network technologies, installation and configuration, media and topologies, security, and much more, plus practical examples drawn from real-world situations. You also gain access to practice exams and electronic flashcards that facilitate info
Recent Results from the Daya Bay Experiment
Yu, Z. Y.; Daya Bay Collaboration
2017-09-01
The Daya Bay reactor neutrino experiment was designed to precisely measure the neutrino oscillation parameter θ 13 via the relative comparison of neutrino rates and spectra at different baselines. Eight identically designed detectors were deployed in two near experimental halls and a far hall. Six 2.9 GWth nuclear power reactors served as intense {\\bar ν _e} sources. Since Dec. 2011, the experiment has been running stably. The latest neutrino oscillation results were based on 1230 days of data. Analysis using a three-flavor oscillation model yielded sin22θ 13 = 0.0841 ± 0.0027(stat.) ± 0.0019(syst.), and effective neutrino mass-squared difference ≤ft| {Δ mee^2} \\right| = ≤ft( {2.50 +/- 0.06≤ft( {stat.} \\right) +/- 0.06≤ft( {syst.} \\right)} \\right) × {10 - 3}e{V^2}. Besides, results from the absolute measurement of reactor {\\bar ν _e} flux and energy spectrum, and a search for a light sterile neutrino are also presented.
Energy Technology Data Exchange (ETDEWEB)
Tran, A; Ruan, D; Woods, K; Yu, V; Nguyen, D; Sheng, K [UCLA School of Medicine, Los Angeles, CA (United States)
2016-06-15
Purpose: The predictive power of knowledge based planning (KBP) has considerable potential in the development of automated treatment planning. Here, we examine the predictive capabilities and accuracy of previously reported KBP methods, as well as an artificial neural networks (ANN) method. Furthermore, we compare the predictive accuracy of these methods on coplanar volumetric-modulated arc therapy (VMAT) and non-coplanar 4π radiotherapy. Methods: 30 liver SBRT patients previously treated using coplanar VMAT were selected for this study. The patients were re-planned using 4π radiotherapy, which involves 20 optimally selected non-coplanar IMRT fields. ANNs were used to incorporate enhanced geometric information including liver and PTV size, prescription dose, patient girth, and proximity to beams. The performance of ANN was compared to three methods from statistical voxel dose learning (SVDL), wherein the doses of voxels sharing the same distance to the PTV are approximated by either taking the median of the distribution, non-parametric fitting, or skew-normal fitting. These three methods were shown to be capable of predicting DVH, but only median approximation can predict 3D dose. Prediction methods were tested using leave-one-out cross-validation tests and evaluated using residual sum of squares (RSS) for DVH and 3D dose predictions. Results: DVH prediction using non-parametric fitting had the lowest average RSS with 0.1176(4π) and 0.1633(VMAT), compared to 0.4879(4π) and 1.8744(VMAT) RSS for ANN. 3D dose prediction with median approximation had lower RSS with 12.02(4π) and 29.22(VMAT), compared to 27.95(4π) and 130.9(VMAT) for ANN. Conclusion: Paradoxically, although the ANNs included geometric features in addition to the distances to the PTV, it did not perform better in predicting DVH or 3D dose compared to simpler, faster methods based on the distances alone. The study further confirms that the prediction of 4π non-coplanar plans were more accurate than
BOREAS RSS-8 BIOME-BGC SSA Simulation of Annual Water and Carbon Fluxes
Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Kimball, John
2000-01-01
The BOREAS RSS-8 team performed research to evaluate the effect of seasonal weather and landcover heterogeneity on boreal forest regional water and carbon fluxes using a process-level ecosystem model, BIOME-BGC, coupled with remote sensing-derived parameter maps of key state variables. This data set contains derived maps of landcover type and crown and stem biomass as model inputs to determine annual evapotranspiration, gross primary production, autotrophic respiration, and net primary productivity within the BOREAS SSA-MSA, at a 30-m spatial resolution. Model runs were conducted over a 3-year period from 1994-1996; images are provided for each of those years. The data are stored in binary image format. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
International Nuclear Information System (INIS)
Zender, S.N.; Jensen, M.F.; Sackett, K.E.
1975-03-01
Recorded test data are presented for Tests S-01-4 and S-01-4A of the semiscale Mod-1 isothermal blowdown test series. These tests are among several semiscale Mod-1 experiments which are counterparts of the planned Loss-of-Fluid Test (LOFT) nonnuclear experiments. System hardware is representative of LOFT design based on volumetric scaling methods, and initial conditions duplicate those identified for the LOFT nonnuclear tests. Tests S-01-4 and S-01-4A employed an intact loop resistance that was similar to that of Test S-01-3 and low relative to that of Test S-01-2. An orificed structure was used in the pressure vessel to simulate the LOFT core simulator. The tests were initiated at initial isothermal conditions of about 2250 psig and 540 0 F by a simulated offset shear of the cold-leg broken-loop piping. During system depressurization, coolant was injected into the cold leg of the intact loop to provide data on the effects of emergency core cooling on system response. Following the blowdown portion of Test S-01-4, coolant spray was introduced into the pressure suppression tank to determine the response of the pressure suppression system. The uninterpreted data are presented. The data, presented in the form of graphs in engineering units, have been analyzed only to the extent necessary to assure that they are reasonable and consistent. (U.S.)
Wassmann, Marko; Moeller, Ralf; Rabbow, Elke; Panitz, Corinna; Horneck, Gerda; Reitz, Günther; Douki, Thierry; Cadet, Jean; Stan-Lotter, Helga; Cockell, Charles S; Rettberg, Petra
2012-05-01
In the space experiment "Molecular adaptation strategies of microorganisms to different space and planetary UV climate conditions" (ADAPT), bacterial endospores of the highly UV-resistant Bacillus subtilis strain MW01 were exposed to low-Earth orbit (LEO) and simulated martian surface conditions for 559 days on board the European Space Agency's exposure facility EXPOSE-E, mounted outside the International Space Station. The survival of B. subtilis MW01 spores from both assays (LEO and simulated martian conditions) was determined by a colony-formation assay after retrieval. It was clearly shown that solar extraterrestrial UV radiation (λ≥110 nm) as well as the martian UV spectrum (λ≥200 nm) was the most deleterious factor applied; in some samples only a few spore survivors were recovered from B. subtilis MW01 spores exposed in monolayers. However, if shielded from solar irradiation, about 8% of MW01 spores survived in LEO conditions, and 100% survived in simulated martian conditions, compared to the laboratory controls. The results demonstrate the effect of shielding against the high inactivation potential of extraterrestrial solar UV radiation, which limits the chances of survival of even the highly UV-resistant strain of B. subtilis MW01 in the harsh environments of outer space and the martian surface.
DEFF Research Database (Denmark)
Bach, Anders
2015-01-01
ZL006 and IC87201 have been presented as efficient inhibitors of the nNOS/PSD-95 protein-protein interaction and shown great promise in cellular experiments and animal models of ischemic stroke and pain. Here, we investigate the proposed mechanism of action of ZL006 and IC87201 using biochemical...... by interacting with the β-finger of nNOS-PDZ. Our findings have implications for further medicinal chemistry efforts of ZL006, IC87201 and analogues, and challenge the general and widespread view on their mechanism of action....
International Nuclear Information System (INIS)
Vel Leitner, N.K.; Guilbault, I.; Legube, B.
2003-01-01
Electron beam irradiation of aqueous solutions of EDTA, EDDA NN', NTA, IDA and Cu-EDTA was performed in the presence of scavengers for the hydroxyl radicals (methanol) or for the solvated electrons (hydrogen peroxide). Experiments showed that for each molecule, the G-value decreases as the radiation dose increases from 1 to 25 kGy, and for EDTA, when the initial concentration decreases from 10 to 0.1 mmol l -1 . At pH 8 and for 5 kGy, the G-values of NTA, IDA, EDTA and EDDA NN' removal ascribed to OH · radicals are, respectively, 0.06, 0.06, 0.15 and 0.20 μmol J -1 , whereas for the solvated electrons the G-values were, respectively, 0.01, 0.01, 0.06 and 0.04 μmol J -1 . The rate constants of hydroxyl radicals and solvated electrons were determined by comparison with one competitor. For each active species (hydroxyl radical or solvated electron), the reactivity is connected to the number of nitrogen atoms and acetate groups. The rate constants of OH · radicals are above 10 10 and 8.6x10 9 l mol -1 s -1 for EDDA NN' and EDTA, respectively, 2.1x10 9 l mol -1 s -1 for IDA and 6.1x10 8 l mol -1 s -1 for NTA. The reactivity of solvated electrons is smaller and the rate constants are in the range 1.9x10 6 -3.7x10 6 l mol -1 s -1 for NTA, IDA and EDDA NN' and equal 1.4x10 7 l mol -1 s -1 for EDTA. The reactivity of the complex Cu-EDTA towards OH · does not differ to a large extent from EDTA whereas with e - aq the reactivity of Cu-EDTA is better than EDTA since k e - /Cu-EDTA reaches 2.2x10 9 l mol -1 s -1 . It follows that when both active entities (OH · and e - aq ) are involved in the electron beam irradiation process, the removal of free aminopolycarboxylic acids is mainly due to OH · radicals. However, the complex Cu-EDTA is concerned by both e - aq and OH · radicals
Whole genome sequences and annotation of Micrococcus luteus SUBG006, a novel phytopathogen of mango.
Rakhashiya, Purvi M; Patel, Pooja P; Thaker, Vrinda S
2015-12-01
Actinobaceria, Micrococcus luteus SUBG006 was isolated from infected leaves of Mangifera indica L. vr. Nylon in Rajkot, (22.30°N, 70.78°E), Gujarat, India. The genome size is 3.86 Mb with G + C content of 69.80% and contains 112 rRNA sequences (5S, 16S and 23S). The whole genome sequencing has been deposited in DDBJ/EMBL/GenBank under the accession number JOKP00000000.
Proton NMR study of α-MnH 0.06
Soloninin, A. V.; Skripov, A. V.; Buzlukov, A. L.; Antonov, V. E.; Antonova, T. E.
2004-07-01
Proton nuclear magnetic resonance (NMR) spectra and spin-lattice relaxation rates for the solid solution α-MnH 0.06 have been measured over the temperature range 11-297 K and the resonance frequency range 20-90 MHz. A considerable shift and broadening of the proton NMR line and a sharp peak of the spin-lattice relaxation rate are observed near 130 K. These effects are attributed to the onset of antiferromagnetic ordering below the Néel temperature TN≈130 K. The proton NMR line does not disappear in the antiferromagnetic phase; this suggests a small magnitude of the local magnetic fields at H-sites in α-MnH 0.06. The spin-lattice relaxation rate in the paramagnetic phase is dominated by the effects of spin fluctuations.
40 CFR 600.006-87 - Data and information requirements for fuel economy vehicles.
2010-07-01
..., motor controller, battery configuration, or other components performed within 2,000 miles prior to fuel... fuel economy vehicles. 600.006-87 Section 600.006-87 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel...
40 CFR 600.006-08 - Data and information requirements for fuel economy vehicles.
2010-07-01
... controller, battery configuration, or other components performed within 2,000 miles prior to fuel economy... fuel economy vehicles. 600.006-08 Section 600.006-08 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel...
48 CFR 3032.006 - Reduction or suspension of contract payments upon finding of fraud.
2010-10-01
... contract payments upon finding of fraud. 3032.006 Section 3032.006 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY, HOMELAND SECURITY ACQUISITION REGULATION (HSAR) GENERAL CONTRACTING... finding of fraud. ...
75 FR 19345 - Federal Acquisition Regulation; FAR Case 2009-006, Labor Relations Costs
2010-04-14
... manner of exercising, the right to organize and bargain collectively through representatives of the... submit comments only and cite FAR case 2009- 006, in all correspondence related to this case. All... publication schedules, contact the Regulatory Secretariat at (202) 501-4755. Please cite FAR case 2009- 006...
International Nuclear Information System (INIS)
Santos, Adimir dos; Fanaro, Leda C.C.B.; Jerez, Rogério
2013-01-01
Highlights: • A new experimental method for the spectral index measurements was developed. • The method eliminates the need of calculated correction factors for the case of 28 ρ. • The experimental results were approved for inclusion in the IRPhE handbook. • MCNP5 with ENDF/B-VII.0 described well the experimental data. - Abstract: New experimental results for the spectral indices of the IPEN/MB-01 reactor are presented in this work. The experimental approach considers a new technique for the 28 ρ case which does not require any sort of calculated correction factors. This aspect gave to the IPEN/MB-01 experiment an excellent quality and free of possible bias due to these calculated correction factors. The uncertainty analysis show, even considering the uncertainties of the geometric and material data of the facility, that the final uncertainties are small enough and well understood for a benchmark problem. The experiment was evaluated and included in the IRPhE handbook. The theory/experiment comparison reveals that there is considerable progress in the 238 U nuclear data for application in thermal reactors. The theory/experiment comparison employs the nuclear data libraries ENDF/B-VII.0, ENDF/B-VI.8, JEF3.1, and JENDL3.3 and reveals an excellent agreement for the spectral index 28 ρ * independently of the nuclear data library considered; aspect never found before in several other comparisons. The long term overprediction of the 238 U neutron epithermal capture appears to be eliminated with the improvements in the recent nuclear data libraries. The experimental performed at the IPEN/MB-01 reactor supports the changes in the 238 U nuclear data incorporated in ENDF/B-VII.0 as well as in the other libraries studied in this work. The theory/experiment comparison of 25 δ * and (C8/F) ept show that these spectral indices are in general slightly overpredicted, thus suggesting that the thermal fission cross section of 235 U might be a little bit underestimated
IRPhE-HTR-ARCH-01, Archive of HTR Primary Documents
International Nuclear Information System (INIS)
2004-01-01
Description: High Temperature Reactor Studies, including experiments in critical facilities or in prototypes have been carried out in the past. Information gathered, experience gained and experimental data produced are of value for the development of future advanced HTRs. For the purpose of knowledge, competence, information preservation and management, computer readable archives have been established. The present archive includes several relevant documents relative to the following: - Graphite Moderated Critical Facility, CESAR at Cadarache. Dragon Countries Physics Meetings (DCPM); - OTTO Pebble Bed Reactors; - Gulf - HTGR Experiments; - Zero Power MARIUS Reactor; - Pebble-bed KAHTER Critical Facility; - Helium Cooled Fast Reactor Assessment Studies; - Gas Cooled Reactor Technology Safety and Siting; - Initial Evaluation of the Gas-Turbine Modules HTGCR; - A report on Nuclear Graphite; - AVR Reactor Juelich (new in version 02); - HTR IAEA proceedings (new in version 02); - Studies at IRI Delft(new in version 02); - Studies and experiments at PSI Villigen (new in version 02); 2 - Related or auxiliary information: IRPHE-DRAGON-DPR, high Temperature Reactor Dragon Project, Primary Documents NEA-1726/01. 3 - Software requirements: Acrobat Reader, Microsoft Word, HTML Browser required
Heck, E. J.; Owsley, B.; Henebry, G. M.; de Beurs, K.
2017-12-01
Since the beginning of the MODIS data record in 2000, several improvements have been made to all available products. Currently, the MODIS community is in the process of completing the roll out of collection 6. While the community takes great interest in data continuity models, less attention has been given to how the changes that are carried out between collections impact the findings of earlier analyses. Here, we assess differences between change detection results from Collection 005 and 006 of the Nadir BRDF-Adjusted Reflectance product (MCD43), the Gridded Vegetation Indices product (MOD13) and the Land Surface Temperature product (MOD11), all at 0.05-degree resolution across the Western Hemisphere. We applied the non-parametric Seasonal-Kendall trend test to time series from C005 and C006 to identify areas of significant change during the period 2001-2016. We analyzed the significant trends and the differences between collections by country, by IGBP land cover class, and by the Human Impact Index category. Preliminary results from the MOD13 product indicate agreement between C005 and C006 for 65% of the pixels when investigating EVI trends and 74% of the pixels when investigating NDVI trends. Only 1% of the pixels reveal a full disagreement in the signal of the significance trends, e.g. negative trend in C005 paired with a positive trend in C006. Though the percentage of complete reversal is low, there are variations of discrepancies between collections that are consistent between both the MOD13 and MCD43 products. For example, while almost 18% of the pixels revealed a significant browning in C005, only 5.80% of the pixels revealed significant browning in both collections. We found that 11% of the pixels with significant browning in C005, were stable in C006. Vice versa, we found that 19.18% of all pixels revealed a significant positive trend in C006 while these pixels were stable in C005. Even though C006 reveals more than double the percentage of positive
Institute of Scientific and Technical Information of China (English)
康凯; 郭伟; 吴诗其
2002-01-01
Mobility management is one of the key problems in the mobile communication techniques. The performance of the mobile communication networks is heavily depended on the effectiveness of the mobility management. In this paper, we have presented a protocol of the mobility management in the mobile IP networks, based on the distributed RSs. When the mobile user in the inactive connection handoffs, some pointers are constructed and modified by the RSs and routers. It can realize the local registration; only when a call arrives, the possible update operations of the mobile database are needed. Consequently, the access of the RS is limited, and the cost of the mobility management is also reduced.
Survey of 0.1- to 16-keV/e plasma sheet ion composition
International Nuclear Information System (INIS)
Lennartsson, W.; Shelley, E.G.
1986-01-01
A large statistical survey of the 0.1- to 16-keV/e plasma sheet ion composition has been carried out using data obtained by the Plasma Composition Experiment on ISEE 1 between 10 and 23 R/sub E/ during 1978 and 1979. This survey includes more than 10 times the quantity of data used in earlier studies of the same topic and makes it possible to investigate in finer detail the relationship between the ion composition and the substorm activity. The larger data base also makes it possible for the first time to study the spatial distribution of the principal ion species. As found in previous studies, the ion composition has a large variance at any given value of the AE index, but a number of distinct trends emerge when the data are averaged at each activity level. During quiet conditions the plasma sheet is dominated by ions of solar origin (H + and He ++ ), as found in earlier studies, and these ions are most numerous during extended periods of very low activity (AE< or approx. =30 γ). The quiet time density of these ions is particularly large in the flanks of the plasma sheet (GSM Yapprox. +- 10 R/sub E/), where it is about twice as large as it is near the central axis of the plasma sheet (Y = Z = 0). In contrast, the energy of these ions peaks near the central axis
2012-12-26
..., Requirement R11), but for other reasons (e.g., ``for consistency purposes, a change in UFLS scheme philosophy... for any action that may have a significant adverse effect on the human environment.\\38\\ The Commission... the human environment. Included in the exclusion are rules that are clarifying, corrective, or...
Flex-prints for the Mu3e experiment
Energy Technology Data Exchange (ETDEWEB)
Dittmeier, Sebastian [Physikalisches Institut, Universitaet Heidelberg (Germany); Collaboration: Mu3e-Collaboration
2016-07-01
Mu3e is a novel experiment dedicated to the search for the charged lepton flavor violating decay μ{sup +} → e{sup +}e{sup -}e{sup +} with a targeted sensitivity of a branching ratio (BR) down to 10{sup -16}. Within the standard model of particle physics this process is extremely suppressed to BR<10{sup -54}. Thus, any observation would be a clear sign for new physics beyond the standard model. The Mu3e detector consists of a silicon pixel tracking detector using the novel HV-MAPS (High Voltage Monolithic Active Pixel Sensor) technology to measure the momentum of the decay products, and scintillating fibres and tiles for precise timing. The pixel sensors are thinned to 50 μ m to achieve a material budget of about 0.1% radiation length per tracking layer. The pixel sensors are powered and connected to readout frontend boards using custom designed flex-prints, which are low material interconnects with a high signal density. We present studies of high speed data transmission up to 3.2 Gb/s over flex-print prototypes produced in-house. The design of the flex-prints for the Mu3e detector will be discussed. A 3-layer design including power, ground and slow control distribution, as well as 9 1.25 Gb/s data transmission lines for the readout of the pixel sensors is foreseen.
Directory of Open Access Journals (Sweden)
Cristina Meléndez Frigola
2016-01-01
Full Text Available Fundamentos: Es necesario profundizar en el conocimiento del conjunto mínimo básico de datos (CMBD-RSS de la línea sociosanitaria de pacientes subagudos (con patología crónica asociada y frecuentes ingresos. El objetivo de este estudio fue conocer las características sanitarias de este tipo de pacientes. Métodos: Muestra de 660 pacientes que ingresaron en camas de subagudos del Hospital Santa Caterina (Región Sanitaria Girona, de octubre de 2013 a diciembre de 2014. La fuente de información fue el CMBD-RSS. Se realizó análisis estadístico descriptivo y se verificó la relación entre variables: número de días de estancia y edad, procedencia del paciente y días de estancia (Significación de Mann-Whitney; diagnóstico principal y días de estancia (Kruskal-Wallis. Se contrastaron la procedencia y el diagnóstico principal mediante χ2 de Pearson y el coeficiente V de Cramer. Resultados: La edad media de las personas de la muestra fue de 83 años, el 55% eran mujeres. Los cinco grupos de enfermedades que concentraron el 80% de los diagnósticos de los pacientes fueron trastorno mental, enfermedades del sistema nervioso, cardiovasculares, respiratoria e infecciones genitourinarias. Los pacientes que procedieron del hospital, tuvieron una estancia media 8 días inferior a los procedentes de domicilio (9 días. En el 80% de los casos se retornó al domicilio al alta. Conclusiones: Las personas con patología crónica asociada con frecuentes ingresos hospitalarios configuran un grupo de riesgo importante. La elevada edad y la descompensación clínica añaden complejidad. Una correcta valoración del paciente al inicio del episodio facilita la asignación del recurso más adecuado. En la muestra estudiada se plasman las patologías más prevalentes, la procedencia, la estancia media y el destino al alta.
Target Tracking with Sensor Navigation Using Coupled RSS and AoA Measurements
Directory of Open Access Journals (Sweden)
Slavisa Tomic
2017-11-01
Full Text Available This work addresses the problem of tracking a signal-emitting mobile target in wireless sensor networks (WSNs with navigated mobile sensors. The sensors are properly equipped to acquire received signal strength (RSS and angle of arrival (AoA measurements from the received signal, while the target transmit power is assumed not known. We start by showing how to linearize the highly non-linear measurement model. Then, by employing a Bayesian approach, we combine the linearized observation model with prior knowledge extracted from the state transition model. Based on the maximum a posteriori (MAP principle and the Kalman filtering (KF framework, we propose new MAP and KF algorithms, respectively. We also propose a simple and efficient mobile sensor navigation procedure, which allows us to further enhance the estimation accuracy of our algorithms with a reduced number of sensors. Model flaws, which result in imperfect knowledge about the path loss exponent (PLE and the true mobile sensors’ locations, are taken into consideration. We have carried out an extensive simulation study, and our results confirm the superiority of the proposed algorithms, as well as the effectiveness of the proposed navigation routine.
e-Learning Continuance Intention: Moderating Effects of User e-Learning Experience
Lin, Kan-Min
2011-01-01
This study explores the determinants of the e-learning continuance intention of users with different levels of e-learning experience and examines the moderating effects of e-learning experience on the relationships among the determinants. The research hypotheses are empirically validated using the responses received from a survey of 256 users. The…
E-Learning Experiences of Hong Kong Students
J. Lam; R. Chan
2013-01-01
The adoption of e-learning in Hong Kong has been increasing rapidly in the past decade. To understand the e-learning experiences of the students, the School of Professional and Continuing Education of The University of Hong Kong conducted a survey. The survey aimed to collect students- experiences in using learning management system, their perceived e-learning advantages, barriers in e-learning and preferences in new e-learning development. A questionnaire with 84 questio...
Angular analysis of the $B^0 \\rightarrow K^{*0} e^+ e^-$ decay in the low-$q^2$ region
Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casanova Mohr, Raimon; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew Christopher; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Domenico, Antonio; Di Ruscio, Francesco; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gastaldi, Ugo; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lowdon, Peter; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skillicorn, Ian; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Sterpka, Christopher Francis; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viana Barbosa, Joao Vitor; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wiedner, Dirk; Wilkinson, Guy; Wilkinson, Michael; Williams, Matthew; Williams, Mike; Wilschut, Hans; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang
2015-04-14
An angular analysis of the $B^0 \\rightarrow K^{*0} e^+ e^-$ decay is performed using a data sample, corresponding to an integrated luminosity of 3.0 ${\\mbox{fb}^{-1}}$, collected by the LHCb experiment in $pp$ collisions at centre-of-mass energies of 7 and 8 TeV during 2011 and 2012. For the first time several observables are measured in the dielectron mass squared ($q^2$) interval between 0.002 and 1.120${\\mathrm{\\,Ge\\kern -0.1em V^2\\!/}c^4}$. The angular observables $F_{\\mathrm{L}}$ and $A_{\\mathrm{T}}^{\\mathrm{Re}}$ which are related to the $K^{*0}$ polarisation and to the lepton forward-backward asymmetry, are measured to be $F_{\\mathrm{L}}= 0.16 \\pm 0.06 \\pm0.03$ and $A_{\\mathrm{T}}^{\\mathrm{Re}} = 0.10 \\pm 0.18 \\pm 0.05$, where the first uncertainty is statistical and the second systematic. The angular observables $A_{\\mathrm{T}}^{(2)}$ and $A_{\\mathrm{T}}^{\\mathrm{Im}}$ which are sensitive to the photon polarisation in this $q^2$ range, are found to be $A_{\\mathrm{T}}^{(2)} = -0.23 \\pm 0.23 \\pm 0.05$ a...
Efficacy of RTS,S/AS01E vaccine against malaria in children 5 to 17 months of age
DEFF Research Database (Denmark)
Bejon, Philip; Lusingu, John; Olotu, Ally
2008-01-01
. We evaluated the efficacy of RTS,S given with a more immunogenic adjuvant system (AS01E) in children 5 to 17 months of age, a target population for vaccine licensure. METHODS: We conducted a double-blind, randomized trial of RTS,S/AS01E vaccine as compared with rabies vaccine in children in Kilifi...... vaccine or the control (rabies) vaccine. Among the 809 children who completed the study procedures according to the protocol, the cumulative number in whom clinical malaria developed was 32 of 402 assigned to receive RTS,S/AS01E and 66 of 407 assigned to receive the rabies vaccine; the adjusted efficacy...... rate for RTS,S/AS01E was 53% (95% confidence interval [CI], 28 to 69; Prabies vaccine, with an adjusted rate of efficacy...
0.1–2000 eV electron impact cross sections for dichlorine monoxide
Energy Technology Data Exchange (ETDEWEB)
Goswami, Biplab; Gupta, Dhanoj; Antony, Bobby, E-mail: bka.ism@gmail.com
2014-03-01
Highlights: • Quantum mechanical models were used to find TCS for e-Cl{sub 2}O from 0.1 to 2000 eV. • R-matrix method at low energies (<13 eV) and SCOP at high energies (13–2000 eV). • Besides TCS, DCS, excitation cross section and momentum transfer CS also predicted. • R-matrix method identifies resonances with a possibility of DEA formation. • Resonance detected at 1.88 eV is associated with Cl{sub 2}O{sup −} anion formation. - Abstract: Scattering dynamics of dichlorine monoxide (Cl{sub 2}O) molecule by electron impact is investigated as a function of electron energy and scattering angle. Electron impact total cross sections for Cl{sub 2}O over an extensive range of impact energies from 0.1 to 2000 eV are reported in this article. Below the ionization threshold of the target, the ab initio R-matrix method and above this incident energy spherical complex optical potential formalism are used for cross section calculation. The total cross section obtained from both theories merges smoothly at the overlapping energy. The resonances obtained using DZP basis sets are located at 1.883, 3.592, 5.205 and 7.326, 8.206, 8.301, 8.452, 9.369 eV and that with 6-31G* basis sets are identified at 1.944, 3.566, 5.183, 5.261, 5.658, 8.738 and 9.187 eV with the possibility of negative ions formation. This is the first attempt to calculate the differential, and momentum transfer cross sections for Cl{sub 2}O molecule.
BOREAS RSS-15 SIR-C and Landsat TM Biomass and Landcover Maps of the NSA
Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Ranson, K. Jon
2000-01-01
As part of BOREAS, the RSS-15 team conducted an investigation using SIR-C, X-SAR, and Landsat TM data for estimating total above-ground dry biomass for the SSA and NSA modeling grids and component biomass for the SSA. Relationships of backscatter to total biomass and total biomass to foliage, branch, and bole biomass were used to estimate biomass density across the landscape. The procedure involved image classification with SAR and Landsat TM data and development of simple mapping techniques using combinations of SAR channels. For the SSA, the SIR-C data used were acquired on 06-Oct-1994, and the Landsat TM data used were acquired on 02-Sep-1995. The maps of the NSA were developed from SIR-C data acquired on 13-Apr-1994. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
Efficacy of RTS,S/AS01E Vaccine against Malaria in Children 5 to 17 Months of Age
Bejon, Philip; Lusingu, John; Olotu, Ally; Leach, Amanda; Lievens, Marc; Vekemans, Johan; Mshamu, Salum; Lang, Trudie; Gould, Jayne; Dubois, Marie-Claude; Demoitié, Marie-Ange; Stallaert, Jean-Francois; Vansadia, Preeti; Carter, Terrell; Njuguna, Patricia; Awuondo, Ken O.; Malabeja, Anangisye; Abdul, Omar; Gesase, Samwel; Mturi, Neema; Drakeley, Chris J.; Savarese, Barbara; Villafana, Tonya; Ballou, W. Ripley; Cohen, Joe; Riley, Eleanor M.; Lemnge, Martha M.; Marsh, Kevin; von Seidlein, Lorenz
2009-01-01
BACKGROUND Plasmodium falciparum malaria is a pressing global health problem. A previous study of the malaria vaccine RTS,S (which targets the circumsporozoite protein), given with an adjuvant system (AS02A), showed a 30% rate of protection against clinical malaria in children 1 to 4 years of age. We evaluated the efficacy of RTS,S given with a more immunogenic adjuvant system (AS01E) in children 5 to 17 months of age, a target population for vaccine licensure. METHODS We conducted a double-blind, randomized trial of RTS,S/AS01E vaccine as compared with rabies vaccine in children in Kilifi, Kenya, and Korogwe, Tanzania. The primary end point was fever with a falciparum parasitemia density of more than 2500 parasites per microliter, and the mean duration of follow-up was 7.9 months (range, 4.5 to 10.5). RESULTS A total of 894 children were randomly assigned to receive the RTS,S/AS01E vaccine or the control (rabies) vaccine. Among the 809 children who completed the study procedures according to the protocol, the cumulative number in whom clinical malaria developed was 32 of 402 assigned to receive RTS,S/AS01E and 66 of 407 assigned to receive the rabies vaccine; the adjusted efficacy rate for RTS,S/AS01E was 53% (95% confidence interval [CI], 28 to 69; P<0.001) on the basis of Cox regression. Overall, there were 38 episodes of clinical malaria among recipients of RTS,S/AS01E, as compared with 86 episodes among recipients of the rabies vaccine, with an adjusted rate of efficacy against all malarial episodes of 56% (95% CI, 31 to 72; P<0.001). All 894 children were included in the intention-to-treat analysis, which showed an unadjusted efficacy rate of 49% (95% CI, 26 to 65; P<0.001). There were fewer serious adverse events among recipients of RTS,S/AS01E, and this reduction was not only due to a difference in the number of admissions directly attributable to malaria. CONCLUSIONS RTS,S/AS01E shows promise as a candidate malaria vaccine. (ClinicalTrials.gov number, NCT
Angular analysis of the $B^0 \\to K^{*0} e^+ e^-$ decay in the low-$q^2$ region at LHCb
Borsato, Martino
2015-01-01
An angular analysis of the $B^0 \\rightarrow K^{*0} e^+ e^-$ decay is performed using a data sample, corresponding to an integrated luminosity of 3.0${\\mbox {fb}^{-1}}$, collected by the LHCb experiment in $pp$ collisions at centre-of-mass energies of 7 and 8 TeV during 2011 and 2012. For the first time several observables are measured in the dielectron mass squared ($q^2$) interval between 0.002 and 1.120${\\mathrm{\\,Ge\\kern -0.1em V^2\\!/}c^4}$. The angular observables $F_{\\mathrm{L}}$ and $A_{\\mathrm{T}}^{\\mathrm{Re}}$ which are related to the \\Kstarz polarisation and to the lepton forward-backward asymmetry, are measured to be $F_{\\mathrm{L}}= 0.16 \\pm 0.06 \\pm0.03$ and $A_{\\mathrm{T}}^{\\mathrm{Re}} = 0.10 \\pm 0.18 \\pm 0.05$, where the first uncertainty is statistical and the second systematic. The angular observables $A_{\\mathrm{T}}^{(2)}$ and $A_{\\mathrm{T}}^{\\mathrm{Im}}$ which are sensitive to the photon polarisation in this $q^2$ range, are found to be $A_{\\mathrm{T}}^{(2)} = -0.23 \\pm 0.23 \\pm...
Directory of Open Access Journals (Sweden)
Tao Zhang
2015-01-01
Full Text Available The high piezoelectricity and high quality factor ferroelectric thin films are important for electromechanical applications especially the micro electromechanical system (MEMS. The ternary compound ferroelectric thin films 0.06Pb(Mn1/3, Nb2/3O3 + 0.94Pb(Zr0.45, Ti0.55O3 (0.06PMnN-0.94PZT(45/55 were deposited on silicon(100 substrates by RF magnetron sputtering method considering that Mn and Nb doping will improve PZT properties in this research. For comparison, nondoped PZT(45/55 films were also deposited. The results show that both of thin films show polycrystal structures with the main (111 and (101 orientations. The transverse piezoelectric coefficients are e31,eff=−4.03 C/m2 and e31,eff=-3.5 C/m2, respectively. These thin films exhibit classical ferroelectricity, in which the coercive electric field intensities are 2Ec=147.31 kV/cm and 2Ec=135.44 kV/cm, and the saturation polarization Ps=30.86 μC/cm2 and Ps=17.74 μC/cm2, and the remnant polarization Pr=20.44 μC/cm2 and Pr=9.87 μC/cm2, respectively. Moreover, the dielectric constants and loss are εr=681 and D=5% and εr=537 and D=4.3%, respectively. In conclusion, 0.06PMnN-0.94PZT(45/55 thin films act better than nondoped films, even though their dielectric constants are higher. Their excellent ferroelectricity, piezoelectricity, and high power and energy storage property, especially the easy fabrication, integration realizable, and potentially high quality factor, make this kind of thin films available for the realistic applications.
2013-07-22
... titled, ``Department of Homeland Security/Federal Emergency Management Agency--006 Citizen Corps Database... DEPARTMENT OF HOMELAND SECURITY Office of the Secretary [Docket No. DHS-2013-0049] Privacy Act of 1974; Department of Homeland Security, Federal Emergency Management Agency--006 Citizen Corps Program...
Calcioferrite with composition (Ca3.94Sr0.06Mg1.01(Fe2.93Al1.07(PO46(OH4·12H2O
Directory of Open Access Journals (Sweden)
Barbara Lafuente
2014-03-01
Full Text Available Calcioferrite, ideally Ca4MgFe3+4(PO46(OH4·12H2O (tetracalcium magnesium tetrairon(III hexakis-phosphate tetrahydroxide dodecahydrate, is a member of the calcioferrite group of hydrated calcium phosphate minerals with the general formula Ca4AB4(PO46(OH4·12H2O, where A = Mg, Fe2+, Mn2+ and B = Al, Fe3+. Calcioferrite and the other three known members of the group, montgomeryite (A = Mg, B = Al, kingsmountite (A = Fe2+, B = Al, and zodacite (A = Mn2+, B = Fe3+, usually occur as very small crystals, making their structure refinements by conventional single-crystal X-ray diffraction challenging. This study presents the first structure determination of calcioferrite with composition (Ca3.94Sr0.06Mg1.01(Fe2.93Al1.07(PO46(OH4·12H2O based on single-crystal X-ray diffraction data collected from a natural sample from the Moculta quarry in Angaston, Australia. Calcioferrite is isostructural with montgomeryite, the only member of the group with a reported structure. The calcioferrite structure is characterized by (Fe/AlO6 octahedra (site symmetries 2 and -1 sharing corners (OH to form chains running parallel to [101]. These chains are linked together by PO4 tetrahedra (site symmetries 2 and 1, forming [(Fe/Al3(PO43(OH2] layers stacking along [010], which are connected by (Ca/Sr2+ cations (site symmetry 2 and Mg2+ cations (site symmetry 2; half-occupation. Hydrogen-bonding interactions involving the water molecules (one of which is equally disordered over two positions and OH function are also present between these layers. The relatively weaker bonds between the layers account for the cleavage of the mineral parallel to (010.
Zhao, Hui; Fang, Yu; Wang, Xiaoyuan; Zhao, Lei; Wang, Jianli; Li, Ye
2018-04-30
L-threonine is an important amino acid that can be added in food, medicine, or feed. Here, the influence of glyoxylate shunt on an L-threonine producing strain Escherichia coli TWF001 has been studied. The gene iclR was deleted, and the native promoter of the aceBA operon was replaced by the trc promoter in the chromosome of TWF001, the resulting strainTWF004 could produce 0.39 g L-threonine from1 g glucose after 36-h flask cultivation. Further replacing the native promoter of aspC by the trc promoter in the chromosome of TWF004 resulted in the strain TWF006. TWF006 could produce 0.42 g L-threonine from 1 g glucose after 36-h flask cultivation. Three key genes in the biosynthetic pathway of L-threonine, thrA * (a mutated thrA), thrB, and thrC were overexpressed in TWF006, resulting the strain TWF006/pFW01-thrA * BC. TWF006/pFW01-thrA * BC could produce 0.49 g L-threonine from 1 g glucose after 36-h flask cultivation. Next, the genes asd, rhtA, rhtC, or thrE were inserted into the plasmid TWF006/pFW01-thrA * BC, and TWF006 was transformed with these plasmids, resulting the strains TWF006/pFW01-thrA * BC-asd, TWF006/pFW01-thrA * BC-rhtA, TWF006/pFW01-thrA * BC-rhtC, and TWF006/pFW01-thrA * BC-thrE, respectively. These four strains could produce more L-threonine than the control strain, and the highest yield was produced by TWF006/pFW01-thrA * BC-asd; after 36-h flask cultivation, TWF006/pFW01-thrA * BC-asd could produce 15.85 g/l L-threonine, i.e., 0.53 g L-threonine per 1 g glucose, which is a 70% increase relative to the control strain TWF001. The results suggested that the combined engineering of glyoxylate shunt and L-threonine biosynthesis pathway could significantly increase the L-threonine production in E. coli.
0084-.pdf | 01 | 006 | reso | Volumes | public | Indian Academy of ...
Indian Academy of Sciences (India)
SPEAKER: Prof. Krishnaswamy Ravi-Chandar. VENUE: Faculty Hall, Indian Institute of Science. 23 February 2018 ǀ 1500. Event poster · Introducing: Summer Schools. Posted on 21 December 2017. ASTROPHYSICS: An Observational View of the Universe. Math Art and Design: MAD about Math, Math Education and ...
0084-0088;.pdf | 01 | 006 | reso | Volumes | public | Indian Academy ...
Indian Academy of Sciences (India)
error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the Three Science Academies of India on the teaching of the theory of evolution
CRED Gridded Bathymetry near Laysan Island (100-006), Northwestern Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — File 100-006b is a 60-m ASCII grid of depth data collected near Laysan Island in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as...
Chukanov, A; Popov, B; Astier, Pierre; Autiero, D; Baldisseri, Alberto; Baldo-Ceolin, M; Banner, M; Bassompierre, G; Benslama, K; Besson, N; Bird, I; Blumenfeld, B; Bobisut, F; Bouchez, J; Boyd, S; Bueno, A; Bunyatov, S; Camilleri, L L; Cardini, A; Cattaneo, P W; Cavasinni, V; Cervera-Villanueva, A; Challis, R; Collazuol, G; Conforto, G; Conta, C; Contalbrigo, M; Cousins, R; Daniels, D; Degaudenzi, H M; Del Prete, T; De Santo, A; Dignan, T; Di Lella, L; Do Couto e Silva, E; Dumarchez, J; Ellis, M; Feldman, G J; Ferrari, R; Ferrère, D; Flaminio, V; Fraternali, M; Gaillard, J M; Gangler, E; Geiser, A; Geppert, D; Gibin, D; Gninenko, S; Godley, A; Gómez-Cadenas, J J; Gosset, J; Gössling, C; Gouanère, M; Grant, A; Graziani, G; Guglielmi, A M; Hagner, C; Hernando, J; Hubbard, D; Hurst, P; Hyett, N; Iacopini, E; Joseph, C; Juget, F; Kent, N; Kirsanov, M; Klimov, O; Kokkonen, J; Kovzelev, A; Krasnoperov, A V; Lacaprara, S; Lachaud, C; Lakic, B; Lanza, A; La Rotonda, L; Laveder, M; Letessier-Selvon, A A; Lévy, J M; Linssen, Lucie; Ljubicic, A; Long, J; Lupi, A; Lyubushkin, V; Marchionni, A; Martelli, F; Méchain, X; Mendiburu, J P; Meyer, J P; Mezzetto, Mauro; Mishra, S R; Moorhead, G F; Nédélec, P; Nefedov, Yu; Nguyen-Mau, C; Orestano, D; Pastore, F; Peak, L S; Pennacchio, E; Pessard, H; Petti, R; Placci, A; Polesello, G; Pollmann, D; Polyarush, A Yu; Poulsen, C; Rebuffi, L; Renò, R; Rico, J; Riemann, P; Roda, C; Rubbia, André; Salvatore, F; Samoylov, O; Schahmaneche, K; Schmidt, B; Schmidt, T; Sconza, A; Sevior, M; Sillou, D; Soler, F J P; Sozzi, G; Steele, D; Stiegler, U; Stipcevic, M; Stolarczyk, T; Tareb-Reyes, M; Taylor, G N; Tereshchenko, V V; Toropin, A; Touchard, A M; Tovey, Stuart N; Tran, M T; Tsesmelis, E; Ulrichs, J; Vacavant, L; Valdata-Nappi, M; Valuev, V; Vannucci, F; Varvell, K E; Veltri, M; Vercesi, V; Vidal-Sitjes, G; Vieira, J M; Vinogradova, T; Weber, F V; Weisse, T; Wilson, F F; Winton, L J; Yabsley, B D; Zaccone, Henri; Zei, R; Zuber, K; Zuccon, P
2006-01-01
First measurements of K*(892) mesons production properties and their spin alignment in nu_mu charged current (CC) and neutral current (NC) interactions are presented. The analysis of the full data sample of the NOMAD experiment is performed in different kinematic regions. For K*+ and K*- mesons produced in nu_mu CC interactions and decaying into K0 pi+/- we have found the following yields per event: (2.6 +/- 0.2 (stat.) +/- 0.2 (syst.))% and (1.6 +/- 0.1 (stat.) +/- 0.1 (syst.))% respectively, while for the K*+ and K*- mesons produced in nu NC interactions the corresponding yields per event are: (2.5 +/- 0.3 (stat.) +/- 0.3 (syst.))% and (1.0 +/- 0.3 (stat.) +/- 0.2 (syst.))%. The results obtained for the rho00 parameter, 0.40 +/- 0.06 (stat) +/- 0.03 (syst) and 0.28 +/- 0.07 (stat) +/- 0.03 (syst) for K*+ and K*- produced in nu_mu CC interactions, are compared to theoretical predictions tuned on LEP measurements in e+e- annihilation at the Z0 pole. For K*+ mesons produced in nu NC interactions the measured r...
On-line experience with the 168/E
International Nuclear Information System (INIS)
Carroll, J.T.; Brau, J.E.; Maruyama, T.; Parker, D.B.; Chima, J.S.; Price, D.R.; Rankin, P.; Hatley, R.W.
1981-04-01
Current 20 GeV/c photoproduction experiments at the SLAC Hybrid Facility require a decision to take a picture within 150 to 300 μs after the beam pulse. A charged track trigger is provided by a 168/E processor which finds tracks in a downstream PWC system. To meet trigger time requirements the 168/E SNOOP module CAMAC interface is augmented by a CAMAD Auxiliary Controller and dedicated I/0 cards in the 168/E chassis. Between beam pulses a floating point Fortran program executing on a 168/E monitors data acquisition. Experiences with software development and application are reviewed
Tecnologia, experiência e memória
Directory of Open Access Journals (Sweden)
Aécio Amaral Jr
2006-10-01
Full Text Available O artigo investiga a estruturação de uma nova cultura de memória, a qual inverte a lógica metafísica com que se pensou a relação entre tecnologia e experiência nas ciências sociais. Com as recentes tecnologias da vida e da informação, a concepção do corpo humano como algo que se constitui à margem de um aparato tecnológico declina em credibilidade. Com isso, um dos principais projetos da metafísica ocidental, a saber, a estruturação de um campo de experiência e conhecimento livre de suportes técnicos, malogra em seu humanismo tecnofóbico. A partir de uma apreciação do conto Memento Mori, de Jonathan Nolan, e do filme Amnésia, de Christopher Nolan, analiso a relação entre memória e escritura, corpo e arquivo na contemporaneidade. O objetivo é perceber as tensões e oscilações implícitas na tentativa de instauração de uma mnemotécnica pretensamente pós-humana ou pós-orgânica. Palavras-chave: tecnologia; experiência; memória; humanismo; pós-humanismo.
Mu2e, a coherent μ → e conversion experiment at Fermilab
International Nuclear Information System (INIS)
Brown, D. N.
2012-01-01
We describe a proposed experiment to search for Charged Lepton Flavor Violation (CLFV) using stopped muons at Fermilab. A primary Proton beam will strike a gold target, producing pions which decay to muons. Low-momentum negative muons will be collected, selected, and transported by a custom arrangement of solenoidal magnets and collimators. Muons will stop in thin foil targets, creating muonic atoms with significant nuclear overlap. Mu2e will search for the coherent conversion of nuclear bound muons to electrons, with an experimental signature of a single mono-energetic electron. Conversion electrons will be detected and measured in a low-mass straw tracker and a crystal calorimeter. Mu2e will have a sensitivity four orders of magnitude better than the most sensitive published result for μ → e conversion, and will have complementary physics reach to LHC experiments and μ → eγ decay experiments such as MEG.
Making a Case for E - learning: Experiences in E-learning at ...
African Journals Online (AJOL)
Making a Case for E - learning: Experiences in E-learning at Langston University ... performances can surpass those of students in traditional learning settings. ... The research method was qualitative based mainly on participatory and ...
Ramli, Rindra M.
2014-01-01
This paper aims to explore and study the current usage trends of Web2.0 namely Facebook, RSS, Blogs and Twitter among selected higher education institutions’ libraries in 6 gulf countries namely: Kingdom of Saudi Arabia, United Arab Emirates, Qatar
Antropologia e filosofia: estética e experiência em Clifford Geertz e Walter Benjamin
Directory of Open Access Journals (Sweden)
Relivaldo Pinho de Oliveira
2012-06-01
Full Text Available Este artigo estuda as concepções de estética e experiência de Clifford Geertz e Walter Benjamin como possibilidades argumentativas e metodológicas para pensar a realidade e suas formas estéticas. Utiliza-se para isso as discussões metodológicas de Geertz, especialmente a respeito do lugar da estética e de sua relação com os demais âmbitos do humano, que encetaram uma nova forma de concebê-los para a etnografia e antropologia de modo geral, e os estudos de Benjamin a respeito da estética como expressão fisionômica de uma época, de determinada realidade, especialmente os que se referem sobre a modernidade. Constata-se essa possibilidade a partir da observação de que a estética e a experiência, nos autores, são tomadas como dimensões da realidade que se relacionam, não de modo mecânico, e sim como âmbitos que atravessam a realidade, os artefatos estéticos, os discursos, e esses assim devem ser observados.This article study the conceptions of aesthetics and experience of Clifford Geertz and Walter Benjamin as argumentative and methodological possibilities for thinking reality and its aesthetic forms. Uses for this Geertz's methodological discussions, especially regarding the place of aesthetics and its relation to other spheres of the human, which has embarked on a new way of conceiving them to ethnography and anthropology in general, and studies Benjamin about the aesthetics and physiognomical expression of an era, a certain reality, especially those concerning about modernity. There is that possibility from the observation that the aesthetics and experience, in the authors, are taken as the dimensions of reality are related, not mechanically, but as areas that cross the reality, the aesthetic artifacts, the speeches, and so these must be observed.
Experience Effect in E-Learning Research
Wu, Bing; Xu, WenXia; Ge, Jun
This study is a productivity review on the literature gleaned from SSCI, SCIE databases concerning experience in E-Learning research. The result indicates that the number of literature productions on experience effect in ELearning research is still growing from 2005. The main research development country is Croatia, and from the analysis of the publication year, the number of papers is increasing to the peaking in 2010. And the main source title is British Journal of Educational Technology. In addition the subject area concentrated on Education & Educational Research. Moreover the research focuses on are mainly survey research and empirical research, in order to explore experience effect in E-Learning research. Also the limitations and future research of these research were discussed, so that the direction for further research work can be exploited
Comptia Network+ review guide exam N10-006
Ferguson, Bill
2015-01-01
Be prepared for the Network+ exam CompTIA Network+ Review Guide is your ideal study companion for preparing for the CompTIA Network+ exam (N10-006). This concise review is the perfect companion to the CompTIA Network+ Study Guide and the CompTIA Network+ Deluxe Study Guide, with full exam coverage organized by objective for quick review and reinforcement of key topics. Each of the book's five parts is devoted to a specific domain area of the exam, providing a focused review to bolster areas of weak understanding. You get access to the Sybex test engine, which includes two bonus practice tests
Kinetic studies of co-pyrolysis of rubber seed shell with high density polyethylene
International Nuclear Information System (INIS)
Chin, Bridgid Lai Fui; Yusup, Suzana; Al Shoaibi, Ahmed; Kannan, Pravin; Srinivasakannan, Chandrasekar; Sulaiman, Shaharin Anwar
2014-01-01
Highlights: • Co-pyrolysis of biomass and plastic waste in thermogravimetric analyzer. • Investigation of thermal degradation behavior in different feedstocks. • Synergistic effect of the biomass and plastic waste mixture is investigated. • Kinetic parameters using one step integral method are determined. - Abstract: This paper investigates the thermal degradation behavior of rubber seed shell (RSS), high density polyethylene (HDPE), and the HDPE/RSS mixtures (0.2:0.8 weight ratio) using thermogravimetric analyzer under non-isothermal condition in argon atmosphere at flowrate of 100 ml min −1 . Cellulose, hemicellulose, and lignin are also analyzed in this study for comparison of pyrolysis behavior with RSS. The experiments were conducted at different heating rates of 10, 20, 30, and 50 K min −1 in the temperature range of 323–1173 K. The kinetic data is generated based on first order rate of reaction. It is observed that the thermal degradation behavior of the main components in biomass such as hemicellulose, cellulose, and lignin differs during pyrolysis process due to the structural differences that leads to distinctive pathways of degradation of feedstock. It is found that there are one, two, and three stages of decomposition occurring in HDPE, RSS, and HDPE/RSS mixtures respectively during the pyrolysis process. The remaining solid residue increases with an increase in heating rate regardless of the type of samples used. The activation energies (E A ) for RSS, HDPE, HDPE/RSS mixtures are 46.94–63.21, 242.13–278.14, and 49.14–83.11 kJ mol −1 respectively for the range of heating rate studied
Heavy reflector experiments in the IPEN/MB-01 reactor
International Nuclear Information System (INIS)
Santos, Adimir dos; Silva, Graciete Simoes de Andrade e; Mura, Luis Felipe; Fuga, Rinaldo; Jerez, Rogerio; Mendonca, Arlindo Gilson
2012-01-01
Full text: The heavy reflector experiments performed in the IPEN/MB-01 research reactor facility comprise a set of critical configurations employing the standard 28x26-fuel-rod configuration. The heavy reflector either Stainless Steel, Carbon Steel or Nickel plates was placed at one of the faces of the IPEN/MB-01 reactor. Criticality is achieved by inserting the control banks BC1 and BC2 to the critical position. 32 plates around 0.3 mm thick were used in the experiment. The chosen distance between last fuel rod row and the first laminate for both type of laminates was 5.5 mm. Considering initially the SS case, the experimental data reveal that the reactivity decreases up to the sixth plate and after that it increases, becomes nearly zero (which was equivalent to initial zero excess reactivity with zero plates) for the 21 plates case and reaches a value of 154.91 pcm when the whole set of 32 plates are inserted in the reflector. This is a very striking result because it demonstrates that when all 32 plates are inserted in the reflector there is a net gain of reactivity. The reactivity behavior demonstrates all the physics events already mentioned in this work. When the number of plates are small (around 6), the neutron absorption in the plates is more important than the neutron reflection and the reactivity decreases. This condition holds up to a point where the neutron reflection becomes more important than the neutron absorption in the plates and the reactivity increases. The experimental data for the Carbon Steel and Nickel case shows the main features of the SS case, but for the Carbon Steel case the reactivity gain is small, thus demonstrating that Carbon Steel or essentially iron has not the reflector capability as the SS laminates do. The measured data of Nickel plates show a higher reactivity gain, thus demonstrating that Nickel is a good reflector. The theoretical analysis employing MCNP5 and ENDF/B-VII.0 show that the SS calculated results are in a good
A measurement of the $\\tau^{-} \\to e^{-} \\overline{\
Abbiendi, G.; Alexander, G.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bock, P.; Bohme, J.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Ciocca, C.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; de Roeck, A.; Dervan, P.; Desch, K.; Dienes, B.; Dixit, M.S.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Estabrooks, P.G.; Etzion, E.; Fabbri, F.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fleck, I.; Folman, R.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Gorn, W.; Grandi, C.; Graham, K.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Harel, A.; Hargrove, C.K.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hobson, P.R.; Hoch, M.; Hocker, James Andrew; Hoffman, Kara Dion; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jimack, M.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kyberd, P.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Lawson, I.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mader, W.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Polok, J.; Przybycien, M.; Rembser, C.; Rick, H.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Sproston, M.; Stahl, A.; Stephens, K.; Steuerer, J.; Stoll, K.; Strom, David M.; Strohmer, R.; Surrow, B.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomas, J.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Ueda, I.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.
1999-01-01
The branching ratio for the decay tau->e nue nutau has been measured using Z0 decay data collected by the OPAL experiment at LEP. In total 33073 tau->e nue nutau candidates were identified from a sample of 186197 selected tau decays, giving a branching ratio of 17.81 +- 0.09(stat) +_ 0.06(sys)%. This result is combined with other measurements to test e-mu and mu-tau universality in charged-current weak interactions. Additionally, the strong coupling constant alpha_s has been extracted and evolved to the Z0 mass scale, giving alpha_s = 0.1204 +- 0.0011(exp) +- 0.0019(theory).
Carbon Monoxide Information Center
Full Text Available ... RSS E-mail Inside CPSC Accessibility Privacy Policy Budget, Performances & Finance Open Government Freedom of Information (FOIA) ... Information Sitemap RSS E-mail Accessibility Privacy Policy Budget & Performance Open Government Freedom of Information (FOIA) USA. ...
Carbon Monoxide Information Center
Full Text Available ... International Newsroom About CPSC Contact Us Sitemap RSS E-mail Inside CPSC Accessibility Privacy Policy Budget, Performances & ... Subscribe to CPSC News and Information Sitemap RSS E-mail Accessibility Privacy Policy Budget & Performance Open Government ...
Carbon Monoxide Information Center
Full Text Available ... Us Sitemap RSS E-mail Inside CPSC Accessibility Privacy Policy Budget, Performances & Finance Open Government Freedom of ... News and Information Sitemap RSS E-mail Accessibility Privacy Policy Budget & Performance Open Government Freedom of Information ( ...
Particle searches in e+e- experiments at PEP and PETRA
International Nuclear Information System (INIS)
Lau, K.H.
1982-10-01
This talk reviews recent results in new particle searches performed by experiments at the high energy e + e - storage rings PEP and PETRA. It concentrates on recent searches for: hadrons with a new quark flavor, spin-1/2 charged heavy leptons, spin-0 charged leptons, spin-0 point-like scalars or pseudoscalars, and neutral heavy leptons
Directory of Open Access Journals (Sweden)
Gemma Moncunill
2017-08-01
Full Text Available Comprehensive assessment of cellular responses to the RTS,S/AS01E vaccine is needed to understand potential correlates and ultimately mechanisms of protection against malaria disease. Cellular responses recognizing the RTS,S/AS01E-containing circumsporozoite protein (CSP and Hepatitis B surface antigen (HBsAg were assessed before and 1 month after primary vaccination by intracellular cytokine staining and 16-color flow cytometry in 105 RTS,S/AS01-vaccinated and 74 rabies-vaccinated participants (controls in a pediatric phase III trial in Africa. RTS,S/AS01E-vaccinated children had significantly higher frequencies of CSP- and HBsAg-specific CD4+ T cells producing IL-2, TNF-α, and CD40L and HBsAg-specific CD4+ T producing IFN-γ and IL-17 than baseline and the control group. Vaccine-induced responses were identified in both central and effector memory (EM compartments. EM CD4+ T cells expressing IL-4 and IL-21 were detected recognizing both vaccine antigens. Consistently higher response rates to both antigens in RTS,S/AS01E-vaccinated than comparator-vaccinated children were observed. RTS,S/AS01E induced polyfunctional CSP- and HBsAg-specific CD4+ T cells, with a greater degree of polyfunctionality in HBsAg responses. In conclusion, RTS,S/AS01E vaccine induces T cells of higher functional heterogeneity and polyfunctionality than previously characterized. Responses detected in memory CD4+ T cell compartments may provide correlates of RTS,S/AS01-induced immunity and duration of protection in future correlates of immunity studies.
Conectividade e Informação: Usabilidade e Mobilidade orientada para User Experience
Directory of Open Access Journals (Sweden)
Antonio Mendes Silva Filho
2012-08-01
Full Text Available Tempo é o bem mais precioso que todo ser humano pode possuir, inclusive para aqueles que pensam nada ter. Adicionalmente, o livre arbítrio de cada ser lhe permite escolher como utilizar esse bem precioso. O ser humano quando envolvido em atividades profissionais ou de lazer buscam otimizar o uso de tempo, que é propiciada pela facilidade através da qual ele(a consegue realizar a atividade. E, se para realizar a atividade, ele requer uso de tecnologias como computador, notebook, iGadgets (como, por exemplo, iPad, iPhone e iPod, TV, DVD player, dentre outros, essa facilidade é oferecida pela usabilidade do produto. Isso é determinante no momento que usuário vai escolher um produto. Preocupar-se com o usuário e prover ele com um produto que tem simplicidade, eficiência e elegância é prover suporte à experiência do usuário. Nesse sentido, este artigo explora e discute como a experiência do usuário (user experience e usabilidade impactam uso e adoção de novas tecnologias.
Directory of Open Access Journals (Sweden)
John Lusingu
2010-11-01
Full Text Available The malaria vaccine candidate, RTS,S/AS01(E, showed promising protective efficacy in a trial of Kenyan and Tanzanian children aged 5 to 17 months. Here we report on the vaccine's safety and tolerability. The experimental design was a Phase 2b, two-centre, double-blind (observer- and participant-blind, randomised (1∶1 ratio controlled trial. Three doses of study or control (rabies vaccines were administered intramuscularly at 1 month intervals. Solicited adverse events (AEs were collected for 7 days after each vaccination. There was surveillance and reporting for unsolicited adverse events for 30 days after each vaccination. Serious adverse events (SAEs were recorded throughout the study period which lasted for 14 months after dose 1 in Korogwe, Tanzania and an average of 18 months post-dose 1 in Kilifi, Kenya. Blood samples for safety monitoring of haematological, renal and hepatic functions were taken at baseline, 3, 10 and 14 months after dose 1. A total of 894 children received RTS,S/AS01(E or rabies vaccine between March and August 2007. Overall, children vaccinated with RTS,S/AS01(E had fewer SAEs (51/447 than children in the control group (88/447. One SAE episode in a RTS,S/AS01(E recipient and nine episodes among eight rabies vaccine recipients met the criteria for severe malaria. Unsolicited AEs were reported in 78% of subjects in the RTS,S/AS01(E group and 74% of subjects in the rabies vaccine group. In both vaccine groups, gastroenteritis and pneumonia were the most frequently reported unsolicited AE. Fever was the most frequently observed solicited AE and was recorded after 11% of RTS,S/AS01(E doses compared to 31% of doses of rabies vaccine. The candidate vaccine RTS,S/AS01(E showed an acceptable safety profile in children living in a malaria-endemic area in East Africa. More data on the safety of RTS,S/AS01(E will become available from the Phase 3 programme.
International Nuclear Information System (INIS)
Zender, S.N.
1975-03-01
Recorded test data are presented for Test S-01-3 of the semiscale Mod-1 isothermal blowdown test series. Test S-01-3 is one of several semiscale Mod-1 experiments which are counterparts of the planned Loss-of-Fluid Test (LOFT) nonnuclear experiments. System hardware is of the LOFT design, selected using volumetric scaling methods, and initial conditions duplicate those identified for the LOFT nonnuclear tests. Test S-01-3 employed an intact loop resistance that was low relative to that of the first test in the series (Test S-01-2) to establish the importance of intact loop resistance on system response during blowdown. An orificed structure was used in the pressure vessel to simulate the LOFT core simulator. The test was initiated at isothermal conditions of 2245 psig and 538 0 F by a simulated offset shear of the cold-leg broken loop piping. During system depressurization, coolant was injected into the lower plenum of the pressure vessel to provide data on the effects of emergency core cooling on system response. Additionally, to aid in determination of the effects of accumulator gas on pressure suppression system response, the nitrogen used to charge the accumulator systems for Test S-01-3 was allowed to vent into the lower plenum following depletion of the coolant. (U.S.)
Torricelli, Andre A M; Santhanam, Abirami; Agrawal, Vandana; Wilson, Steven E
2014-01-01
To perform a masked study to determine whether resolvin E1 (RvE1), a lipid-derived immunomodulator, could regulate the development of corneal haze and opacity-related myofibroblasts after opacity-generating high correction photorefractive keratectomy (PRK) in rabbits. Three groups of eight rabbits each were included in the study. Nine diopter (D) PRK for myopia was performed in each test cornea, and the eyes were treated with 30 µl of topical solution every 4 h (six times a day) for 5 days starting immediately after PRK. Group 1 was treated with 0.1% RX-10045, a prodrug of an RvE1 analog; group 2 was treated with 0.01% RX-10045; and group 3 was treated with vehicle control solution. At 1 month after PRK, haze was graded at the slit-lamp by a masked observer. Immunohistochemistry for α-smooth muscle actin (SMA) was performed on the central cornea of each test eye to determine the anterior stromal myofibroblast density. Corneal opacity was significantly lower in the 0.1% RX-10045 group, but not the 0.01% RX-10045 group, compared to the vehicle control group (p=0.029), at 1 month after -9.0D PRK. At 1 month after -9.0D PRK, SMA+ myofibroblast densities in the anterior stroma were not statistically significantly different among the three groups, although a trend toward lower myofibroblast generation was noted in the 0.1% RX-10045 group. Topical 0.1% RX-10045, a prodrug of an RvE1 analog, reduces corneal opacity after haze-generating PRK in rabbits. Further studies are needed to determine the precise points at which RvE1 decreases corneal opacity after injury.
A connecter-like factor, CacA, links RssB/RpoS and the CpxR/CpxA two-component system in Salmonella.
Kato, Akinori; Hayashi, Hironori; Nomura, Wataru; Emori, Haruka; Hagihara, Kei; Utsumi, Ryutaro
2012-10-02
Bacteria integrate numerous environmental stimuli when generating cellular responses. Increasing numbers of examples describe how one two-component system (TCS) responds to signals detected by the sensor of another TCS. However, the molecular mechanisms underlying this phenomenon remain poorly defined. Here, we report a connector-like factor that affects the activity of the CpxR/CpxA two-component system in Salmonella enterica serovar Typhimurium. We isolated a clone that induced the expression of a cpxP-lac gene fusion from a high-copy-number plasmid pool of random Salmonella genomic fragments. A 63-amino acid protein, CacA, was responsible for the CpxA/CpxR-dependent activation of the cpxP gene. The CpxR-activated genes cpxP and spy exhibited approximately 30% and 50% reductions in transcription, respectively, in a clean cacA deletion mutant strain in comparison to wild-type. From 33 response regulator (RR) deletion mutants, we identified that the RssB regulator represses cacA transcription. Substitution mutations in a conserved -10 region harboring the RNA polymerase recognition sequence, which is well conserved with a known RpoS -10 region consensus sequence, rendered the cacA promoter RpoS-independent. The CacA-mediated induction of cpxP transcription was affected in a trxA deletion mutant, which encodes thioredoxin 1, suggesting a role for cysteine thiol-disulfide exchange(s) in CacA-dependent Cpx activation. We identified CacA as an activator of the CpxR/CpxA system in the plasmid clone. We propose that CacA may integrate the regulatory status of RssB/RpoS into the CpxR/CpxA system. Future investigations are necessary to thoroughly elucidate how CacA activates the CpxR/CpxA system.
A connecter-like factor, CacA, links RssB/RpoS and the CpxR/CpxA two-component system in Salmonella
Directory of Open Access Journals (Sweden)
Kato Akinori
2012-10-01
Full Text Available Abstract Background Bacteria integrate numerous environmental stimuli when generating cellular responses. Increasing numbers of examples describe how one two-component system (TCS responds to signals detected by the sensor of another TCS. However, the molecular mechanisms underlying this phenomenon remain poorly defined. Results Here, we report a connector-like factor that affects the activity of the CpxR/CpxA two-component system in Salmonella enterica serovar Typhimurium. We isolated a clone that induced the expression of a cpxP-lac gene fusion from a high-copy-number plasmid pool of random Salmonella genomic fragments. A 63-amino acid protein, CacA, was responsible for the CpxA/CpxR-dependent activation of the cpxP gene. The CpxR-activated genes cpxP and spy exhibited approximately 30% and 50% reductions in transcription, respectively, in a clean cacA deletion mutant strain in comparison to wild-type. From 33 response regulator (RR deletion mutants, we identified that the RssB regulator represses cacA transcription. Substitution mutations in a conserved -10 region harboring the RNA polymerase recognition sequence, which is well conserved with a known RpoS -10 region consensus sequence, rendered the cacA promoter RpoS-independent. The CacA-mediated induction of cpxP transcription was affected in a trxA deletion mutant, which encodes thioredoxin 1, suggesting a role for cysteine thiol-disulfide exchange(s in CacA-dependent Cpx activation. Conclusions We identified CacA as an activator of the CpxR/CpxA system in the plasmid clone. We propose that CacA may integrate the regulatory status of RssB/RpoS into the CpxR/CpxA system. Future investigations are necessary to thoroughly elucidate how CacA activates the CpxR/CpxA system.
Directory of Open Access Journals (Sweden)
Denise Felício Silva
2014-09-01
Full Text Available O gerenciamento impróprio dos resíduos de serviços de saúde (RSS expõe significantes riscos a pacientes, aos trabalhadores da saúde, à comunidade e ao meio ambiente. Um dos fatores que têm contribuído para aumentar a tendência da adoção do modelo diferenciado de gerenciamento de RSS em diversos países é que eles muitas vezes têm como destino final o mesmo local utilizado para descarte dos demais resíduos urbanos. Com o objetivo de avaliar os procedimentos do gerenciamento dos RSS em relação ao prescrito nas normas e nos regulamentos em municípios da região metropolitana de Belo Horizonte, Minas Gerais, foram realizadas visitas a campo para observar e descrever formas de gerenciamento dos RSS (desde a coleta até a destinação final utilizadas, visando ao conhecimento da realidade. Como resultado, evidenciaram-se falhas nos abrigos externos, nos procedimentos de coleta, no uso de equipamentos de proteção individual, no acondicionamento dos RSS e no seu transporte.
Hypernuclear spectroscopy with the (e, e-prime K+) reaction
Energy Technology Data Exchange (ETDEWEB)
Yu Fujii
2003-06-16
Experimental conditions of the (e,e'K+) reaction for hypernuclear spectroscopy at Jefferson Lab Hall C are considered. Then two hypernuclear experiments at Hall C, Jlab E89-009 and E01-011 are introduced and compared, and possibility to extract information on hypernuclear states are discussed by referring expected spectra obtained with a DWIA calculation.
Directory of Open Access Journals (Sweden)
Eleandro Aparecido Tronchini
2012-12-01
Full Text Available CONTEXT: Diabetes mellitus is a disease characterized by hyperglycemia that, when allowed to progress long-term untreated, develops vascular and neurological complications, which are responsible for the development of alterations in the enteric nervous system in diabetic patients. In the gastrointestinal tract, diabetes mellitus promotes motor and sensory changes, and in the reflex function of this system, causing gastroparesis, diarrhea, constipation, megacolon, slow gastrointestinal transit, gastric stasis and dilation with decreased or increased peristaltic contractions. Several studies have shown that oxidative stress is the main responsible for the vascular and neurological complications affecting the enteric nervous system of diabetics. OBJECTIVE: The effects of 0.1% and 2% vitamin E on myosin-V- and nNOS-immunoreactive neurons in the jejunum of diabetic rats were investigated. METHODS: Thirty rats were divided into the groups: normoglycemic, normoglycemic treated with 0.1% vitamin E, normoglycemic treated with 2% vitamin E, diabetic, diabetic treated with 0.1% vitamin E, and diabetic treated with 2% vitamin E. The neuronal density and areas of neuron cell bodies were determined. RESULTS: Diabetes (diabetic group significantly reduced the number of myosin-V-immunoreactive neurons compared with the normoglycemic group. The diabetic treated with 0.1% vitamin E and diabetic treated with 2% vitamin E groups did not exhibit a greater density than the D group (P>0.05. Nitrergic density did not change with diabetes (P>0.05. The areas of myosin-V- and nNOS-immunoreactive neurons significantly increased in the normoglycemic treated with 2% vitamin E and diabetic groups compared with the normoglycemic group. CONCLUSION: Supplementation with 2% vitamin E had a neurotrophic effect only in the area of myosin-V-immunoreactive neurons compared with the diabetic group.CONTEXTO: O diabetes mellitus (DM é uma doença caracterizada pela hiperglicemia que a
Directory of Open Access Journals (Sweden)
E.S. Balieiro
1999-08-01
Full Text Available O objetivo do estudo foi estimar os parâmetros e as tendências fenotípica, genética e ambiental para idade ao primeiro parto (IPP e intervalo de partos (IDP na raça Gir, com o emprego de análises uni e bivariadas sob o método da máxima verossimilhança restrita, por meio de algoritmo livre de derivadas (MTDFREML, que ajusta o modelo animal. O modelo matemático adotado para estudo do IDP incluiu os efeitos fixos rebanho-ano de parto, época de parto e idade da vaca ao parto como covariável e os efeitos aleatórios de animal e ambiente permanente. Para a IPP, o modelo incluiu os efeitos fixos rebanho-ano de nascimento e época de nascimento e efeito de animal como aleatório. Por meio de análises bivariadas, as estimativas de herdabilidade foram 0,17 para IPP e 0,06 para IDP. A estimativa de repetibilidade para IDP foi 0,17. As correlações fenotípica, genética e de ambiente entre IPP e IDP foram, respectivamente, 0,06, 0,37 e 0,03. As mudanças anuais fenotípica, genética e de ambiente para IPP foram, respectivamente, -0,446±0,077 (PThe aims of the present study were to estimate genetic parameters, as well as phenotypic, genetic and environmental trends for age at first calving (AFC and calving intervals (CI on Gyr dairy breed, using a multivariate derivative-free restricted maximum likelihood (MTDFREML with an animal model. The mathematic model for calving interval included herd-year of calving, calving season, and the covariate age of cow as fixed effects, and animal, and permanent environment as random effects. The model for age at first calving included herd-year of birth and season of birth as fixed effects, and animal as random effect. Through the bivariate analyses, estimates of heritability were: for age at first calving 0.17 and for calving interval 0.06. The estimate of repeatability for calving interval was 0.17. The phenotypic, genetic and environmental correlations between age at first calving and calving interval
Directory of Open Access Journals (Sweden)
Anelise Henrich Crestani
2012-04-01
Full Text Available TEMA: a experiência da maternidade e dialogia mãe-filho com distúrbio de linguagem. PROCEDIMENTOS: o objetivo de investigar as possíveis relações entre a constituição da experiência da maternidade e a dialogia mãe-filho com distúrbio de linguagem. A amostra desta pesquisa foi constituída por 4 crianças, entre 2 e 4 anos, com distúrbio de linguagem, e suas mães. As mães foram submetidas a uma entrevista semi-estruturada acerca da experiência materna e a possibilidade de a mesma ter passado por alterações emocionais tais como a depressão e/ou ansiedade. Coletou-se uma interação mãe-filho, e em um caso avó-neta, através da filmagem da díade em atividade lúdica para analisar o modo como a dialogia e a interação aconteciam na díade. RESULTADOS: demonstraram que as quatro crianças estiveram sujeitas a interações com mães e avó com índices de ansiedade (dois casos e depressão (dois casos. Apenas uma mãe não possuía tais índices e esta possuía dialogia adequada com a filha. CONCLUSÃO: os dados demonstraram relações entre a dialogia mãe-filho e a experiência materna. Houve distinções na dialogia e no brincar relacionados aos estados emocionais das mães e, em um caso, da avó.BACKGROUND: the maternal experience and language impairment mother-child dialogics. PROCEDURES: the aim was to research the possible relations between maternal experience and mother-child dialogics, in language impairment children cases. The sample was made up with four children, between two and four year old with language impairment and their mothers.The mothers answered a semi-structured interview about the maternal experience and possible mothers' emotional signs like anxiety and depression. The pairs engaged in interaction were videotaped in order to interpret the mother's speech, in one case grand-mother, and the interaction process. RESULTS: the results showed that the children were in interactions with mothers and a grandmother
Review of the treat upgrade reactor scram system reliability analysis
International Nuclear Information System (INIS)
Montague, D.F.; Fussell, J.B.; Krois, P.A.; Morelock, T.C.; Knee, H.E.; Manning, J.J.; Haas, P.M.; West, K.W.
1984-10-01
In order to resolve some key LMFBR safety issues, ANL personnel are modifying the TREAT reactor to handle much larger experiments. As a result of these modifications, the upgraded Treat reactor will not always operate in a self-limited mode. During certain experiments in the upgraded TREAT reactor, it is possible that the fuel could be damaged by overheating if, once the computer systems fail, the reactor scram system (RSS) fails on demand. To help ensure that the upgraded TREAT reactor is shut down when required, ANL personnel have designed a triply redundant RSS for the facility. The RSS is designed to meet three reliability goals: (1) a loss of capability failure probability of 10 -9 /demand (independent failures only); (2) an inadvertent shutdown probability of 10 -3 /experiment; and (3) protection agaist any known potential common cause failures. According to ANL's reliability analysis of the RSS, this system substantially meets these goals
Liu, Shu-Guang; Wang, Yun-Mei; Zhang, Yan-Jun; He, Xi-Jing; Ma, Tao; Song, Wei; Zhang, Yu-Min
2017-09-01
Spinal cord ischemia (SCI) induces a range of cellular and molecular cascades, including activation of glutamate receptors and downstream signaling. Post-synaptic density protein 95 (PSD-95) links neuronal nitric oxide synthase (nNOS) with the N-methyl-d-aspartic acid (NMDA) receptors to form a ternary complex in the CNS. This molecular complex-mediated cytotoxicity has been implicated in brain ischemia, but its role in SCI has not been determined. The goal of the study was to investigate the potential protective effects of ZL006, a small-molecule inhibitor of the PSD-95/nNOS interaction, in an in vitro SCI model induced by oxygen and glucose deprivation (OGD) in cultured spinal cord neurons. We found that ZL006 reduced OGD-induced lactate dehydrogenase (LDH) release, neuronal apoptosis and loss of cell viability. This protection was accompanied by the preservation of mitochondrial function, as evidenced by reduced mitochondrial oxidative stress, attenuated mitochondrial membrane potential (MMP) loss, and enhanced ATP generation. In addition, ZL006 stimulated mitochondrial enzyme activities and SOD2 deacetylation in a Sirt3-dependent manner. The results of western blot analysis showed that ZL006 increased the activation of AMPK-PGC-1α-Sirt3 pathway, and the beneficial effects of ZL006 was partially abolished by AMPK inhibitor and PGC-1α knockdown. Therefore, our present data showed that, by the AMPK-PGC-1α-Sirt3 pathway, ZL006 protects spinal cord neurons against ischemia through reducing mitochondrial oxidative stress to prevent apoptosis. Copyright © 2017 Elsevier Ltd. All rights reserved.
SU-E-CAMPUS-T-01: Automation of the Winston-Lutz Test for Stereotactic Radiosurgery
Energy Technology Data Exchange (ETDEWEB)
Litzenberg, D; Irrer, J; Kessler, M; Lam, K [University of Michigan, Ann Arbor, MI (United States); Keranen, W [Varian Medical Systems, Inc., Palo Alto, CA (United States)
2014-06-15
Purpose: To optimize clinical efficiency and shorten patient wait time by minimizing the time and effort required to perform the Winston-Lutz test before stereotactic radiosurgery (SRS) through automation of the delivery, analysis, and documentation of results. Methods: The radiation fields of the Winston-Lutz (WL) test were created in a “machine-QA patient” saved in ARIA for use before SRS cases. Images of the BRW target ball placed at mechanical isocenter are captured with the portal imager for each of four, 2cm×2cm, MLC-shaped beams. When the WL plan is delivered and closed, this event is detected by in-house software called EventNet which automates subsequent processes with the aid of the ARIA web services. Images are automatically retrieved from the ARIA database and analyzed to determine the offset of the target ball from radiation isocenter. The results are posted to a website and a composite summary image of the results is pushed back into ImageBrowser for review and authenticated documentation. Results: The total time to perform the test was reduced from 20-25 minutes to less than 4 minutes. The results were found to be more accurate and consistent than the previous method which used radiochromic film. The images were also analyzed with DoseLab for comparison. The difference between the film and automated WL results in the X and Y direction and the radius were (−0.17 +/− 0.28) mm, (0.21 +/− 0.20) mm and (−0.14 +/− 0.27) mm, respectively. The difference between the DoseLab and automated WL results were (−0.05 +/− 0.06) mm, (−0.01 +/− 0.02) mm and (0.01 +/− 0.07) mm, respectively. Conclusions: This process reduced patient wait times by 15–20 minutes making the treatment machine available to treat another patient. Accuracy and consistency of results were improved over the previous method and were comparable to other commercial solutions. Access to the ARIA web services is made possible through an Eclipse co-development agreement
Macrorrealismo fenomenológico e campos-experiência
Directory of Open Access Journals (Sweden)
Renato Schaeffer
1995-01-01
Full Text Available Este artigo critica a concepção predominante, representacionista-neurofisicalista sobre a percepção sensorial. Introduz a noção de "campo-experiência" na tentativa de tratamento ontológico dos dados fenomenológicos da experiência. A idéia geral é que a experiência visual, por exemplo, seria ontologicamente algo assim como um campo-experiência de intencionalidade visual, que se estende por sobre e entre o sistema nervoso central do sujeito da experiência e o objeto distai da visão. Chamo esta posição de macrorrealismo fenomenológico, em contraste com o microrrealismo científico. Qualidades da fenomenalidade não estão subjetivamente dentro do cérebro, mas objetivamente dentro de campos-experiência perceptuais extra-encefálicos, ou, como dizemos, lá fora no mundo. Algumas conseqüências específicas do macrorrealismo fenomenológico são apresentadas.
ATP for the portable 500 CFM exhauster POR-006 skid D
International Nuclear Information System (INIS)
Keller, C.M.
1997-01-01
This Acceptance Test Plan is for a 500 CFM Portable Exhauster POR-006 to be used for saltwell pumping. The Portable Exhauster System will be utilized to eliminate potential flammable gases that may exist within the dome space of the tank. This Acceptance Plan will test and verify that the exhauster meets the specified design criteria, safety requirements, operations requirements, and will provide a record of the functional test results
Revisiting anomalous B(E2;41+→21+)/B(E2;21+→01+) values in 98Ru and 180Pt
International Nuclear Information System (INIS)
Williams, E.; Plettner, C.; McCutchan, E. A.; Levine, H.; Casten, R. F.; Ai, H.; Heinz, A.; Qian, J.; Meyer, D. A.; Werner, V.; Zamfir, N. V.; Cakirli, R. B.; Beausang, C. W.; Guerdal, G.; Pietralla, N.
2006-01-01
Recently, a set of nine nonmagic nuclei with anomalous values of the B(E2) ratio B 4/2 ≡B(E2;4 1 + →2 1 + )/B(E2;2 1 + →0 1 + ) 1 + →2 1 + ) values for two of these nuclei, 98 Ru and 180 Pt, were re-measured to determine if the current literature values for these nuclei are correct. 98 Ru was studied in a 27 Al( 98 Ru, 98 Ru*) Coulomb excitation experiment in inverse kinematics, while the lifetime of the 4 1 + state in 180 Pt was measured in a 122 Sn( 62 Ni, 4n) 180 Pt recoil distance method (RDM) experiment. For both nuclei, the remeasured B 4/2 values are well above 1, removing the deviations from collective models
Directory of Open Access Journals (Sweden)
Kathleen Schreurs
2013-12-01
Full Text Available Children’s e-books waited to emerge until technology could support their advanced requirements. Recent technologies such as colour e-readers and tablets like Apple’s iPad provide support for heavy visual content and opportunities for interactivity. E-books for children have grown in availability and popularity and now include puzzles, games, music, video, and audio features that boost narratives and create a unique reading experience that is further from print than ever before. This article positions e-books for children as leaders in e-book development. It reviews concepts, practices, and scholarship in the area of e-books for children and highlights issues with definitions and research caused by the rapid growth of enhanced and interactive e-books. There is little argument among scholars and practitioners that the reading experience is changing, and the new generation of readers may have different opinions, assumptions, and preferences for the meanings of ‘book’ and ‘reading’. Managing these shifts in the reading experience, which is still strongly tied to notions from print culture, is an important role for LIS scholars, librarians, educators, and parents. Recent research on e-books for children focuses largely on literacy and education. Little attention has been paid to if and why children enjoy the e-reading experience. Additionally, the majority of current research examines children’s e-reading from an adult perspective with most surveys and interviews consulting parent participants and not children. An examination of relevant research as well as literature on the history and conceptualization of e-books and reading as an evolving experience reveals that, from new technologies to new experiences and new definitions, e-books for children are pushing toward the future of reading.
Non-01 Vibrio cholerae infections in Cancun, Mexico.
Finch, M J; Valdespino, J L; Wells, J G; Perez-Perez, G; Arjona, F; Sepulveda, A; Bessudo, D; Blake, P A
1987-03-01
To determine the role of Vibrio cholerae as a cause of diarrheal illness in Cancun, Mexico, an investigation was conducted in July and August 1983. Although toxigenic V. cholerae 01 were not found, non-01 V. cholerae were isolated from 22 (16%) of 134 stools from persons with diarrheal illness and none of 22 stools from well persons; 58 (92%) of 63 sewage samples; 12 (86%) of 14 untreated well water samples; a home storage tank for treated water; and 5 (21%) of 24 samples of raw seafood. None of the V. cholerae isolates from patients were toxigenic. The illness occurred mainly in small children, and were characterized principally by diarrhea and abdominal pain. No patient was seriously ill, and all recovered without sequelae. Seven different serotypes of non-01 V. cholerae were isolated from the stool specimens, and Smith serotype 12 accounted for 10 (46%) of the 22 isolates. A matched-pair case-control study found that cases were more likely than controls to have eaten home prepared gelatin (P = 0.03, OR = 5/0) and seafood (P = 0.06, OR = 4/0).
International Nuclear Information System (INIS)
Zender, S.N.; Crapo, H.S.; Jensen, M.F.; Sackett, K.E.
1975-04-01
Recorded test data are presented for Test S-01-1 of the semiscale Mod-1 isothermal blowdown test series. Test S-01-1 is one of several semiscale Mod-1 experiments which are counterparts of the planned Loss-of-Fluid Test (LOFT) nonnuclear experiments. System hardware is representative of the LOFT design, selected using volumetric scaling methods, and initial conditions duplicate those identified for the LOFT nonnuclear tests. Test S-01-1 was conducted from an initial temperature of 540 0 F and an initial pressure of 1596 psig. A simulated intermediate size double-ended hot leg break (0.00145 ft 2 break area on each end) was used to investigate the system response to a slow depressurization transient. An orificed structure was used in the pressure vessel to simulate the LOFT core simulator. During system depressurization, coolant was injected into the vessel downcomer inlet annulus to investigate the effectiveness of injection into the inlet annulus with respect to delivery of coolant to the lower plenum. Following the blowdown portion of Test S-01-1, coolant spray was introduced into the pressure suppression tank to determine the response of the pressure suppression system. The purpose of this report is to make available the uninterpreted data from Test S-01-1 for future data analysis and test results reporting activities. The data, presented in the form of graphs in engineering units, have been analyzed only to the extent necessary to assure that they are reasonable and consistent. (U.S.)
Cosmic-ray positron fraction measurement from 1 to 30 GeV with AMS-01
Aguilar, M; Allaby, James V; Alpat, B; Ambrosi, G; Anderhub, H; Ao, L; Arefev, A; Azzarello, P; Baldini, L; Basile, M; Barancourt, D; Barão, F; Barbier, G; Barreira, G; Battiston, R; Becker, R; Becker, U; Bellagamba, L; Bene, P; Berdugo, J; Berges, P; Bertucci, B; Biland, A; Blasko, S; Bölla, G; Boschini, M; Bourquin, M; Brocco, L; Bruni, G; Buénerd, M; Burger, J D; Burger, W J; Cai, X D; Camps, C; Cannarsa, P; Capell, M; Cardano, F; Casadei, D; Casaus, J; Castellini, G; Chang, Y H; Chen, H F; Chen, H S; Chen, Z G; Chernoplekov, N A; Tzi Hong Chiueh; Cho, K; Choi, M J; Choi, Y Y; Cindolo, F; Commichau, V; Contin, A; Cortina, E; Cristinziani, M; Dai, T S; Delgado, C; Difalco, S; Djambazov, L; D'Antone, I; Dong, Z R; Emonet, P; Engelberg, J; Eppling, F J; Eronen, T; Esposito, G; Extermann, P; Favier, Jean; Fiandrini, E; Fisher, P H; Flügge, G; Fouque, N; Galaktionov, Yu; Gast, H; Gervasi, M; Giusti, P; Grandi, D; Grimm, O; Gu, W Q; Hangarter, K; Hasan, A; Hermel, V; Hofer, H; Hungerford, W; Jongmanns, M; Karlamaa, K; Karpinski, W; Kenney, G; Kim, D H; Kim, G N; Kim, K S; Kim, M Y; Klimentov, A; Kossakowski, R; Kounine, A; Koutsenko, V F; Kraeber, M; Laborie, G; Laitinen, T; Lamanna, G; Lanciotti, E; Laurenti, G; Lebedev, A; Lechanoine-Leluc, C; Lee, M W; Lee, S C; Levi, G; Liu, C L; Liu, H T; Lu, G; Lü, Y S; Lübelsmeyer, K; Luckey, D; Lustermann, W; Maña, C; Margotti, A; Mayet, F; McNeil, R R; Meillon, B; Menichelli, M; Mihul, A; Mujunen, A; Oliva, A; Olzem, J; Palmonari, F; Park, H B; Park, W H; Pauluzzi, M; Pauss, F; Perrin, E; Pesci, A; Pevsner, A; Pilo, F; Pimenta, M; Plyaskin, V; Pozhidaev, V; Pohl, M; Produit, N; Rancoita, P G; Rapin, D; Raupach, F; Ren, D; Ren, Z; Ribordy, M; Richeux, J P; Riihonen, E; Ritakari, J; Ro, S; Röser, U; Rossin, C; Sagdeev, R; Santos, D; Sartorelli, G; Sbarra, C; Schael, S; Schultzvon Dratzig, A; Schwering, G; Seo, E S; Shin, J W; Shoumilov, E; Shoutko, V; Siedenburg, T; Siedling, R; Son, D; Song, T; Spinella, F; Steuer, M; Sun, G S; Suter, H; Tang, X W; Ting, Samuel C C; Ting, S M; Tornikoski, M; Torsti, J; Trumper, J; Ulbricht, J; Urpo, S; Valtonen, E; Vandenhirtz, J; Velikhov, E P; Verlaat, B; Vetlitskii, I; Vezzu, F; Vialle, J P; Viertel, G; Vite, D; Von Gunten, H; Waldmeier-Wicki, S; Wallraff, W; Wang, B C; Wang, J Z; Wiik, K; Williams, C; Wu, S X; Xia, P C; Xu, S; Yan, J L; Yan, L G; Yang, C G; Yang, J; Yang, M; Ye, S W; Xu, Z Z; Zhang, H Y; Zhang, Z P; Zhao, D X; Zhou, Y; Zhu, G Y; Zhu, W Z; Zhuang, H L; Zichichi, A; Zimmermann, B; Zuccon, P
2007-01-01
A measurement of the cosmic ray positron fraction e+/(e+ + e-) in the energy range of 1-30 GeV is presented. The measurement is based on data taken by the AMS-01 experiment during its 10 day Space Shuttle flight in June 1998. A proton background suppression on the order of 10^6 is reached by identifying converted bremsstrahlung photons emitted from positrons.
Cosmic-ray positron fraction measurement from 1 to 30 GeV with AMS-01
International Nuclear Information System (INIS)
Aguilar, M.; Alcaraz, J.; Allaby, J.
2007-01-01
A measurement of the cosmic ray positron fraction e + /(e + +e - ) in the energy range of 1-30 GeV is presented. The measurement is based on data taken by the AMS-01 experiment during its 10 day Space Shuttle flight in June 1998. A proton background suppression on the order of 10 6 is reached by identifying converted bremsstrahlung photons emitted from positrons
Why a NESSiE-like experiment at SBL is needed?
Pasqualini, Laura
2015-01-01
The NESSiE experiment is designed to perform an accurate measurement of muon-neutrino disappearance at small L/E, in order to severely constrain models with more than three-standard neutrinos, or even determine for the first time the presence of a new kind of neutrino oscillation. NESSiE is a Short-Baseline experiment with magnetic spectrometers at two different sites on the FNAL-Booster neutrino beam. The experiment would allow to definitively solve the existing tension of the muon-neutrino ...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e
Study I: effects of 0.06% and 0.10% blood alcohol concentration on human postural control.
Modig, F; Patel, M; Magnusson, M; Fransson, P A
2012-03-01
Alcohol intoxication causes many accidental falls presented at emergency departments, with the injury severity often related to level of blood alcohol concentration (BAC). One way to evaluate the decline in postural control and the fall risk is to assess standing stability when challenged. The study objective was to comprehensively investigate alcohol-related impairments on postural control and adaptive motor learning at specific BAC levels. Effects of alcohol intoxication at 0.06% and 0.10% BAC were examined with posturography when unperturbed or perturbed by calf vibration. Twenty-five participants (mean age 25.1 years) were investigated standing with either eyes open or closed. Our results revealed several significant findings: (1) stability declined much faster from alcohol intoxication between 0.06% and 0.10% BAC (60-140%) compared with between 0.0% and 0.06% BAC (30%); (2) sustained exposure to repeated balance perturbations augmented the alcohol-related destabilization; (3) there were stronger effects of alcohol intoxication on stability in lateral direction than in anteroposterior direction; and (4) there was a gradual degradation of postural control particularly in lateral direction when the balance perturbations were repeated at 0.06% and 0.10% BAC, indicating adaptation deficits when intoxicated. To summarize, alcohol has profound deteriorating effects on human postural control, which are dose dependent, time dependent and direction specific. The maximal effects of alcohol intoxication on physiological performance might not be evident initially, but may be revealed first when under sustained sensory-motor challenges. Copyright © 2011 Elsevier B.V. All rights reserved.
Out-of-core detectors experiments in IPEN/MB-01 reactor
International Nuclear Information System (INIS)
Abe, Alfredo Y.; Fuga, Rinaldo; Mendonca, Arlindo Gilson; Moreira, Joao M.L.; Angioletto, Elcio; Fanaro, Leda Cristina C.B.; Jerez, Rogerio; Coelho, Paulo R. Pinto; Santos, Adimir dos; Silva, Graciete S. de A. e; Diniz, Ricardo
2000-01-01
In order to study the response of out-of-core detectors, 16 stainless steel plates, with 0.5 cm thickness, were placed at the core-reflector interface of the IPEN/MB-01 reactor. BF 3 , 10 B and Au foil detectors were localized beyond the stainless steel plates in 7 different positions, one of them outside the moderator tank of the reactor for simulating a true PWR out-of-core detector. Calculations were performed for comparison with the experimental results with the TORT code, a three-dimensional transport theory discrete ordinate code. The experiment model utilized 16 energy groups, X-Y Z geometry, S 16 discrete ordinates and P 3 cross-sections. The obtained results showed a good agreement between measured and calculated reaction rates in Au foils. The larger discrepancy occurred for the case with 16 stainless steel with a 2,2% deviation. For position 7, outside of the moderator tank, the neutron flux was so low that it could not active the Au foils for the reaction rate measurements. (author)
78 FR 13213 - Regional Reliability Standard PRC-006-NPCC-1- Automatic Underfrequency Load Shedding
2013-02-27
...-006- NPCC-1 applies to generator owners, planning coordinators, distribution providers, and... Street NE., Washington, DC 20426, Telephone: (202) 502-6750, [email protected] . Matthew... First Street NE., Washington, DC 20426, Telephone: (202) 502-8408, [email protected
Open-Rate Controlled Experiment in E-Mail Marketing Campaigns
Directory of Open Access Journals (Sweden)
Antun Biloš
2016-06-01
Full Text Available Purpose – The main purpose of this paper is to test the controlled experiment (A/B split methodology in B2C oriented e-mail marketing campaigns. Design/Methodology/Approach – E-mail marketing techniques have been a substantial part of e-marketing methodology since the early Internet days of the mid-1990s. From the very beginning of Internet utilization for business purposes, e-mail was one of the most widely used communication techniques in B2B and B2C markets alike. Due to high volumes of spamming and progression of online communication clutter, some practitioners began to question the usability of e-mail as a marketing communication channel, while others embarked on working on improving the message itself. Efforts were invested into improving message quality, as well as into better understanding user expectations. One of the most commonly used techniques to test specific e-mail message elements is the controlled experiment. Findings and implications – This paper explores several types of controlled experiments in a specific Croatian B2C market. Tests were run to determine subscriber behavior towards several newsletter components, including sending time, sending day, sender’s name, and subject line. Open and click rates for tested campaigns, and several other metrics were investigated using MailChimp software. An N − 1 two-proportion test using an adjusted Wald confidence interval around the difference in the proportions was used for comparing the open-rate measure in the controlled experiments between subjects. Limitation – Controlled experiments (A/B split tests showed a lot of potential as a way of measuring behavior and preferences of subscribers, although several apparent limitations (the data-set scope, comparability issues indicated a clear need for standardization on a managerial and scientific level. Originality – This paper provides an up-to-date e-mail marketing effectiveness literature review, describes and tests the
E-36: First Proto-Megascience Experiment at NAL
Energy Technology Data Exchange (ETDEWEB)
Pronskikh, Vitaly S. [Fermilab
2016-03-01
E-36, an experiment on small angle proton-proton scattering, began testing equipment in the National Accelerator Laboratory’s newly achieved 100-GeV beam on February 12, 1972, marking the beginning of NAL’s experimental program. This experiment, which drew collaborators from NAL, Joint Institute for Nuclear Research (JINR at Dubna, USSR), the University of Rochester (Rochester, New York) and Rockefeller University (New York City) was significant not only as a milestone in Fermilab’s history but also as a model of cooperation between the East and West at a time when Cold War tensions still ran high. An examination of the origin, operation, and resolution of E-36 and the chain of experiments it spawned reveals the complex interplay of science and politics that drove these experiments as well as seeds of the megascience paradigm that has come to dominate high-energy physics research since the 1970s.
Charged particle multiplicity distributions in e+e--annihilation processes in the LEP experiments
International Nuclear Information System (INIS)
Shlyapnikov, P.V.
1992-01-01
Results of studies of the charged particle multiplicity distributions in the process of e + e - -annihilation into hadrons obtained in experiments at LEP accelerator in CERN are reviewed. Universality in energy dependence of the average charged particle multiplicity in e + e - and p ± p collisions, evidence for KNO-scaling in e + e - data, structure in multiplicity distribution and its relation to the jet structure of events, average particle multiplicities or quark and gluon jets, 'clan' picture and other topics are discussed. 73 refs.; 20 figs.; 3 tabs
E143 experiment. Shower counter calibration
International Nuclear Information System (INIS)
Fonvieille, H.; Grenier, P.
1994-01-01
The calibration procedure for the shower counters used in the E143 experiment is described. It has been developed during january 1994 in view of being used for the quick analysis. The method is explained and the results obtained on a given run are presented. (author)
The Influence of Experience, Ability and Interest on e-Learning Effectiveness
Haverila, Matti; Barkhi, Reza
2009-01-01
The purpose of this paper is to report the findings of a research conducted to evaluate the effect of learning preconceptions, prior e-learning experience, ability and interest of students on their perceptions regarding the process of e-learning. We study the effectiveness of e-learning as it relates to the level of e-learning experience. The…
DEFF Research Database (Denmark)
Bejon, Philip; Cook, Jackie; Bergmann-Leitner, Elke
2011-01-01
(See the article by Greenhouse et al, on pages 19-26.) Background. RTS,S/AS01(E) is the lead candidate malaria vaccine and confers pre-erythrocytic immunity. Vaccination may therefore impact acquired immunity to blood-stage malaria parasites after natural infection. Methods. We measured, by enzyme......, MSP-1(42), and MSP-3 antibody concentrations and no significant change in GIA. Increasing anti-merozoite antibody concentrations and GIA were prospectively associated with increased risk of clinical malaria. Conclusions. Vaccination with RTS,S/AS01E reduces exposure to blood-stage parasites and, thus......-linked immunosorbent assay, antibodies to 4 Plasmodium falciparum merozoite antigens (AMA-1, MSP-1(42), EBA-175, and MSP-3) and by growth inhibitory activity (GIA) using 2 parasite clones (FV0 and 3D7) at 4 times on 860 children who were randomized to receive with RTS,S/AS01(E) or a control vaccine. Results. Antibody...
International Nuclear Information System (INIS)
Zender, S.N.; Crapo, H.S.; Jensen, M.F.; Sackett, K.E.
1975-04-01
Recorded test data are presented for Test S-01-5 of the semiscale Mod-1 isothermal blowdown test series. Test S-01-5 is one of several semiscale Mod-1 experiments which are counterparts of the LOFT nonnuclear experiments. System hardware is representative of LOFT with the design based on volumetric scaling methods and with initial conditions duplicating those identified for LOFT nonnuclear tests. Test S-01-5 was conducted with the secondary side of the steam generator pressurized with nitrogen gas in order to effectively eliminate heat transfer from the steam generator during blowdown and thereby to investigate the effect on overall system behavior of heat transfer from the steam generator. An orificed structure was used in the pressure vessel to simulate the LOFT core simulator. The test was initiated at isothermal conditions of 2270 psig and 540 0 F by a simulated offset shear of the cold leg broken loop piping. During system depressurization, coolant was injected into the cold leg of the operating loop to simulate emergency core cooling (ECC). Following the blowdown portion of the test, coolant spray was introduced into the pressure suppression tank to determine the response of the pressure suppression system. The uninterpreted data from Test S-01-5 and the reference material needed for future data analysis and test results reporting activities are presented. The data, presented in the form of graphs in engineering units, have been analyzed only to the extent necessary to assure that they are reasonable and consistent. (U.S.)
Wang, Lin; Fei, Chang; Huang, Zheng-Lan; Li, Hui; Liu, Zhang-Lin; Feng, Wen-Li
2015-08-01
To investigate the effect of SH2-Caspase 8 fusion protein expressed by recombinant adenovirus AdE-SH2-Caspase8-HA-GFP (SC) on the apoptosis of K562/G01 cell line, which is a BCR/ABL positive chronic myeloid leukemia cell line and resistant to imatinib. The K562/G01 cell line was infected with AdE-SH2-Caspase 8-HA-GFP adenovirus (SC), then the cells were divided into 3 groups: AdE-SH2m-Caspase 8-HA-GFP (SmC) group, AdE-GFP (CMV) group and PBS group as control. The infection efficiency was observed under fluorescent microscopy and by flow cytometry. The expression of fusion protein SH2-Caspase 8-HA was measured by Western blot. The morphology of the cells detected by Wright's staining. The apoptosis of the cells were detected by flow cytometry and DNA ladder. The expression of Caspase 3 and PARP were detected by Western blot. The infection efficiency of SC on K562/G01 cells was high which was confirmed by fluorescent microscopy and FCM. SH2-Caspase 8-HA fusion protein were expressed correctly in K562/G01 cells. After treatment with SC the apoptosis of K562/G01 cells could be observed by microscopy. The result of FCM showed that early apoptosis of K562/G01 cells increased significantly as compared with control groups (P SH2-Caspase 8 fusion protein can induces the apoptosis of K562/G01 cells.
International Nuclear Information System (INIS)
Malhotra, Poonam; Gupta, Ashutosh K.; Singh, Praveen K.; Chhachhia, Neha; Singh, Shravan K.; Raj Kumar
2014-01-01
Redox imbalance due to radiation induced oxidation of vital bio-macromolecules activates inflammatory response cascade leading to cell death. In present study, bacterial secondary metabolite, RK-IP-006.G, was evaluated for its oxidative stress and apoptosis inhibiting activities in irradiated J774A.1 murine macrophage cell line. Radiation induced intracellular ROS generation and its inhibition upon RK-IP-006.G pretreatment was estimated using 2',7'dichlorodihydroflurescein diacetate (DCFDA). Modulation in mitochondrial membrane potential (MMP) in irradiated cells and its protection by RK-IP-006.G pretreatment was evaluated using Rhodamine-123. Modulation in protein expression in irradiated and RK-IP-006.G treated J774A.1 cells was assessed by SDS-PAGE. Compensatory effect of RK-IP-006.G treatment on TNF-α expression in irradiated cells was estimated using ELISA assay. APO-BrDU assay was performed to evaluate radiation-induced apoptosis in irradiated cells. Radiation-induced cell damage and protective ability of RK-IP-006.G was also evaluated using Differential Interference Contrast Microscopy. Results of the study indicated significant (p< 0.05) decrease in DCFDA fluorescence in irradiated cells that were pretreated (∼2h) with RK-IP-006.G (0.25 μg/ml) as compared to irradiated cells. Similarly, significant (p<0.05) decrease in MMP was observed in irradiated cells pretreated with RK-IP-006.G (0.25 μg/ml) as compared to only irradiated cells at 1 h time point. SDS-PAGE analysis clearly demonstrated up-regulation of some prominent proteins in irradiated cells pretreated with RK-IP-006.G at 2-4h after treatment as compared to irradiated control. Significant (p<0.05) down regulation in TNF-α expression was observed in irradiated cells that pretreated with RK-IP-006.G compared to irradiated controls. APO-BrDU assay revealed significant reduction in apoptosis in irradiated cells pretreated with RK-IP-006.G when compared to irradiated control. The findings
International Nuclear Information System (INIS)
Gunaydin, Yusuf Oguzhan
2009-01-01
Cross-sections are presented for 58 GeV π, K, and p on a wide range of nuclear targets. These cross-sections are essential for determining the neutrino flux in measurements of neutrino cross-sections and oscillations. The E907 Main Injector Particle Production (MIPP) experiment at Fermilab is a fixed target experiment for measuring hadronic particle production using primary 120 GeV/c protons and secondary π, K, and p beams. The particle identification is made by dE/dx in a time projection chamber, and by time-of-flight, differential Cherenkov and ring imaging Cherenkov detectors, which together cover a wide range of momentum from 0.1 GeV/c up to 120 GeV/c. MIPP targets span the periodic table, from hydrogen to uranium, including beryllium and carbon. The MIPP has collected ∼ 0.26 x 10 6 events of 58 GeV/c secondary particles produced by protons from the main injector striking a carbon target.
Postirradiation examination of Peach Bottom HTGR Driver Fuel Element E06-01
International Nuclear Information System (INIS)
Dyer, F.F.; Wichner, R.P.; Martin, W.J.; Fairchild, L.L.; Kedl, R.J.; de Nordwall, H.J.
1976-04-01
The report presented describes the postirradiation examinations of driver fuel element E06-01, which had been irradiated an equivalent of 384 full-power days in Peach Bottom, Unit 1. The fuel element is described in detail and its temperature and irradiation service history briefly outlined. Results presented include: (1) visual observations; (2) critical dimensions of fuel compacts, sleeve, and spine; (3) axial distributions of gamma-emitting nuclides plus 3 H and 90 Sr; (4) radial distributions of these nuclides in the sleeve and spine at three axial locations in the fueled regions and three locations in the upper reflector; (5) metallographic examination of samples of fuel compact material; and (6) burnup determinations via radiochemical analyses at two compact locations
The Mu2e experiment at Fermilab
International Nuclear Information System (INIS)
Donghia, R.
2017-01-01
The Mu2e experiment searches for the neutrinoless muon to electron conversion in the field of a nucleus, which is a charged lepton flavor violating process. The goal of the experiment is to reach a single event sensitivity of 2.8×10"−"1"7, setting an upper limit on the muon conversion rate of 6.7 × 10"−"1"7. This corresponds to a four order of magnitude improvement with respect to the existing limits.
Directory of Open Access Journals (Sweden)
Antônio Claret Guerra
2015-07-01
Full Text Available Este artigo tem como objetivo identificar a contribuição de redes sociais on-line (OSN para o processo de disseminação e compartilhamento de experiências de turismo das gerações X e Y. A pesquisa realizada tem natureza exploratória e abordagem qualitativa, sendo os dados obtidos por entrevistas semiestruturadas. A análise de conteúdo (Bardin, 2009 foi a técnica usada para a análise dos dados coletados. Procurou-se, dessa forma, investigar vários aspectos ligados ao tema proposto: se as OSN são uma inovação tecnológica que impactou o setor de viagens; sua importância para o desenvolvimento e manutenção de relacionamentos das gerações X e Y com mídias sociais on-line; a interface de cocriação de produtos turísticos; sua contribuição para a formação de preferências e intenções de compra. Entre as conclusões do estudo, verifica-se que os entrevistados concordam que as OSN impactam o setor e o consumidor busca benefícios ao utilizá-las, destacando a praticidade, comodidade, segurança, troca de informações e experiências. Foi citado, ainda, que as OSN divulgam roteiros turísticos competitivos e acessíveis, que antes da era digital eram relativamente pouco conhecidos do grande público. Palavras-chave: Turismo. Experiência Turística. Redes Sociais On-line. Gerações X e Y. Social Networks and Generations X and Y: Dissemination and Tourism Experience Sharing - This article aims to identify the on-line social network (OSN contribution to the X and Y generations´ tourism experiences of dissemination and sharing process. The content analysis (Bardin, 2008 was the technique used to analyses the data obtained through semi structured interviews. It was sought to investigate the OSN as technological innovation, its significance for the X and y generations relationships development, co-creation and formation of purchase intentions interface. Among the conclusions is the actual benefit of the OSN impact on the
Directory of Open Access Journals (Sweden)
Akyene Tetteh
2017-04-01
Full Text Available Background: Although the Internet boosts business profitability, without certain activities like efficient transportation, scheduling, products ordered via the Internet may reach their destination very late. The environmental problems (vehicle part disposal, carbon monoxide [CO], nitrogen oxide [NOx] and hydrocarbons [HC] associated with transportation are mostly not accounted for by industries. Objectives: The main objective of this article is to minimising negative externalities cost in e-commerce environments. Method: The 0-1 mixed integer linear programming (0-1 MILP model was used to model the problem statement. The result was further analysed using the externality percentage impact factor (EPIF. Results: The simulation results suggest that (1 The mode of ordering refined petroleum products does not impact on the cost of distribution, (2 an increase in private cost is directly proportional to the externality cost, (3 externality cost is largely controlled by the government and number of vehicles used in the distribution and this is in no way influenced by the mode of request (i.e. Internet or otherwise and (4 externality cost may be reduce by using more ecofriendly fuel system.
Collaborative e-Science Experiments and Scientific Workflows
Belloum, A.; Inda, M.A.; Vasunin, D.; Korkhov, V.; Zhao, Z.; Rauwerda, H.; Breit, T.M.; Bubak, M.; Hertzberger, L.O.
2011-01-01
Recent advances in Internet and grid technologies have greatly enhanced scientific experiments' life cycle. In addition to compute- and data-intensive tasks, large-scale collaborations involving geographically distributed scientists and e-infrastructure are now possible. Scientific workflows, which
Meson spectroscopy experiment at KEK - E/iota puzzle
International Nuclear Information System (INIS)
Tsuru, Tsuneaki
1985-01-01
Physics interests at the KEK (National Laboratory for High Energy Physics) are (1) search for exotic mesons such as glueballs (gg), meiktons (q anti q g) and multiquark states (q sup(2 - )q 2 ), (2) search for missing ordinary mesons (q anti q) and confirmation of unestablished mesons, and (3) new informations of quark contents of mesons, mixing angles of SU(3) singlet-octet and tests of conservations law. Special interest is in search for exotics such as glueballs and meiktons. (2) is a so-called meson spectroscopy experiment. This is important not only in itself but also in identifying newly discovered states as exotics because exotics have often same quantum numbers as ordinary mesons. Contents are the following: glueballs and E/iota puzzles, spectrometer system, experiments, performance of the spectrometer, physics outputs, E/iota puzzles and πI experiment, future plans. (Mori, K.)
Experiência e Utopia em Theodor W. Adorno, André Gorz e François Dubet
Directory of Open Access Journals (Sweden)
Sílvio César Camargo
2007-01-01
sociedade contemporânea. Conceito bastante complexo quanto a sua possibilidade de apreensão pela sociologia, experiência se refere tanto a problemas relativos ao conhecimento e suas possibilidades, mas também para as possibilidades de transformação da sociedade. Entende-se que há três teóricos da sociedade contemporânea, que partindo de bases epistemológicas diferentes, problematizam a emancipação humana a partir de uma singular atenção ao conceito de experiência. Theodor W. Adorno, André Gorz e François Dubet representam três formas de pensamento sobre a sociedade bastante diferentes, mas que possuem em comum o interesse normativo, e seu confronto nos mostra a importância do conceito de experiência para a compreensão da sociedade contemporânea e para pensar-se a utopia.
Delírios I – Agonia e experiência (jogos de vida e morte
Directory of Open Access Journals (Sweden)
Vinícius Nicastro Honesko
2010-07-01
Full Text Available O presente ensaio pretende expor uma idéia de agonia como jogo de vida e morte no qual imerge o artista no ato de criação. A partir das leituras e conceituações do termo jogo em Johan Huizinga e em Roger Caillois, mostra como tais idéias são importantes para compreender a experiência humana diante do incompreensível que é a morte. Aponta como a agonia inspira no poeta, principalmente na modernidade, uma distância em relação às certezas do conhecimento, implicando uma leitura etimológica do termo experiência, isto é, como ex periri, (aqui, também, jogo de vida e morte. Por fim, procura ver como os traços desse jogo – uma eterna luta – sutilmente se mostram nos pânicos de Murilo Mendes e de Paul Gauguin, artistas nos quais a consciência dessa luta é atravessada pela imagem do lugar por excelência da agonia: o Calvário.
Experimental utilization of the IPEN/MB-01 reactor
International Nuclear Information System (INIS)
Bitelli, U. d'Utra; Santos, A. dos; Jerez, R.; Diniz, R.; Fanaro, L.C.C.B.; Abe, A.Y.; Moreira, J.M.L.; Fer, N.; Giada, M.R.; Fuga, R.
2003-01-01
This paper aims to show the experimental utilization of the IPEN/MB-01 nuclear reactor during the last fourteen years. The IPEN/MB-01 is a zero-power critical assembly specially designed to measure integral and differential reactor physics parameters to validate calculational methodologies and related nuclear data libraries. Experiments involving determination of spectral indices, critical mass, relative abundance of delayed neutrons, the inversion point of the isothermal reactivity coefficient and burnable poison are considered the most important experiments. Current experiments at IPEN/MB-01 reactor are also commented. (author)
Received Signal Strength Database Interpolation by Kriging for a Wi-Fi Indoor Positioning System.
Jan, Shau-Shiun; Yeh, Shuo-Ju; Liu, Ya-Wen
2015-08-28
The main approach for a Wi-Fi indoor positioning system is based on the received signal strength (RSS) measurements, and the fingerprinting method is utilized to determine the user position by matching the RSS values with the pre-surveyed RSS database. To build a RSS fingerprint database is essential for an RSS based indoor positioning system, and building such a RSS fingerprint database requires lots of time and effort. As the range of the indoor environment becomes larger, labor is increased. To provide better indoor positioning services and to reduce the labor required for the establishment of the positioning system at the same time, an indoor positioning system with an appropriate spatial interpolation method is needed. In addition, the advantage of the RSS approach is that the signal strength decays as the transmission distance increases, and this signal propagation characteristic is applied to an interpolated database with the Kriging algorithm in this paper. Using the distribution of reference points (RPs) at measured points, the signal propagation model of the Wi-Fi access point (AP) in the building can be built and expressed as a function. The function, as the spatial structure of the environment, can create the RSS database quickly in different indoor environments. Thus, in this paper, a Wi-Fi indoor positioning system based on the Kriging fingerprinting method is developed. As shown in the experiment results, with a 72.2% probability, the error of the extended RSS database with Kriging is less than 3 dBm compared to the surveyed RSS database. Importantly, the positioning error of the developed Wi-Fi indoor positioning system with Kriging is reduced by 17.9% in average than that without Kriging.
Experiment E89-044 on the Quasielastic 3He(e,e'p) Reaction at Jefferson Laboratory
Energy Technology Data Exchange (ETDEWEB)
Penel-Nottaris, Emilie [Univ. Joseph Fourier Grenoble (France)
2004-07-07
The Jefferson Lab Hall A E89-044 experiment has measured the 3He(e,e'p) reaction cross-sections. The extraction of the longitudinal and transverse response functions for the two-body break-up 3He(e,e'p)d reaction in parallel kinematics allows the study of the bound proton electromagnetic properties inside the 3He nucleus and the involved nuclear mechanisms beyond plane wave approximations.
International Nuclear Information System (INIS)
Finn, P.A.; Reedy, G.T.; Homa, M.I.; Clemmer, R.G.; Pappas, G.; Slawecki, M.A.; Graczyk, D.G.; Bowers, D.L.; Clemmer, E.D.
1983-01-01
The tritium recovery experiment, TRIO-01, required a gas analysis system which detected the form of tritium, the amount of tritium (differential and integral), and the presence and amount of other radioactive species. The system had to handle all contingencies and function for months at a time unattended during weekend operation. The designed system, described herein, consisted of a train of components which could be grouped as desired to match tritium release behavior
Directory of Open Access Journals (Sweden)
Seth Owusu-Agyei
2009-10-01
Full Text Available The target delivery channel of RTS,S candidate malaria vaccines in malaria-endemic countries in Africa is the World Health Organisation Expanded Program on Immunization. As an Adjuvant System, age de-escalation and schedule selection step, this study assessed 3 schedules of RTS,S/AS01(E and RTS,S/AS02(D in infants and young children 5-17 months of age in Ghana.A Phase II, partially-blind randomized controlled study (blind to vaccine, not to schedule, of 19 months duration was conducted in two (2 centres in Ghana between August 2006 and May 2008. Subjects were allocated randomly (1:1:1:1:1:1 to one of six study groups at each study site, each defining which vaccine should be given and by which schedule (0,1-, 0,1,2- or 0,1,7-months. For the 0,1,2-month schedule participants received RTS,S/AS01(E or rabies vaccine at one center and RTS,S/AS01(E or RTS,S/AS02(D at the other. For the other schedules at both study sites, they received RTS,S/AS01(E or RTS,S/AS02(D. The primary outcome measure was the occurrence of serious adverse events until 10 months post dose 1.The number of serious adverse events reported across groups was balanced. One child had a simple febrile convulsion, which evolved favourably without sequelae, considered to be related to RTS,S/AS01(E vaccination. Low grade reactions occurred slightly more frequently in recipients of RTS,S/AS than rabies vaccines; grade 3 reactions were infrequent. Less local reactogenicity occurred with RTS,S/AS01(E than RTS,S/AS02(D. Both candidate vaccines were highly immunogenic for anti-circumsporozoite and anti-Hepatitis B Virus surface antigen antibodies. Recipients of RTS,S/AS01(E compared to RTS,S/AS02(D had higher peak anti-circumsporozoite antibody responses for all 3 schedules. Three dose schedules were more immunogenic than 2 dose schedules. Area under the curve analyses for anti-circumsporozoite antibodies were comparable between the 0,1,2- and 0,1,7-month RTS,S/AS01(E schedules.Both candidate
Evaluation Of User Experience And Its Economics In E-Commerce
Directory of Open Access Journals (Sweden)
Praneeth Kumar Baru
2017-10-01
Full Text Available User Experience pertains to designing studying and evaluating experiences that users have while using or interacting with the system with a specific context. UX is seen as a field of study a phenomenon and as a practice as well. To understand it with an analogy justice as a phenomenon law as a field of study and a lawyers work as a practice. Evaluating the users experience can help quantify or measure to the extent to which the system is being understood or perceived the way it is supposed to be. Evaluation methods can take various forms and are categorized in this paper. Essentials of the user experience are elaborated and furthermore some quantified data is presented that discusses the role user experience in e-commerce website and also the future prospects of the e-commerce domain are briefly described.
NODC Standard Format Pathology Data Sets (1973-1975): Fin Rot (F006) Data (NODC Accession 0014147)
National Oceanic and Atmospheric Administration, Department of Commerce — The Fin Rot (F006) dataset contains data from examinations of the biological condition of diseased fishes. For tow samples collected, data include: total number of...
Acar, Ugur; Acar, Damla Erginturk; Tanriverdi, Cafer; Acar, Mutlu; Ozdemir, Ozdemir; Erikci, Acelya; Ornek, Firdevs
2017-06-01
To compare the lowering effects of ketorolac 0.4% and nepafenac 0.1% on aqueous and vitreous humor prostaglandin E 2 (PGE 2 ) levels in rabbits. Ketorolac and nepafenac ophthalmic solutions were administered to the right eyes of 24 healthy rabbits after randomized division into two groups. The left eyes of these rabbits were considered as controls for the two groups. On the 4th day of the experiment, the samples were taken from the aqueous and vitreous humors of the rabbits bilaterally, and PGE 2 levels were measured by an enzyme immune assay kit. Ketorolac and nepafenac achieved a statistically significant decrease (phumor (6.58 ± 4.62 and 9.83 ± 4.55 pg/mL, respectively). Both ketorolac and nepafenac inhibited PGE 2 levels in both the aqueous and vitreous humors of rabbits. Although PGE 2 -lowering effects were similar in the aqueous humor, nepafenac seemed to be more potent than ketorolac in the vitreous humor.
The Calibration System of the E989 Experiment at Fermilab
Energy Technology Data Exchange (ETDEWEB)
Anastasi, Antonio [Univ. of Messina (Italy)
2017-01-01
The muon anomaly aµ is one of the most precise quantity known in physics experimentally and theoretically. The high level of accuracy permits to use the measurement of aµ as a test of the Standard Model comparing with the theoretical calculation. After the impressive result obtained at Brookhaven National Laboratory in 2001 with a total accuracy of 0.54 ppm, a new experiment E989 is under construction at Fermilab, motivated by the diff of aexp SM µ - aµ ~ 3σ. The purpose of the E989 experiment is a fourfold reduction of the error, with a goal of 0.14 ppm, improving both the systematic and statistical uncertainty. With the use of the Fermilab beam complex a statistic of × 21 with respect to BNL will be reached in almost 2 years of data taking improving the statistical uncertainty to 0.1 ppm. Improvement on the systematic error involves the measurement technique of ωa and ωp, the anomalous precession frequency of the muon and the Larmor precession frequency of the proton respectively. The measurement of ωp involves the magnetic field measurement and improvements on this sector related to the uniformity of the field should reduce the systematic uncertainty with respect to BNL from 170 ppb to 70 ppb. A reduction from 180 ppb to 70 ppb is also required for the measurement of ωa; new DAQ, a faster electronics and new detectors and calibration system will be implemented with respect to E821 to reach this goal. In particular the laser calibration system will reduce the systematic error due to gain fl of the photodetectors from 0.12 to 0.02 ppm. The 0.02 ppm limit on systematic requires a system with a stability of 10-4 on short time scale (700 µs) while on longer time scale the stability is at the percent level. The 10-4 stability level required is almost an order of magnitude better than the existing laser calibration system in particle physics, making the calibration system a very challenging item. In addition to the high level
O Plano Real à luz da experiência mexicana e argentina
Directory of Open Access Journals (Sweden)
Paulo Nogueira Batista Jr.
1996-12-01
Full Text Available O trabalho discute os primeiros dois anos do Plano Real e em especial os seus efeitos sobre as relações externas do Brasil, à luz da experiência de programas de estabilização adotados no México, em 1988-1994, e na Argentina, desde 1991. Embora cada experiência nacional apresente as suas peculiaridades, argumenta-se que a economia brasileira vem revivendo a experiência mexicana e argentina em alguns pontos importantes, combinando sucesso no combate à inflação com acentuada e persistente apreciação cambial, elevados déficits no balanço de pagamentos em conta corrente e dependência de fluxos voláteis de capital internacional.This paper discusses the first two years of Brazil's current stabilization programme - known as the Real Plan - and in particular its effects on the country's external economic relations, in the ligth of similar stabilization programmes adopted in Mexico from 1988 to 1994 and in Argentina since 1991. Although each national experience has its peculiarities, it is shown that the Brazilian economy has been reliving the Mexican and Argentinian experience in some important respects, combining success in terms of inflation reduction, with strong and persistent exchange rate appreciation, high deficits in the balance of payments on current account and dependence on volatile international capital flows.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AK01 (Link to dictyBase) - - - Contig-U15038-1 FC-AK01E (Li...nk to Original site) - - - - - - FC-AK01E 996 Show FC-AK01 Library FC (Link to library) Clone ID FC-AK01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15038-1 Original site URL http://dict...s clone omyk-evn... 172 6e-79 AF401557_1( AF401557 |pid:none) Ictalurus punctatus...reticulum 4.0 %: vacuolar >> prediction for FC-AK01 is mit 5' end seq. ID - 5' end seq. - Length of 5' end s
International Reactor Physics Experiment Evaluation (IRPhE) Project. IRPhE Handbook - 2015 edition
International Nuclear Information System (INIS)
Bess, John D.; Gullifor, Jim
2015-03-01
The purpose of the International Reactor Physics Experiment Evaluation (IRPhE) Project is to provide an extensively peer-reviewed set of reactor physics-related integral data that can be used by reactor designers and safety analysts to validate the analytical tools used to design next-generation reactors and establish the safety basis for operation of these reactors. This work of the IRPhE Project is formally documented in the 'International Handbook of Evaluated Reactor Physics Benchmark Experiments', a single source of verified and extensively peer-reviewed reactor physics benchmark measurements data. The evaluation process entails the following steps: Identify a comprehensive set of reactor physics experimental measurements data, Evaluate the data and quantify overall uncertainties through various types of sensitivity analysis to the extent possible, verify the data by reviewing original and subsequently revised documentation, and by talking with the experimenters or individuals who are familiar with the experimental facility, Compile the data into a standardized format, Perform calculations of each experiment with standard reactor physics codes where it would add information, Formally document the work into a single source of verified and peer reviewed reactor physics benchmark measurements data. The International Handbook of Evaluated Reactor Physics Benchmark Experiments contains reactor physics benchmark specifications that have been derived from experiments that were performed at nuclear facilities around the world. The benchmark specifications are intended for use by reactor designers, safety analysts and nuclear data evaluators to validate calculation techniques and data. Example calculations are presented; these do not constitute a validation or endorsement of the codes or cross-section data. The 2015 edition of the International Handbook of Evaluated Reactor Physics Benchmark Experiments contains data from 143 experimental series that were
International Nuclear Information System (INIS)
Shkola, N.F.; Shevchenko, Yu.A.
1989-01-01
An analog processor, model AP-006, is reported. The processor is a development of a series of spectrometric units based on a shaper of the type 'DL dif +TVS+gated ideal integrator'. Structural and circuits design features are described. The results of testing the processor in a setup with a Si(Li) detecting unit over an input count-rate range of up to 5x10 5 cps are presented. Processor applications are illustrated. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Dahmen, H D; Schuelke, L; Zech, G [Physics Department, Siegen University, Germany, F.R.
1979-02-26
A measurement of parity violating effects in the process e/sup +/e/sup -/ ..-->.. tau/sup +/tau/sup -/ for unpolarized e/sup +/e/sup -/ beams is proposed. For realistic assumptions on the luminosity of PETRA and PEP an estimate shows that the experiment is feasible.
Religiosidade e turismo: o primado da experiência
Directory of Open Access Journals (Sweden)
António Sérgio Araújo de Almeida
Full Text Available Resumo Localizada em um plano complexo e multifacetado, a experiência turística em contexto religioso é fortemente afetada pelos aspectos simbólicos, culturais, sociais e econômicos, presentes no lugar de visitação. É neste sentido que este trabalho se propõe a discutir alguns destes elementos no contexto empírico da Semana Santa de Braga, em Portugal.
International Nuclear Information System (INIS)
Astier, P.; Autiero, D.; Baldisseri, A.; Baldo-Ceolin, M.; Banner, M.; Bassompierre, G.; Benslama, K.; Besson, N.; Bird, I.; Blumenfeld, B.; Bobisut, F.; Bouchez, J.; Boyd, S.; Bueno, A.; Bunyatov, S.; Camilleri, L.; Cardini, A.; Cattaneo, P.W.; Cavasinni, V.; Cervera-Villanueva, A.; Challis, R.C.; Chukanov, A.; Collazuol, G.; Conforto, G.; Conta, C.; Contalbrigo, M.; Cousins, R.; Daniels, D.; Degaudenzi, H.; Del Prete, T.; De Santo, A.; Dignan, T.; Di Lella, L.; Couto e Silva, E. do; Dumarchez, J.; Ellis, M.; Feldman, G.J.; Ferrari, R.; Ferrere, D.; Flaminio, V.; Fraternali, M.; Gaillard, J.-M.; Gangler, E.; Geiser, A.; Geppert, D.; Gibin, D.; Gninenko, S.; Godley, A.; Gomez-Cadenas, J.-J.; Gosset, J.; Goessling, C.; Gouanere, M.; Grant, A.; Graziani, G.; Guglielmi, A.; Hagner, C.; Hernando, J.; Hubbard, D.; Hurst, P.; Hyett, N.; Iacopini, E.; Joseph, C.; Juget, F.; Kent, N.; Kirsanov, M.; Klimov, O.; Kokkonen, J.; Kovzelev, A.; Krasnoperov, A.; Lacaprara, S.; Lachaud, C.; Lakic, B.; Lanza, A.; La Rotonda, L.; Laveder, M.; Letessier-Selvon, A.; Levy, J.-M.; Linssen, L.; Ljubicic, A.; Long, J.; Lupi, A.; Lyubushkin, V.; Marchionni, A.; Martelli, F.; Mechain, X.; Mendiburu, J.-P.; Meyer, J.-P.; Mezzetto, M.; Mishra, S.R.; Moorhead, G.F.; Naumov, D.; Nedelec, P.; Nefedov, Yu.; Nguyen-Mau, C.; Orestano, D.; Pastore, F.; Peak, L.S.; Pennacchio, E.; Pessard, H.; Petti, R.; Placci, A.; Polesello, G.; Pollmann, D.; Polyarush, A.; Popov, B.; Poulsen, C.; Rebuffi, L.; Rico, J.; Riemann, P.; Roda, C.; Rubbia, A.; Salvatore, F.; Schahmaneche, K.; Schmidt, B.; Schmidt, T.; Sconza, A.; Sevior, M.; Sillou, D.; Soler, F.J.P.; Sozzi, G.; Steele, D.; Stiegler, U.; Stipcevic, M.; Stolarczyk, Th.; Tareb-Reyes, M.; Taylor, G.N.; Tereshchenko, V.; Toropin, A.; Touchard, A.-M.; Tovey, S.N.; Tran, M.-T.; Tsesmelis, E.; Ulrichs, J.; Vacavant, L.; Valdata-Nappi, M.; Valuev, V.; Vannucci, F.; Varvell, K.E.; Veltri, M.; Vercesi, V.; Vidal-Sitjes, G.; Vieira, J.-M.; Vinogradova, T.; Weber, F.V.; Weisse, T.; Wilson, F.F.; Winton, L.J.; Yabsley, B.D.; Zaccone, H.; Zei, R.; Zuber, K.; Zuccon, P.
2004-01-01
Bose-Einstein correlations in one and two dimensions have been studied, with high statistics, in charged current muon-neutrino interaction events collected with the NOMAD detector at CERN. In one dimension the Bose-Einstein effect has been analyzed with the Goldhaber and the Kopylov-Podgoretskii phenomenological parametrizations. The Goldhaber parametrization gives the radius of the pion emission region R G =1.01±0.05(stat) +0.09 -0.06 (sys) fm and for the chaoticity parameter the value λ=0.40±0.03(stat) +0.01 -0.06 (sys). Using the Kopylov-Podgoretskii parametrization yields R KP =2.07±0.04(stat) +0.01 -0.14 (sys) fm and λ KP =0.29±0.06(stat) +0.01 -0.04 (sys). Different parametrizations of the long-range correlations have been also studied. The two-dimensional shape of the source has been investigated in the longitudinal comoving frame. A significant difference between the transverse and the longitudinal dimensions is observed. The high statistics of the collected sample allowed the study of the Bose-Einstein correlations as a function of rapidity, charged particle multiplicity and hadronic energy. A weak dependence of both radius and chaoticity on multiplicity and hadronic energy is found
Feminilidade: alteridade e experiência Femininity: alterity and experience
Directory of Open Access Journals (Sweden)
Márcia Arán
2002-06-01
Full Text Available Este ensaio tem como objetivo desenvolver a noção de alteridade na psicanálise a partir dos conceitos de feminilidade e de experiência. Parte de uma crítica à centralidade do modelo Édipo / castração na teoria psicanalítica modelo este que fundamenta uma forma de subjetivação que se faz pelo recalque como defesa ou pela renúncia pulsional - para pensar novas formas de sociabilidade. Inicialmente, procura-se analisar o destino da experiência alteritária na modernidade: o outro como estranho-familiar. Em seguida, através da análise de algumas passagens da obra freudiana, procura-se desen volver a noção de alteridade no registro da imanência, ou seja, como uma abertura para a diferença.The objective of this essay is to elaborate on the notion of alterity in psychoanalysis based on the concepts of femininity and experience. The point of departure is a critique of the centrality of the Oedipean/castration model in psychoanalytical theory (a model underlying a form of subjectivation resulting from repression or denial of drive in order to conceive new forms of sociabilily. The article begins by analyzing lhe fate of the altetily experience in modernity: lhe other as slrange/familiar. Next, by analyzing key passages from Freud's work, lhe author seeks to develop the notion of alterily in lhe context of immanence, that is, as an openness to difference.
A "Uses and Gratification Expectancy Model" to Predict Students' "Perceived e-Learning Experience"
Mondi, Makingu; Woods, Peter; Rafi, Ahmad
2008-01-01
This study investigates "how and why" students' "Uses and Gratification Expectancy" (UGE) for e-learning resources influences their "Perceived e-Learning Experience." A "Uses and Gratification Expectancy Model" (UGEM) framework is proposed to predict students' "Perceived e-Learning Experience," and…
Directory of Open Access Journals (Sweden)
Thitiworn Choosong
2014-06-01
Conclusion: The urinary 1-OHP levels of workers exposed to PAHs were high. The accumulation of 1-OHP in the body was not clear although the workers had long working hours with few days off during their working experience. Therefore, a regular day off schedule and rotation shift work during high productive RSS should be set for RSS workers.
The E166 experiment: Development of an undulator-based ...
Indian Academy of Sciences (India)
A longitudinal polarized positron beam is foreseen for the international linear collider (ILC). A proof-of-principle experiment has been performed in the final focus test beam at SLAC to demonstrate the production of polarized positrons for implementation at the ILC. The E166 experiment uses a 1 m long helical undulator in a ...
Directory of Open Access Journals (Sweden)
Cai Ge Lu
2008-12-01
Full Text Available Actinomyces strain A01 was isolated from soil of a vegetable field in the suburb of Beijing, China. According to the morphological, cultural, physiological and biochemical characteristics, and 16S rDNA sequence analysis, strain A01 was identified as Streptomyces lydicus. In the antimicrobial spectrum test strain A01 presented a stable and strong inhibitory activity against several plant pathogenic fungi such as Fusarium oxysporum, Botrytis cinerea, Monilinia laxa, etc. However, no antibacterial activity was found. In pot experiments in greenhouse, the development of tomato gray mold was markedly suppressed by treatment with the fermentation broth of the strain A01, and the control efficacy was higher than those of Pyrimethanil and Polyoxin. A main antifungal compound (purity 99.503% was obtained from the fermentation broth of strain A01 using column chromatography and HPLC. The chemical structural analysis with UV, IR, MS, and NMR confirmed that the compound produced by the strain A01 is natamycin, a polyene antibiotic produced by S. chattanovgensis, S. natalensis, and S. gilvosporeus, widely used as a natural biological preservative for food according to previous reports. The present study revealed a new producing strain of natamycin and its potential application as a biological control agent for fungal plant diseases.A cepa Actinomyces A01 foi isolada do solo de um campo agrícola no subúrbio de Beijing, China. De acordo com as características morfológicas, culturais, fisiológicas e bioquímicas, e análise da sequência 16S rDNA , a cepa A01 foi identificada como Streptomyces lydicus. Nos testes de espectro antimicrobiano, a cepa A01 apresentou atividade inibitória intensa e estável contra vários fungos patogênicos para plantas, como Fusarium oxysporum, Botrytis cinerea, Monilia laxa, etc. Entretanto, não foi encontrada atividade antibacteriana. Em experimentos em estufas, o desenvolvimento do fungo cinza do tomate foi fortemente
The HKS experiment on Lambda--hypernuclear spectroscopy via electroproduction at JLab
International Nuclear Information System (INIS)
Tang, Liguang; Yuan, Lulin; Acha Quimper, Armando; Ahmidouch, Abdellah; Androic, Darko; Asaturyan, Arshak; Asaturyan, Razmik; Baker, O.; Baturin, Pavlo; Benmokhtar, Fatiha; Bosted, Peter; Carlini, Roger; Chen, X.; Christy, Michael; Cole, Leon; Danagoulian, Samuel; Daniel, Aji; Dharmawardane, Kahanawita; Egiyan, Kim; Elaasar, Mostafa; Ent, Rolf; Fenker, Howard; Fujii, Yu; Furic, Miroslav; Gan, Liping; Gaskell, David; Gasparian, Ashot; Gibson, Edward; Gueye, Paul; Halkyard, Rebekah; Hashimoto, Osamu; Honda, D.; Horn, Tanja; Hu, Bitao; Hu, S.; Hungerford, Ed; Ispiryan, Mikayel; Johnston, Kathleen; Jones, Mark; Kalantarians, Narbe; Kaneta, M.; Kato, F.; Kato, Seigo; Kawama, Daisuke; Keppel, Cynthia; Li, Y.; Luo, Wei; Mack, David; Margaryan, Amur; Marikyan, Gagik; Maruyama, Nayuta; Matsumura, Akihiko; Miyoshi, Toshinobu; Mkrtchyan, Arthur; Mkrtchyan, Hamlet; Nakamura, Satoshi; Navasardyan, Tigran; Niculescu, Gabriel; Niculescu, Maria-Ioana; Nomura, Hiroshi; Nonaka, Kenichi; Ohtani, Atsushi; Okayasu, Yuichi; Pamela, Priscilla; Perez, Naipy; Petkovic, Tomislav; Randeniya, Kapugodage; Reinhold, Joerg; Rivera Castillo, Roberto; Roche, Julie; Rodriguez, Victor; Sato, Yoshinori; Seva, Tomislav; Simicevic, Neven; Smith, Gregory; Sumihama, Mizuki; Song, Yujun; Tadevosyan, Vardan; Takahashi, Toshiyuki; Tamura, Hirokazu; Tvaskis, Vladas; Vulcan, William; Wang, B.; Wells, Stephen; Wood, Stephen; Yan, Chen; Zamkochian, S.
2008-01-01
The HKS (Jlab E01-011) experiment on spectroscopy of Lambda-hypernuclei using (e,e'K+) reaction was successfully carried out in 2005. This paper gives a brief description of the experiment and its technique and shows some of the preliminary spectra that are still under analysis.
Energy Technology Data Exchange (ETDEWEB)
Leroy, J; Martelly, J
1958-12-01
An exponential experiment on a natural uranium and graphite lattice is described. The critical buckling for a cubic pile made with this lattice is B{sup 2} = 0.726 {+-} 0.011 m{sup -2} and the anisotropy {alpha} = (B{sub L}{sup 2}/B{sub T}{sup 2}) is 0.987 {+-} 0.006. The behavior of the neutron density in the lattice near the reflector and sources is discussed in detail. (authors) [French] Une experience exponentielle sur reseau a uranium naturel et graphite est decrite. Le Laplacien de la pile cubique nue, critique, constituee avec un tel reseau serait: B{sup 2} = 0.726 {+-} 0.011 m{sup -2} et l'anisotropie {alpha} (B{sub L}{sup 2}/B{sub T}{sup 2}) est egale a 0.987 {+-} 0.006. La perturbation apportee a la densite de neutrons dans le reseau par le voisinage du reflecteur est discutee en detail. (auteurs)
O ensino e a experiência nas narrativas de professores de Inglês
Directory of Open Access Journals (Sweden)
Annallena de Souza Guedes
2016-09-01
Full Text Available Resumo: Este trabalho tem como objetivo analisar três narrativas de professores de Inglês em exercício, através das quais são reveladas experiências que dizem respeito ao processo de ensinar Inglês em contextos de instituições públicas no Brasil. Pautado no conceito de experiência (MICCOLI, 2010, buscamos compreender quais experiências emergem dessas narrativas e como elas influenciam na prática de ensino dos professores. Ademais, intentamos analisar como os professores de Inglês se veem e quais desafios ele enfrentam nos seus contextos de trabalho. Os resultados desse estudo mostraram que, apesar de todas as experiências de dificuldades e indisciplina reveladas nas narrativas, duas delas parecem ainda encontrar motivação e esperança quanto à sua profissão. Além disso, percebemos que o modo como os professores veem sua realidade, seus alunos e seu trabalho são importantes para caracterizar sua prática profissional. Assim, acreditamos que o contexto e as experiências retratados nas narrativas podem ser caminhos que direcionem as ações desses professores em sala de aula e, consequentemente, possibilitem reflexões e mudanças no seu papel como educador.
Search for neutrino oscillation anti νμ→ anti νe with the KARMEN experiment
International Nuclear Information System (INIS)
Rapp, J.M.
1996-04-01
The neutrino experiment KARMEN at the neutron spallation source ISIS at the Rutherford Appleton Laboratory in England makes use of neutrinos generated by the decay chain of π + produced in the spallation process. The π + and the subsequent μ + decay at rest generates ν μ , ν e and anti ν μ which are emitted isotropically with equal intensity and well defined energies (E ν e from the π - decay chain is less than 0.1%. The unique time structure of the ISIS proton synchrotron allows a separation of ν μ from anti ν μ and ν e by time measurement. The KARMEN-detector is a large volume calorimeter of 67 m 3 liquid organic scintillator, situated about 17 m from the ν-source, investigating neutrino-nucleus interactions at low energies. Cross sections of nuclear excitations through the charged and neutral weak currents spectroscopic quality and the μ-e-universality is tested at energies less than 53 MeV. Further objectives of KARMEN are the search for neutrino flavour oscillations and lepton number violating decays of pions and muons. This work presents the limits for anti ν μ → anti ν e oscillations in the appearance channel obtained after five years of measuring time (July 90-July 95). The data are predominantly evaluated on the basis of a multi-parameter maximum likelihood analysis. (orig.)
Open-Rate Controlled Experiment in E-Mail Marketing Campaigns
Biloš, Antun; Turkalj, Davorin; Kelić, Ivan
2016-01-01
Purpose – The main purpose of this paper is to test the controlled experiment (A/B split) methodology in B2C oriented e-mail marketing campaigns. Design/Methodology/Approach – E-mail marketing techniques have been a substantial part of e-marketing methodology since the early Internet days of the mid-1990s. From the very beginning of Internet utilization for business purposes, e-mail was one of the most widely used communication techniques in B2B and B2C markets alike. Due to high volumes o...
Rare K+ decays from experiment E787
International Nuclear Information System (INIS)
Jain, V.
2000-01-01
This paper presents the latest results from experiment E787, at Brookhaven National Laboratory, on K + -> π + νbar ν and radiative K + decays. The result for K + -> π + νbar ν uses data collected in runs taken during 1995, 1996 and 1997. In addition, they discuss plans for future measurements of K + -> π + νbar ν
The HKS experiment on {lambda}-hypernuclear spectroscopy via electroproduction at JLab
Energy Technology Data Exchange (ETDEWEB)
Tang, L. [Department of Physics, Hampton University, Hampton, VA 23668, U.S.A. (United States); Physics Division, Thomas Jefferson National Accelerator Facility, Newport News, VA 23606, U.S.A. (United States); Yuan, L. [Department of Physics, Hampton University, Hampton, VA 23668 (United States); Acha, A.; Ahmidouch, A.; Androic, D.; Asaturyan, A.; Asaturyan, R.; Baker, O.K.; Baturin, P.; Benmokhtar, F.; Bosted, P.; Carlini, R.; Chen, X.; Christy, M.; Cole, L.; Danagoulian, S.; Daniel, A.; Dharmawardane, V.; Egiyan, K.; Elaasar, M.; Ent, R.; Fenker, H.; Fujii, Y.; Furic, M.; Gan, L.; Gaskell, D.; Gasparian, A.; Gibson, Ed.F.; Gueye, P.; Halkyard, R.; Hashimoto, O.; Honda, D.; Horn, T.; Hu, B.; Hu, S.; Hungerford, Ed.V.; Ispiryan, M.; Johnston, K.; Jones, M.; Kalantarians, N.; Kaneta, M.; Kato, F.; Kato, S.; Kawama, D.; Kepple, C.; Li, Y.; Luo, W.; Mack, D.; Margaryan, A.; Marikyan, G.; Maruyama, N.; Matsumura, A.; Miyoshi, T.; Mkrtchyan, A.; Mkrtchyan, H.; Nakamura, S.N.; Navasardyan, T.; Niculescu, G.; Niculescu, M.-I.; Nomura, H.; Nonaka, K.; Ohtani, A.; Okayasu, Y.; Pamela, P.; Perez, N.; Petkovic, T.; Randeniya, S.; Reinhold, J.; Rivera, R.; Roche, J.; Rodriguez, V.M.; Sato, Y.; Seva, T.; Simicevic, N.; Smith, G.; Sumihama, M.; Song, Y.; Tadevosyan, V.; Takahashi, T.; Tamura, H.; Tvaskis, V.; Vulcan, W.; Wang, B.; Wells, S.; Wood, S.; Yan, C.; Zamkochian, S
2007-06-15
The HKS (Jlab E01-011) experiment on spectroscopy of {lambda}-hypernuclei using (e,e'K{sup +}) reaction was successfully carried out in 2005. This paper gives a brief description of the experiment and its technique and shows some of the preliminary spectra that are still under analysis.
International Reactor Physics Experiment Evaluation (IRPhE) Project
International Nuclear Information System (INIS)
2013-01-01
The International Reactor Physics Experiment Evaluation (IRPhE) Project aims to provide the nuclear community with qualified benchmark data sets by collecting reactor physics experimental data from nuclear facilities, worldwide. More specifically the objectives of the expert group are as follows: - maintaining an inventory of the experiments that have been carried out and documented; - archiving the primary documents and data released in computer-readable form; - promoting the use of the format and methods developed and seek to have them adopted as a standard. For those experiments where interest and priority is expressed by member countries or working parties and executive groups within the NEA provide guidance or co-ordination in: - compiling experiments into a standard international agreed format; - verifying the data, to the extent possible, by reviewing original and subsequently revised documentation, and by consulting with the experimenters or individuals who are familiar with the experimenters or the experimental facility; - analysing and interpreting the experiments with current state-of-the-art methods; - publishing electronically the benchmark evaluations. The expert group will: - identify gaps in data and provide guidance on priorities for future experiments; - involve the young generation (Masters and PhD students and young researchers) to find an effective way of transferring know-how in experimental techniques and analysis methods; - provide a tool for improved exploitation of completed experiments for Generation IV reactors; - coordinate closely its work with other NSC experimental work groups in particular the International Criticality Safety Benchmark Evaluation Project (ICSBEP), the Shielding Integral Benchmark Experiment Data Base (SINBAD) and others, e.g. knowledge preservation in fast reactors of the IAEA, the ANS Joint Benchmark Activities; - keep a close link with the working parties on scientific issues of reactor systems (WPRS), the expert
XbD Video 2, Taxonomy of Experience (ToE) [Online
DEFF Research Database (Denmark)
2013-01-01
This is the second video in the Experience-based Designing series: It describes the Taxonomy of Experience, a structural way of looking at human experiences of almost any kind.This hierarchical model is useful to researchers and decision makers as a general method or tool for guiding the collection......, processing and categorisation of field data about an everyday experience. Researchers using this model often referred to the process as 'doing a ToE'...
Nietzsche e a jubilosa experiência trágica dos gregos
Directory of Open Access Journals (Sweden)
Renato Nunes Bittencourt
2010-10-01
Full Text Available Neste texto analisamos a interpretação de Nietzsche sobre o sentido existencial da experiência trágica realizada pelos antigos gregos na celebração estética e religiosa da Tragédia Ática, e de que modo tal experiência favorece a compreensão imanente e amoral da vida, suprimindo-se ainda qualquer tipo de depreciação moralista em relação ao real.
E-Books and Audiobooks: Extending the Digital Reading Experience
Larson, Lotta C.
2015-01-01
This article examines how sixth-grade students navigated and perceived a combined e-book and audiobook reading experience using Kindle Fires. While audiobooks and e-books are not new, little is known about students' use and perceptions of the combination of these two media, as the ability to synchronize audio contents with digital texts is rather…
International Nuclear Information System (INIS)
Finn, P.A.; Bowers, D.L.; Clemmer, E.D.; Clemmer, R.G.; Graczyk, D.G.; Homa, M.I.; Pappas, G.; Reedy, G.T.; Slawecki, M.A.
1983-01-01
The tritium recovery experiment, TRIO-01, required a gas analysis system which detected the form of tritium, the amount of tritium (differential and integral), and the presence and amount of other radioactive species. The system had to handle all contingencies and function for months at a time; unattended during weekend operation. The designed system, described herein, consisted of a train of components which could be grouped as desired to match tritium release behavior
Gene : CBRC-CJAC-01-0809 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0809 Novel UN B UNKNOWN ZNF99_HUMAN 1e-22 55% dbj|BAC87181.1| unnamed ...protein product [Homo sapiens] 1e-30 69% MLCFKTHAPILSALSFPVFFMQVDPHLPATTESAASSSKGKQSQRVFVWLLLLSYLLFYFLRWSLTL
De Marias e Luizes: experiências devocionais e de gênero numa festa mariana
Directory of Open Access Journals (Sweden)
Martín, Eloísa
2003-01-01
Full Text Available O presente artigo parte de uma pesquisa levada a cabo entre 1998 e 2000 na festa da Virgem de Itatí em Corrientes (Argentina. A partir de dois casos, proponho analisar a maneira pela qual as experiências religiosas e de gênero relacionam-se e se constituem mutuamente a través de certas práticas devocionais. Tais práticas, transmitidas e reproduzidas por meio de laços familiares também marcadas por diferenciais de gênero, se processam em termos de um compromisso com a Virgem, mas também com as tradições locais e com os próprios laços de parentesco. Assim, através de certas práticas de devoção, veremos como se aprende a ser, ao mesmo tempo e desde o início, mulher e devota, homem e devoto
Directory of Open Access Journals (Sweden)
Drasko Boko
2010-01-01
Full Text Available Methanogenic archaea possess unusual seryl-tRNA synthetases (SerRS, evolutionarily distinct from the SerRSs found in other archaea, eucaryotes and bacteria. Our recent X-ray structural analysis of Methanosarcina barkeri SerRS revealed an idiosyncratic N-terminal domain and catalytic zinc ion in the active site. To shed further light on substrate discrimination by methanogenic-type SerRS, we set up to explore in vivo the interaction of methanogenic-type SerRSs with their cognate tRNAs in Escherichia coli or Saccharomyces cerevisiae. The expression of various methanogenic-type SerRSs was toxic for E. coli, resulting in the synthesis of erroneous proteins, as revealed by β-galactosidase stability assay. Although SerRSs from methanogenic archaea recognize tRNAsSer from all three domains of life in vitro, the toxicity presumably precluded the complementation of endogenous SerRS function in both, E. coli and S. cerevisiae. However, despite the observed toxicity, coexpression of methanogenic-type SerRS with its cognate tRNA suppressed bacterial amber mutation.
Reactor IPEN/MB-01 dosimetry using TLDs
Energy Technology Data Exchange (ETDEWEB)
Cavalieri, Tássio A.; Siqueira, Paulo T.D.; Yoriyaz, Hélio, E-mail: tassio.cavalieri@usp.br [Instituto de Pesquisas Energética s e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil)
2017-07-01
This paper is a preliminary study on the use of reactor IPEN/MB-01 as standard radiation source for mixed field dosimetry studies. As a first step on this attempt, simulations and experiments, evaluating the neutron and gamma field distributions, were performed and compared. TLDs are widely employed in dose measurements and the TLD 100 / TLD 700 pair conforms with ICRU recommendations for mixed field dosimetry. In this study, TLD irradiations were performed in the IPEN/MB-01 nuclear reactor. IPEN/MB-01 reactor is zero power reactor widely used to perform reactor physics experiments. Its neutron flux distribution is well known for a variety of reactor core configurations. However, the photon fluxes are unknown. A series of experiments with TLD 100 and TLD 700 were performed for two different core configurations (rectangular and cylindrical with a central flux trap). Simulations with MCNP5 for these two configurations were also done, and neutron and gamma fluxes distributions along the core were computed. The responses of TLD 100 and TLD 700 were compared with simulated fluxes and showing a good agreement between them. This paper presents the results of the experiments done so far given the status of the study under way in order to couple IPEN/MB-01 and TLD 100 / 700 pair into a mixed field calibration methodology. (author)
A Low Cost C8051F006 SoC-Based Quasi-Static C-V Meter for Characterizing Semiconductor Devices
Directory of Open Access Journals (Sweden)
Khairurrijal Khairurrijal
2012-12-01
Full Text Available Based on a C8051F006 SoC (system on-a-chip, a simple and low cost quasi-static capacitance-voltage (C-V meter was designed and developed to obtain C-V characteristics of semiconductor devices. The developed C-V meter consists of a capacitance meter, a programmable voltage source, a C8051F006 SoC-based slave controller, and a personal computer (PC as a master controller. The communication between the master and slave controllers is facilitated by the RS 232 serial communication. The accuracy of the C-V meter was guaranteed by the calibration functions, which are employed by the program in the PC and obtained through the calibration processes of analog to digital converter (ADC, digital to analog converters (DACs of the C8051F006 SoC, and the programmable voltage source. Examining 33-pF and 1000-pF capacitors as well three different p-n junction diodes, it was found that the capacitances of common capacitors are in the range of specified values and typical C-V curves of p-n junction diodes are achieved.
SIEX design predictions for the PNC fuel pins in the HEDL P-E01 power-to-melt test
International Nuclear Information System (INIS)
1979-01-01
During the design phase of the HEDL P-E01 power-to-melt test, a series of design predictions were generated for the three PNC pins using the SIEX fuel pin modeling code. This document tabulates a series of selected PNC pin design predictions as requested by M. Shinohara during his visit to HEDL
The challenges of new nuclear projects. E.ON Experience
International Nuclear Information System (INIS)
Spechty, J.; Perez Rodriguez, J. L.
2012-01-01
E.ON is one of the largest privately-owned energy companies in the world. Its portfolio of nuclear assets in composed of 21 nuclear power plants on 13 sites located in Germany and Sweden, 9 of which are directly operated by E.ON. At present E.ON develops large-scale construction projects in two of the European countries willing to commit to new nuclear build-Finland and UK - for which its experience as the best nuclear power plant operator in Europe is key. (Author)
Feasibility of a 81Br(ν,e-) 81Kr solar neutrino experiment
International Nuclear Information System (INIS)
Hurst, G.S.; Chen, C.H.; Kramer, S.D.; Cleveland, B.T.; Davis, R. Jr.; Rowley, R.K.; Gabbard, F.; Schima, F.J.
1984-01-01
A solar neutrino experiment utilizing the interaction of 81 Br(ν,e - ) 81 Kr to study the 7 Be neutrino source in the interior of the sun is shown to be feasible. Resonance ionization spectroscopy was used to count less than 1000 atoms of 2 x 10 5 -yr 81 Kr, making the bromine experiment possible. Except for the method of counting product atoms, the bromine experiment would be very similar to the successful chlorine detector 37 Cl(ν,e - ) 37 Ar, and thus it is a natural sequel to the only solar neutrino experiment to date
Energy Technology Data Exchange (ETDEWEB)
Fu, Lingling; Lin, Dunmin; Zheng, Qiaoji; Wu, Xiaochun; Xu, Chenggang [College of Chemistry and Materials Science, and Visual Computing and Virtual Reality Key Laboratory of Sichuan Province, Sichuan Normal University, Chengdu 610066 (China)
2012-11-15
Lead-free piezoelectric ceramics (K{sub 0.94-x}Na{sub x}Li{sub 0.06})(Nb{sub 0.94}Sb{sub 0.06})O{sub 3} have been fabricated by a conventional ceramic technique and the effects of K{sup +}/Na{sup +} ratio on the structure and piezoelectric properties of the ceramics have been studied. All the ceramics possess a pure perovskite structure. The coexistence of tetragonal and orthorhombic phases is formed at room temperature in the ceramics with 0.45 {<=} x {<=} 0.55. The tetragonal-orthorhombic phase-transition temperature T{sub O-T} decreases from 110 to 54 C with x increasing from 0.35 to 0.55 and then increases from 84 to 144 C with x further increasing from 0.6 to 0.7, while the Curie temperature T{sub C} deceases from 388 to 348 C with x increasing from 0.35 to 0.70. Because of the coexistence of the two phases near room temperature, the ceramics with x = 0.50 exhibit the optimum piezoelectric properties: d{sub 33} = 230 pC/N and k{sub p} = 49%. The ceramics possess good time stability of piezoelectric properties. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Biometria e características físico-químicas da fruta-pão (Artocarpus altilis
Directory of Open Access Journals (Sweden)
Erick dos Anjos Bezerra
2017-02-01
Full Text Available A espécie Artocarpus altilis produz frutos popularmente conhecidos como fruta-pão. São climatéricos e contribuem com quantidades consideráveis de energia e fornecer os principais nutrientes da dieta. Podem ser consumidos cozidos, fritos ou torrados e em processos tecnológicos tendo potencial para ser empregados em biscoitos e comercializados como farinha. Na literatura são poucos os trabalhos que relatem as características desses frutos, principalmente da região Nordeste. Desta forma, objetivou-se avaliar a biometria e as características físico-químicas da fruta-pão coletada no município de Santa Rita, Paraíba, Brasil. Foram selecionados 30 frutos firmes em 3 estádios de maturação, com pedúnculo, casca verde e amarelada, látex presente e livres de lesões. Os frutos apresentaram em média diâmetro externo transversal e diâmetro externo longitudinal de 15,98 (± 0,12 e 13,11 (± 0,13 cm, respectivamente, bem como massa média de 1,52 (± 0,06 Kg e firmeza de 66,80 (± 1,13 N. Quanto a composição centesimal apresentou valores de umidade, cinzas, proteína, lipídeos e carboidrato de 68,76% (± 0,02, 0,61% (± 0,01, 1,73 ± (0,00, 0,55% (± 0,01 e 28,35%, respectivamente, valor energético 125,27 Kcal, teor de amido de 24,68% (± 0,39, °Brix 2,01 (± 0,01, pH 6,4 (±0,01, fenólicos 0,023% (± 0,02 de ácido tânico e Aw 0,993 (± 0,00. De acordo com os resultados das físico-químicas, os frutos estudados apresentaram grande potencial para serem explorados comercialmente pela indústria de alimentos.Biometrics and physical-chemical characteristics of breadfruit (Artocarpus altilisAbstract: The species Artocarpus altilis produces fruits popularly known as breadfruit. They are climacteric and contribute considerable amounts of energy and provide the main nutrients in the diet. They can be consumed cooked, fried or roasted and in technological processes having potential to be used in cookies and marketed as flour. In the
A road map to solar neutrino fluxe, neutrino oscillation parameters, and tests for new physics
Bahcall, J N; Bahcall, John N.; Peña-Garay, Carlos
2003-01-01
We analyze all available solar and related reactor neutrino experiments, as well as simulated future ^7Be, p-p, pep, and ^8B solar neutrino experiments. We treat all solar neutrino fluxes as free parameters subject to the condition that the total luminosity represented by the neutrinos equals the observed solar luminosity (the `luminosity constraint'). Existing experiments show that the p-p solar neutrino flux is 1.01 + - 0.02 (1 sigma) times the flux predicted by the BP00 standard solar model; the ^7Be neutrino flux is 0.97^{+0.28}_{-0.54} the predicted flux; and the ^8B flux is 1.01 + - 0.06 the predicted flux. The oscillation parameters are: Delta m^2 = 7.3^{+0.4}_{-0.6} 10^{-5} eV^2 and tan^2 theta_{12} = 0.42^{+0.08}_{-0.06}. We evaluate how accurate future experiments must be to determine more precisely neutrino oscillation parameters and solar neutrino fluxes, and to elucidate the transition from vacuum-dominated to matter-dominated oscillations. A future ^7Be nu-e scattering experiment accurate to + -...
International Reactor Physics Experiment Evaluation (IRPhE) Project. IRPhE Handbook - 2017 edition
International Nuclear Information System (INIS)
2017-01-01
The International Reactor Physics Evaluation (IRPhE) Project was initiated as a pilot in 1999 by the Nuclear Energy Agency (NEA) Nuclear Science Committee (NSC). The project was endorsed as an official activity of the NSC in June 2003. While the NEA co-ordinates and administers the IRPhE Project at the international level, each participating country is responsible for the administration, technical direction and priorities of the project within their respective countries. The information and data included in this handbook are available to NEA member countries, to all contributing countries and to others on a case-by-case basis. The IRPhE Project is patterned after the International Criticality Safety Benchmark Evaluation Project (ICSBEP). It closely co-ordinates with the ICSBEP to avoid duplication of efforts and publication of conflicting information. Some benchmark data are applicable to both nuclear criticality safety and reactor physics technology. Some have already been evaluated and published by the ICSBEP, but have been extended to include other types of measurements in addition to the critical configuration. Through this effort, the IRPhE Project will be able to 1) consolidate and preserve the existing worldwide information base; 2) retrieve lost data; 3) identify areas where more data are needed; 4) draw upon the resources of the international reactor physics community to help fill knowledge gaps; 5) identify discrepancies between calculations and experiments due to deficiencies in reported experimental data, cross-section data, cross-section processing codes and neutronics codes; 6) eliminate a large amount of redundant research and processing of reactor physics experiment data, and 7) improve future experimental planning, execution and reporting. This handbook contains reactor physics benchmark specifications that have been derived from experiments performed at nuclear facilities around the world. The benchmark specifications are intended for use by
Derivation of the human embryonic stem cell line RCe006-A (RC-2
Directory of Open Access Journals (Sweden)
P.A. De Sousa
2016-03-01
Full Text Available The human embryonic stem cell line RCe006-A (RC-2 was derived from a frozen and thawed blastocyst voluntarily donated as surplus to fertility requirements following ethics committee approved informed consent under licence from the UK Human Fertilisation and Embryology Authority. The cell line exhibits expression of expected pluripotency markers and in vitro differentiation potential to three germinal lineage representative cell populations. It has a male trisomy 12 karyotype (47XY, +12. Microsatellite DNA marker identity and HLA and blood group typing data are available.
Directory of Open Access Journals (Sweden)
Eleandro Aparecido Tronchini
2012-12-01
Full Text Available CONTEXT: Diabetes mellitus is a disease characterized by hyperglycemia that, when allowed to progress long-term untreated, develops vascular and neurological complications, which are responsible for the development of alterations in the enteric nervous system in diabetic patients. In the gastrointestinal tract, diabetes mellitus promotes motor and sensory changes, and in the reflex function of this system, causing gastroparesis, diarrhea, constipation, megacolon, slow gastrointestinal transit, gastric stasis and dilation with decreased or increased peristaltic contractions. Several studies have shown that oxidative stress is the main responsible for the vascular and neurological complications affecting the enteric nervous system of diabetics. OBJECTIVE: The effects of 0.1% and 2% vitamin E on myosin-V- and nNOS-immunoreactive neurons in the jejunum of diabetic rats were investigated. METHODS: Thirty rats were divided into the groups: normoglycemic, normoglycemic treated with 0.1% vitamin E, normoglycemic treated with 2% vitamin E, diabetic, diabetic treated with 0.1% vitamin E, and diabetic treated with 2% vitamin E. The neuronal density and areas of neuron cell bodies were determined. RESULTS: Diabetes (diabetic group significantly reduced the number of myosin-V-immunoreactive neurons compared with the normoglycemic group. The diabetic treated with 0.1% vitamin E and diabetic treated with 2% vitamin E groups did not exhibit a greater density than the D group (P>0.05. Nitrergic density did not change with diabetes (P>0.05. The areas of myosin-V- and nNOS-immunoreactive neurons significantly increased in the normoglycemic treated with 2% vitamin E and diabetic groups compared with the normoglycemic group. CONCLUSION: Supplementation with 2% vitamin E had a neurotrophic effect only in the area of myosin-V-immunoreactive neurons compared with the diabetic group.
Infância, experiência e performatividade: primeiras aproximações
Directory of Open Access Journals (Sweden)
Sandro Vinicius Sales dos Santos
2014-08-01
Full Text Available http://dx.doi.org/10.5007/1980-4512.2014n30p31 O presente trabalho apresenta e discute alguns resultados parciais de uma pesquisa de mestrado em andamento que objetiva analisar as experiências vivenciadas por crianças de quatro anos no interior de uma instituição pública de educação infantil. O estudo de caráter interpretativo busca suas bases teóricas na sociologia da infância e nas pedagogias da infância e da educação infantil. Do ponto de vista metodológico, a pesquisa se fundamenta em um estudo de caso (ANDRÉ, 1991; SARMENTO, 2003 assumindo uma lógica de investigação etnográfica (CASTANHEIRA, 2004; GREEN, DIXON, ZAHALIRICK, 2005, tendo como principais instrumentos de coleta de dados, a observação participante, fotografias e desenhos articulados com a oralidade; entrevista com crianças e adultos, dentre outros. Discute ainda a noção de experiência infantil como a possibilidade de análise das formas de sociabilidade das crianças. Palavras-chave: infância, crianças, educação infantil, experiência infantil, ponto de vista das crianças.
Testing the QGSJET01 and QGSJETII-04 models with the help of atmospheric muons
Dedenko, Leonid G.; Lukyashin, Anton V.; Roganova, Tatiana M.; Fedorova, Galina F.
2017-06-01
More accurate original calculations of the atmospheric vertical muon energy spectra at energies 102 - 105 GeV have been carried out in terms of the QGSJET01 and QGSJETII-04 models. The Gaisser-Honda approximations of the measured energy spectra of primary protons, helium and nitrogen nuclei have been used. The CORSIKA package has been used to simulate cascades in the standard atmosphere induced by different primary particles with various fixed energies E. Statistics of simulated cascades for secondary particles with energies (0.01 - 1) · E was increased up to 106. It has been shown that predictions of the QGSJET01 and QGSJETII-04 models for these muon fluxes are below the data of the classical experiments L3 + Cosmic, MACRO and LVD by factors of ˜ 1.7-2 at energies above 102 GeV. It has been concluded that these tested models underestimate the production of the most energetic secondary particles, namely, π-mesons and K-mesons, in interactions of primary protons and other primary nuclei with nuclei in the atmosphere by the same factors.
Coincidence (e,e'p) Scattering on 40Ar and 48Ti to Aid Precision Neutrino Oscillation Experiments
Abrams, Dan; E12-14-012 Collaboration
2017-09-01
Neutrino oscillations are an active area of research, with experiments such as DUNE (Deep Underground Neutrino Experiment). DUNE will make use of large liquid argon detectors to perform a precision measurement of the CP violating phase. Hence, an understanding of the argon nuclear ground state and its response to (anti-)neutrino interactions is of paramount importance. Information about the nuclear ground state is encapsulated in the spectral function, S (k , E) , the joint probability of removing a nucleon of momentum k = |k | from the ground state leaving the residual (A-1) system with excitation energy E. E12-14-012 at Jefferson Lab ran in early 2017 and has measured the argon spectral function through coincidence (e ,e' p) scattering on 40Ar and 48Ti. The results of E12-14-012 are important to both the neutrino and nuclear physics communities. A direct measurement of the coincidence (e ,e' p) cross section from 40Ar and 48Ti will provide valuable information about the argon nucleus, as well as the experimental input necessary to constrain theoretical models used to calculate S (k , E) , paving the way for reliable estimates of the neutrino cross sections. Data from E12-14-012 is currently being analyzed at UVA and Va. Tech. Supported in part by the Department of Energy Grant No: DE-FG02-96ER40950.
Tempo e Trânsito na Experiência Subjetiva de Motoristas
Ana Inez Oka Elvas de Lima; Sylvia Cavalcante
2015-01-01
Esta pesquisa investiga como são percebidos e vivenciados o tempo e a pressa no trânsito por motoristas de Fortaleza, identificando e analisando seus estados subjetivos e comportamentos associados a essa experiência. Para a coleta de dados, organizaram-se quatro grupos focais, a partir dos quais emergiram diversos elementos relacionados ao tempo e à pressa e à incidência de comportamentos inadequados no trânsito, segundo o sexo e a idade dos participantes. Para analisar os dados obtidos nas d...
Telford, Mark; Senior, Emma
2017-06-08
This article describes the experiences of undergraduate healthcare students taking a module adopting a 'flipped classroom' approach. Evidence suggests that flipped classroom as a pedagogical tool has the potential to enhance student learning and to improve healthcare practice. This innovative approach was implemented within a healthcare curriculum and in a module looking at public health delivered at the beginning of year two of a 3-year programme. The focus of the evaluation study was on the e-learning resources used in the module and the student experiences of these; with a specific aim to evaluate this element of the flipped classroom approach. A mixed-methods approach was adopted and data collected using questionnaires, which were distributed across a whole cohort, and a focus group involving ten participants. Statistical analysis of the data showed the positive student experience of engaging with e-learning. The thematic analysis identified two key themes; factors influencing a positive learning experience and the challenges when developing e-learning within a flipped classroom approach. The study provides guidance for further developments and improvements when developing e-learning as part of the flipped classroom approach.
International Nuclear Information System (INIS)
Cerny, V.
1983-01-01
A model based estimate is presented of the geometrical acceptance of the HYPERON spectrometer for the detection of the e + e - pairs in the proposed lepton experiment. The results of the Monte Carlo calculation show that the expected acceptance is fairly high. (author)
Proposed solar neutrino experiment using 81Br(nu,e-)81Kr
International Nuclear Information System (INIS)
Hurst, G.S.; Chen, C.H.; Kramer, S.D.; Allman, S.L.
1984-12-01
It has now been shown that it is feasible to measure the 7 Be neutrino source in the sun by using the reaction 81 Br(nu,e - ) 81 Kr in a radiochemical experiment. Such an experiment would be quite similar to the Davis, Cleveland, and Rowley method for measuring the 8 B neutrino using 37 Cl(nu,e - ) 37 Ar except that the resonance ionization spectroscopy (RIS) method (instead of decay counting) would be employed to count the 2 x 10 5 -yr 81 Kr atoms
Status and future of the experiment PS 170 (anti pp → e+e-)
International Nuclear Information System (INIS)
Duclos, J.
1985-03-01
The LEAR experiment PS170 is designed to detect the e +- pairs from anti p-annihilation. It aims to measure the proton form factors in the time like region and the spectrum of vector mesons in the mass range: 1-1,6 GeV. Data have been taken at 300, 600 and 1500 MeV/c incident momenta. The analysis of the 300 MeV/c data gave 200 2-body events: (anti pp → e + e - ), clearly separated from the hadronic background. Values of the form factors are extracted near threshold. The next step will be to accumulate sufficient data to measure separately the electric and magnetic components up to 600 MeV/c. The use of an internal target is considered for measurements at high momenta
Portable exhausters POR-004 SKID B, POR-005 SKID C, POR-006 SKID D storage plan
International Nuclear Information System (INIS)
Nelson, O.D.; Keller, G.M.
1997-01-01
This document provides a storage plan for portable exhausters POR-004 SKID B, POR-005 SKID C, AND POR-006 SKID D. The exhausters will be stored until they are needed by the TWRS (Tank Waste Remediation Systems) Saltwell Pumping Program. The storage plan provides criteria for portable exhauster storage, periodic inspections during storage, and retrieval from storage
Rodgers, K K; Villey, I J; Ptaszek, L; Corbett, E; Schatz, D G; Coleman, J E
1999-07-15
RAG1 and RAG2 are the two lymphoid-specific proteins required for the cleavage of DNA sequences known as the recombination signal sequences (RSSs) flanking V, D or J regions of the antigen-binding genes. Previous studies have shown that RAG1 alone is capable of binding to the RSS, whereas RAG2 only binds as a RAG1/RAG2 complex. We have expressed recombinant core RAG1 (amino acids 384-1008) in Escherichia coli and demonstrated catalytic activity when combined with RAG2. This protein was then used to determine its oligomeric forms and the dissociation constant of binding to the RSS. Electrophoretic mobility shift assays show that up to three oligomeric complexes of core RAG1 form with a single RSS. Core RAG1 was found to exist as a dimer both when free in solution and as the minimal species bound to the RSS. Competition assays show that RAG1 recognizes both the conserved nonamer and heptamer sequences of the RSS. Zinc analysis shows the core to contain two zinc ions. The purified RAG1 protein overexpressed in E.coli exhibited the expected cleavage activity when combined with RAG2 purified from transfected 293T cells. The high mobility group protein HMG2 is stably incorporated into the recombinant RAG1/RSS complex and can increase the affinity of RAG1 for the RSS in the absence of RAG2.
Assessing the User Experience of E-Books in Academic Libraries
Zhang, Tao; Niu, Xi; Promann, Marlen
2017-01-01
We report findings from an assessment of e-book user experience (search and information seeking) from usage data and user tests. The usage data showed that most reading sessions were brief and focused on certain pages, suggesting that users mainly use e-books to find specific information. The user tests found that participants tended to use…
Muon polarization in the MEG experiment: predictions and measurements
International Nuclear Information System (INIS)
Baldini, A.M.; Dussoni, S.; Galli, L.; Grassi, M.; Sergiampietri, F.; Signorelli, G.; Bao, Y.; Hildebrandt, M.; Kettle, P.R.; Mtchedlishvili, A.; Papa, A.; Ritt, S.; Baracchini, E.; Bemporad, C.; Cei, F.; D'Onofrio, A.; Nicolo, D.; Tenchini, F.; Berg, F.; Hodge, Z.; Rutar, G.; Biasotti, M.; Gatti, F.; Pizzigoni, G.; Boca, G.; De Bari, A.; Cattaneo, P.W.; Rossella, M.; Cavoto, G.; Piredda, G.; Renga, F.; Voena, C.; Chiarello, G.; Panareo, M.; Pepino, A.; Chiri, C.; Grancagnolo, F.; Tassielli, G.F.; De Gerone, M.; Fujii, Y.; Iwamoto, T.; Kaneko, D.; Mori, Toshinori; Nakaura, S.; Nishimura, M.; Ogawa, S.; Ootani, W.; Sawada, R.; Uchiyama, Y.; Yoshida, K.; Graziosi, A.; Ripiccini, E.; Grigoriev, D.N.; Haruyama, T.; Mihara, S.; Nishiguchi, H.; Yamamoto, A.; Ieki, K.; Ignatov, F.; Khazin, B.I.; Popov, A.; Yudin, Yu.V.; Kang, T.I.; Lim, G.M.A.; Molzon, W.; You, Z.; Khomutov, N.; Korenchenko, A.; Kravchuk, N.; Venturini, M.
2016-01-01
The MEG experiment makes use of one of the world's most intense low energy muon beams, in order to search for the lepton flavour violating process μ + → e + γ. We determined the residual beam polarization at the thin stopping target, by measuring the asymmetry of the angular distribution of Michel decay positrons as a function of energy. The initial muon beam polarization at the production is predicted to be P μ = -1 by the Standard Model (SM) with massless neutrinos. We estimated our residual muon polarization to be P μ =.0.86 ± 0.02 (stat) -0.06 +0.05 (syst) at the stopping target, which is consistent with the SM predictions when the depolarizing effects occurring during the muon production, propagation and moderation in the target are taken into account. The knowledge of beam polarization is of fundamental importance in order to model the background of our μ + → e + γ search induced by the muon radiative decay: μ + → e + anti ν μ ν e γ. (orig.)
Emoções e pesquisa narrativa: transformando experiências de aprendizagem
Directory of Open Access Journals (Sweden)
Rodrigo Aragão
2008-01-01
Full Text Available Este artigo explora a influência de uma pesquisa narrativa nas experiências de aprendizagem de estudantes de Letras/Inglês. Ao refletir sobre suas histórias de aprendizagem, eles deram voz e sentido às suas experiências, sentindo-se valorizados. Suas histórias de aprendizagem expõem a relevância das emoções no desenvolvimento de habilidades orais, na reflexão e na responsabilidade por sua trajetória profissional. Três participantes transformaram suas experiências de aprendizagem de inglês ao refletir sobre as emoções que limitam seu desempenho oral e ao projetar imagens que representassem o desejo de se tornarem falantes fluentes. Porém, transformar os desejos em ações pode envolver investimentos que extrapolam a tomada de consciência na reflexão pela pesquisa.This article explores the influence of a narrative research on the language learning experiences of undergraduate students of English. As they reflect upon their language learning histories, they give voice and meaning to their experiences and their self-esteem improves. Their language learning histories reveal the relevance of emotions in their oral skills development, reflection, and responsibility for their professional trajectories. Three participants transformed their language experiences by reflecting on the emotions that restrained their speaking skills and projecting images that would represent their desire to become fluent speakers. However, transforming their desires into actions entails dealing with investments that may go beyond reflection fostered by this research.
Po'ad, F. A.; Ismail, W.; Jusoh, J. F.
2017-08-01
This paper describes the experiments and analysis conducted on 2.4 GHz embedded active Radio Frequency Identification (RFID) - Wireless Sensor Network (WSN) based system that has been developed for the purposes of location tracking and monitoring in indoor and outdoor environments. Several experiments are conducted to test the effectiveness and performance of the developed system and two of them is by measuring the Radio Frequency (RF) transmitting power and Received Signal Strength (RSS) to prove that the embedded active RFID tag is capable to generate higher transmit power during data transmission and able to provide better RSS reading compared to standalone RFID tag. Experiments are carried out on two RFID tags which are active RFID tag embedded with GPS and GSM (ER2G); and standalone RFID tag communicating with the same active RFID reader. The developed ER2G contributes 12.26 % transmit power and 6.47 % RSS reading higher than standalone RFID tag. The results conclude that the ER2G gives better performance compared to standalone RFID tag and can be used as guidelines for future design improvements.
Usabilidade e user experience: essencial para aceitabilidade de produtos e serviços
Directory of Open Access Journals (Sweden)
Antonio Mendes Silva Filho
2011-11-01
Full Text Available Usabilidade é um atributo de qualidade essencial que tem sido usado pelas empresas para conquistar novos consumidores. E, você quando busca adquirir um novo produto (ou serviço, você intenciona (a atingir objetivos (que atendam suas necessidades num determinado contexto; (b eficiência (obtendo um resultado ou solução, de modo eficiente e produtivo, para um problema que tenha em mãos; e (c satisfação (de maneira subjetiva no uso do produto ou serviço. Esses três aspectos destacados compreendem os fatores, utilizados pela Norma 9241-11 da ISO (International Organization for Standardization para definir a usabilidade. De acordo com a Norma 9241-11 da ISO (International Organization for Standardization, a usabilidade é definida como “The extent to which a product can be used by specified users to achieve specified goals with effectiveness, efficiency, and satisfaction in a specified context of use”. Esses objetivos compreendem a base do que é denominado “user experience”. Mas, o que é user experience? Trata-se da experiência do usuário quando interage com produtos ou serviços. Um produto pode ser qualquer coisa como, por exemplo, um tablet, um aparelho celular ou smartphone, um painel de automóvel ou software. Qualquer desses produtos ou até serviços (como oferecidos em web sites, têm a usabilidade como atributo determinante da qualidade perceptível aos usuários. Nesse sentido, o objetivo deste artigo é discutir a usabilidade e estratégias de sua avaliação.
International Nuclear Information System (INIS)
Walker, D.H.; Savin, N.L.
1985-01-01
The calculational models developed for the Reactor Safety Study (RSS) have traditionally been used to generate 'point estimate values' for radionuclide release to the environment for nuclear power plant risk assessments. The point estimate values so calculated are acknowledged by most knowledgeable individuals to be conservatively high. Further, recent evaluations of the overall uncertainties in the various components that make up risk estimates for nuclear electric generating stations show that one of the large uncertainties is associated with the magnitude of the radionuclide release to the environment. In the approach developed for the RSS, values for fission product release from the fuel are derived from data obtained from small experiments. A reappraisal of the RSS release fractions was published in 1981 in NUREG-0772. Estimates of fractional releases from fuel are similar to those of the RSS. In the RSS approach, depletion during transport from the core (where the fission products are released) to the containment is assumed to be zero for calculation purposes. In the containment, the CORRAL code is applied to calculate radioactivity depletion by containment processes and to calculate the quantity and timing of release to the environment
Directory of Open Access Journals (Sweden)
Adair Menezes Jr.
2012-01-01
Full Text Available CONTEXTO: Vivências psicóticas e dissociativas não patológicas são comuns na população geral, especialmente em grupos religiosos. Há poucos estudos sobre o perfil da população não clínica com essas vivências, bem como há dúvidas sobre critérios para o diagnóstico diferencial dessas experiências. OBJETIVOS: Identificar o perfil sociodemográfico e de experiências anômalas (EA entre pessoas que buscaram ajuda em centros espíritas. MÉTODOS: Foram entrevistadas 115 pessoas que procuraram auxílio em seis centros espíritas de Juiz de Fora/MG por causa de vivências psicóticas e/ou dissociativas. Entrevista semiestruturada investigou dados sociodemográficos, experiências anômalas apresentadas e a presença de critérios propostos para identificar experiências espirituais não patológicas. RESULTADOS: Predomínio de mulheres (70%, de meia-idade, com alta escolaridade, ativas ocupacionalmente e cujas EA começaram na infância (65% ou adolescência (23%. As EA mais frequentes foram alucinações visuais (63%, auditivas (54%, "percepção espiritual" (53%, "sonhos paranormais" (38% e experiências fora do corpo (31%. Para a maioria da amostra, essas EA não traziam prejuízos sócio-ocupacionais, eram curtas, episódicas e benéficas; entretanto referiram sofrimento emocional e falta de controle sobre elas. CONCLUSÃO: A alta frequência e diversidade de EA encontradas, bem como suas implicações teóricas, clínicas e de saúde pública, indicam a urgência de maior atenção a esse tópico.BACKGROUND: Non-pathological psychotic and dissociative experiences are frequent in the general population, particularly in religious groups. There are few studies on the profile of non-clinical populations with these experiences, and on criteria for differential diagnosis. OBJECTIVES: To identify the sociodemographic profile and anomalous experiences (AE among people who sought help in spiritualist groups. METHODS: We interviewed 115
Empirical study on flow experience in China tourism e-commerce market
Directory of Open Access Journals (Sweden)
Jianling Wang
2015-04-01
Full Text Available Purpose: While tourism e-commerce develops rapidly in China, these channels are truly new to both web providers and web consumers, understanding the nature of these media attaches greater importance. This study investigates the mediation effects of flow experience on the relationship between motivation and behavior intention in tourism e-commerce.Design/methodology/approach: Based on the technology acceptance model, an empirical study is designed to test this relationship.we estimated the measurement model with 13 manifest indicators and 4 latent constructs by CFA to assess the reliability and validity of the construct measures, then tested hypotheses by OLS regression and a formal three-step mediation procedure.Findings: Overall, the results reveal that trust is incorporated in motivation and play it’s role together with other motivations; telepresence and concentration are confirmed in flow experience, and both partially mediated the relationship.Research limitations/implications: This study demonstrates that to improve consumers’ usage adoption, marketers should pay much attention to not only consumers’ motivation but also the areas such as flow experience.Originality/value: This study takes flow experience as a new perspective to explore china tourism e-commerce, estimates its measurement and tests its roles between motivation and behavior intention.
Review of e+e- experiments with PLUTO from 3 to 31 GeV
International Nuclear Information System (INIS)
Criegee, L.; Knies, G.
1981-07-01
The contributions of the PLUTO experiment to e + e - physics at collision energies in the range of 3-31 GeV are reviewed. The review briefly sketches the storage rings DORIS and PETRA at DESY, and describes the most important features of the PLUTO detector, of data processing, and of the analysis methods. It covers the physics results in the fields of electroweak interactions, of the heavy lepton tau and the search for still heavier leptons, of hadron production with evidence for quark and gluon jets, as well as multiparton effects, of UPSILON decays and their relation to QCD, and concludes with first results in high-energy photon-photon interactions. (orig.)
IE Supplement No. 2 to Bulletin No. 79-01B: Environmental qualification of Class 1E equipment
International Nuclear Information System (INIS)
Anon.
1993-01-01
Enclosed are the generic questions and answers which resulted from NRC/Licensee meetings in NRC Regional Offices during the week of July 14, 1980 regarding environmental qualification of Class 1E equipment in use at power reactor facilities. These answers address specific questions asked during the meetings. Due to the generic nature of some of these questions, the staff is issuing them as a bulletin supplement. Some answers given in Supplement No. 1 to IEB-79-01B are superseded by these answers
Energy Technology Data Exchange (ETDEWEB)
Tang, Liguang; Chen, Chunhua; Gogami, Toshiyuki; Kawama, Daisuke; Han, Yuncheng; Yuan, Lulin; Matsumura, Akihiko; Okayasu, Yuichi; Seva, Tomislav; Rodriguez, Victor; Baturin, Pavlo; Acha Quimper, Armando; Achenbach, Carsten; Ahmidouch, Abdellah; Albayrak, Ibrahim; Androic, Darko; Asaturyan, Arshak; Asaturyan, Razmik; Ates, Ozgur; Badui, Rafael; Baker, Oliver; Benmokhtar, Fatiha; Boeglin, Werner; Bono, Jason; Bosted, Peter; Brash, Edward; Carter, Philip; Carlini, Roger; Chiba, Atsushi; Christy, Michael; Cole, Leon; Dalton, Mark; Danagoulian, Samuel; Daniel, Aji; De Leo, Raffaele; Dharmawardane, Kahanawita; Doi, Daisuke; Egiyan, Kim; Elaasar, Mostafa; Ent, Rolf; Fenker, Howard; Fujii, Yu; Furic, Miroslav; Gabrielyan, Marianna; Gan, Liping; Garibaldi, Franco; Gaskell, David; Gasparian, Ashot; Gibson, Edward; Gueye, Paul; Hashimoto, Osamu; Honda, D; Horn, Tanja; Hu, Bitao; Hungerford, Ed; Jayalath, Chandana; Jones, Mark; Johnston, Kathleen; Kalantarians, Narbe; Kanda, Hiroki; Kaneta, M; Kato, F; Kato, Seigo; Kawai, Masaharu; Keppel, Cynthia; Khanal, Hari; Kohl, M; Kramer, Laird; Lan, Kejian; Li, Ya; Habarakada Liyanage, Anusha; Luo, Wei; Mack, David; Maeda, Kazushige; Malace, Simona; Margaryan, Amur; Marikyan, Gagik; Markowitz, Pete; Maruta, Tomofumi; Maruyama, Nayuta; Maxwell, Victor; Millener, David; Miyoshi, Toshinobu; Mkrtchyan, Arthur; Mkrtchyan, Hamlet; Motoba, Toshio; Nagao, Sho; Nakamura, Satoshi; Narayan, Amrendra; Neville, Casey; Niculescu, Gabriel; Niculescu, Maria; Nunez, Angel; Nuruzzaman, nfn; Nomura, Hiroshi; Nonaka, Kenichi; Ohtani, Atsushi; Oyamada, Masamichi; Perez, Naipy; Petkovic, Tomislav; Pochodzalla, J; Qiu, Xiyu; Randeniya, Kapugodage; Raue, Brian; Reinhold, Joerg; Rivera, R; Roche, Julie; Samanta, Chhanda; Sato, Yoshinori; Sawatzky, Bradley; Segbefia, Edwin; Schott, Diane; Shichijo, Ayako; Simicevic, Neven; Smith, Gregory; Song, Yushou; Sumihama, Mizuki; Tadevosyan, Vardan; Takahashi, Toshiyuki; Taniya, Naotaka; Tsukada, Kyo; Tvaskis, Vladas; Veilleux, Micah; Vulcan, William; Wells, Steven; Wesselmann, Frank; Wood, Stephen; Yamamoto, Taku; Yan, Chen; Ye, Z; Yokota, Kosuke; Zhamkochyan, Simon; Zhu, Lingyan
2014-09-01
Since the pioneering experiment, E89-009 studying hypernuclear spectroscopy using the $(e,e^{\\prime}K^+)$ reaction was completed, two additional experiments, E01-011 and E05-115, were performed at Jefferson Lab. These later experiments used a modified experimental design, the "Tilt Method", to dramatically suppress the large electromagnetic background, and allowed for a substantial increase in luminosity. Additionally, a new kaon spectrometer, HKS (E01-011), a new electron spectrometer, HES, and a new splitting magnet were added to produce precision, high-resolution hypernuclear spectroscopy. These two experiments, E01-011 and E05-115, resulted in two new data sets, producing sub-MeV energy resolution in the spectra of ${}^{7}_{\\Lambda}\\text{He}$, ${}^{12}_{\\Lambda}\\text{B}$ and ${}^{28}_{\\Lambda} \\text{Al}$ and ${}^{7}_{\\Lambda}\\text{He}$, ${}^{10}_{\\Lambda}\\text{Be}$, ${}^{12}_{\\Lambda}\\text{B}$ and ${}^{52}_{\\Lambda}\\text{V}$. All three experiments obtained a ${}^{12}_{\\Lambda}\\text{B}$, spectrum, which is the most characteristic $p$-shell hypernucleus and is commonly used for calibration. Independent analyses of these different experiments demonstrate excellent consistency and provide the clearest level structure to date of this hypernucleus as produced by the $(e,e^{\\prime}K^+)$ reaction. This paper presents details of these experiments, and the extraction and analysis of the observed ${}^{12}_{\\Lambda}\\text{B}$ spectrum.
Experimental Conditions: SE48_S01_M01_D01 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available structure elucidation of 36 specialized metabolites from Oryza sativa (rice) by using MS/MS and NMR analyse...s SE48_S01 Habataki SE48_S01_M01 1 μL SE48_MS01 LC–QTOF-MS/MS analysis SE48_DS01 Data upload Default SE48_AM01 SE48_SS01 Isolation of specialized metabolites ...
Directory of Open Access Journals (Sweden)
Yoly Souza Ramos
2011-08-01
Full Text Available Observa-se na academia a discussão sobre os resíduos sólidos urbanos (RSU, sendo os oriundos de serviços de saúde (RSS parte integrante dos RSU, não necessariamente pela quantidade gerada, mas pelo potencial de risco que afeta à saúde coletiva e ambiental. Objetivou-se verificar a vulnerabilidade do manejo dos RSS, nos estabelecimentos de atenção primária, secundária e terciária de João Pessoa - PB. Foi uma pesquisa quantitativa, exploratória e descritiva do manejo dos RSS, tendo como instrumentos de coleta de dados checklist e avaliação analítica da vulnerabilidade do manejo dos RSS. Percebeu-se que 21,05% dos estabelecimentos não realizam segregação, 26,34% não padronizam os sacos plásticos e 47,37% dos trabalhadores responsáveis pela coleta não possuem treinamento para o manuseio dos RSS. Conclui-se que a vulnerabilidade do manejo dos RSS de João Pessoa - PB foi significativo 48,02%, podendo contribuir para a deterioração da saúde ambiental e coletiva, acarretando problema de saúde pública.The discussion in the academy on solid urban waste residues (UWR is analyzed, with health service waste (HSW being an integral part of UWR, not necessarily in terms of the amount generated, but due to the risk potential to collective and environmental health. The scope of the study was to verify the vulnerability of UWR handling in primary, secondary and tertiary healthcare units in João Pessoa in the state of Paraíba. This involved a quantitative, exploratory and descriptive investigation of the handling of UWR, using a checklist and analytical evaluation of the vulnerability of HSW handling for data collection. It was detected that 21.05% of the establishments failed to separate hazardous waste, 26.34% did not standardize plastic disposal bags, and 47.37% of the workers responsible for collection were not trained to handle HSW. It was concluded that the vulnerability of HSW handling in João Pessoa in the order of 48
DEFF Research Database (Denmark)
Boucherma, Rachid; Kridane-Miledi, Hédia; Bouziat, Romain
2013-01-01
We have generated a panel of transgenic mice expressing HLA-A*01:03, -A*24:02, -B*08:01, -B*27:05, -B*35:01, -B*44:02, or -C*07:01 as chimeric monochain molecules (i.e., appropriate HLA α1α2 H chain domains fused with a mouse α3 domain and covalently linked to human β2-microglobulin). Whereas...... a quantitative and qualitative restoration of the peripheral CD8(+) T cell repertoire, which exhibited a TCR diversity comparable with C57BL/6 WT mice. Potent epitope-specific, HLA-restricted, IFN-γ-producing CD8(+) T cell responses were generated against known reference T cell epitopes after either peptide...
An Electron Fixed Target Experiment to Search for a New Vector Boson A' Decaying to e+e-
Energy Technology Data Exchange (ETDEWEB)
Essig, Rouven; Schuster, Philip; /SLAC; Toro, Natalia; /Stanford U., Phys. Dept.; Wojtsekhowski, Bogdan; /Jefferson Lab
2010-06-11
We describe an experiment to search for a new vector boson A' with weak coupling {alpha}' {approx}> 6 x 10{sup -8} {alpha} to electrons ({alpha} = e{sup 2}/4{pi}) in the mass range 65 MeV < m{sub A'} < 550 MeV. New vector bosons with such small couplings arise naturally from a small kinetic mixing of the 'dark photon' A' with the photon - one of the very few ways in which new forces can couple to the Standard Model - and have received considerable attention as an explanation of various dark matter related anomalies. A' bosons are produced by radiation off an electron beam, and could appear as narrow resonances with small production cross-section in the trident e{sup +}e{sup -} spectrum. We summarize the experimental approach described in a proposal submitted to Jefferson Laboratory's PAC35, PR-10-009. This experiment, the A' Experiment (APEX), uses the electron beam of the Continuous Electron Beam Accelerator Facility at Jefferson Laboratory (CEBAF) at energies of {approx} 1-4 GeV incident on 0.5-10% radiation length Tungsten wire mesh targets, and measures the resulting e{sup +}e{sup -} pairs to search for the A' using the High Resolution Spectrometer and the septum magnet in Hall A. With a {approx} 1 month run, APEX will achieve very good sensitivity because the statistics of e{sup +}e{sup -} pairs will be {approx} 10,000 times larger in the explored mass range than any previous search for the A' boson. These statistics and the excellent mass resolution of the spectrometers allow sensitivity to {alpha}'/{alpha} one to three orders of magnitude below current limits, in a region of parameter space of great theoretical and phenomenological interest. Similar experiments could also be performed at other facilities, such as the Mainz Microtron.
Experimental Conditions: SE51_S01_M01_D01 [Metabolonote[Archive
Lifescience Database Archive (English)
Full Text Available SE51_S01_M01_D01 SE51 RIKEN tandem mass spectral database (ReSpect) for phytochemic...als: A plant-specific MS/MS-based data resource and database SE51_S01 L. japonicus accessions SE51_S01_M01 N
DEFF Research Database (Denmark)
Dersjant-Li, Y.; Jensen, Søren Krogh; Bos, L.W.
2009-01-01
were taken at slaughter of the six veal calves in experiment 2. The distribution of different alpha-tocopherol stereoisomers in feed, plasma, and tissues was analyzed. In both experiments, it was observed that RRR-alpha-tocopherol was the dominant stereoisomer in plasma and tissues. The average...... vitamin E intake. Other 2R-alpha-tocopherol stereoisomers had lower utilization efficiency than RRR-alpha-tocopherol stereoisomer. 2S-alpha-tocopherol stereoisomers were basically not utilized by calves.......This study evaluated the biological discrimination of different alpha-tocopherol stereoisomers (i. e. RRR-, RRS-, RSR-, RSS- and the four 2S-alpha-tocopherols) from all-rac-alpha-tocopheryl acetate supplementation in milk replacer for rearing and veal calves respectively, in practical farming...
Controlled Experiment Replication in Evaluation of E-Learning System's Educational Influence
Grubisic, Ani; Stankov, Slavomir; Rosic, Marko; Zitko, Branko
2009-01-01
We believe that every effectiveness evaluation should be replicated at least in order to verify the original results and to indicate evaluated e-learning system's advantages or disadvantages. This paper presents the methodology for conducting controlled experiment replication, as well as, results of a controlled experiment and an internal…
The Social & Mobile Learning Experiences of Students Using Mobile E-Books
Kissinger, Jeff S.
2013-01-01
This research was designed to explore the learning experiences of state college students using mobile electronic textbook (e-book) readers. The purpose of the study was to build a rich description of how students used e-books delivered on mobile computing devices for college-level, introductory
Making music out of noise. The Sentara Healthcare Experience Implementing e-Care.
Abraham, Chon; Reese, Bertram
2010-01-01
This paper describes insights from the an implementation experience with a project titled eCare, a comprehensive health IT solution integrating all environments of care and the primary business functions at Sentara Healthcare, the largest system in southeastern Virginia and northeastern North Carolina. eCare is expected to account for more than $16 million by the end of 2009, from realized benefits in quality of care, process efficiencies and firm performance. Made evident by Sentara's experience, eCare-type technology may be as much of a market differentiator for healthcare as the ATM was for banking industry, but prudent management in the implementation process is key.
Results from preliminary experiments of the 1 MeV 0.1 A D- project at CEA-Cadarache
International Nuclear Information System (INIS)
Simonin, A.; Fumelli, M.; Jequier, F.; Pamela, J.; Bucalossi, J.; Bottereau, J.M.; Brugnetti, R.
1994-01-01
A 1 MeV 0.1 A D - -beam acceleration experiment under preparation is described. It will study a simplified concept of negative ion beam electrostatic accelerator called SINGAP. Some critical HV components, like a large MV bushing or protection systems against the HV vacuum breakdowns will also be tested. The experiments reported here have been conducted during the preparatory phase of this MeV project. A negative ion source was developed and produced 1 A D - beams and j(D - )=12 mA/cm 2 beams. A new type of extraction grid was designed which traps almost 100% of the stray electrons extracted from the source plasma. A new emittance diagnostic has been successfully tested with 60-100 keV D - beams. A 1 MV 120 mA Haefely power supply has been moved from KfK, adapted and operated on a resistive load at the nominal operating characteristics. (author) 5 refs.; 6 figs
Study of the Ds+ → K+K-e+νe decay channel with the Babar experiment
International Nuclear Information System (INIS)
Serrano, J.
2008-04-01
Charm semileptonic decays allow a validation of lattice QCD calculations through the measurement of the hadronic form factors, which characterize the effect of strong interaction in these reactions. The accuracy of such calculations is crucial for the improvement of the test of the standard model in flavour physics. This thesis presents a study of the D s + → K + K - e + ν e channel using 214fb -1 recorded by de Babar experiment. For events with a K + K - mass in the range between 1.01 GeV/c 2 and 1.03 GeV/c 2 , the φ → K + K - is the dominant component. Using the simple pole model to parameterize the q 2 dependence of the form factors -V(q 2 ), A 1 (g 2 ) and A 2 (q 2 )- the following ratios are measured at q 2 = 0: r v = V(0)/A 1 (0) 1.868±0.061±0.079, r 2 = A 2 (0)/A 1 (0) = 0.763±0.072±0.062. The mass pole of the axial-vector form factor is also obtained: m A (2.30 0.18 +0.24 ±0.21) GeV/c 2 . In the same mass range, the semileptonic branching fraction, relative to the D s + → φπ + channel, is measured, and the absolute normalisation of the axial-vector form factor is extracted: A 1 (q 2 = 0) = 0.605 ± 0.012 ± 0.018 ± 0.018. The stated errors refer to the statistical, systematic and errors from external inputs, respectively. An S wave component in the K + K - system, possibly originating from a f 0 , is also studied through its interference with the φ. An S wave component is observed for the first time in this decay channel with a 5σ significance. (author)
Bold, Krysten W; Morean, Meghan E; Kong, Grace; Simon, Patricia; Camenga, Deepa R; Cavallo, Dana A; Krishnan-Sarin, Suchitra
2017-12-01
Identifying risk factors for youth e-cigarette use is critical, given high rates of e-cigarette use and unknown health effects of long-term use. The current study examined whether an early age of onset of e-cigarette use mediates the association between impulsivity and e-cigarette frequency. Cross-sectional survey data of e-cigarette users (n=927) were collected from 8 high schools in southeastern Connecticut. The sample was 44.7% female (mean age 16.2 [SD=1.2], mean age of e-cigarette onset 14.7 [SD=1.6]). Two domains of self-reported, trait impulsivity were assessed using the abbreviated Barratt Impulsiveness Scale: impaired self-regulation (e.g., problems with concentration or self-control) and behavioral impulsivity (e.g., doing things without thinking). Mediation was tested with Mplus, and the model included school as a cluster variable and controlled for covariates related to e-cigarette use (i.e., sex, age, race, peer use, and other tobacco products ever tried). The hypothesized mediation was supported for both domains of impulsivity (impaired self-regulation a 1 b=0.09, SE=0.02, 95%CI [0.03-0.14], p=.002; behavioral impulsivity a 2 b=0.07, SE=0.03, 95%CI [.01-.14], p=0.03). Specifically, impaired self-regulation (B=-0.33, SE=0.06, pe-cigarette use in the past month (B=-0.28, SE=0.08, prisk for more frequent e-cigarette use through an early age of e-cigarette initiation. Further research is needed to evaluate these relationships longitudinally and to develop targeted e-cigarette interventions for impulsive youth. Copyright © 2017 Elsevier B.V. All rights reserved.
Calibrating the CERN ATLAS Experiment with $E/p$
Froeschl, R; Aleksa, M
2009-01-01
Inside the ATLAS experiment two proton beams will collide with a center of mass energy of 14 TeV. These proton beams will be delivered with unprecedented high collision rates by the Large Hadron Collider (LHC) at the European Center of Particle Physics, CERN. For important parts of the physics program of ATLAS, e.g. the search for the Higgs boson, the performance of the electromagnetic calorimeter, whose primary task is to measure the energy of electrons and photons, is crucial. The main topic of this thesis is the intercalibration of the energy scale of the electromagnetic calorimeter and the momentum scale of the inner detector. This is an important consistency test for these two detectors. The intercalibration is performed by investigating the ratio E/p for electrons, i.e. the ratio of the energy E measured by the electromagnetic calorimeter and the momentum p measured by the inner detector. The starting point is the Combined Test Beam (CTB) 2004, where a segment of the ATLAS detector was exposed to differ...
International Nuclear Information System (INIS)
1993-01-01
Projects POL/5/006 was initiated in 1985 to assist the Government of Poland in improving the mutation breeding efforts in the country to promote the development of new and higher yielding crop varieties. The difficult economic situation in the country at this time restricted the procurement of special equipment, spare parts and supplies from abroad and, therefore, impeded research and development work in this field. The project was implemented using a distinctive approach and design characterized by having six recipient institutions and the establishment of one central gamma-irradiation facility to be made available to all participating institutions for mutation induction. The project was formally closed in 1989. The review of project POL/5/006 was undertaken in accord with the expressed wishes of the Board of Governors for selected ex-post evaluations of completed projects. The main purpose of the review was to ascertain if the project objectives were achieved, and to determine what impact the technical assistance provided may have had on continued post-project and current plant breeding programmes in Poland
Energy Technology Data Exchange (ETDEWEB)
NONE
1993-09-14
Projects POL/5/006 was initiated in 1985 to assist the Government of Poland in improving the mutation breeding efforts in the country to promote the development of new and higher yielding crop varieties. The difficult economic situation in the country at this time restricted the procurement of special equipment, spare parts and supplies from abroad and, therefore, impeded research and development work in this field. The project was implemented using a distinctive approach and design characterized by having six recipient institutions and the establishment of one central gamma-irradiation facility to be made available to all participating institutions for mutation induction. The project was formally closed in 1989. The review of project POL/5/006 was undertaken in accord with the expressed wishes of the Board of Governors for selected ex-post evaluations of completed projects. The main purpose of the review was to ascertain if the project objectives were achieved, and to determine what impact the technical assistance provided may have had on continued post-project and current plant breeding programmes in Poland.
Providing pervasive Learning eXperiences by Combining Internet of Things and e-Learning standards
Directory of Open Access Journals (Sweden)
Aroua TAAMALLAH
2015-12-01
Full Text Available Nowadays, learning is more and more taking place anywhere and anytime. This implies that e-learning environments are expanded from only virtual learning environments to both virtual and physical ones. Thanks to the evolution of Internet, ICT (Information and Communication Technology and Internet of Things, new learning scenarios could be experienced by learners either individually or collaboratively. These learning scenarios are Pervasive in such a way that they allow to mix virtual and physical learning environments as well. They are therefore characterized by possible interactions of the learner with the physical environment, the Learner's contextual data detection as well as the adaptation of pedagogical strategies and services according to this context. This paper aims to take advantage of this trend and keep up also with existing e-Learning standards such as IMS LD and LOM. The solution proposed is therefore to extend these standards models with that of Internet of Things and to provide an adaptation approach of learning activities based on learner's context and her/his track using the eXperience API. In this context and in order to allow both reasoning capabilities and interoperability between the proposed models Ontological representations and implementation are therefore proposed. Moreover a technical architecture highlighting the required software components and their interactions is provided. And finally, a relevant pervasive learning scenario is implemented and experimented.
Directory of Open Access Journals (Sweden)
Sandoval Vilaverde Monteiro
2004-01-01
Full Text Available O principal objetivo do texto consiste em problematizar as práticas corporais vivenciadas como lazer e aventura em ambientes naturais, em especial aquelas ligadas ao montanhismo, buscando pensá-las no contexto das formas contemporâneas de sociabilidade e processos de subjetivação, indagando sobre os liames sociais suscitados a partir da relação com tais práticas. A partir dos dados provenientes do contexto dos grupos estudados, bem como do referencial teórico adotado, sustenta-se o argumento de que o envolvimento com estas práticas coletivas de lazer e aventura na natureza pode, em algumas situações, ser entendido como experiências existenciais férteis para o exercício de uma relação renovada do sujeito consigo mesmo, com o outro e com a natureza. Este exercício faculta aos sujeitos envolvidos a possibilidade de vivenciar processos renovados de subjetivação coletiva, podendo resultar em formas de amizade mais solidárias, livres e criativas. Palavras-chaves: subjetividade, amizade, lazer, natureza
Gene : CBRC-XTRO-01-0171 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0171 Novel UN A Pheromone receptors V2R1B_MOUSE 1e-150 38% ref|NP_001093059.1| vomeronasa...YKCTQNRIPSAFIGHLLSSVSYGAIDASFGDRIRFPLFYRTVPSETAQYQVIIQLIKAFNWNWVGMISSDDETHQKASEEMQNEIKKNGICVAFLLRIGGKDVRNYHRALEKIRQSNASA
Gene : CBRC-OGAR-01-1295 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OGAR-01-1295 Novel UN A Pheromone receptors V2R1B_MOUSE 9e-90 54% ref|NP_001074918.2| vomeronasa...AGLAVLVLGVFLKHRDTPVVRANNRALSYMLLTSLALCALSALLFIGRPTVATCLLRQTTFAVVFTVAVSSILAKTLTVVLAFRITRPGDRVQMCLGPNASALVVLVA
Gene : CBRC-CJAC-01-0846 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0846 Novel UN B UNKNOWN TCB1_RABIT 5e-07 33% dbj|BAC87052.1| unnamed protein product [Homo sapi...MHRHIHVHMCVYVHTQRDMCTHAQTHTCVHRHTCINTDMHTCTHTDTHTYIHWHWYGITLNAPIRLGILNIFVILSLSTQECGSPTFSQSSLPVVSNIHGFL ...
Mestres do Tao: tradição, experiência e etnografia
Directory of Open Access Journals (Sweden)
José Bizerril Neto
2005-12-01
Full Text Available Neste artigo analiso a dimensão performática constitutiva da transmissão da tradição em uma linhagem taoísta no Brasil, partindo de uma perspectiva baseada na antropologia da experiência. A idéia de conhecimento no taoísmo baseia-se em uma noção pragmática: conhece-se por experiência pessoal corporificada o legado da tradição. A possibilidade de conhecer está fundada em uma relação pessoal entre mestre e aprendiz, inserida em uma cadeia dialógica e genealógica.In this article I analyse the performative dimension that constitutes the transmission of tradition in taoist lineage located in Brazil, from the perspective of the anthropology of experience. The idea of knowing in taoism is based on a practical notion: one knows the legacy of tradition through personal embodied experience. The very possibility of knowing is based upon a personal relation between master and apprentice, inserted on a dialogical and genealogical.
Gene : CBRC-OGAR-01-0879 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OGAR-01-0879 Novel UN B UNKNOWN PCFT_RAT 5e-30 30% gb|AAH60850.1| SLC46A3 protein [Homo sapi...ens] emb|CAI17158.1| novel protein [Homo sapiens] gb|EAX08438.1| hypothetical protein LOC28353...MRESSSQNVTMSCGEGFKNLFYRTYMLFKNASGKQRTLLCLLLFTVITYYFVIIGSAPIFILYELDSPLCWNEVFIGYGSALGSASFLTSFLGIWVFSYCMEDIHMAFIGIFTTMAGMAMTAFARTTLMMFLGESQLYP ... ...7, isoform CRA_b [Homo sapiens] 1e-141 89% MDISGLIPGLVSTFILLSNSDHYGRKLPMILSSVGGLATTIWLCLLSYFALPFQLLIASTFIGAF
Gene : CBRC-CJAC-01-1355 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-1355 Novel UN C UNKNOWN PCFT_RAT 1e-30 29% gb|AAH60850.1| SLC46A3 protein [Homo sapi...ens] emb|CAI17158.1| novel protein [Homo sapiens] gb|EAX08438.1| hypothetical protein LOC28353...IDFLLGLVTGLTGLSSGYFIRELGFVWSFLIIAVSLAVNLVYILFFLGDPMKESSSQNVTMSCSEGFKDLFYRTYMLFKNPSGKRRALLCLLLFTIITYYFMVIGIAPI...7, isoform CRA_b [Homo sapiens] 1e-157 92% MHQRFPTHNLLATGKKACTMIFLRTLCKLHCLLFLSLQEVQKKVSRFNLQVDISGLIPGLVSTFI
Adye, T J
1998-01-01
This thesis describes two separate areas of work conducted for the DELPHI detector at LEP. The first concerns the Slow Controls of the DELPHI detector, which enable a single operator to oversee the proper functioning of the apparatus and to diagnose faults as they occur. The hardware and software of this system, as well as their interface to the experiment and the operator, are described. Some conclusions are drawn from seven years' design work and the initial six years' operation of DELPHI. Secondly, a study is made of the production, at e+e- collision centre of mass energies close to the Z0 resonance, of J/psi mesons, decaying to mu+ mu-. J/psi mesons produced via a B-hadron are used to measure the mean B lifetime, tau_B = (1.53 +- 0.11 (stat.) +- 0.06 (syst.)) ps A measurement is also made of the fraction of J/psis produced promptly at the e+e- collision point, N(Z0 -> prompt J/psi X) / N(Z0 -> J/psi X) = (9.6 +- 3.2 (stat.) +- 1.2 (syst.))%. This method is largely model-independent.
Leonardo Breno Martins
2012-01-01
Esta pesquisa compara pessoas que alegam experiências anômalas e que não as alegam quanto aos cinco grandes fatores da personalidade, indicadores de transtornos mentais e atribuições de causalidade. O recorte incide sobre experiências caracteristicamente contemporâneas, que mencionam objetos voadores não-identificados (óvnis) e eventos correlatos, como alegadas visões de alienígenas. As variáveis foram escolhidas para o estudo devido ao seu papel teórico na edificação das experiências e aos a...
Park, Hyejin; Moon, Mikyung; Baeg, Jung Hoon
2014-09-01
Cancer is a critical disease with a high mortality rate in the US. Although useful information exists on the Internet, many people experience difficulty finding information about cancer prevention because they have limited eHealth literacy. This study aimed to identify relationships between the level of eHealth literacy and cancer information seeking experience or prior experience with cancer screening tests. A total of 108 adults participated in this study through questionnaires. Data covering demographics, eHealth literacy, cancer information seeking experience, educational needs for cancer information searching, and previous cancer screening tests were obtained. Study findings show that the level of eHealth literacy influences cancer information seeking. Individuals with low eHealth literacy are likely to be less confident about finding cancer information. In addition, people who have a low level of eHealth literacy need more education about seeking information than do those with a higher level of eHealth literacy. However, there is no significant relationship between eHealth literacy and cancer screening tests. More people today are using the Internet for access to information to maintain good health. It is therefore critical to educate those with low eHealth literacy so they can better self-manage their health.
Search for νμ→νe oscillations in the NOMAD experiment
International Nuclear Information System (INIS)
Krasnoperov, A.
2000-06-01
The NOMAD experiment is looking for ν μ →ν τ and ν→ν e oscillations in a predominantly ν μ beam at the CERN SPS. Neutrino oscillations are closely related with the existence of non-zero neutrino mass and mixing between different flavours. This document describes the search for ν μ →ν e oscillations in the full NOMAD data sample accumulated during four years of data-taking (1995-98). The search for ν e appearance was performed by studying the charged current (CC) interactions with in the NOMAD detector. The selection of ν e CC and ν μ interactions with the help of different particle identification algorithms, as well as using the event kinematic criteria, is described here in detail. We show that the NOMAD experiment is sensitive to the LSND allowed region of oscillation parameters with the squared mass difference larger than 10 eV 2 /C 4 . An upper limit on the probability of ν μ →ν e oscillations, based on a fraction of the NOMAD data, is given. (author)
ANÁLISE DE RISCO DE PRAGUICIDAS EM LEITE CRU E CARACTERIZAÇÃO DO USO EM PROPRIEDADES LEITEIRAS
Directory of Open Access Journals (Sweden)
Rafael Fagnani
2011-12-01
Full Text Available Este trabalho teve como objetivo a caracterização do uso de praguicidas em propriedades leiteiras no agreste de Pernambuco e estudar a contaminação do leite cru por praguicidas organofosforados (OF e carbamatos (CB, estimando a ingestão diária provável desses resíduos pelo leite. Em 28 propriedades e em dois tanques resfriadores comunitários do agreste pernambucano foram coletadas 30 amostras de leite. A quantificação de praguicidas nas amostras foi realizada por cromatografia gasosa. Doze amostras (40% apresentaram resíduos, sendo seis (20% positivas para OF, cinco (16,7% para CB e uma (3,32% para ambos praguicidas. As médias dos praguicidas detectados no leite em ng/ml foram: 0,04 para coumafós, 0,01 para dimetoato, 0,06 para fention, 0,02 para malation, 0,02 para aldicarb, 0,02 para carbaril e 0,01 para carbofuran. Quando a Ingestão Diária Provável Média dos princípios ativos detectados no leite foi comparada à respectiva Ingestão Diária Aceitável, não houve risco para nenhuma faixa etária, considerando o consumo per capta Brasileiro, pernambucano e o consumo recomendado pelo Ministério da Saúde de leite.
MODIS/Terra Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Day V006
National Aeronautics and Space Administration — MODIS/Terra Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Day (MOD21A1D.006). A new suite of MODIS Land Surface Temperature (LST) and...
MODIS/Aqua Land Surface Temperature/3-Band Emissivity 8-Day L3 Global 1km SIN Grid V006
National Aeronautics and Space Administration — MODIS/Aqua Land Surface Temperature/3-Band Emissivity 8-Day L3 Global 1km SIN Grid (MYD21A2.006). A new suite of MODIS Land Surface Temperature (LST) and Emissivity...
MODIS/Aqua Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Day V006
National Aeronautics and Space Administration — MODIS/Aqua Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Day (MYD21A1D.006). A new suite of MODIS Land Surface Temperature (LST) and...
MODIS/Terra Land Surface Temperature/3-Band Emissivity 8-Day L3 Global 1km SIN Grid V006
National Aeronautics and Space Administration — MODIS/Terra Land Surface Temperature/3-Band Emissivity 8-Day L3 Global 1km SIN Grid (MOD21A2.006). A new suite of MODIS Land Surface Temperature (LST) and Emissivity...
MODIS/Terra Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Night V006
National Aeronautics and Space Administration — MODIS/Terra Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Night (MOD21A1N.006). A new suite of MODIS Land Surface Temperature (LST) and...
MODIS/Aqua Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Night V006
National Aeronautics and Space Administration — MODIS/Aqua Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Night (MYD21A1N.006). A new suite of MODIS Land Surface Temperature (LST) and...
DEFF Research Database (Denmark)
Olotu, Ally; Lusingu, John; Leach, Amanda
2011-01-01
RTS,S/AS01E is the lead candidate malaria vaccine. We recently showed efficacy against clinical falciparum malaria in 5-17 month old children, during an average of 8 months follow-up. We aimed to assess the efficacy of RTS,S/AS01E during 15 months of follow-up.......RTS,S/AS01E is the lead candidate malaria vaccine. We recently showed efficacy against clinical falciparum malaria in 5-17 month old children, during an average of 8 months follow-up. We aimed to assess the efficacy of RTS,S/AS01E during 15 months of follow-up....
Precise measurement in elastic electron scattering: HAPPEX and E-158 experiments
International Nuclear Information System (INIS)
Vacheret, A.
2004-12-01
Parity Violation asymmetry measurements in elastic electron scattering are in one hand an interesting way of retrieving new informations about the sea quarks of the nucleon and in the other hand a powerful test of the Standard Model electroweak sector at low energy. This thesis describes the HAPPEX experiment at JLab and the E-158 experiment at SLAC (USA) which measure de parity violation asymmetries in elastic scattering of polarized electron on nuclei like Hydrogen or Helium and on atomic electrons. With the measurements on hadronic targets one can extract the strange quarks contribution to the charge and current density of the nucleon. With the electron-electron scattering one can test the standard model at the loop level and far from the Z pole by extracting sin 2 θ W . In this thesis we describe the formalism associated with the electroweak probe. We present in detail the experimental methods used to make such precise measurements of parity violation asymmetry. Then, we describe the experimental set-up of each experiment and in particular the electron detector and the feedback loop on the beam current for the HAPPEX experiment and the analysis of E-158 run III with a dedicated systematic study on the beam sub-pulse fluctuations. We present the preliminary results for each experiment with a comparison with the other existing results and the future experiments. (author)
NCBI nr-aa BLAST: CBRC-DNOV-01-2083 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-2083 ref|ZP_00368580.1| competence locus E (comE3) [Campylobacter lari... RM2100] gb|EAL55745.1| competence locus E (comE3) [Campylobacter lari RM2100] ZP_00368580.1 3e-06 28% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0762 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0762 ref|ZP_00370456.1| competence locus E (comE3) [Campylobacter upsaliens...is RM3195] gb|EAL53586.1| competence locus E (comE3) [Campylobacter upsaliensis RM3195] ZP_00370456.1 6e-04 25% ...
The effect of x-irradiation on the implantation and development of the white rat fetus
International Nuclear Information System (INIS)
Danius, J.; Bahauddin, R.
1976-01-01
X-ray whole body irradiation (200R, exposure dose) was performed on young virgin females of about 4 months old. The female rats, divided into three groups, were treated as follows: Female rats as control (unirradiated = 1Kt): female rats irradiated before mating (RSbK), and female rats irradiated after mating (RSsK). The average number of surviving foetuses at 20 days gestational stage of 1Kt was compared with that of RSbK, and no significant difference was found (P<=0.05) while the difference between the average number of RSsK foetuses compared with that of 1Kt and RSbK was highly significant (P<0.01). A decrease in the average number of surviving foetuses was found in RSsK, although the analysis of variance of all groups, revealed no significant difference (P<=0.05) in the average number of implantations and weight of the foetuses. (author)
Beam Extinction Monitoring in the Mu2e Experiment
Energy Technology Data Exchange (ETDEWEB)
Prebys, Eric [Fermilab; Bartoszek, Larry [Technicare; Gaponenko, Andrei [Fermilab; Kasper, Peter [Fermilab
2015-06-01
The Mu2e Experiment at Fermilab will search for the conversion of a muon to an electron in the field of an atomic nucleus with unprecedented sensitivity. The experiment requires a beam consisting of proton bunches approximately 200ns FW long, separated by 1.7 microseconds, with no out-of-time protons at the 10⁻¹⁰ fractional level. The verification of this level of extinction is very challenging. The proposed technique uses a special purpose spectrometer which will observe particles scattered from the production target of the experiment. The acceptance will be limited such that there will be no saturation effects from the in-time beam. The precise level and profile of the out-of-time beam can then be built up statistically, by integrating over many bunches.
Feasibility of 81Br(nu,e-)81Kr solar neutrino experiment
International Nuclear Information System (INIS)
Hurst, G.S.; Allman, S.L.; Chen, C.H.; Kramer, S.D.; Thomson, J.O.; Cleveland, B.
1985-05-01
Several ingenious solutions have been offered for the solar neutrino problem - a defect in the solar model, the appearance of a new type of neutrino physics, the sun is no longer burning, etc. The range of these proffered solutions stresses the need for a new experiment to study the sun. The modern pulsed laser now makes possible a new solar neutrino test which examines an independent neutrino source in the sun. A recently proposed experiment would use the reaction 81 Br(nu,e - ) 81 Kr to measure the flux of 7 Be neutrinos from the sun. When 7 Be decays by electron capture to make 7 Li, a neutrino is emitted at 0.862 MeV and the flux of these on the earth is about 4 x 10 9 cm -2 s -1 , according to the standard model. Therefore, an experiment based on 81 Br(nu,e - ) 81 Kr which is sensitive to these lower energy neutrinos would be of fundamental importance. To first order, the chlorine experiment detects the 8 B neutrinos while bromine detects the much more abundant 7 Be neutrino source. In practice, the proposed bromine experiment would be very similar to the chlorine radiochemical experiment, except that 81 Kr with a half-life of 2 x 10 5 years cannot be counted by decay methods. With an experiment of about the same volume as the chlorine experiment (380 m 3 ) filled with CH 2 Br 2 , the model predicts about 2 atoms of 81 Kr per day. The bromine experiment depends entirely on the RIS method, implemented with pulsed lasers, for its success. 10 refs., 3 figs
Investigation of fullerene ions in crossed-beams experiments
International Nuclear Information System (INIS)
Hathiramani, D.; Scheier, P.; Braeuning, H.; Trassl, R.; Salzborn, E.; Presnyakov, L.P.; Narits, A.A.; Uskov, D.B.
2003-01-01
Employing the crossed-beams technique, we have studied the interaction of fullerene ions both with electrons and He 2+ -ions. Electron-impact ionization cross sections for C 60 q+ (q=1,2,3) have been measured at electron energies up to 1000 eV. Unusual features in shape and charge state dependence have been found, which are not observed for atomic ions. The evaporative loss of neutral C 2 fragments in collisions with electrons indicates the presence of two different mechanisms. In a first-ever ion-ion crossed-beams experiment involving fullerene ions a cross section of (1.05 ± 0.06) x 10 -15 cm 2 for charge transfer in the collision C 60 + + He 2+ at 117.2 keV center-of-mass energy has been obtained
Directory of Open Access Journals (Sweden)
José Ricardo Oliveira
2009-07-01
Full Text Available Testou-se a ação de diferentes concentrações de cloreto de sódio, benzocaína e óleo de cravo-da-índia na sobrevivência de alevinos e juvenis de tilápia (Oreochromis niloticus, linhagem chitralada, por 5 horas visando ao transporte. Utilizaram-se 1.350 alevinos (9,74 ± 0,04 g e 6,79 ± 0,01 cm e 270 juvenis (29,6 ± 0,06 g e 11,52 ± 0,01. Os peixes foram mantidos em jejum por 24 horas em quatro caixas de amianto (500 L com aeração constante. Em seguida, os peixes foram distribuídos em 54 sacos plásticos, capacidade para 5 L e mantidos em soluções de: cloreto de sódio nas concentrações de (0; 4; ou 8 g/L, benzocaína (0; 20; ou 40 mg/L e óleo de cravo (0; 2; ou 5 mg/L. O delineamento foi em blocos casualizados, com três repetições, em arranjo multifatorial, com três fatores: substâncias, peixes e concentrações de cada substância em estudo. Mensuraram-se, no início, os parâmetros oxigênio dissolvido, temperatura, pH, salinidade e amônia e, ao final do experimento, a glicose dos peixes. Maiores níveis de glicose foram registrados nos juvenis mantidos na água com óleo de cravo e cloreto de sódio. Não foi observada diferença significativa na sobrevivência entre os tipos de peixes e as substâncias. Entretanto, as dosagens de cloreto de sódio e benzocaína ocasionaram diferenças significativas na taxa de sobrevivência. A sobrevivência foi baixa nos alevinos com 0 g/L de cloreto de sódio e diferiu das dosagens 4 e 8 g/L. O óleo de cravo promoveu resultados similares, em todas as dosagens e substâncias, de taxas de glicose. Ao final do experimento, a sobrevivência foi satisfatória, com média geral de 97,26%, comprovando que as três substâncias podem ser usadas no transporte de alevinos e juvenis durante 5 horas. Sugere-se o cloreto de sódio por seu melhor custo-benefício.The action of different concentrations of sodium chloride, benzocaine and clove oil in the survival of fingerling and juvenile
Weak mixing and CP-violation involving heavy quarks and possible measurements in e+e- experiments
International Nuclear Information System (INIS)
Ali, A.; Aydin, Z.Z.
1978-09-01
We evaluate weak mass mixing among the neutral heavy mesons with a bottom (Q = -1/3) or top (Q = +2/3) quark and CP-violation in the frame work of six quark (V - A) models. It is argued that bottom and top mesons may distinguish the Higgs exchange mechanism of CP-violation from a complex phase in the quark mass matrix, if bottom and top quark masses are sufficiently different. Estimates of weak mixing-and CP-violating effects for e + e - experiments at PETRA, PEP and CESR energies are presented. (orig.) [de
NCBI nr-aa BLAST: CBRC-MDOM-01-0519 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-01-0519 ref|YP_001126904.1| prophage LambdaBa01, membrane protein, putative [Geobacillus thermoden...itrificans NG80-2] gb|ABO68159.1| Prophage LambdaBa01, membrane protein, putative [Geobacillus thermodenitrificans NG80-2] YP_001126904.1 8e-12 24% ...
Directory of Open Access Journals (Sweden)
Cléopâtre Montandon
2005-08-01
Full Text Available Este artigo tenta mostrar o quanto é importante estudar a experiência das crianças e seus pontos de vista para podermos compreender os diferentes fenômenos sociais que lhes dizem respeito. Na perspectiva da sociologia da infância, sua experiência é considerada no âmbito das estruturas sociais e do contexto particular nos quais se insere. A partir de vários exemplos no campo da educação de crianças, a autora argumenta que não basta examinar as práticas educativas de seus educadores, mas que é necessário compreender as perspectivas das crianças ou, dito de modo mais simples, que importa analisar não apenas o que os educadores fazem com as crianças, como também o que estas fazem com o que se faz com elas. Duas pesquisas são apresentadas para apoiar essa abordagem: a primeira diz respeito à experiência que as crianças têm de sua educação no âmbito familiar e escolar; a segunda trata de um objetivo particular dos educadores modernos: o desenvolvimento da autonomia das crianças. Em ambos os estudos, a experiência das crianças foi apreendida por intermédio de suas representações, emoções e ações, e foi situada segundo suas características sociais e culturais.This paper tries to show that the experience of children and their points of view are paramount when one wants to understand the various social phenomena that concern them. According to the perspective of the Sociology of Childhood, children's experience is analyzed in the framework of the social structures and the particular contexts in which it takes place. Using different examples from the field of the education of children, the author argues that it is not sufficient to examine the educational practices of adults; it is equally important to examine the children's perspective. In other words, we should take into consideration what the children do with what is done to them. Two studies are presented to support this approach: the first one concerns the
Experiência subjetiva do tempo e sua influência no comportamento: revisão e modelos
Directory of Open Access Journals (Sweden)
Alejandro Vásquez Echeverría
Full Text Available Pesquisadores têm tentado explicar, desde o início da psicologia, a experiência temporal das pessoas e sua influência nas cognições, emoções e comportamentos. Trata-se de uma das dimensões mais complexas e influentes da psique, que tem sido abordada a partir de concepções diferentes e sem uma estrutura consensual. Este artigo tem o objetivo de contribuir na sistematização da psicologia do tempo, ampliando um modelo de quatro níveis, aprofundando na percepção do tempo vital ou tempo III. Trabalhos incluídos foram selecionados segundo a sua importância na historia da psicologia ou índice de citação. Sugere-se um modelo explicativo do Tempo III, que inclui discussão e debate e visa integrar os diferentes modelos existentes na literatura.
NCBI nr-aa BLAST: CBRC-DNOV-01-1855 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-1855 ref|ZP_00368580.1| competence locus E (comE3) [Campylobacter lari... RM2100] gb|EAL55745.1| competence locus E (comE3) [Campylobacter lari RM2100] ZP_00368580.1 0.18 31% ...
Gene : CBRC-GGOR-01-0659 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGOR-01-0659 Novel UN C UNKNOWN Y1540_LACLM 3.6 29% gb|EAW72564.1| hCG2037024 [Homo sapi...ens] 2e-23 41% MSYVLRSSYVPSTCGVGLSNVSSLVLGKGGAVCKGLSIVPACIWLLSCVDPPVLCEVGALPKGLSTIVTLIRLFPSVCPFVLAEQGAVVEGFPTLIAPI
Gene : CBRC-XTRO-01-2206 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-2206 Novel UN D UNKNOWN VTP3_TTV1V 1e-11 32% dbj|BAC87052.1| unnamed protein product [Homo sapi...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLYAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYM...PTHLPPLAPTCPHTCPHWHLHAHTPAPTDTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPH ...
Heavy reflector experiments composed of carbon steel and nickel in the IPEN/MB-01 reactor
International Nuclear Information System (INIS)
Santos, Adimir dos; Silva, Graciete Simoes de Andrade e; Mura, Luis Felipe; Jerez, Rogerio; Mendonca, Arlindo Gilson; Fuga, Rinaldo
2013-01-01
The heavy reflector experiments performed in the IPEN/Mb-01 research reactor facility comprise a set of critical configurations employing the standard 28x26-fuel-rod configuration. The heavy reflector either, carbon steel or nickel plates was placed at one of the faces of the IPEN/MB-01 reactor. Criticality is achieved by inserting the control banks BC1 and BC2 to the critical position. 32 plates around 0.3 mm thick were used in all the experiment. The chosen distance between last fuel rod row and the first laminate for all types of laminates was 5.5 mm. Considering initially the carbon steel case, the experimental data reveal that the reactivity decreases up to the fifth plate and after that it increases, becomes nearly zero (which was equivalent to initial zero excess reactivity with zero plates) for the 28 plates case and reaches a value of 42.73 pcm when the whole set of 32 plates are inserted in the reflector. This is a very striking result because it demonstrates that when all 32 plates are inserted in the reflector there is a net gain of reactivity. The reactivity behavior demonstrates all the physics events already mentioned in this work. When the number of plates are small (around 5), the neutron absorption in the plates is more important than the neutron reflection and the reactivity decreases. This condition holds up to a point where the neutron reflection becomes more important than the neutron absorption in the plates and the reactivity increases. The experimental data for the nickel case shows the main features of the carbon steel case, but for the carbon steel case the reactivity gain is small, thus demonstrating that carbon steel or essentially iron has not the reflector capability as the nickel laminates do. The measured data of nickel plates show a higher reactivity gain, thus demonstrating that nickel is a better reflector than iron. The theoretical analysis employing MCNP5 and ENDF/B-VII.0 show that the calculated results have good results up to
Muon polarization in the MEG experiment: predictions and measurements
Energy Technology Data Exchange (ETDEWEB)
Baldini, A.M.; Dussoni, S.; Galli, L.; Grassi, M.; Sergiampietri, F.; Signorelli, G. [Pisa Univ. (Italy); INFN Sezione di Pisa, Pisa (Italy); Bao, Y.; Hildebrandt, M.; Kettle, P.R.; Mtchedlishvili, A.; Papa, A.; Ritt, S. [Paul Scherrer Institut PSI, Villigen (Switzerland); Baracchini, E. [University of Tokyo, ICEPP, Tokyo (Japan); INFN, Laboratori Nazionali di Frascati, Rome (Italy); Bemporad, C.; Cei, F.; D' Onofrio, A.; Nicolo, D.; Tenchini, F. [INFN Sezione di Pisa, Pisa (Italy); Pisa Univ., Dipartimento di Fisica, Pisa (Italy); Berg, F.; Hodge, Z.; Rutar, G. [Paul Scherrer Institut PSI, Villigen (Switzerland); Swiss Federal Institute of Technology ETH, Zurich (Switzerland); Biasotti, M.; Gatti, F.; Pizzigoni, G. [INFN Sezione di Genova, Genova (Italy); Genova Univ., Dipartimento di Fisica, Genova (Italy); Boca, G.; De Bari, A. [INFN Sezione di Pavia, Pavia (Italy); Pavia Univ., Dipartimento di Fisica, Pavia (Italy); Cattaneo, P.W.; Rossella, M. [Pavia Univ. (Italy); INFN Sezione di Pavia, Pavia (Italy); Cavoto, G.; Piredda, G.; Renga, F.; Voena, C. [Univ. ' ' Sapienza' ' , Rome (Italy); INFN Sezione di Roma, Rome (Italy); Chiarello, G.; Panareo, M.; Pepino, A. [INFN Sezione di Lecce, Lecce (Italy); Univ. del Salento, Dipartimento di Matematica e Fisica, Lecce (Italy); Chiri, C.; Grancagnolo, F.; Tassielli, G.F. [Univ. del Salento (Italy); INFN Sezione di Lecce, Lecce (Italy); De Gerone, M. [Genova Univ. (Italy); INFN Sezione di Genova, Genova (Italy); Fujii, Y.; Iwamoto, T.; Kaneko, D.; Mori, Toshinori; Nakaura, S.; Nishimura, M.; Ogawa, S.; Ootani, W.; Sawada, R.; Uchiyama, Y.; Yoshida, K. [University of Tokyo, ICEPP, Tokyo (Japan); Graziosi, A.; Ripiccini, E. [INFN Sezione di Roma, Rome (Italy); Univ. ' ' Sapienza' ' , Dipartimento di Fisica, Rome (Italy); Grigoriev, D.N. [Budker Institute of Nuclear Physics of Siberian Branch of Russian Academy of Sciences, Novosibirsk (Russian Federation); Novosibirsk State Technical University, Novosibirsk (Russian Federation); Novosibirsk State University, Novosibirsk (Russian Federation); Haruyama, T.; Mihara, S.; Nishiguchi, H.; Yamamoto, A. [KEK, High Energy Accelerator Research Organization, Tsukuba, Ibaraki (Japan); Ieki, K. [Paul Scherrer Institut PSI, Villigen (Switzerland); University of Tokyo, ICEPP, Tokyo (Japan); Ignatov, F.; Khazin, B.I.; Popov, A.; Yudin, Yu.V. [Budker Institute of Nuclear Physics of Siberian Branch of Russian Academy of Sciences, Novosibirsk (Russian Federation); Novosibirsk State University, Novosibirsk (Russian Federation); Kang, T.I.; Lim, G.M.A.; Molzon, W.; You, Z. [University of California, Irvine, CA (United States); Khomutov, N.; Korenchenko, A.; Kravchuk, N. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Venturini, M. [Pisa Univ. (Italy); INFN Sezione di Pisa, Pisa (Italy); Scuola Normale Superiore, Pisa (Italy); Collaboration: The MEG Collaboration
2016-04-15
The MEG experiment makes use of one of the world's most intense low energy muon beams, in order to search for the lepton flavour violating process μ{sup +} → e{sup +}γ. We determined the residual beam polarization at the thin stopping target, by measuring the asymmetry of the angular distribution of Michel decay positrons as a function of energy. The initial muon beam polarization at the production is predicted to be P{sub μ} = -1 by the Standard Model (SM) with massless neutrinos. We estimated our residual muon polarization to be P{sub μ} =.0.86 ± 0.02 (stat){sub -0.06}{sup +0.05} (syst) at the stopping target, which is consistent with the SM predictions when the depolarizing effects occurring during the muon production, propagation and moderation in the target are taken into account. The knowledge of beam polarization is of fundamental importance in order to model the background of our μ{sup +} → e{sup +}γ search induced by the muon radiative decay: μ{sup +} → e{sup +} anti ν{sub μ}ν{sub e}γ. (orig.)
Directory of Open Access Journals (Sweden)
Jacinta Diva Ferrugem Gomes
2007-07-01
Full Text Available O melhoramento genético de suínos levou ao surgimento de diversas linhagens suínas que apresentam elevada capacidade de desenvolvimento de massa muscular. Entretanto, pouco se sabe cientificamente sobre a morfologia de órgãos destes animais, conhecimento que ajuda a elucidar características relacionadas ao desempenho zootécnico como ganho de peso e conversão alimentar em carne magra. Objetivou-se, assim, comparar a morfologia dos órgãos digestivos e não-digestivos de suínos de linhagens modernas ao final das fases de Crescimentos Ie II, Terminação e Pós-terminação. O peso dos órgãos em relação ao peso vivo diminuiu significativamente (p The genetic market makes use of various modern swine genotypes that present high capacity for muscular mass development. These genetic lines have been used in swine production without existing scientificinformation about morphology, knowledge that can elucidate factors related to growth performance, such as weight gain and food conversion in lean meat yield. The aim of this experiment was to compare the morphology of digestive and non-digestive organs of moderngenotypes. At the end of the phases: Growing I, Growing II, Finishing and Post-finishing, the pigs were slaughtered and the organs were weighed. The weight of the organs decreased (p < 0.01 with body development, in agreement with the biological growth of the animals. The morphology of the digestive organs were different (p < 0.06 among lineages, which showed that differences can exist, mainly regarding digestive capacity and, possibly, food intake and efficiency. The length of the small intestine was different (p < 0.06 among lines, which can be an indicative of increased body development due to an extended food exposition area to intestinalcells. The scientific knowledge of swine lines morphology is important because this information can contribute to animal growth performance.
Gene : CBRC-CINT-01-0076 [SEVENS
Lifescience Database Archive (English)
Full Text Available ntestinalis cDNA, clone:cieg003b01, full insert sequence /gb=AK116512 /gi=23589081 /ug=Cin.12858 /len=2519 5e-04 29% MMSCLLLNLPVRLMMS...CLLLNSPVCLMMSCRLLNSPVRLMISCLLLNSPVCLMMSCLLLNSPVRLMMSCLLLNSPVRLMMSCLLLNSPVCLMMS...CLLLNSPVRLMMSCLLLNSPVRLMISCLLLNSPVRLMISCLLLNPPVRLMMSCVLLNLPVRLMMICILSNSPVCLVISCLLLNSPVRLMISCLLLNSPVCLMMS...CVLPNSPVRLMMSCLLLNSPVRLMMSCLLLNLPVRLMMSCLLLNSPVCLMMSCLILNSPVRLMICCLLLNSPVCLMTICILLNSTVRLMICCLLLNPPVRLMISCLLNPPVRLMMSCVLLNSPVRLMTSRFRLELMYVRCLTIFKKFLL ...
Performance Analysis of Handover Measurements and Layer 3 Filtering for UTRAN LTE
DEFF Research Database (Denmark)
Anas, Mohmmad; Calabrese, Francesco Davide; Östling, Per-Erik
2007-01-01
B domain L3 filtering has been studied by using a dynamic system level simulator for a 3GPP UTRAN LTE recommended scenario. The results suggest that RSS measurement with linear or dB domain L3 filtering is a better criterion for handover in terms of reduced number of handovers for a small penalty......Handover is one of the key functionalities which tries to keep a user equipment (UE) connected to the best base station (eNodeB). Handover is usually based on the downlink received signal strength (RSS) and carrier-to-interference ratio (CIR) measurements. Processing of the handover measurement...... is usually done in Layer 1 (L1) and Layer 3 (L3) by the UE, and handover is initiated by the serving eNodeB if certain event criteria are met. L3 filtering can be done in linear domain or decibel (dB) domain. A hard handover algorithm based on the downlink RSS and CIR measurements along with linear and d...
Legitimidade e não legitimidade das experiências dos sofrimentos e adoecimentos de longa duração
Canesqui, Ana Maria
2018-01-01
Resumo Discute-se a legitimidade e não legitimidade das experiências de adoecimentos e sofrimentos de longa duração selecionados, considerados ou não doenças pelos diagnósticos médicos, como a dor, a fadiga crônica e a “pressão alta”, usando pesquisas internacionais e nacionais sociológicas e antropológicas em saúde. As análises dos relatos de adoecidos ou de profissionais de saúde nas pesquisas consideradas exploram o assunto, suas implicações, reflexos e ambiguidades geradas nos sujeitos e ...
Directory of Open Access Journals (Sweden)
Carlos Hubinger Tokarnia
1999-01-01
Full Text Available Em função de históricos obtidos, no presente estudo tentou-se reproduzir, em bovinos, fotossensibilização e/ou aborto com as favas de Enterolobium spp (Leg. Mimosoi-deae. As favas de E. contortisiliquum e E. timbouva ("tamboril" ou "timbaúba", de diversas procedências, inclusive as colhidas durante dois surtos de intoxicação caracterizados por fotossensiblilização e aborto, foram administradas em doses únicas e repetidas, a bovinos jovens e a vacas em gestação. Em todos os experimentos realizados, a resposta à ingestão das favas independentemente da procedência, sempre foi caracterizada por diarréia e diminuição do apetite, passageiras. Também ficou evidente que os animais mostram menor sensibilidade, à medida que ingerem as favas seguidamente. Os experimentos não revelaram possíveis fatores envolvidos ou eventuais condições necessárias para que as favas de Enterolobium contortisiliquum e E. timbouva causem fotossen-siblização e/ou aborto.The pods of Enterolobium spp (Leg.Mimosoideae are said to cause photsensitivity and abortion in cattle. The pods of E. contortisiliquum and E. timbouva ("tamboril" or "timbaúba", collected at various localities, in two occasions during outbreaks of photosensitization and abortions, were fed in single and repeated doses to young bovines and to cows in calf. In all experiments the animals showed only diarrhoea and loss of apetite, as it had been already seen in previous experiments with E. contortisiliquum performed in Fortaleza, northeastern Brazil. Also it was seen again that the animals become tolerant to the toxicity of the pods if they get successive doses. The experiments did not reveal possible conditions necessary for the pods of Enterolobium contortisiliquum and E. timbouva to cause photosensitization and/or abortion.
NCBI nr-aa BLAST: CBRC-OPRI-01-0198 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OPRI-01-0198 ref|ZP_00370456.1| competence locus E (comE3) [Campylobacter upsaliens...is RM3195] gb|EAL53586.1| competence locus E (comE3) [Campylobacter upsaliensis RM3195] ZP_00370456.1 0.21 23% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-1116 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-1116 ref|ZP_00370456.1| competence locus E (comE3) [Campylobacter upsaliens...is RM3195] gb|EAL53586.1| competence locus E (comE3) [Campylobacter upsaliensis RM3195] ZP_00370456.1 0.028 27% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0384 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0384 ref|ZP_00370456.1| competence locus E (comE3) [Campylobacter upsaliens...is RM3195] gb|EAL53586.1| competence locus E (comE3) [Campylobacter upsaliensis RM3195] ZP_00370456.1 0.030 26% ...
Etnografia como prática e experiência
Directory of Open Access Journals (Sweden)
José Guilherme Cantor Magnani
2009-12-01
Full Text Available Este artigo, a partir de alguns usos pouco ortodoxos da etnografia, fora do campo da antropologia, propõe uma discussão sobre a especificidade desse método de pesquisa, com base em pesquisas e reflexões realizadas sobre o tema no Núcleo de Antropologia Urbana da USP (NAU. Tomando como ponto de partida uma citação de Lévi-Strauss, repassa alguns autores - Goldman, Peirano, DaMatta, Favret-Saada, entre outros - para estabelecer parâmetros na busca de traços que considera específicos do fazer etnográfico e assim chega a três considerações principais: etnografia como experiência, como prática e com base numa certa noção de totalidade. O relato de uma etnografia sobre jovens surdos é apresentado para oferecer um suporte empírico àquelas conclusões.Considering some less orthodox uses of ethnography, not belonging to the anthropological field, this article proposes a discussion on the specificities of the ethnographical research method, based on reflections and researches undertaken at the Urban Anthropology Nucleus (NAU. Taking a Lévi-Strauss's quotation as its starting point, it examines the ideas of authors like Goldman, Peirano, Da Matta, Favret-Saada, among others, in order to establish parameters to guide the search for specific features in the ethnographic métier. Such a discussion leads to three considerations: ethnography as experience, as practice, and as based on a certain concept of "totality". The report of an ethnography on deaf young people is included in the article as empirical support to the conclusions.
NCBI nr-aa BLAST: CBRC-CJAC-01-0227 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0227 ref|YP_438598.1| lipoprotein, putative [Burkholderia thailandensi...s E264] gb|ABC36143.1| lipoprotein, putative [Burkholderia thailandensis E264] YP_438598.1 2e-18 52% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0189 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0189 ref|YP_438598.1| lipoprotein, putative [Burkholderia thailandensi...s E264] gb|ABC36143.1| lipoprotein, putative [Burkholderia thailandensis E264] YP_438598.1 6e-32 45% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0102 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0102 ref|YP_438598.1| lipoprotein, putative [Burkholderia thailandensi...s E264] gb|ABC36143.1| lipoprotein, putative [Burkholderia thailandensis E264] YP_438598.1 5e-36 49% ...
NCBI nr-aa BLAST: CBRC-GACU-01-0025 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-01-0025 ref|YP_438598.1| lipoprotein, putative [Burkholderia thailandensi...s E264] gb|ABC36143.1| lipoprotein, putative [Burkholderia thailandensis E264] YP_438598.1 7e-14 39% ...
DEFF Research Database (Denmark)
Lusingu, John; Olotu, Ally; Leach, Amanda
2010-01-01
) recipient and nine episodes among eight rabies vaccine recipients met the criteria for severe malaria. Unsolicited AEs were reported in 78% of subjects in the RTS,S/AS01(E) group and 74% of subjects in the rabies vaccine group. In both vaccine groups, gastroenteritis and pneumonia were the most frequently...
NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...
Directory of Open Access Journals (Sweden)
Yeimi Alexandra Alzate López
2014-10-01
Full Text Available O artigo analisa as experiências de enfermidade de pacientes com leucemia mieloide crônica (LMC, centrando nas dimensões que apontam a chegada da doença como uma ruptura biográfica. Este estudo qualitativo baseou-se na análise das narrativas de seis pacientes, com idades entre 23 e 62 anos, usuários do Sistema Único de Saúde (SUS e pacientes de um hospital – centro de referência em atenção hematológica na cidade de Salvador, Bahia, Brasil. Nos resultados apresenta-se a experiência de ruptura com base em três categorias (1 os significados da doença e a LMC como ameaça; (2 rupturas físicas, sociais e as experiências estigmatizantes; (3 a percepção de um “antes” e um “depois” da LMC, apontando para as mudanças no self, nas relações sociais e na vida cotidiana. Concluiu-se que os impactos biográficos, sociais e dos sistemas de saúde (considerando o custo das medicações atualizam e ampliam questões como o acesso a tratamentos, assim como o enfrentamento do certo e do incerto, em que o “conhecido” da LMC encontra-se pouco acessível ao estoque de conhecimento da vida cotidiana.
Choi, J H; Choi, W Q; Choi, Y; Jang, H I; Jang, J S; Jeon, E J; Joo, K K; Kim, B R; Kim, H S; Kim, J Y; Kim, S B; Kim, S Y; Kim, W; Kim, Y D; Ko, Y; Lee, D H; Lim, I T; Pac, M Y; Park, I G; Park, J S; Park, R G; Seo, H; Seo, S H; Seon, Y G; Shin, C D; Siyeon, K; Yang, J H; Yeo, I S; Yu, I
2016-05-27
The RENO experiment has analyzed about 500 live days of data to observe an energy dependent disappearance of reactor ν[over ¯]_{e} by comparing their prompt signal spectra measured in two identical near and far detectors. In the period between August of 2011 and January of 2013, the far (near) detector observed 31 541 (290 775) electron antineutrino candidate events with a background fraction of 4.9% (2.8%). The measured prompt spectra show an excess of reactor ν[over ¯]_{e} around 5 MeV relative to the prediction from a most commonly used model. A clear energy and baseline dependent disappearance of reactor ν[over ¯]_{e} is observed in the deficit of the observed number of ν[over ¯]_{e}. Based on the measured far-to-near ratio of prompt spectra, we obtain sin^{2}2θ_{13}=0.082±0.009(stat)±0.006(syst) and |Δm_{ee}^{2}|=[2.62_{-0.23}^{+0.21}(stat)_{-0.13}^{+0.12}(syst)]×10^{-3} eV^{2}.
Energy Technology Data Exchange (ETDEWEB)
Krasnoperov, A
2000-06-01
The NOMAD experiment is looking for {nu}{sub {mu}}{yields}{nu}{sub {tau}} and {nu}{yields}{nu}{sub e} oscillations in a predominantly {nu}{sub {mu}} beam at the CERN SPS. Neutrino oscillations are closely related with the existence of non-zero neutrino mass and mixing between different flavours. This document describes the search for {nu}{sub {mu}}{yields}{nu}{sub e} oscillations in the full NOMAD data sample accumulated during four years of data-taking (1995-98). The search for {nu}{sub e} appearance was performed by studying the charged current (CC) interactions with in the NOMAD detector. The selection of {nu}{sub e} CC and {nu}{sub {mu}} interactions with the help of different particle identification algorithms, as well as using the event kinematic criteria, is described here in detail. We show that the NOMAD experiment is sensitive to the LSND allowed region of oscillation parameters with the squared mass difference larger than 10 eV{sup 2}/C{sup 4}. An upper limit on the probability of {nu}{sub {mu}}{yields}{nu}{sub e} oscillations, based on a fraction of the NOMAD data, is given. (author)
Energy Technology Data Exchange (ETDEWEB)
Ding, Hanping; Xue, Xingjian [Department of Mechanical Engineering, University of South Carolina, Columbia, SC 29208 (United States)
2010-10-15
A new anode-supported SOFC material system Ni-BZCYYb vertical stroke BZCYYb vertical stroke PBFO is investigated, in which a cobalt-free layered perovskite oxide, PrBaFe{sub 2}O{sub 5+{delta}} (PBFO), is synthesized and employed as a novel cathode while the synthesized BZCYYb is used as an electrolyte. The cell is fabricated by a simple dry-pressing/co-sintering process. The cell is tested and characterized under intermediate temperature range from 600 to 700 C with humified H{sub 2} ({proportional_to}3% H{sub 2}O) as fuel, ambient air as oxidant. The results show that the open-circuit potential of 1.006 V and maximal power density of 452 mW cm{sup -2} are achieved at 700 C. The polarization resistance of the electrodes is 0.18 {omega} cm{sup 2} at 700 C. Compared to BaZr{sub 0.1}Ce{sub 0.7}Y{sub 0.1}O{sub 3-{delta}}, the conductivity of co-doped barium zirconate-cerate BZCYYb is significantly improved. The ohmic resistance of single cell is 0.37 {omega} cm{sup 2} at 700 C. The results indicate that the developed Ni-BZCYYb vertical stroke BZCYYb vertical stroke PBFO cell is a promising functional material system for SOFCs. (author)
Respiratory severity score and extubation readiness in very low birth weight infants
Directory of Open Access Journals (Sweden)
Maroun J. Mhanna
2017-12-01
Full Text Available Background: The respiratory severity score (RSS is a byproduct of mean airway pressure (MAP and fraction of inspired oxygen (FiO2. We sought to determine whether RSS could be used as a screening tool to predict extubation readiness in very low birth weight (VLBW infants. Methods: In a retrospective cohort study, medical records of all VLBW infants admitted to our unit (6/1/09â2/28/12 were reviewed for infants' demographics, prenatal characteristics, and medication use. Also, records were reviewed for unplanned vs. planned extubation, blood gas, ventilator parameters and signs of severe respiratory failure [RF, defined as partial pressure of carbon dioxide (pCO2 > 65, pH  50%, and MAP > 10 cm] on the day of extubation. Results: During the study period 31% (45/147 failed extubation. Overall, infants who failed extubation had a lower birth weight (BW and gestational age (GA, and on the day of extubation had a higher RSS and percentage of having one or more signs of severe RF. In a logistic regression model, adjusting for BW, GA, RSS and RF, RSS remained the only risk factor associated with extubation failure [adjusted OR 1.63 (95% CI: 1.10â2.40; p = 0.01]. RSS had a sensitivity of 0.86 (95% CI: 0.72â0.94 at a cutoff of 1.26 and a specificity of 0.88 (95% CI: 0.80â0.94 at a cutoff of 2.5. There was no difference in extubation failure between unplanned vs. planned extubation [41% (9/22 vs. 29% (36/125; p = 0.25]. Conclusion: An elevated RSS is associated with extubation failure. Successful unplanned extubation is common in VLBW infants. Key Words: very low birth weight, extubation, mechanical ventilation, respiratory severity score
NCBI nr-aa BLAST: CBRC-CREM-01-1310 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CREM-01-1310 ref|YP_442494.1| acyltransferase family protein [Burkholderia thailand...ensis E264] gb|ABC38658.1| acyltransferase family protein [Burkholderia thailandensis E264] YP_442494.1 2e-52 44% ...
An experiment to measure the electron neutrino mass using a cryogenic tritium source
International Nuclear Information System (INIS)
Fackler, O.; Jeziorski, B.; Kolos, W.; Monkhorst, H.; Mugge, M.; Sticker, H.; Szalewicz, K.; White, R.M.; Woerner, R.
1985-01-01
An experiment has been performed to determine the electron neutrino mass with the precision of a few eV by measuring the tritium beta decay energy distribution near the endpoint. Key features of the experiment are a 2 eV resolution electrostatic spectrometer and a high-activity frozen tritium source. It is important that the source have electronic wavefunctions which can be accurately calculated. These calculations have been made for tritium and the HeT + daughter ion and allow determination of branching fractions to 0.1% and energy of the excited states to 0.1 eV. The excited final molecular state calculations and the experimental apparatus are discussed. 4 refs., 5 figs
Seiberg duality and e+e- experiments
International Nuclear Information System (INIS)
De Gouvea, Andre; Friedland, Alexander; Murayama, Hitoshi
1998-01-01
Seiberg duality in supersymmetric gauge theories is the claim that two different theories describe the same physics in the infrared limit. However, one cannot easily work out physical quantities in strongly coupled theories and hence it has been difficult to compare the physics of the electric and magnetic theories. In order to gain more insight into the equivalence of two theories, we study the ''e + e - '' cross sections into ''hadrons'' for both theories in the superconformal window. We describe a technique which allows us to compute the cross sections exactly in the infrared limit. They are indeed equal in the low-energy limit and the equality is guaranteed because of the anomaly matching condition. The ultraviolet behavior of the total ''e + e - '' cross section is different for the two theories. We comment on proposed nonsupersymmetric dualities. We also analyze the agreement of the ''γγ'' and ''WW'' scattering amplitudes in both theories, and in particular try to understand if their equivalence can be explained by the anomaly matching condition
Book Review "Advances on remote laboratories and e-learning experiences"
Directory of Open Access Journals (Sweden)
Jesús A. del Alamo
2007-08-01
Full Text Available Book Review "Advances on remote laboratories and e-learning experiences", book editors: Luís Gomes and Javier García-Zubía, University of Deusto, Spain. Reviewed by Jesús A. del Alamo, Massachusetts Institute of Technology, M.I.T.
Preliminary experience with frameless stereotactic radiotherapy
International Nuclear Information System (INIS)
Buatti, John M.; Bova, Francis J.; Friedman, William A.; Meeks, Sanford L.; Marcus, Robert B.; Mickle, J. Parker; Ellis, Thomas L.; Mendenhall, William M.
1998-01-01
Purpose: To report initial clinical experience with a novel high-precision stereotactic radiotherapy system. Methods and Materials: Sixty patients ranging in age from 2 to 82 years received a total of 1426 treatments with the University of Florida frameless stereotactic radiotherapy system. Of the total, 39 (65%) were treated with stereotactic radiotherapy (SRT) alone, and 21 (35%) received SRT as a component of radiotherapy. Pathologic diagnoses included meningiomas (15 patients), low-grade astrocytomas (11 patients), germinomas (9 patients), and craniopharyngiomas (5 patients). The technique was used as means of dose escalation in 11 patients (18%) with aggressive tumors. Treatment reproducibility was measured by comparing bite plate positioning registered by infrared light-emitting diodes (IRLEDs) with the stereotactic radiosurgery reference system, and with measurements from each treatment arc for the 1426 daily treatments (5808 positions). We chose 0.3 mm vector translation error and 0.3 deg. rotation about each axis as the maximum tolerated misalignment before treating each arc. Results: With a mean follow-up of 11 months, 3 patients had recurrence of malignant disease. Acute side effects were minimal. Of 11 patients with low grade astrocytomas, 4 (36%) had cerebral edema and increased enhancement on MR scans in the first year, and 2 required steroids. All had resolution and marked tumor involution on follow-up imaging. Bite plate reproducibility was as follows. Translational errors: anterior-posterior, 0.01 ± 0.10; lateral, 0.02 ± 0.07; axial, 0.01 ± 0.10. Rotational errors (degrees): anterior-posterior, 0.00 ± 0.03; lateral, 0.00 ± 0.06; axial, 0.01 ± 0.04. No patient treatment was delivered beyond the maximum tolerated misalignment. Daily treatment was delivered in approximately 15 min per patient. Conclusion: Our initial experience with stereotactic radiotherapy using the infrared camera guidance system was good. Patient selection and treatment
Directory of Open Access Journals (Sweden)
Shu Guowei
2016-06-01
Full Text Available The objective of the present study was to obtain the optimum proportion of the carbon source and prebiotics for Bifidobacterium bifidum BB01 by the central composite design (CCD. The effect of carbon source (lactose and two prebiotics (inulin and fructooligosaccharides on the BB01 were observed by measuring the OD600 value, pH value and the viable counts at 18h. The final optimized concentrations of carbon source and prebiotics were: lactose 1.6%, inulin 0.26%, and fructooligosaccharides 0.22%. The result indicates that the growth of B. bifidum BB01 shows an significant increase in the optimized culture medium (p < 0.05, the OD600 value reached 1.434 at 18h, which increased 6.58% compared to the control. And the viable counts of B. bifidum BB01 increased 24.36% and reached (2.17±0.06 ×109cfu/mL. The results show that the optimization of the carbon source and prebiotics using CCD in this study is workable and necessary.
Muon Intensity Increase by Wedge Absorbers for Low-E Muon Experiments
Energy Technology Data Exchange (ETDEWEB)
Neuffer, D. V. [Fermilab; Stratakis, D. [Fermilab; Bradley, J. [Fermilab
2017-09-01
Low energy muon experiments such as mu2e and g-2 have a limited energy spread acceptance. Following techniques developed in muon cooling studies and the MICE experiment, the number of muons within the desired energy spread can be increased by the matched use of wedge absorbers. More generally, the phase space of muon beams can be manipulated by absorbers in beam transport lines. Applications with simulation results are presented.
NCBI nr-aa BLAST: CBRC-XTRO-01-0672 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0672 ref|YP_440029.1| ABC transporter domain protein [Burkholderia thailand...ensis E264] gb|ABC33982.1| ABC transporter domain protein [Burkholderia thailandensis E264] YP_440029.1 5e-87 76% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-0757 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-0757 ref|YP_440088.1| Rhs element Vgr protein [Burkholderia thailanden...sis E264] gb|ABC34956.1| Rhs element Vgr protein [Burkholderia thailandensis E264] YP_440088.1 2e-09 36% ...
SU-F-T-351: Establishing a Workflow for IMRT Pre-Treatment Reviews for NRG-GY006 Clinical Trial
Energy Technology Data Exchange (ETDEWEB)
Giaddui, T [Sidney Kimmel Cancer Center, Thomas Jefferson University, Philadelphia, PA (United States); Li, N; Moore, K; Mell, L [University of California, San Diego, San Diego, CA (United States); Curry, K [MIM Software, Inc., Clevealand, OH (United States); Leath, C [University of Alabama at Birmingham, Birmingham, AL (United States); Kunos, C [Northeastern Ohio University College, Clevealand, OH (United States); Xiao, Y [University of Pennsylvania, Philadelphia, PA (United States)
2016-06-15
Purpose: To establish a workflow for NRG-GY006 IMRT pre-treatment reviews, incorporating advanced radiotherapy technologies being evaluated as part of the clinical trial. Methods: Pre-Treatment reviews are required for every IMRT case as part of NRG-GY006 (a randomized phase II trial of radiation therapy and cisplatin alone or in combination with intravenous triapine in women with newly diagnosed bulky stage I B2, stage II, IIIB, or IVA cancer of the uterine cervix or stage II-IVA vaginal cancer. The pretreatment review process includes structures review and generating an active bone marrow(ABM)- to be used as an avoidance structure during IMRT optimization- and evaluating initial IMRT plan quality using knowledgeengineering based planning (KBP). Institutions will initially submit their simulation CT scan, structures file and PET/CT to IROC QA center for generating ABM. The ABM will be returned to the institution for use in planning. Institutions will then submit an initial IMRT plan for review and will receive information back following implementation of a KBP algorithm, for use in re-optimization, before submitting the final IMRT used for treatment. Results: ABM structure is generated using MIM vista software (Version 6.5, MIM corporation, Inc.). Here, the planning CT and the diagnostic PET/CT are fused and a sub threshold structure is auto segmented above the mean value of the SUV of the bone marrow. The generated ABM were compared with those generated with other software system (e.g. Velocity, Varian) and Dice coefficient (reflects the overlap of structures) ranged between 80 – 90% was achieved. A KBP model was built in Varian Eclipse TPS using the RapidPlan KBP software to perform plan quality assurance. Conclusion: The workflow for IMRT pretreatment reviews has been established. It represents a major improvement of NRG Oncology clinical trial quality assurance and incorporates the latest radiotherapy technologies as part of NCI clinical trials. This project
SU-F-T-351: Establishing a Workflow for IMRT Pre-Treatment Reviews for NRG-GY006 Clinical Trial
International Nuclear Information System (INIS)
Giaddui, T; Li, N; Moore, K; Mell, L; Curry, K; Leath, C; Kunos, C; Xiao, Y
2016-01-01
Purpose: To establish a workflow for NRG-GY006 IMRT pre-treatment reviews, incorporating advanced radiotherapy technologies being evaluated as part of the clinical trial. Methods: Pre-Treatment reviews are required for every IMRT case as part of NRG-GY006 (a randomized phase II trial of radiation therapy and cisplatin alone or in combination with intravenous triapine in women with newly diagnosed bulky stage I B2, stage II, IIIB, or IVA cancer of the uterine cervix or stage II-IVA vaginal cancer. The pretreatment review process includes structures review and generating an active bone marrow(ABM)- to be used as an avoidance structure during IMRT optimization- and evaluating initial IMRT plan quality using knowledgeengineering based planning (KBP). Institutions will initially submit their simulation CT scan, structures file and PET/CT to IROC QA center for generating ABM. The ABM will be returned to the institution for use in planning. Institutions will then submit an initial IMRT plan for review and will receive information back following implementation of a KBP algorithm, for use in re-optimization, before submitting the final IMRT used for treatment. Results: ABM structure is generated using MIM vista software (Version 6.5, MIM corporation, Inc.). Here, the planning CT and the diagnostic PET/CT are fused and a sub threshold structure is auto segmented above the mean value of the SUV of the bone marrow. The generated ABM were compared with those generated with other software system (e.g. Velocity, Varian) and Dice coefficient (reflects the overlap of structures) ranged between 80 – 90% was achieved. A KBP model was built in Varian Eclipse TPS using the RapidPlan KBP software to perform plan quality assurance. Conclusion: The workflow for IMRT pretreatment reviews has been established. It represents a major improvement of NRG Oncology clinical trial quality assurance and incorporates the latest radiotherapy technologies as part of NCI clinical trials. This project
International Nuclear Information System (INIS)
Marques, Andre Luis Ferreira; Ting, Daniel Kao Sun; Mendonca, Arlindo Gilson
1996-01-01
A calculation methodology of Flux Depression, Self-Shielding and Cadmium Factors is presented, using the ANISN code, for experiments conducted at the IPEN/MB-01 Research Reactor. The correction factors were determined considering thermal neutron flux and 0.125 e 0.250 mm diameter of 197 Au wires. (author)
NCBI nr-aa BLAST: CBRC-CREM-01-1344 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CREM-01-1344 ref|YP_441750.1| C4-dicarboxylate transport protein [Burkholderia thailand...ensis E264] gb|ABC36407.1| C4-dicarboxylate transport protein [Burkholderia thailandensis E264] YP_441750.1 1e-72 65% ...
Status of soft photons in experiment E855
International Nuclear Information System (INIS)
Woody, C.; Lissauer, D.; Gomez del Campo, J.; Ray, A.; Shapira, D.; Tincknell, M.; Clark, R.; Erd, C.; Schukraft, J.; Willis, W.
1990-01-01
Experiment E855 was carried out at the AGS at Brookhaven National Laboratory to study soft photon production near center of mass rapidity Y cm ∼ 0 in proton-nucleus collisions at 10 at 18 GeV/c. This was the first dedicated experiment to study this phenomenon at these lower energies. It is important to note that the related process of low mass dilepton pair production has been studied extensively at these energies and an excess signal of dileptons above known hadronic backgrounds has been firmly established. E855 was designed to measure photon production from P t ∼ 5 MeV/c up to several GeV/c. A search will be made for an excess of soft photons in the P t region below the Jacobian peak from π 0 decays, above that which is expected from hadronic bremsstrahlung. Any observed signal will be correlated with the total charged multiplicity in the event in order to determine its production mechanism. This correlation can be used to distinguish purely hadronic sources of soft photons, such as mesons decays and bremsstrahlung, which vary linearly with the charged multiplicity, and a thermal source of soft photons which would exhibit a quadratic dependence on the charged multiplicity. In addition, E855 will measure low energy photons from nuclear decays which can be a background for measuring soft photons near Y cm ∼ 0. These photons are also interesting from a nuclear physics point of view, since the spectrum of photons from nuclei excited by incident high energy protons gives a measure of the temperature of the excited nucleus and the amount of excitation energy which can be transferred to a nucleus in a high energy proton collision
Li, Honglei; Aham-Anyanwu, Nnanyelugo; Tevrizci, Cemal; Luo, Xin
2015-01-01
This research aims to investigate the process and factors relevant for developing customer e-loyalty from an e-service quality experience perspective. Based on previously published loyalty studies and e-commerce literature, an integrated model of e-loyalty development process is proposed by including and validating value perception and the e-service quality scale eTailQ scale. The eTailQ scale consists of website design, security/privacy, value perception, reliability and customer support and...
Gene : CBRC-CJAC-01-0155 [SEVENS
Lifescience Database Archive (English)
Full Text Available al stress-inducible protein emb|CAA42554.1| environmental stress and abscisic acid ...CBRC-CJAC-01-0155 Novel UN D UNKNOWN GRPA_MEDFA 1e-06 35% sp|Q09134|GRPA_MEDFA Abscisic acid and environment
Crossed molecular beams study of the reaction D+H2→DH+H at collision energies of 0.53 and 1.01 eV
International Nuclear Information System (INIS)
Continetti, R.E.; Balko, B.A.; Lee, Y.T.
1990-01-01
This paper reports the first product differential cross section (DCS) measurements for the D+H 2 →DH+H reaction as a function of laboratory (LAB) scattering angle with sufficient resolution to resolve product DH vibrational states. Using a D-atom beam produced by the photodissociation of DI at 248 nm, product velocity and angular distributions were measured at 12 LAB angles at a nominal collision energy of 0.53 eV and at 22 LAB angles at a nominal collision energy of 1.01 eV with a crossed molecular beams apparatus. After correction of the raw product time-of-flight (TOF) spectra for modulated background, a comparison with recent exact quantum mechanical scattering calculations was made using a Monte Carlo simulation of the experimental conditions. The simulation showed that although the theoretical predictions agree qualitatively with the measurements, some significant discrepancies exist. Using the Monte Carlo simulation, a best-fit set of DH(v,j) DCS's which showed good agreement with the measurements was found. At the detailed level of the state-to-state DCS, significant differences were observed between theory and experiment for rotationally excited DH(v, j) products. The discrepancies observed suggest that some regions of the current ab initio H 3 potential energy surfaces, particularly the bending potential at high energies, may need further examination
User Experience: essencial no projeto de produtos e serviços
Directory of Open Access Journals (Sweden)
Antonio Mendes Silva Filho
2012-03-01
Full Text Available Simplicidade é um desejo inconsciente buscado pelo ser humano quando utiliza um produto para executar uma tarefa. Simplicidade é um objetivo de projeto que todo projetista deve ter em mente quando projeta um novo produto. O projetista deve se colocar no lugar do usuário do produto, buscando entender se as funcionalidades implementadas pelo sistema e a maneira pela qual elas podem ser acessadas são facilmente assimiladas pelos usuários. Ter essa preocupação é considerar a usabilidade como determinante no processo de desenvolvimento de um produto ou sistema. Essa atitude impacta diretamente sobre a aceitabilidade e sucesso do produto. Este artigo aborda como a experiência do usuário (user experience é essencial no desenvolvimento de novos produtos.
Fernandes, Marcos Gimenes; Nunes, Sandra Adriana Neves; Raposo, José Vasconcelos; Fernandes, Helder Miguel
2014-01-01
O presente estudo teve os seguintes objetivos: i) examinar as correlações inter-escalas entre as três dimensões de respostas (intensidade, direção e frequência) do CSAI-2R e sua relação com a experiência competitiva; e ii) verificar o efeito da experiência competitiva na ansiedade (cognitiva e somática) e na autoconfiança na amostra total e em função de diferentes tipos de modalidades (individuais vs. coletivas). A amostra foi composta por 267 atletas (196 do sexo masculino e 71 do sexo femin...
Search for structure in sigma(e+e-→hadrons) between √s = 10.34 and 11.6 GeV
International Nuclear Information System (INIS)
Rice, E.; Boehringer, T.; Franzini, P.; Han, K.; Herb, S.W.; Mageras, G.; Peterson, D.; Yoh, J.K.; Lee-Franzini, J.; Giannini, G.; Schamberger, R.D. Jr.; Sivertz, M.; Spencer, L.J.; Tuts, P.M.; Imlay, R.; Levman, G.; Metcalf, W.; Sreedhar, V.; Blanar, G.; Dietl, H.; Eigen, G.; Lorenz, E.; Pauss, F.; Vogel, H.
1982-01-01
The CUSB detector at the Cornell electron storage ring has been used to measure R-sigma(e + e - →hadrons)/sigma(e + e - →μ + μ - ) in the c.m. energy regions between the UPSILON'' and the UPSILON''', and above the UPSILON''' up to √s = 11.6 GeV, with integrated luminosities of 5000 and 2100 nb -1 , respectively. No narrow resonances are observed, and limits on the leptonic widths are presented. The average value of R increases by 0.31 +- 0.06 across the flavor threshold
Tempo e Trânsito na Experiência Subjetiva de Motoristas
Directory of Open Access Journals (Sweden)
Ana Inez Oka Elvas de Lima
2015-03-01
Full Text Available Esta pesquisa investiga como são percebidos e vivenciados o tempo e a pressa no trânsito por motoristas de Fortaleza, identificando e analisando seus estados subjetivos e comportamentos associados a essa experiência. Para a coleta de dados, organizaram-se quatro grupos focais, a partir dos quais emergiram diversos elementos relacionados ao tempo e à pressa e à incidência de comportamentos inadequados no trânsito, segundo o sexo e a idade dos participantes. Para analisar os dados obtidos nas discussões grupais utilizaram-se os critérios da Análise Clássica de Conteúdo. Os resultados levaram à conclusão de que a questão do tempo e da pressa constitui um potencial gerador de erros e violações na condução de veículos, pois exerce influência decisiva sobre os comportamentos dos motoristas e configura uma realidade importante para se compreender os fatores humanos envolvidos na dinâmica do trânsito e do ambiente urbano como um todo.
“Aniversário Guanabara”: comunicação, consumo e experiência comum
Directory of Open Access Journals (Sweden)
João Luis de Araújo Maia
2015-12-01
Full Text Available Neste artigo, discutimos como experiências de consumo podem compreender muito mais que a simples venda e aquisição de bens ou serviços. Nosso foco está na experiência vivida de forma compartilhada, onde o desejo de estar junto, em meio à multidão, ganha mais destaque e relevância que a prática econômica do consumo. No evento “Aniversário Guanabara”, comprar barato é apenas um dos dados que orientam os consumidores. Tocar-se, esbarrar-se e vivenciar a confusão nos corredores do supermercado assumem um caráter de divertimento e prazer para muitos que ali estão.
Study of the Z Boson Production at the ATLAS Experiment with First Data
Schott, Matthias
The ATLAS detector, currently in its final installation phase at CERN, is designed to provide precise measurements of 14 TeV proton-proton collisions at the Large Hadron Collider. The measurements of the cross section and transverse momentum spectrum of the Z boson production at LHC provides first tests of the standard model in a new energy domain and may reveal exotic physics processes. Moreover, the properties of the Z boson resonance and its decay into two muons are known to very high precision from LEP experiments and hence can be used as a physics process for calibration and alignment. The Z boson production is also a common background process for many other physics analyses and must therefore be well understood. This thesis describes a measurement strategy of the cross section s for the process pp->Z->(mu)(mu) at the ATLAS experiment during its startup phase. As a result of this study a precision of d(sigma)/ (sigma) = 0.006(stat) + 0.008(sys) + 0.01 (pdf) is expected for an integrated luminosity of 50 ...
Midlatitude Continental Convective Clouds Experiment (MC3E)
Energy Technology Data Exchange (ETDEWEB)
Jensen, MP; Petersen, WA; Del Genio, AD; Giangrande, SE; Heymsfield, A; Heymsfield, G; Hou, AY; Kollias, P; Orr, B; Rutledge, SA; Schwaller, MR; Zipser, E
2010-04-10
The Midlatitude Continental Convective Clouds Experiment (MC3E) will take place in central Oklahoma during the April–May 2011 period. The experiment is a collaborative effort between the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility and the National Aeronautics and Space Administration’s (NASA) Global Precipitation Measurement (GPM) mission Ground Validation (GV) program. The field campaign leverages the unprecedented observing infrastructure currently available in the central United States, combined with an extensive sounding array, remote sensing and in situ aircraft observations, NASA GPM ground validation remote sensors, and new ARM instrumentation purchased with American Recovery and Reinvestment Act funding. The overarching goal is to provide the most complete characterization of convective cloud systems, precipitation, and the environment that has ever been obtained, providing constraints for model cumulus parameterizations and space-based rainfall retrieval algorithms over land that have never before been available.
Women's expectations and experiences regarding e-health treatment: A systematic review.
Verhoeks, Carmen; Teunissen, Doreth; van der Stelt-Steenbergen, Anke; Lagro-Janssen, Antoine
2017-08-01
There is a gap in knowledge of women's perceptions of e-health treatment. This review aims to investigate women's expectations and experiences regarding e-health. A search was conducted in MEDLINE, EMBASE, CINAHL and PsycInfo in March 2016. We included articles published between 2000 and March 2016, reporting on e-health interventions. The initial search yielded 2987 articles. Eventually, 16 articles reporting on 16 studies were included. Barriers to e-health treatment were lower for women than barriers to face-to-face treatment, such as feelings of shame and time constraints. Women were able to develop an online therapeutic relationship. As reduced feelings of obligation and lack of motivation were women's greatest challenges in completing e-health treatment, they expressed a wish for more support during e-health treatment, preferably blended care. e-Health lowers the threshold for women to seek healthcare. Combining e-health interventions with face-to-face sessions may enhance women's motivation to complete treatment.
Pixel sensor evaluation and online event selection for the Mu3e experiment
Energy Technology Data Exchange (ETDEWEB)
Bruch, Dorothea vom
2017-10-27
Despite having survived numerous experimental tests, the standard model of particle physics is not a complete description of nature. The Mu3e experiment tests theories beyond the standard model by searching for the lepton flavour violating decay μ→e{sup +}e{sup -}e{sup +}, aiming at a branching ratio sensitivity of 2.10{sup -15} in a first phase of the experiment. A high precision magnetic spectrometer combined with scintillation detectors will measure the momenta, vertices and timing of the decay products of 1.10{sup 8} μ/s stopped on a target. In this work, a prototype of the high voltage monolithic active pixel sensor envisaged for the spectrometer was characterised. With an efficiency >99% and a time resolution of 14 ns, it meets the requirements imposed on the final sensor. Furthermore, an online signal selection process was developed and implemented on a graphics processing unit (GPU), keeping 98% of signal decays, while reducing the data rate of 80 Gbit/s by a factor of 140; resulting in a rate that can be stored to disk. With the computing performance achieved on the GPU, the selection process can run on the hardware planned for the experiment. Both the online selection and the silicon sensor are key aspects for the success of Mu3e.
Directory of Open Access Journals (Sweden)
Valéria Garcia Caputo
2008-06-01
Full Text Available OBJETIVO: Analisar fatores individuais e familiares associados à gravidez na adolescência, incluindo uso freqüente de álcool e drogas ilícitas por familiar. MÉTODOS: Estudo de caso-controle com amostra de 408 adolescentes (13-17 anos escolares sexualmente ativas, de Marília, SP, 2003-2004. Os casos eram 100 primigestas atendidas em programas de pré-natal de unidades de saúde e os controles, 308 estudantes que nunca haviam engravidado, provenientes de oito escolas estaduais. Foram coletados com instrumentos padronizados dados sociodemográficos, educacionais, comportamento contraceptivo, problemas de saúde mental e características familiares. A análise estatística incluiu testes de qui-quadrado e modelos de regressão logística. RESULTADOS: A baixa escolaridade paterna (p=0,01, a falta de informação sobre sexualidade e fertilização (p=0,001 e o uso de drogas ilícitas por familiar residente no domicílio (p=0,006 foram fatores de risco independentemente dos demais. Renda familiar per capita e pedir ao parceiro que usasse preservativo foram fatores de confundimento. CONCLUSÕES: O uso freqüente de drogas ilícitas por familiar residente no domicílio é um fator fortemente associado à gravidez na adolescência, independentemente dos demais. A expectativa de cursar a faculdade constitui fator de proteção, principalmente na presença de baixa escolaridade materna.OBJECTIVE: To assess individual and family factors associated to teenage pregnancy, including frequent use of alcohol and illicit drugs by family members. METHODS: Case-control study conducted with a sample of 408 sexually active female adolescents (aged 13-17 years in school from the city of Marília (Southeastern Brazil in 2003-2004. Cases consisted of 100 primigravid teenagers assisted in prenatal care programs in health units. Controls were 308 nulligravid students from state public schools. Standardized instruments identified demographic and educational factors
Energy Technology Data Exchange (ETDEWEB)
Conner, K.R.
2000-12-12
This document presents the assessment of environmental impacts resulting from releases of hazardous substances from the facilities in the Old Radioactive Waste Burial Ground 643-E, including Solvent Tanks 650-01E to 650-22E, also referred to as Solvent Tanks at the Savannah River Site, Aiken, South Carolina.
Inclusive (e,e'N), (e,e'NN), (e,e'π),... reactions in nuclei
International Nuclear Information System (INIS)
Gil, A.; Oset, E.
1997-01-01
We study the inclusive (e,e'N), (e,e'NN), (e,e'π), (e,e'πN) reactions in nuclei using a Monte Carlo simulation method to treat the multichannel problem of the final state. The input consists of reaction probabilities for the different steps evaluated using microscopical many body methods. We obtain a good agreement with experiment in some channels where there is data and make predictions for other channels which are presently under investigation in several electron laboratories. The comparison of the theoretical results with experiment for several kinematical conditions and diverse channels can serve to learn about different physical processes occurring in the reaction. The potential of this theoretical tool to make prospections for possible experiments, aiming at pinning down certain reaction probabilities, is also emphasized. (orig.)
"Nicarágua na encruzilhada": Cortázar, Vargas Llosa e a experiência sandinista
Directory of Open Access Journals (Sweden)
Adriane Vidal Costa
2009-12-01
Full Text Available No final dos anos 1970 e início dos 80, Julio Cortázar e Mario Vargas Llosa compararam a Nicarágua sandinista com a Cuba de Fidel Castro, colocando em dia o debate sobre a revolução e o socialismo na América Latina. O presente trabalho analisa os artigos de Cortázar e Vargas Llosa para mostrar como eles compreenderam e traduziram a experiência sandinista. Em fins dos anos 1970, muitos intelectuais passaram a defender a Revolução Sandinista, como a possível revolução ideal ou uma nova chance para a experiência socialista na América Latina, como foi o caso de Cortázar. Vargas Llosa, desencantado com as esquerdas, apontava os "erros" do regime que poderiam levar a experiência sandinista a transformar o país centro-americano em uma "nova Cuba".
Accurate determination of rates from non-uniformly sampled relaxation data
Energy Technology Data Exchange (ETDEWEB)
Stetz, Matthew A.; Wand, A. Joshua, E-mail: wand@upenn.edu [University of Pennsylvania Perelman School of Medicine, Johnson Research Foundation and Department of Biochemistry and Biophysics (United States)
2016-08-15
The application of non-uniform sampling (NUS) to relaxation experiments traditionally used to characterize the fast internal motion of proteins is quantitatively examined. Experimentally acquired Poisson-gap sampled data reconstructed with iterative soft thresholding are compared to regular sequentially sampled (RSS) data. Using ubiquitin as a model system, it is shown that 25 % sampling is sufficient for the determination of quantitatively accurate relaxation rates. When the sampling density is fixed at 25 %, the accuracy of rates is shown to increase sharply with the total number of sampled points until eventually converging near the inherent reproducibility of the experiment. Perhaps contrary to some expectations, it is found that accurate peak height reconstruction is not required for the determination of accurate rates. Instead, inaccuracies in rates arise from inconsistencies in reconstruction across the relaxation series that primarily manifest as a non-linearity in the recovered peak height. This indicates that the performance of an NUS relaxation experiment cannot be predicted from comparison of peak heights using a single RSS reference spectrum. The generality of these findings was assessed using three alternative reconstruction algorithms, eight different relaxation measurements, and three additional proteins that exhibit varying degrees of spectral complexity. From these data, it is revealed that non-linearity in peak height reconstruction across the relaxation series is strongly correlated with errors in NUS-derived relaxation rates. Importantly, it is shown that this correlation can be exploited to reliably predict the performance of an NUS-relaxation experiment by using three or more RSS reference planes from the relaxation series. The RSS reference time points can also serve to provide estimates of the uncertainty of the sampled intensity, which for a typical relaxation times series incurs no penalty in total acquisition time.
Directory of Open Access Journals (Sweden)
Monica Grin
2011-09-01
Full Text Available O presente artigo busca tratar comparativamente duas experiências recentes de reserva de vagas em universidades públicas, nos EUA e no Brasil, que utilizaram o critério racial, e seus impactos na opinião pública. Trata-se, no primeiro caso, da pioneira introdução de cotas para negros na UERJ, em janeiro de 2003; e, no segundo, da decisão da Suprema Corte norte-americana envolvendo a graduação (college e a Escola de Direito (Law School da Universidade de Michigan, em junho de 2003. Como hipótese inicial, sugiro que as duas experiências de cotas raciais em universidades públicas, ainda que assemelhadas, ativam princípios sociológicos, éticos e jurídicos substantivamente diferenciados.
Directory of Open Access Journals (Sweden)
Mariane de Paula Ishi
2007-12-01
Full Text Available O melhoramento genético de suínos levou ao surgimento de diversas linhagens suínas que apresentam elevada capacidade de desenvolvimento de massa muscular. Entretanto, pouco se sabe cientificamente sobre a morfologia de órgãos destes animais, conhecimento que ajuda a elucidar características relacionadas ao desempenho zootécnico como ganho de peso e conversão alimentar em carne magra. Objetivou-se, assim, comparar a morfologia dos órgãos digestivos e não-digestivos de suínos de linhagens modernas ao final das fases de Crescimentos I e II, Terminação e Pós-terminação. O peso dos órgãos em relação ao peso vivo diminuiu significativamente (p The genetic market makes use of various modern swine genotypes that present high capacity for muscular mass development. These genetic lines have been used in swine production without existing scientific information about morphology, knowledge that can elucidate factors related to growth performance, such as weight gain and food conversion in lean meat yield. The aim of this experiment was to compare the morphology of digestive and non-digestive organs of modern genotypes. At the end of the phases: Growing I, Growing II, Finishing and Post-finishing, the pigs were slaughtered and the organs were weighed. The weight of the organs decreased (p < 0.01 with body development, in agreement with the biological growth of the animals. The morphology of the digestive organs were different (p < 0.06 among lineages, which showed that differences can exist, mainly regarding digestive capacity and, possibly, food intake and efficiency. The length of the small intestine was different (p < 0.06 among lines, which can be an indicative of increased body development due to an extended food exposition area to intestinal cells. The scientific knowledge of swine lines morphology is important because this information can contribute to animal growth performance.
An example of e-p colliding machine experiments at TRISTAN
International Nuclear Information System (INIS)
1980-01-01
This is a design report of a possible detector system of the e-p colliding machine experiment at TRISTAN. The aim of this note is to know what kind of detectors should be developed and what kind of requirements the TRISTAN machines and the environmental supporting facilities should fulfill. (author)
Public gaming: eSport and event marketing in the experience economy
Borowy, Michael
2012-01-01
This thesis situates organized competitive digital gaming (eSport) in the context of historical sport, the rise of the computer and video games industry, event marketing, and the experience economy. It argues that the oftentimes misattributed origins of eSport in truth first took place during the early 1980s in arcades, when the various criteria for sport, including public contest, a structured framework for victory and defeat, mediatization and promotion, professionalization, record-keeping,...
Capital social e qualidade da atenção à saúde: as experiências do Brasil e da Catalunha
Directory of Open Access Journals (Sweden)
Selma Cristina Franco
2013-07-01
Full Text Available Os diferentes modelos de gestão da saúde refletem as concepções que os embasam e seus arranjos institucionais podem propiciar o aprimoramento da política de saúde. O presente artigo objetiva fazer uma reflexão sobre as potencialidades e os limites da estrutura organizacional e do capital social para produzirem mudanças no desempenho das organizações públicas de saúde na busca de melhor qualidade assistencial. A descrição e a análise de duas experiências de organização de sistemas públicos de saúde universais, na Catalunha e no Brasil, mostram similaridades nos marcos legais, porém com uma diversidade de caminhos trilhados, que deu origem a experiências distintas de gestão, uma priorizando a organização gerencial e a outra o protagonismo de atores sociais promovendo a institucionalização do capital social. Sugere-se que em modelos de gestão onde há diálogo entre um desenho organizacional eficiente e participação cidadã capaz de construir capital social, pode-se promover mudanças na cultura organizacional em prol da qualidade assistencial.
O caminho, a experiência e a aventura
Directory of Open Access Journals (Sweden)
Marcelo Rodrigues Souza Ribeiro
2009-01-01
Full Text Available http://dx.doi.org/10.5007/2178-4582.2009v43n1p265 Acompanhando o itinerário demarcado pelas palavras do título, o artigo se divide em quatro partes. Na primeira, após um prelúdio sobre os escritos de Georg Simmel, o tema do milagre do caminho como diferença do humano em relação ao animal orienta, por meio de uma interrogação histórica, um questionamento sobre o conceito de vida na modernidade. Na segunda, a questão da modernidade é desdobrada em torno do motivo da destruição ou expropriação da experiência, tal como discutido por Simmel e Walter Benjamin (entre outros. Na terceira, uma leitura de A aventura, ensaio de 1911 de Simmel, possibilita interrogar a colonialidade como condição da modernidade. Na quarta, retomando a questão da diferença entre humano e animal em relação à discussão sobre aventura, colonialidade e modernidade, esboça-se uma compreensão do conjunto das narrativas de Tarzan como exemplo paradigmático de narrativas de aventura coloniais-modernas que, ademais, articulam discursos sobre a diferença entre humano e animal.
Fast optical readout for Mu3e experiment
Energy Technology Data Exchange (ETDEWEB)
Huang, Qinhua [Institut fuer Kernphysik, Universitaet Mainz, Mainz (Germany); Collaboration: Mu3e-Collaboration
2016-07-01
Charged lepton flavour violation is highly suppressed in the Standard Model, which results in a prediction for the branching ratio of μ{sup +}→e{sup +}e{sup +}e{sup -} below O(10{sup -54}). The Mu3e experiment will search for this rare decay with a sensitivity of 10{sup -16}. An observation would be a clear sign for new physics. A high muon stopping rate of 2.10{sup 9} Hz is required so that sufficient statistics can be accumulated in about one year of data taking. The high event rate and the requirement of a full online track reconstruction demand a fast readout system which should provide a bandwidth above 1 Tbit/s. Reconfigurable devices, namely FPGAs, can easily parallelise the data processing, so it becomes possible to sort, merge, pack and route the data with low latency at high throughput. Optical fibres are the only option for the interconnection between different FPGA-based boards. The fibres also reduce the crosstalk and signal attenuation, especially over long distance links. As part of the readout system prototyping, firmware for synchronous merging of different data streams is being developed. In addition, the optical links have been tested and show a bit error rate below O(10{sup -16}) at 6.4 Gbit/s for a single fibre.
Kim, Hyoshin; Davis, Andrew H; Dohack, Jaime L; Clark, Pamela I
2017-02-01
To gain a better understanding of electronic cigarette (e-cigarette) use behavior and experience among adult e-cigarette users, with the goal of informing development of future e-cigarette use measures. Between August and October 2014 six focus groups were conducted in Seattle. Participants (63% male; 60% >35 years old; 60% White): e-cigarette users who used combustible tobacco products either currently or in the past. E-cigarette discussion topics covered: their daily use pattern (eg, frequency), product-related characteristics (eg, nicotine levels), and perceptions about health risks and benefits. Participants' descriptions of daily use were so varied that no common "unit" of a "session" easily summarized frequency or quantity of typical e-cigarette use. Most users had difficulty in tracking their own use. Participants reported nicotine craving relief when using e-cigarettes, but described e-cigarettes use as less satisfying than combustible cigarettes. Valued characteristics included "ready availability" and the possibility of using indoors. A unique aspect of the e-cigarette use experience is the option of adding flavors and having the ability to exhale "big clouds" of vapor/aerosol. Most perceived e-cigarettes as a better and safer alternative to conventional cigarettes, yet still sought further information about health consequences and safety of e-cigarettes from trusted sources. E-cigarettes users are far from homogeneous in their behavior and motivation for adopting e-cigarettes. A range of use patterns arising from both hedonic and utilitarian factors, along with product characteristics (eg, variable nicotine levels and flavors) extending beyond those of conventional cigarettes, suggest that new, specific e-cigarette use measures must be developed. The current study provides timely information on adult e-cigarette use behavior, which is a crucial step in measuring this new phenomenon and assessing the risks associated with using e-cigarette products. Our
Real remote physics experiments across Internet-- inherent part of Integrated e-Learning
Directory of Open Access Journals (Sweden)
Frantisek Lustig
2008-05-01
Full Text Available Abstract— The implementation of the real remote experiments across the Internet into teaching process, up till now not available, enables introduction of Integrated e-Learning, composed of three components: the real remote experiments across the Internet, the simulation applets and the electronic interactive textbooks. We present here the prospective remote laboratory system with data transfer using Intelligent School Experimental System (ISES as hardware and ISES WEB Control kit as software. This approach enables the simple construction of remote experiments without building any hardware and virtually no programming, only with paste and copy approach of pre-built typical blocks as camera view, controls, graphs, displays etc. In conclusion we summarize the achieved experience with remote experiments.
Guerra, Manuel Pereira Rodrigues
2011-01-01
Este trabalho Cria e Recria a Forma e Vazio com Fantasia e Imaginação,apresentando uma forte ligação entre a Forma e Vazio. Considerando mesmo,que o vazio é forma e a forma é vazio,por outro lado, é no vazio que as formas acontecem. Além das experiências que foram desenvolvidas individualmente, também trabalhei conjuntamente em grupos com os alunos. Este trabalho ajudou a uma boa cooperação entre o professor e os alunos. Estas experiências demonstram, que os pedagogos, os professores devem da...
NCBI nr-aa BLAST: CBRC-TBEL-01-2355 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TBEL-01-2355 ref|ZP_01467471.1| gspii_e N-terminal domain family [Stigmatella ...aurantiaca DW4/3-1] gb|EAU61761.1| gspii_e N-terminal domain family [Stigmatella aurantiaca DW4/3-1] ZP_01467471.1 3e-05 38% ...
Bringing back the book through digital experiences: e-Books and ...
African Journals Online (AJOL)
Bringing back the book through digital experiences: e-Books and digital media as platforms for reading among school children. ... for technology has changed the format of books and reading platforms from print to ereaders. ... print. Findings further showed that there is no significant difference in the attitude of boys and girls ...
Directory of Open Access Journals (Sweden)
J.E. Ramírez-Bribiesca
2005-02-01
Full Text Available Three experiments were carried out to determine the optimum selenium-vitamin E injection level to maintain acceptable blood selenium (Se status of does and kids, as well as to determine the relation of that status to mortality rates in kids. In experiment 1, 238 goats were assigned to one of three groups during the mating period: A1-control, A2- 0.06mgSe+0.8IU vitE/kgBW and A3-0.125mgSe+1.7IU vitE/kgBW. No differences (P>.05 for fertility and prolificacy were observed among the groups. Blood Se concentration did not differ among Se-vit E groups and control group before injection, and both groups showed Se deficient condition. There was a trend (PForam conduzidos três experimentos para determinar a quantidade ótima da injeção de selênio-vitamina E (Se-vit E para manter o nível aceitável do status de selênio no sangue de cabras e cabritos e determinar essa relação com o status sobre a taxa de mortalidade de cabritos. No primeiro experimento, 238 cabras foram usados em um dos três grupos durante o período do acasalamento: A1- controle, A2- 0,06mgSe+0,8UI vit E/kg de peso-vivo e A3- 0,125mgSe+1,7UI vitE/kg de peso-vivo. Não houve diferenças (P>0,05 entre os grupos para fertilidade e prolificidade. A concentração de Se no sangue não foi diferente entre os grupos que receberam Se-vit E e o controle antes da injeção e ambos os grupos mostravam deficiência de Se. Sessenta dias pós-tratamento houve tendência (P<0,05; 32% de aumentar o nível de Se no sangue e não houve diferença entre os grupos A2 e controle. Houve diferença significativa (P<0,05; 103% entre os grupos A1 e A2 e o grupo A3. No segundo experimento, 48 cabras foram divididas em quatro grupos: B1- controle, B2- 0,125mgSe+1,7UI vitE/kg de peso-vivo, B3- 0,25mgSe+3,4UI vitE/kg de peso-vivo e B4- 0,31mgSe+4,2UI vitE/kg de peso-vivo. O grupo B4 alcançou a concentração mais alta no terceiro mês depois da injeção (0,11ppm e diminuiu depois de 100 dias, quando o valor
The LYSO crystal calorimeter for the Mu2e experiment
International Nuclear Information System (INIS)
Pezzullo, G; Cervelli, F; Budagov, J; Davydov, Yu; Glagolev, V; Carosi, R; Cheng, C; Echenard, B; Hitlin, D; Ongmonkolkul, P; Porter, F; Cordelli, M; Corradi, G; Giovannella, S; Happacher, F; Luca, A; Martini, M; Miscetti, S; Saputi, A; Murat, P
2014-01-01
The Mu2e experiment at Fermilab searches the neutrino-less conversion of the muon into electron in the field of an Aluminum nucleus. If such a process will be observed, it will be a proof of the charged-lepton-flavor-violation (cLFV), otherwise Mu2e will set an upper limit of R μe < 6 × 10 −17 @ 90% C.L. (which represents an improvement by 3–4 order of magnitude over the existing limit). The Mu2e detector apparatus consists of a magnetic spectrometer, devoted to the measurement of the electrons momentum, and an electromagnetic calorimeter (EMC) which provides an independent measurement of the electron energy, time and position, used for validating or rejecting candidate tracks selected by the tracking system. In this paper, we describe the baseline project of the EMC and present results in terms of performances and R and D
Directory of Open Access Journals (Sweden)
Irma de Oliveira
2000-06-01
Full Text Available O presente estudo foi realizado com mães acompanhantes em um hospital escola. Os objetivos foram: compreender as interações vivenciadas, identificar os significados que o familiar acompanhante atribui à experiência de vivenciar a hospitalização da criança, identificar o que essa vivência provoca na vida do familiar e construir um modelo teórico representativo da experiência. Utilizou-se como Referencial Teórico o Interacionismo Simbólico e Referencial Metodológico a "Grounded Theory". Identificou-se os fenômenos Indo em busca de solução e Atravessando uma situação difícil. A partir desses fenômenos emergiu a categoria central Vivenciando com o filho uma passagem difícil e reveladora.This study was conducted with live-in mother in university hospital. The objectives were as follows: to understand the experienced interactions, to identify the meanings that a family attribute to the experience of going through the child's hospitalization, to identify what the experience of hospitalization provokes in the family life and construct a model theory representative of the experience. Reference Theory the Symbolic Interactionism and Reference Methodology Grounded Theory had been utilized. From results appeared the phenomenon Going in search of solution, and Going through a difficult situation. Through these phenomena, the main category Experiencing a difficult and revealing passage with her child was identified.
Utilization of a terrestrial cyanobacterium, Nostoc sp. HK-01, for space habitation
Kimura, Shunta; Tomita-Yokotani, Kaori; Arai, Mayumi; Yamashita, Masamichi; Katoh, Hiroshi; Ajioka, Reiko; Inoue, Kotomi
2016-07-01
A terrestrial cyanobacterium, Nostoc sp. HK-01 (hereafter HK-01), has several useful abilities for space habitation; photosynthesis, nitrogen fixation, and space environmental tolerances to vacuum, UV, gamma-ray, heavy particle beam, low and high temperature. Space environmental tolerances are important for transportation to Mars. HK-01 can grow on Martian regolith simulant (MRS) in vitro. Furthermore, HK-01 is useful as food. HK-01 may be utilized as oxygen supply, soil formation and food material for bio-chemical circulation in closed bio-ecosystems, including space habitation such as Mars. HK-01 was adopted as a biological material for the "TANPOPO" mission (JAXA et al.,), because of their high environmental tolerances. The "TANPOPO" mission is performing the space exposure experiments on the Japan Experimental Module (JEM) of the International Space Station (ISS). The results of these experiments will show the ability of HK-01 to survive in space.
Precise measurement of the neutron magnetic form factor from quasielastic 3 rvec He(rvec e,e')
International Nuclear Information System (INIS)
Gao, H.
1997-01-01
Polarized 3 He targets have proven to be a useful tool for studying the electric and magnetic form factors of the neutron, and the spin structure of the neutron. The neutron magnetic form factor at low Q 2 was determined previously at MIT-Bates from the quasielastic 3 rvec He(rvec e, e ' ) process. New experiment was planned at TJNAF to systematically measure the inclusive 3 He quasielastic transverse asymmetry, A T ' , at Q 2 = 0.1 - 0.5 (GeV/c) 2 with high statistical and systematic accuracy. A 2% statistical uncertainty is aimed at all the pro- posed values of Q 2 , and 3% systematic uncertainty for A T ' can be achieved for this experiment. The precise data will constrain theoretical calculations of 3 He quasielastic asymmetry. Furthermore, the neutron magnetic form factor at Q 2 = 0.1 - 0.5 (GeV/c) 2 will be extracted from the measured asymmetries with an overall uncertainty of 2%. Precise measurements of G n M at low Q 2 will resolve the discrepancy among the existing data in the same Q 2 region
E-st@r-I experience: Valuable knowledge for improving the e-st@r-II design
Corpino, S.; Obiols-Rabasa, G.; Mozzillo, R.; Nichele, F.
2016-04-01
Many universities all over the world have now established hands-on education programs based on CubeSats. These small and cheap platforms are becoming more and more attractive also for other-than-educational missions, such as technology demonstration, science applications, and Earth observation. This new paradigm requires the development of adequate technology to increase CubeSat performance and mission reliability, because educationally-driven missions have often failed. In 2013 the ESA Education Office launched the Fly Your Satellite! Programme which aims at increasing CubeSat mission reliability through several actions: to improve design implementation, to define best practices for conducting the verification process, and to make the CubeSat community aware of the importance of verification. Within this framework, the CubeSat team at Politecnico di Torino developed the e-st@r-II CubeSat as follow-on of the e-st@r-I satellite, launched in 2012 on the VEGA Maiden Flight. E-st@r-I and e-st@r-II are both 1U satellites with educational and technology demonstration objectives: to give hands-on experience to university students and to test an active attitude determination and control system based on inertial and magnetic measurements with magnetic actuation. This paper describes the know-how gained thanks to the e-st@r-I mission, and how this heritage has been translated into the improvement of the new CubeSat in several areas and lifecycle phases. The CubeSat design has been reviewed to reduce the complexity of the assembly procedure and to deal with possible failures of the on-board computer, for example re-coding the software in the communications subsystem. New procedures have been designed and assessed for the verification campaign accordingly to ECSS rules and with the support of ESA specialists. Different operative modes have been implemented to handle some anomalies observed during the operations of the first satellite. A new version of the on-board software is
Directory of Open Access Journals (Sweden)
Daisy Maria Rizatto Tronchin
2015-12-01
Full Text Available RESUMO Objetivo Descrever a experiência no planejamento e desenvolvimento de um Curso de Atualização On-Line em Gerenciamento em Enfermagem destinado a enfermeiros nos contextos Brasil e Portugal. Método O desenho instrucional do Curso fundamentou-se na Teoria da Aprendizagem Significativa, na Andragogia e na Metodologia Dialética, valorizando a interação entre os atores e privilegiando os cenários de prática e a aplicação dos conceitos abordados. Resultados O Curso está estruturado em nove unidades teóricas, quatro estudos de caso e prova dissertativa. Foi avaliado positivamente pelos participantes, os quais referiram oportunidades de aquisição de novos conhecimentos; interação e intercâmbio de experiência; motivação em estudar os temas e autoaprendizagem. Conclusão Espera-se que a experiência descrita estimule a proposição de novos cursos e programas na modalidade de Educação a Distância, incrementando os processos de ensino e de aprendizagem para subsidiar análises futuras do seu impacto no desenvolvimento e no aprimoramento de competências gerenciais em enfermagem.
Test of the Behavioral Perspective Model in the Context of an E-Mail Marketing Experiment
Sigurdsson, Valdimar; Menon, R. G. Vishnu; Sigurdarson, Johannes Pall; Kristjansson, Jon Skafti; Foxall, Gordon R.
2013-01-01
An e-mail marketing experiment based on the behavioral perspective model was conducted to investigate consumer choice. Conversion e-mails were sent to two groups from the same marketing database of registered consumers interested in children's books. The experiment was based on A-B-A-C-A and A-C-A-B-A withdrawal designs and consisted of sending B…
Reactivity effect of a heavy water tank as reflector in the IPEN/MB-01 reactor
International Nuclear Information System (INIS)
Santos, Adimir dos; Fuga, Rinaldo
2013-01-01
This experiment comprises a set of experiments performed in the IPEN/MB-01 reactor and described in the International Handbook of Evaluated Reactor Physics Benchmark Experiments, specifically the experiment aim to evaluate the reactivity due to the heavy water tank placed at reflector region of the IPEN/MB-01 reactor. An aluminum tank was designed to be filled with heavy water and positioned at the west face of the IPEN/MB-01, additionally the experiment was also designed to allow variable heavy water height inside of this tank providing different neutron leakage rate in the west face of the IPEN/MB-01, consequently providing a series of interesting combinations. The measured quantities in the experiment are reactivities and critical control bank positions for several combinations of the control banks and an excess of reactivity of the heavy water tank. The experiment will be simulated using a Monte Carlo code MCNP in order to compare the different critical control bank position. (author)
The Material Plasma Exposure eXperiment (MPEX)
Rapp, J.; Biewer, T. M.; Bigelow, T. S.; Canik, J.; Caughman, J. B. O.; Duckworth, R. C.; Goulding, R. H.; Hillis, D. L.; Lore, J. D.; Lumsdaine, A.; McGinnis, W. D.; Meitner, S. J.; Owen, L. W.; Shaw, G. C.; Luo, G.-N.
2014-10-01
Next generation plasma generators have to be able to access the plasma conditions expected on the divertor targets in ITER and future devices. The Material Plasma Exposure eXperiment (MPEX) will address this regime with electron temperatures of 1--10 eV and electron densities of 1021--1020 m-3. The resulting heat fluxes are about 10 MW/m2. MPEX is designed to deliver those plasma conditions with a novel Radio Frequency plasma source able to produce high density plasmas and heat electron and ions separately with Electron Bernstein Wave (EBW) heating and Ion Cyclotron Resonance Heating (ICRH). Preliminary modeling has been used for pre-design studies of MPEX. MPEX will be capable to expose neutron irradiated samples. In this concept targets will be irradiated in ORNL's High Flux Isotope Reactor (HFIR) or possibly at the Spallation Neutron Source (SNS) and then subsequently (after a sufficient long cool-down period) exposed to fusion reactor relevant plasmas in MPEX. The current state of the pre-design of MPEX including the concept of handling irradiated samples will be presented. ORNL is managed by UT-Battelle, LLC, for the U.S. DOE under Contract DE-AC-05-00OR22725.
DESI and other Dark Energy experiments in the era of neutrino mass measurements
Energy Technology Data Exchange (ETDEWEB)
Font-Ribera, Andreu [Institute of Theoretical Physics, University of Zurich, Winterthurerstrasse 190, Zurich, 8057 (Switzerland); McDonald, Patrick; Mostek, Nick; Reid, Beth A.; Seo, Hee-Jong [Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA, 94720 (United States); Slosar, Anže, E-mail: afont@lbl.gov, E-mail: PVMcDonald@lbl.gov, E-mail: njmostek@lbl.gov, E-mail: BAReid@lbl.gov, E-mail: hee-jongseo@lbl.gov, E-mail: anze@bnl.gov [Brookhaven National Laboratory, Upton, NY, 11973 (United States)
2014-05-01
We present Fisher matrix projections for future cosmological parameter measurements, including neutrino masses, Dark Energy, curvature, modified gravity, the inflationary perturbation spectrum, non-Gaussianity, and dark radiation. We focus on DESI and generally redshift surveys (BOSS, HETDEX, eBOSS, Euclid, and WFIRST), but also include CMB (Planck) and weak gravitational lensing (DES and LSST) constraints. The goal is to present a consistent set of projections, for concrete experiments, which are otherwise scattered throughout many papers and proposals. We include neutrino mass as a free parameter in most projections, as it will inevitably be relevant — DESI and other experiments can measure the sum of neutrino masses to ∼ 0.02 eV or better, while the minimum possible sum is ∼ 0.06 eV. We note that constraints on Dark Energy are significantly degraded by the presence of neutrino mass uncertainty, especially when using galaxy clustering only as a probe of the BAO distance scale (because this introduces additional uncertainty in the background evolution after the CMB epoch). Using broadband galaxy power becomes relatively more powerful, and bigger gains are achieved by combining lensing survey constraints with redshift survey constraints. We do not try to be especially innovative, e.g., with complex treatments of potential systematic errors — these projections are intended as a straightforward baseline for comparison to more detailed analyses.
eXframe: reusable framework for storage, analysis and visualization of genomics experiments
Directory of Open Access Journals (Sweden)
Sinha Amit U
2011-11-01
Full Text Available Abstract Background Genome-wide experiments are routinely conducted to measure gene expression, DNA-protein interactions and epigenetic status. Structured metadata for these experiments is imperative for a complete understanding of experimental conditions, to enable consistent data processing and to allow retrieval, comparison, and integration of experimental results. Even though several repositories have been developed for genomics data, only a few provide annotation of samples and assays using controlled vocabularies. Moreover, many of them are tailored for a single type of technology or measurement and do not support the integration of multiple data types. Results We have developed eXframe - a reusable web-based framework for genomics experiments that provides 1 the ability to publish structured data compliant with accepted standards 2 support for multiple data types including microarrays and next generation sequencing 3 query, analysis and visualization integration tools (enabled by consistent processing of the raw data and annotation of samples and is available as open-source software. We present two case studies where this software is currently being used to build repositories of genomics experiments - one contains data from hematopoietic stem cells and another from Parkinson's disease patients. Conclusion The web-based framework eXframe offers structured annotation of experiments as well as uniform processing and storage of molecular data from microarray and next generation sequencing platforms. The framework allows users to query and integrate information across species, technologies, measurement types and experimental conditions. Our framework is reusable and freely modifiable - other groups or institutions can deploy their own custom web-based repositories based on this software. It is interoperable with the most important data formats in this domain. We hope that other groups will not only use eXframe, but also contribute their own
Quality Assurance on Undoped CsI Crystals for the Mu2e Experiment
Atanov, N.; Baranov, V.; Budagov, J.; Davydov, Yu. I.; Glagolev, V.; Tereshchenko, V.; Usubov, Z.; Cervelli, F.; Di Falco, S.; Donati, S.; Morescalchi, L.; Pedreschi, E.; Pezzullo, G.; Raffaelli, F.; Spinella, F.; Colao, F.; Cordelli, M.; Corradi, G.; Diociaiuti, E.; Donghia, R.; Giovannella, S.; Happacher, F.; Martini, M.; Miscetti, S.; Ricci, M.; Saputi, A.; Sarra, I.; Echenard, B.; Hitlin, D. G.; Hu, C.; Miyashita, T.; Porter, F.; Zhang, L.; Zhu, R.-Y.; Grancagnolo, F.; Tassielli, G.; Murat, P.
2018-02-01
The Mu2e experiment is constructing a calorimeter consisting of 1,348 undoped CsI crystals in two disks. Each crystal has a dimension of 34 x 34 x 200 mm, and is readout by a large area silicon PMT array. A series of technical specifications was defined according to physics requirements. Preproduction CsI crystals were procured from three firms: Amcrys, Saint-Gobain and Shanghai Institute of Ceramics. We report the quality assurance on crystal's scintillation properties and their radiation hardness against ionization dose and neutrons. With a fast decay time of 30 ns and a light output of more than 100 p.e./MeV measured with a bi-alkali PMT, undoped CsI crystals provide a cost-effective solution for the Mu2e experiment.
PDB: CBRC-CJAC-01-0391 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0391 1FFX,1IA0,1JFF,1SA0,1SA1,1TUB,1TVK,2WBE,1Z2B,3DCO,3DU7,3E22, Region:421-804(Identity...=82%) PDB:1FFX Chain:B (X-ray Resolution=3.95),Region:421-804(Identity=82%) PDB:1IA0 Chai...n:B (EM Resolution=15.00),Region:421-804(Identity=82%) PDB:1JFF Chain:B (EM Resolution=3.50),Region:421-804(Identity...=82%) PDB:1SA0 Chain:B (X-ray Resolution=3.58),Region:421-804(Identity=82...%) PDB:1SA1 Chain:B (X-ray Resolution=4.20),Region:421-788(Identity=82%) PDB:1TUB Chain:B (EM Resolution=3.70),Region:421-788(Identit
WE-E-9A-01: Ultrasound Elasticity
Energy Technology Data Exchange (ETDEWEB)
Emelianov, S [University of Texas at Austin, Austin, TX (United States); Hall, T [University of WI-Madison, Madison, WI (United States); Bouchard, R [UT MD Anderson Cancer Center and UTHSC at Houston Graduate School of Biomed, Houston, TX (United States)
2014-06-15
Principles and techniques of ultrasound-based elasticity imaging will be presented, including quasistatic strain imaging, shear wave elasticity imaging, and their implementations in available systems. Deeper exploration of quasistatic methods, including elastic relaxation, and their applications, advantages, artifacts and limitations will be discussed. Transient elastography based on progressive and standing shear waves will be explained in more depth, along with applications, advantages, artifacts and limitations, as will measurement of complex elastic moduli. Comparisons will be made between ultrasound radiation force techniques, MR elastography, and the simple A mode plus mechanical plunger technique. Progress in efforts, such as that by the Quantitative Imaging Biomarkers Alliance, to reduce the differences in the elastic modulus reported by different commercial systems will be explained. Dr. Hall is on an Advisory Board for Siemens Ultrasound and has a research collaboration with them, including joint funding by R01CA140271 for nonlinear elasticity imaging. Learning Objectives: Be reminded of the long history of palpation of tissue elasticity for critical medical diagnosis and the relatively recent advances to be able to image tissue strain in response to an applied force. Understand the differences between shear wave speed elasticity measurement and imaging and understand the factors affecting measurement and image frame repletion rates. Understand shear wave propagation effects that can affect measurements, such as essentially lack of propagation in fluids and boundary effects, so important in thin layers. Know characteristics of available elasticity imaging phantoms, their uses and limitations. Understand thermal and cavitational limitations affecting radiation force-based shear wave imaging. Have learning and references adequate to for you to use in teaching elasticity imaging to residents and technologists. Be able to explain how elasticity measurement
WE-E-9A-01: Ultrasound Elasticity
International Nuclear Information System (INIS)
Emelianov, S; Hall, T; Bouchard, R
2014-01-01
Principles and techniques of ultrasound-based elasticity imaging will be presented, including quasistatic strain imaging, shear wave elasticity imaging, and their implementations in available systems. Deeper exploration of quasistatic methods, including elastic relaxation, and their applications, advantages, artifacts and limitations will be discussed. Transient elastography based on progressive and standing shear waves will be explained in more depth, along with applications, advantages, artifacts and limitations, as will measurement of complex elastic moduli. Comparisons will be made between ultrasound radiation force techniques, MR elastography, and the simple A mode plus mechanical plunger technique. Progress in efforts, such as that by the Quantitative Imaging Biomarkers Alliance, to reduce the differences in the elastic modulus reported by different commercial systems will be explained. Dr. Hall is on an Advisory Board for Siemens Ultrasound and has a research collaboration with them, including joint funding by R01CA140271 for nonlinear elasticity imaging. Learning Objectives: Be reminded of the long history of palpation of tissue elasticity for critical medical diagnosis and the relatively recent advances to be able to image tissue strain in response to an applied force. Understand the differences between shear wave speed elasticity measurement and imaging and understand the factors affecting measurement and image frame repletion rates. Understand shear wave propagation effects that can affect measurements, such as essentially lack of propagation in fluids and boundary effects, so important in thin layers. Know characteristics of available elasticity imaging phantoms, their uses and limitations. Understand thermal and cavitational limitations affecting radiation force-based shear wave imaging. Have learning and references adequate to for you to use in teaching elasticity imaging to residents and technologists. Be able to explain how elasticity measurement
Kruithof, Willeke J; Visser-Meily, Johanna M A; Post, Marcel W M
2012-11-01
Studies into caregivers usually have been focused on negative caregiving experiences. This study is based on the hypotheses that positive caregiving experiences (i.e., self-esteem derived from caregiving) of spouses of stroke patients also need to be taken into account, and that these are related to life satisfaction in 2 ways: first, by a direct association with life satisfaction, and second, indirectly by way of a buffer effect (i.e., by compensating for the impact of negative caregiving experiences on life satisfaction). In this cross-sectional study (n = 121) 3 years poststroke, the Caregiver Reaction Assessment was used to assess caregiver burden (Burden) and self-esteem derived from caregiving (Self-esteem scale). Life satisfaction was measured with the Life Satisfaction Questionnaire (LiSat-9). Spearman correlations and regression analyses were performed. Both Self-esteem and Burden scores were associated with life satisfaction (correlation coefficients 0.35 and -0.74, respectively). An interaction effect was also found (P = .006); spouses who perceived both high Burden and high Self-esteem reported significantly higher life satisfaction scores (mean 4.2, standard deviation [SD] 0.5) than spouses who perceived high Burden but low Self-esteem (mean 3.6, SD 0.7). Positive caregiving experiences are related to spouses' life satisfaction 3 years poststroke and mediate the impact of burden on life satisfaction. Positive caregiving experiences should get more attention in rehabilitation research and practice. Copyright © 2012 National Stroke Association. Published by Elsevier Inc. All rights reserved.
Farokhnia, Mehdi; Sheskier, Mikela B; Lee, Mary R; Le, April N; Singley, Erick; Bouhlal, Sofia; Ton, Timmy; Zhao, Zhen; Leggio, Lorenzo
2018-04-14
Gamma-aminobutyric acid (GABA), the main inhibitory neurotransmitter in the nervous system, plays an important role in biobehavioral processes that regulate alcohol seeking, food intake, and stress response. The metabotropic GABA-B receptor has been investigated as a potential therapeutic target for alcohol use disorder, by using orthosteric agonists (e.g., baclofen) and positive allosteric modulators. Whether and how pharmacological manipulation of the GABA-B receptor, in combination with alcohol intake, may affect feeding- and stress-related neuroendocrine pathways remains unknown. In the present randomized, double-blind, placebo-controlled study, thirty-four alcohol-dependent individuals received baclofen (30 mg/day) or placebo in a naturalistic outpatient setting for one week, and then performed a controlled laboratory experiment which included alcohol cue-reactivity, fixed-dose priming, and self-administration procedures. Blood samples were collected, and the following neuroendocrine markers were measured: ghrelin, leptin, amylin, glucagon-like peptide-1 (GLP-1), insulin, prolactin, thyroid-stimulating hormone, growth hormone, cortisol, and adrenocorticotropic hormone (ACTH). During the outpatient phase, baclofen significantly increased blood concentrations of acyl-ghrelin (p = 0.01), leptin (p = 0.01), amylin (p = 0.004), and GLP-1 (p = 0.02). Significant drug × time-point interaction effects for amylin (p = 0.001) and insulin (p = 0.03), and trend-level interaction effects for GLP-1 (p = 0.06) and ACTH (p = 0.10) were found during the laboratory experiment. Baclofen, compared to placebo, had no effect on alcohol drinking in this study (p's ≥ 0.05). Together with previous studies, these findings shed light on the role of the GABAergic system and GABA-B receptors in the shared neurobiology of alcohol-, feeding-, and stress-related behaviors. Copyright © 2018. Published by Elsevier Ltd.
Analysis of the laser photoelectron spectrum of CH-2
International Nuclear Information System (INIS)
Bunker, P.R.; Sears, T.J.
1985-01-01
We have simulated the photoelectron spectrum of CH - 2 using the model described previously [Sears and Bunker, J. Chem. Phys. 79, 5265 (1983)]. The optimization of the fit of the simulated spectrum to the recently observed spectrum of Lineberger and co-workers [J. Chem. Phys. 81, 1048 (1984) and preceding paper] has enabled us to determine the rotation-bending energy levels of triplet CH 2 over an energy range of more than 1 eV. It has also enabled us to determine that the rotational temperature of the CH - 2 in the experiment is 220 K and that, for v 2 = 1, the vibrational temperature is 680 K. For CH - 2 we determine that a/sub e/ = 103 0 and that ν 2 = 1230 cm -1 . The singlet--triplet splitting in methylene is determined to be 3150 +- 30 cm -1 (0.3905 +- 0.004 eV, 9.01 +- 0.09 kcal/mol) from the photoelectron spectrum, in excellent agreement with the more accurate value previously obtained from LMR spectroscopy [McKellar et al., J. Chem. Phys. 79, 5251 (1983)] of 3165 +- 20 cm -1 (0.3924 +- 0.0025 eV, 9.05 +- 0.06 kcal/mol), and the electron affinity of triplet CH 2 is determined to be 0.652 +- 0.006 eV
2012-07-24
..., Oklahoma, Arkansas, Louisiana, Texas and Florida). The SERC Region is currently geographically divided into... Requirement itself and directed NERC to make that requirement explicit in future versions of the Reliability..., 888 First Street NE., [[Page 43195
NCBI nr-aa BLAST: CBRC-CREM-01-1346 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CREM-01-1346 ref|NP_939160.1| Na(+)/H(+) antiporter homolog [Corynebacterium diphtheria...e NCTC 13129] emb|CAE49312.1| Na(+)/H(+) antiporter homolog [Corynebacterium diphtheriae] NP_939160.1 2e-34 34% ...
A Two-Pass Exact Algorithm for Selection on Parallel Disk Systems.
Mi, Tian; Rajasekaran, Sanguthevar
2013-07-01
Numerous OLAP queries process selection operations of "top N", median, "top 5%", in data warehousing applications. Selection is a well-studied problem that has numerous applications in the management of data and databases since, typically, any complex data query can be reduced to a series of basic operations such as sorting and selection. The parallel selection has also become an important fundamental operation, especially after parallel databases were introduced. In this paper, we present a deterministic algorithm Recursive Sampling Selection (RSS) to solve the exact out-of-core selection problem, which we show needs no more than (2 + ε ) passes ( ε being a very small fraction). We have compared our RSS algorithm with two other algorithms in the literature, namely, the Deterministic Sampling Selection and QuickSelect on the Parallel Disks Systems. Our analysis shows that DSS is a (2 + ε )-pass algorithm when the total number of input elements N is a polynomial in the memory size M (i.e., N = M c for some constant c ). While, our proposed algorithm RSS runs in (2 + ε ) passes without any assumptions. Experimental results indicate that both RSS and DSS outperform QuickSelect on the Parallel Disks Systems. Especially, the proposed algorithm RSS is more scalable and robust to handle big data when the input size is far greater than the core memory size, including the case of N ≫ M c .
Cuidadores Principais Ante a Experiência da Morte: Seus Sentidos e Significados
Directory of Open Access Journals (Sweden)
Carolina Peres de Lima
Full Text Available Resumo O presente trabalho teve como objetivo compreender os sentidos e significados atribuídos pelos cuidadores principais à experiência de acompanhamento de pacientes com câncer em Cuidados ao Fim de Vida. Com este intuito, foi realizada uma pesquisa qualitativa exploratória, utilizando a observação participante como recurso metodológico. A análise de conteúdo foi utilizada como método de avaliação dos resultados, no qual a Teoria Existencialista de Viktor Frankl e a literatura contemporânea sobre Cuidados Paliativos serviram de substrato teórico à compreensão da temática em questão. Após a análise do diário de campo, foram extraídas cinco categorias temáticas: A espiritualidade atribuindo sentido à experiência; O tempo de espera; Morte como alívio do sofrimento; Revisão da história de vida; Incerteza quanto ao futuro. Foi possível perceber reações e sentimentos expostos pelos cuidadores, que, apesar do esgotamento físico e emocional, desejavam permanecer ao lado de seu familiar até sua morte. Entendemos que a comunicação da equipe ao cuidador sobre a aproximação da morte pode contribuir para o processo de elaboração psíquica desta vivência. A compreensão da experiência subjetiva do cuidador viabiliza uma abordagem efetiva da equipe às reais necessidades de cuidado do familiar.
Influence of food quality and salinity on dietary cadmium availability in Mytilus trossulus
International Nuclear Information System (INIS)
Widmeyer, Joline R.; Bendell-Young, Leah I.
2007-01-01
Surficial sediments (a combination of re-suspended and suspended sediments denoted as RSS) were collected from two distinct marine intertidal habitats. The two habitats differed with respect to salinity (25 ppt versus 15 ppt) and RSS % organic carbon content (24% versus 15%). Feeding experiments were conducted simulating the conditions in the two habitats to determine if salinity and RSS % organic carbon content affected cadmium accumulation in the pacific blue mussel Mytilus trossulus. Eleven different treatments including pure phytoplankton, collected RSS and control clay were radiolabeled with 109 Cd and pulse-fed to M. trossulus under both high (25 ppt) and low salinities (15 ppt). Metal uptake and accumulation was determined using the DYMBAM biodynamic metal bioaccumulation model. Although M. trossulus ingestion rates (IR) were significantly higher at 25 ppt as compared to 15 ppt, assimilation efficiencies (AEs) and [ 109 Cd] tissue levels were significantly lower at high as compared to low salinity exposures. Of the abiotic and biotic parameters examined and in contrast to other studies, differences in salinity rather than ingestion rate or food quality (as defined by % organic carbon content) seemed to best define the observed differences in 109 Cd AE by M. trossulus
Influence of food quality and salinity on dietary cadmium availability in Mytilus trossulus
Energy Technology Data Exchange (ETDEWEB)
Widmeyer, Joline R. [Simon Fraser University, Department of Biological Sciences, Burnaby, British Columbia, V5A 1S6 (Canada)]. E-mail: joline_widmeyer@alumni.sfu.ca; Bendell-Young, Leah I. [Simon Fraser University, Department of Biological Sciences, Burnaby, British Columbia, V5A 1S6 (Canada)
2007-02-28
Surficial sediments (a combination of re-suspended and suspended sediments denoted as RSS) were collected from two distinct marine intertidal habitats. The two habitats differed with respect to salinity (25 ppt versus 15 ppt) and RSS % organic carbon content (24% versus 15%). Feeding experiments were conducted simulating the conditions in the two habitats to determine if salinity and RSS % organic carbon content affected cadmium accumulation in the pacific blue mussel Mytilus trossulus. Eleven different treatments including pure phytoplankton, collected RSS and control clay were radiolabeled with {sup 109}Cd and pulse-fed to M. trossulus under both high (25 ppt) and low salinities (15 ppt). Metal uptake and accumulation was determined using the DYMBAM biodynamic metal bioaccumulation model. Although M. trossulus ingestion rates (IR) were significantly higher at 25 ppt as compared to 15 ppt, assimilation efficiencies (AEs) and [{sup 109}Cd] tissue levels were significantly lower at high as compared to low salinity exposures. Of the abiotic and biotic parameters examined and in contrast to other studies, differences in salinity rather than ingestion rate or food quality (as defined by % organic carbon content) seemed to best define the observed differences in {sup 109}Cd AE by M. trossulus.
Review of modern double beta decay experiments
Barabash, A. S.
2015-10-01
The review of modern experiments on search and studying of double beta decay processes is done. Results of the most sensitive current experiments are discussed. The main attention is paid to EXO-200, KamLAND-Zen, GERDA-I and CUORE-0 experiments. Modern values of T1/2(2ν) and best present limits on neutrinoless double beta decay and double beta decay with Majoron emission are presented. Conservative limits on effective mass of a Majorana neutrino ( at the level of ˜ 0.01-0.1 eV are discussed.
Study of the angular distribution of the reaction bar pp→χc2→J/ψγ→e+e-γ
International Nuclear Information System (INIS)
Armstrong, T.A.; Bettoni, D.; Bharadwaj, V.; Biino, C.; Borreani, G.; Broemmelsiek, D.; Buzzo, A.; Calabrese, R.; Ceccucci, A.; Cester, R.; Church, M.D.; Dalpiaz, P.; Dalpiaz, P.F.; Dibenedetto, R.; Dimitroyannis, D.; Fabbri, M.G.; Fast, J.E.; Gianoli, A.; Ginsburg, C.M.; Gollwitzer, K.E.; Hahn, A.A.; Hasan, M.A.; Hsueh, S.Y.; Lewis, R.A.; Luppi, E.; Macri, M.; Majewska, A.M.; Mandelkern, M.A.; Marchetto, F.; Marinelli, M.; Marques, J.L.; Marsh, W.; Martini, M.; Masuzawa, M.; Menichetti, E.; Migliori, A.; Mussa, R.; Palestini, S.; Pallavicini, M.; Pastrone, N.; Patrignani, C.; Peoples, J. Jr.; Pesando, L.; Petrucci, F.; Pia, M.G.; Pordes, S.; Rapidis, P.A.; Ray, R.E.; Reid, J.D.; Rinaudo, G.; Roccuzzo, B.; Rosen, J.L.; Santroni, A.; Sarmiento, M.; Savrie, M.; Scalisi, A.; Schultz, J.; Seth, K.K.; Smith, A.; Smith, G.A.; Sozzi, M.; Trokenheim, S.; Weber, M.F.; Werkema, S.J.; Zhang, Y.; Zhao, J.L.; Zioulas, G.
1993-01-01
We report on a study of the angular distribution in the reaction bar pp→χ c2 →J/ψγ→e + e-γ. Using a sample of 1904 events, we find that the contribution of helicity zero in the formation process is B 0 2 2 =-0.14±0.06. The normalized radiative decay octupole amplitude a 3 is found to be consistent with zero
NCBI nr-aa BLAST: CBRC-PMAR-01-0384 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PMAR-01-0384 ref|YP_439624.1| hypothetical protein BTH_II1428 [Burkholderia thailand...ensis E264] gb|ABC34039.1| conserved hypothetical protein [Burkholderia thailandensis E264] YP_439624.1 2.3 36% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...
NCBI nr-aa BLAST: CBRC-CREM-01-1103 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CREM-01-1103 ref|YP_439586.1| CAAX protease family protein [Burkholderia thailand...ensis E264] gb|ABC35570.1| CAAX protease family protein [Burkholderia thailandensis E264] YP_439586.1 3.2 36% ...
Psicologia e Práticas Restaurativas na Socioeducação: Relato de Experiência
Directory of Open Access Journals (Sweden)
Iara da Silva Ferrão
Full Text Available Resumo Este artigo tem como objetivo apresentar um relato de experiência de profissional da área da Psicologia, dentro de uma Unidade de Internação de adolescentes em conflito com a lei. Ainda pretendeu-se relacionar práticas restaurativas com possibilidade de experiência exitosa ao sistema socioeducativo. O relato tem como cenário uma unidade de Atendimento Socioeducativo de uma cidade no interior do estado do Rio Grande do Sul. Os dados obtidos são frutos da experiência profissional da autora e fazem parte de um estudo maior intitulado “Um Estudo dos Fatores de Risco e de Proteção em Jovens que Cumprem Medida Socioeducativa”. Os resultados mostraram que as práticas restaurativas realizadas nesta instituição foram apenas os círculos de compromisso. O tema da Justiça Restaurativa (JR, por ser novo e por não ter sido originalmente um modelo criado no cenário brasileiro, ainda é difícil de avaliar possíveis resultados e impactos. As experiências apresentadas sugerem que há possibilidade da JR ser uma experiência exitosa para o Sistema Socioeducativo. Indica-se a necessidade de realização de mais pesquisas com relação a essa temática.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BF01 (Link to dictyBase) - - - Contig-U15105-1 FC-BF01Z (Li...nk to Original site) - - FC-BF01Z 674 - - - - Show FC-BF01 Library FC (Link to library) Clone ID FC-BF01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict...402813_1( AF402813 |pid:none) Ictalurus punctatus 40S ribosomal ... 260 3e-68 AJ783868_1( AJ783868 |pid:none...lasmic 8.0 %: mitochondrial 4.0 %: nuclear >> prediction for FC-BF01 is cyt 5' end seq. ID - 5' end seq. - L
... Incompatibility Stillbirth Teenage Pregnancy Tubal Ligation Tumors and Pregnancy Twins, Triplets, Multiple Births Vasectomy Substance Abuse Problems Alcohol Alcohol Use Disorder (AUD) Treatment Alcoholism and Alcohol Abuse Anabolic Steroids Club Drugs Cocaine ...
Automatic Threshold Design for a Bound Document Scanner.
1982-12-01
CCC6G i CcCS aCCa 3C67 311E? Ell CZA JE ~z:: 006! 1069------------------------- LT CAN1~. C3I 007C OC07 35 0071 OUTS 5 0072 a 000! 2040 0073 BEGIN L...00 76 01 7C 00 76 nOCS -01 F3 00 48 01 Fh 00 3E 906FO - 01 70 00 81 01 7 00 77 MOO1 -01 F5 0 40 Ol F 00 3F O6 - 01 7F 00 70 01 80 00 78 MOOS0 01 F7 00
NCBI nr-aa BLAST: CBRC-PVAM-01-1566 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PVAM-01-1566 ref|XP_002416287.1| glycine rich secreted cement protein, putativ...e [Ixodes scapularis] gb|EEC19954.1| glycine rich secreted cement protein, putative [Ixodes scapularis] XP_002416287.1 4e-13 42% ...
NCBI nr-aa BLAST: CBRC-GGOR-01-1493 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGOR-01-1493 ref|XP_002416287.1| glycine rich secreted cement protein, putativ...e [Ixodes scapularis] gb|EEC19954.1| glycine rich secreted cement protein, putative [Ixodes scapularis] XP_002416287.1 7e-28 46% ...
Offline Software for the Mu2e Experiment
Energy Technology Data Exchange (ETDEWEB)
Kutschke, Robert K. [Fermilab
2012-01-01
The Mu2e experiment at Fermilab is in the midst of its R&D and approval processes. To aid and inform this process, a small team has developed an end-to-end Geant4-based simulation package and has developed reconstruction code that is already at the stage of an advanced prototype. Having these tools available at an early stage allows design options and tradeoffs to be studied using high level physics quantities. A key to the success of this effort has been, as much as possible, to acquire software and customize it, rather than to build it in-house.
Track reconstruction for the Mu3e experiment based on a novel Multiple Scattering fit
Directory of Open Access Journals (Sweden)
Kozlinskiy Alexandr
2017-01-01
Full Text Available The Mu3e experiment is designed to search for the lepton flavor violating decay μ+ → e+e+e−. The aim of the experiment is to reach a branching ratio sensitivity of 10−16. In a first phase the experiment will be performed at an existing beam line at the Paul-Scherrer Institute (Switzerland providing 108 muons per second, which will allow to reach a sensitivity of 2 · 10−15. The muons with a momentum of about 28 MeV/c are stopped and decay at rest on a target. The decay products (positrons and electrons with energies below 53MeV are measured by a tracking detector consisting of two double layers of 50 μm thin silicon pixel sensors. The high granularity of the pixel detector with a pixel size of 80 μm × 80 μm allows for a precise track reconstruction in the high multiplicity environment of the Mu3e experiment, reaching 100 tracks per reconstruction frame of 50 ns in the final phase of the experiment. To deal with such high rates and combinatorics, the Mu3e track reconstruction uses a novel fit algorithm that in the simplest case takes into account only the multiple scattering, which allows for a fast online tracking on a GPU based filter farm. An implementation of the 3-dimensional multiple scattering fit based on hit triplets is described. The extension of the fit that takes into account energy losses and pixel size is used for offline track reconstruction. The algorithm and performance of the offline track reconstruction based on a full Geant4 simulation of the Mu3e detector are presented.
Radiographic skeletal survey and radionuclide bone scan in Langerhans cell histiocytosis of bone
International Nuclear Information System (INIS)
Nieuwenhuyse, J.P. van; Clapuyt, P.; Malghem, J.; Everarts, P.; Melin, J.; Pauwels, S.; Brichard, B.; Ninane, J.; Vermylen, C.; Cornu, G.
1996-01-01
Background. The lack of a consensus in the literature on the imaging strategy in Langerhans cell histiocytosis (LCH) bone lesions in childhood. Objective. To evaluate the relative value of radionuclide bone scan (RBS) and radiographic skeletal survey (RSS) in the detection of LCH bone lesions, both in the initial work-up of the disease and during the follow-up period. Materials and methods. Ten children with bone lesions evaluated by means of RSS and RBS in a retrospective study (1984-1993). Results. Fifty radiologically and/or scintigraphically abnormal foci were detected: 27 anomalies in the initial work-up (12 by both RSS and RBS, 8 by RSS only and 7 by RBS only) and 23 additional anomalies during follow-up (10 by both RSS and RBS, 10 by RSS only and 3 by RBS only). RSS+/RBS- lesions (n = 18) are more frequently encountered in the skull (P = 0.038), and more frequently lack radiologic signs of osteoblastic activity (P = 0.020), than RSS+/RBS+ lesions (n = 22). RSS-/RBS+ abnormalities (n = 10) were most frequently insignificant. Conclusion. In the initial work-up both RSS and RBS should be carried out, while in the follow-up only RSS should be performed. (orig.). With 2 figs., 4 tabs
Image Classification of Ribbed Smoked Sheet using Learning Vector Quantization
Rahmat, R. F.; Pulungan, A. F.; Faza, S.; Budiarto, R.
2017-01-01
Natural rubber is an important export commodity in Indonesia, which can be a major contributor to national economic development. One type of rubber used as rubber material exports is Ribbed Smoked Sheet (RSS). The quantity of RSS exports depends on the quality of RSS. RSS rubber quality has been assigned in SNI 06-001-1987 and the International Standards of Quality and Packing for Natural Rubber Grades (The Green Book). The determination of RSS quality is also known as the sorting process. In the rubber factones, the sorting process is still done manually by looking and detecting at the levels of air bubbles on the surface of the rubber sheet by naked eyes so that the result is subjective and not so good. Therefore, a method is required to classify RSS rubber automatically and precisely. We propose some image processing techniques for the pre-processing, zoning method for feature extraction and Learning Vector Quantization (LVQ) method for classifying RSS rubber into two grades, namely RSS1 and RSS3. We used 120 RSS images as training dataset and 60 RSS images as testing dataset. The result shows that our proposed method can give 89% of accuracy and the best perform epoch is in the fifteenth epoch.
Psicologia Organizacional e do Trabalho: Relato de Experiência em Estágio Supervisionado
Directory of Open Access Journals (Sweden)
Priscilla de Oliveira Martins-Silva
Full Text Available Resumo Trata-se de relato de experiência em estágio supervisionado em Psicologia Organizacional e do Trabalho (POT envolvendo um grupo de alunos de uma Instituição de Educação Superior (IES localizada no Estado do Espírito Santo. O objetivo central foi discutir os aspectos teóricos e práticos que influenciaram na formação profissional do discente em Psicologia, tendo como foco o estágio supervisionado. Além de relatar a experiência, foi realizado um levantamento junto aos ex-alunos sobre as contribuições do estágio na sua formação educacional e profissional. Da experiência relatada foi possível verificar que: a instituição das Diretrizes Curriculares Nacionais (DCN constituiu-se em um marco na flexibilização curricular dos cursos; o estágio é um componente curricular de integração entre ensino, pesquisa e prática; e o estágio em POT requer dos discentes conhecimentos multidisciplinares. Além desses aspectos, observou-se que a prática do estágio supervisionado indica o rompimento com a imagem negativa do psicólogo que atua em POT, limitada à aplicação de testes e psicotécnicas. De fato, a atividade do psicólogo em POT mostrou-se muito mais ampla e complexa, sobretudo em termos dos impactos de sua intervenção no ambiente organizacional.
Métricas da qualidade da experiência do consumidor de bares e restaurantes: uma revisão comparada
Directory of Open Access Journals (Sweden)
Gisah Moreira Akel
2012-11-01
Full Text Available A busca pela compreensão do comportamento do consumidor tem sido amplamente discutida por acadêmicos e gestores. Considerando suas especificidades, o crescente setor de alimentos e bebidas, instiga investigadores em busca de caminhos que permitam ao empreendimento proporcionar serviços e experiências memoráveis, exigências da evolução da ótica de consumo moderna. Este panorama motiva a realização deste estudo que tem por objetivo analisar métricas da qualidade da experiência do consumidor de bares e restaurantes, por meio de uma revisão bibliográfica contemplando: o comportamento do consumidor de alimentos e bebidas, expectativa, qualidade, satisfação e os componentes da qualidade da experiência do consumidor deste nicho. Esta revisão culminou na comparação de três modelos principais de medição da qualidade da experiência, sendo eles: o SERVQUAL (PARASSURAMAN et al., 1988, o DINESERV (STEVENS et al., 1995 e Qualidade da Experiência (GIMENES et al., 2012. Constatou-se que os modelos oferecem visões distintas e de certo modo, complementares. No entanto, conclui-se que o suporte de Gimenes et al. (2012 compreende uma métrica mais extensa e focada neste segmento específico. Normal 0 21 false false false PT-BR X-NONE X-NONE
Carbon Monoxide Information Center
Full Text Available ... Regulations, Laws & Standards Research & Statistics Business & Manufacturing Small Business Resources OnSafety Blogs International Newsroom About CPSC Contact Us Sitemap RSS E- ...
Directory of Open Access Journals (Sweden)
Angélica Araújo Maia
2016-05-01
Full Text Available Nos dias atuais, as teorias fundamentadas nos Novos Letramentos representam uma importante referência para o ensino de Língua Inglesa no Brasil, propondo uma educação linguística que, ao mesmo tempo, possa fortalecer a consciência crítica e favorecer a agência cidadã. Nessa perspectiva, o presente artigo relata a experiência de um projeto de extensão voltado para o ensino de inglês para adolescentes e jovens, com foco na profissionalização e no letramento crítico, com o objetivo de evidenciar de que forma a proposta curricular e metodológica do projeto,além de promover o desenvolvimento do conhecimento da língua inglesa, constituiu-se um espaço de engajamento dialógico e de expansão de perspectiva dosparticipantes. O estudo foi desenvolvido com base na análise de fragmentos das aulas, registrados em vídeo, dos planos de aula e material didático utilizado, além das postagens dos jovens participantes acerca dos temas abordados em uma página do projeto em uma rede social. As categorias que guiaram a interpretação dos dados se referem a etapas constituintes das aulas e consistem em: preparação, exploração, problematização e expansão (EDMUNDO, 2012; e ainda: experiências com o conhecido, experiências com o novo, conceituações, conexões locais e globais, expansão de perspectiva, transformação (MONTE-MOR, 2010; DUBOC, 2015. No final, argumenta-se a favor da transposição dessa abordagem, desenvolvida em um espaço não escolar em João Pessoa - Paraíba (organização não-governamental, para o espaço da escola, de forma a ampliar,na educação básica, as possibilidades de uma aprendizagem da língua inglesa mais significativa e capaz de empoderaradolescentes e jovens no uso da linguagem.
NCBI nr-aa BLAST: CBRC-OANA-01-2147 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OANA-01-2147 ref|YP_439999.1| nodulation competitiveness protein nfeD [Burkhol...deria thailandensis E264] gb|ABC34343.1| nodulation competitiveness protein nfeD [Burkholderia thailandensis E264] YP_439999.1 0.001 38% ...
Carbon Monoxide Information Center
Full Text Available ... E-mail Inside CPSC Accessibility Privacy Policy Budget, Performances & Finance Open Government Freedom of Information (FOIA) Inspector ... Sitemap RSS E-mail Accessibility Privacy Policy Budget & Performance Open Government Freedom of Information (FOIA) USA.gov ...
Effects of gamma radiation on Clostridium botulinum type E under various parameters
International Nuclear Information System (INIS)
Lim, Y.H.
1986-01-01
Spores of Clostridium botulinum type E strain Eklund (Eklund) was irradiated with gamma radiation and its recovery was tested on the tryptone-peptone-glucose-yeast extract-agar (TPGYA) containing various levels of NaCl and Na-thioglycollate. The presence of 0.5% or more NaCl in the media decreased the viable counts, while Na-thioglycollate of up to 0.15% did not affect the recovery of both irradiated and non-irradiated spores. Eklund spores were also irradiated under air (21% O 2 ), N 2 O and N 2 , with or without the additive of one of the following agents (additive/concentration): disodium ethylenediaminetetraacetate (EDTA), 0.01 M; t-butanol, 0.1 M; NaCl, 0.01 M; catalyze, 10 mg/ml and DL-cysteine, 0.1 mM. Radiation process was most effective in destroying the spores when carried out under air (21% O 2 ), followed by N 2 O and N 2 . Among the additives tested, EDTA was the most efficient protector followed by t-butanol when irradiation process was carried under N 2 O and N 2 gas environment. Catalase and DL-cysteine sensitized the spores when irradiated under N 2 O and N 2 , while NaCl only sensitized under N 2 . Spores kept frozen at -75 0 C for 30 days but thawed prior to irradiation were more sensitive to radiation damage than freshly prepared spores. Radiation resistance of the spores increased when 15% glycerol was added to the phosphate bugger (0.06 M, pH 7.0) and used as suspending media. When the concentration of the spore increased from 10 6 /ml to 10 11 /ml, the radiosensitivities also increased. Seven strains of C. botulinum type E were screened for plasmids by agarose gel electrophoresis
NCBI nr-aa BLAST: CBRC-TTRU-01-0904 [SEVENS
Lifescience Database Archive (English)
Full Text Available n, putative [Campylobacter upsaliensis RM3195] gb|EAL52818.1| iron compound ABC transporter, permease protein, putative [Campylobacter upsaliensis RM3195] ZP_00371683.1 0.006 27% ...
Vitrification of F006 plating waste sludge by Reactive Additive Stabilization Process (RASP)
International Nuclear Information System (INIS)
Martin, H.L.; Jantzen, C.M.; Pickett, J.B.
1994-01-01
Solidification into glass of nickel-on-uranium plating wastewater treatment plant sludge (F006 Mixed Waste) has been demonstrated at the Savannah River She (SRS). Vitrification using high surface area additives, the Reactive Additive Stabilization Process (RASP), greatly enhanced the solubility and retention of heavy metals In glass. The bench-scale tests using RASP achieved 76 wt% waste loading In both soda-lime-silica and borosilicate glasses. The RASP has been Independently verified by a commercial waste management company, and a contract awarded to vitrify the approximately 500,000 gallons of stored waste sludge. The waste volume reduction of 89% will greatly reduce the disposal costs, and delisting of the glass waste is anticipated. This will be the world's first commercial-scale vitrification system used for environmental cleanup of Mixed Waste. Its stabilization and volume reduction abilities are expected to set standards for the future of the waste management Industry
NCBI nr-aa BLAST: CBRC-TSYR-01-1466 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-1466 ref|YP_177750.1| PE-PGRS family protein [Mycobacterium tuberculosis... H37Rv] pir||E70824 hypothetical glycine-rich protein Rv0746 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55316.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177750.1 6e-21 35% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-2803 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-2803 ref|YP_177978.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||E70806 hypothetical glycine-rich protein Rv3507 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55603.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177978.1 9e-35 37% ...
Uso da Ciprofloxacina durante a Prenhez de Ratas: efeitos sobre a Mãe e Fetos
Directory of Open Access Journals (Sweden)
Approbato Mário Silva
2000-01-01
Full Text Available Objetivos: estudar os efeitos da ciprofloxacina sobre a taxa de abortos, ganho de peso durante a gravidez, morte materna e fetal, malformações fetais grosseiras, número de recém-nascidos, peso dos filhotes e análise dos reflexos neurológicos dos filhotes. Métodos: foram utilizadas 30 ratas da linhagem Wistar, divididas em três grupos. Os grupos tratados receberam ciprofloxacina e o grupo controle soro fisiológico, uma vez ao dia, durante os primeiros 7 dias após o cruzamento. As doses para os grupos D50 e D100 foram, respectivamente, de 50 e 100 mg de ciprofloxacina por kg de peso corporal por dia. Os parâmetros avaliados foram: o ganho de peso durante a prenhez, a prevalência de abortamentos, mortes fetal e materna e malformações fetais grosseiras. Nos 217 filhotes nascidos analisamos o número, o peso e reflexos neurológicos (postural, preensão e orientação no 1º, 3º, 5º e 10º dia de vida por ninhada. Resultados: não houve diferenças estatisticamente significativas no número de ratas que ficaram prenhes, na média de ganho de peso materno ou número de filhotes. Os filhotes apresentaram diferenças significativas nos pesos das observações do 3º, 5º e 10º dia (p = 0,006, 0,01 e 0,03, respectivamente, sendo a média menor no grupo D100. Observamos alteração significativa (p = 0,002 na positividade do reflexo de orientação no primeiro dia de vida, alteração que não se manteve nas outras observações. Não se observou caso de abortamento ou malformações grosseiras nos recém-nascidos. Conclusões: a ciprofloxacina alterou o peso ao nascimento e o reflexo dos filhotes nos primeiros dias de vida. Portanto, deve-se estudar a restrição ao seu uso durante a gravidez.
Directory of Open Access Journals (Sweden)
Flavia Liberman
2018-01-01
Full Text Available A imagem da capa refere-se a uma experiência realizada em um curso no Congresso Brasileiro e Latino Americano de Terapia Ocupacional em 2013 que buscou oferecer aos participantes ferramentas relacionadas às abordagens corporais e às artes plásticas e visuais para a construção de estratégias de intervenção e cuidado com diferentes populações em terapia ocupacional. As propostas sensibilizaram para os estados de presença dos corpos, buscando uma maior agregação das partes e uma conexão mais potente com o presente e com os ambientes. A experiência promoveu um espaço de criação e interação grupal e expressou a singularidade dos processos de cada participante em meio a produção coletiva. AbstractThe cover image refers to an experiment conducted in a course at the Brazilian and Latin American Congress of Occupational Therapy in 2013 that sought to provide participants with tools related to body approaches and visual arts for the construction of intervention and care strategies with different populations in occupational therapy. The proposals sensitized the states of presence of the bodies, seeking a greater aggregation of the parts and a more powerful connection with the present and with the environments. The experience promoted a space of creation and group interaction and expressed the uniqueness of the processes of each participant in the midst of collective production.Key words: Art; Body; Education; Group; Occupational Therapy.
Study on magnetic properties of (Nd0.8Ce0.2)2-xFe12Co2B (x = 0-0.6) alloys
Tan, G. S.; Xu, H.; Yu, L. Y.; Tan, X. H.; Zhang, Q.; Gu, Y.; Hou, X. L.
2017-09-01
In the present work, (Nd0.8Ce0.2)2-xFe12Co2B (x = 0-0.6) permanent alloys are prepared by melt-spinning method. The hard magnetic properties of (Nd0.8Ce0.2)2-xFe12Co2B (x = 0-0.6) alloys annealed at optimum temperatures have been investigated systematically. Depending on the Nd, Ce concentration, the maximum energy product ((BH)max) and remanence (Br) increase gradually with x in the range of 0 ≤ x ≤ 0.4, whereas decrease gradually in the alloys with 0.4 plays a certain role in the magnetization reversal behavior and can improve the microstructure of (Nd0.8Ce0.2)1.6Fe12Co2B alloy.
NCBI nr-aa BLAST: CBRC-XTRO-01-0459 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0459 ref|YP_438260.1| transporter, AcrB/D/F family [Burkholderia thailand...ensis E264] gb|ABC35049.1| transporter, AcrB/D/F family [Burkholderia thailandensis E264] YP_438260.1 0.0 70% ...
NCBI nr-aa BLAST: CBRC-PMAR-01-0090 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PMAR-01-0090 ref|YP_001277704.1| 2-oxoglutarate dehydrogenase, E1 subunit [Rose...iflexus sp. RS-1] gb|ABQ91754.1| 2-oxoglutarate dehydrogenase, E1 subunit [Roseiflexus sp. RS-1] YP_001277704.1 0.030 36% ...
Directory of Open Access Journals (Sweden)
Elena Syrtsova
2017-06-01
Full Text Available The article is devoted to the study of various aspects of development and implementation of e-learning at higher education institutions. This system has been created according to the main approaches and criteria used by the European Foundation for quality assurance of e-learning (EFQUEL. The article presents the main results of the experiment on Vyatka State University's e-learning system development. The article reveals the feasibility of the development of e-learning in the region. The authors consider three main strategies of implementation of e-learning system at Vyatka State University. The authors substantiate the choice of the most effective and promising strategy of them based on the analysis and considering the peculiarities of the university and the region. In the article, the fundamental results of the experiment and description of the stages of the implementation of e-learning system are presented.
Review of modern double beta decay experiments
Energy Technology Data Exchange (ETDEWEB)
Barabash, A. S., E-mail: barabash@itep.ru [Institute of Theoretical and Experimental Physics (NRC ”Kurchatov Institute”), B. Cheremushkinskaya 25, Moscow (Russian Federation)
2015-10-28
The review of modern experiments on search and studying of double beta decay processes is done. Results of the most sensitive current experiments are discussed. The main attention is paid to EXO-200, KamLAND-Zen, GERDA-I and CUORE-0 experiments. Modern values of T{sub 1/2}(2ν) and best present limits on neutrinoless double beta decay and double beta decay with Majoron emission are presented. Conservative limits on effective mass of a Majorana neutrino (〈m{sub ν}〉 < 0.46 eV) and a coupling constant of Majoron to neutrino (〈g{sub ee}〉 < 1.3 · 10{sup −5}) are obtained. Prospects of search for neutrinoless double beta decay in new experiments with sensitivity to 〈m{sub ν}〉 at the level of ∼ 0.01-0.1 eV are discussed.
Directory of Open Access Journals (Sweden)
Alexander Moreira de Almeida
2003-01-01
Full Text Available As experiências anômalas (EA (vivências incomuns ou que se acredita diferentes do habitual e das explicações usualmente aceitas como realidade: alucinações, sinestesia e vivências interpretadas como telepáticas... e os estados alterados de consciência (EAC são descritos em todas as civilizações de todas as eras, constituindo-se elementos importantes na história das sociedades. Apesar disso, têm recebido pouca atenção da comunidade científica, ou são abordados de forma pouco rigorosa. As EA e os EAC podem ser estudados sem que se compartilhem as crenças envolvidas, sendo possível investigá-los enquanto experiências subjetivas e, como tais, correlacionados com quaisquer outros dados. Neste artigo, procurou-se apresentar algumas diretrizes metodológicas para um estudo rigoroso do tema, entre elas: evitar uma abordagem preconceituosa e a "patologização" do diferente, a necessidade de uma teoria e de uma revisão exaustiva da literatura existente, utilizar diversos critérios de normalidade e patologia, investigar populações clínicas e não clínicas, desenvolvimento de instrumentos adequados para avaliação, cuidados na escolha dos termos e no estabelecimento de nexos causais, distinguir entre a experiência vivenciada e suas interpretações, considerar o papel da cultura, avaliar a confiabilidade e a validade dos relatos, por fim, o desafio gerado pela necessidade de criatividade e diversidade na escolha dos métodos.Anomalous experiences (AE (uncommon experiences or one that is believed to deviate from the usually accepted explanations of reality: hallucinations, synesthesia, experiences interpreted as telepathic... and altered states of consciousness (ASC are described in all societies of all ages. Even so, the scientists have long neglected the studies on this theme. To study AE and ASC is not necessary to share the believes we discuss, they can be investigated as subjective experiences and correlated like any
Nuclear E&T for Building and Sustaining Capacity from Korean Experience
International Nuclear Information System (INIS)
Nam, Youngmi
2014-01-01
Lessons learned: • A strong national initiative needs to be maintained, involving stakeholders with a staged national nuclear E&T plan and its execution together with an HRD plan. • An integrated competence based E&T for NEPIOs, operators, regulators, TSOs and etc. is an important element to become a knowledgeable customer or responsible vendor. • International cooperation is a useful mechanism by which long-term and widely ranged experience from others, including international organizations can be absorbed or transferred effectively in a relatively shorter term, minimizing trial and error
Dicty_cDB: Contig-U16049-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 46 0.003 (Q99MI1) RecName: Full=ELKS/RAB6-interacting/CAST family member ... 46 0.003 ( P90901 ) RecName: Full=Intermed...158L3-1, ... 46 0.003 X70834_1( X70834 |pid:none) C.elegans IFA1 gene for intermed...ma OY-M D... 45 0.006 AY154743_1( AY154743 |pid:none) Heterodera glycines intermediate f... 45 0.006 BC01755...e R3-3104H6, **... 44 0.35 5 ( EK361499 ) 1095469021880 Global-Ocean-Sampling_GS-31-01-01-1... 34 0.75 2 ( A...is duranensis genomi... 48 1.0 1 ( EJ349938 ) 1092963576764 Global-Ocean-Sampling_GS-28-01-01-1... 48 1.0 1
Experience of e-learning implementation through massive open online courses
Ivleva, N. V.; Fibikh, E. V.
2016-04-01
E-learning is considered to be one of the most prospective directions in education development worldwide. To have a competitive advantage over other institutions offering a wide variety of educational services it is important to introduce information and communication technologies into the educational process to develop e-learning on the whole. The aim of the research is to reveal problems which prevent from full implementation of e-learning at the Reshetnev Siberian State Aerospace University (SibSAU) and to suggest ways on solving those problems through optimization of e-learning introduction process at the university by motivating students and teaching staff to participate in massive open online courses and formation of tailored platforms with the view to arrange similar courses at the premises of the university. The paper considers the introduction and development level of e-learning in Russia and at SibSAU particularly. It substantiates necessity to accelerate e-learning introduction process at an aerospace university as a base for training of highly-qualified specialists in the area of aviation, machine building, physics, info-communication technologies and also in other scientific areas within which university training is carried out. The paper covers SibSAU’s experience in e-learning implementation in the educational process through students and teaching staff participation in massive open online courses and mastering other up-to-date and trendy educational platforms and their usage in the educational process. Key words. E-learning, distance learning, online learning, massive open online course.
"Haunting experiences: Ghosts in contemporary folklore," by Diane E. Goldstein et al.
Directory of Open Access Journals (Sweden)
Linda Levitt
2010-03-01
Full Text Available Diane E. Goldstein, Sylvia Ann Grider, and Jeannie Banks Thomas. Haunting experiences: Ghosts in contemporary folklore. Logan: Utah State University Press, 2007, paperback, $24.95 (272p ISBN 978-0-87421-636-3.
Discharge initiation experiments in the Tokapole II tokamak
International Nuclear Information System (INIS)
Shepard, D.A.
1984-06-01
Experiments in the Tokapole II tokamak demonstrate the benefits of high density (n/sub e//n 0 greater than or equal to 0.01) preionization by reducing four quantities at startup: necessary toroidal loop voltage (V 1 ) (50%), volt-second consumption (40 to 50%), impurity radiation (25 to 50%), and runaway electron production (approx. 80 to 100%). A zero-dimensional code models the loop voltage reduction dependence on preionization density and predicts a similar result for reactor scale devices. The code shows low initial resistivity and a high resistivity time derivative contribute to loop voltage reduction. The power balance of the ECR plasma in a toroidal-field-only case was studied. Langmuir probes and impurity doping were used. The vertical electric field (E/sub v/) and current (I/sub v/), which result from curvature drift, were measured (E/sub v/ approx. 10 V/cm and I/sub v/ approx. 50 Amps) and exceeded expected values for the bulk electron temperature (approx. 10 eV). A series of experiments with external windings to simulate field errors perpendicular to the toroidal field was done. The results imply that an error field of 0.1% of the toroidal field is deleterious to ECR plasma density
Indivíduo e pessoa na experiência da saúde e da doença
Directory of Open Access Journals (Sweden)
Luiz Fernando Dias Duarte
Full Text Available Revisão de uma linha de pesquisa no campo das ciências sociais em saúde no Brasil que se centra na hipótese metodológica de uma diferença cultural fundamental entre os modelos relacionais de "pessoa" e o modelo do "indivíduo" ocidental moderno (pensado como livre, autônomo e igual. Essa diferença cultural é de particular importância na caracterização das formas diferenciais de experiência da saúde e da doença entre as classes populares das sociedades nacionais modernas e os segmentos portadores dos saberes biomédicos eruditos, dominantes e oficiais. Estes últimos têm um compromisso originário com algumas características da ideologia do individualismo, tais como o universalismo/racionalismo e o cientificismo/fisicalismo. As representações, práticas e instituições dela dependentes ocupam um espaço de oposição à forma integrada, relacional, holista, como são pensadas e experimentadas as "doenças" (ou, como prefiro, as "perturbações físico-morais" mesmo nos segmentos "individualizados", quanto mais nos segmentos regidos por representações hierárquicas, relacionais, de "pessoa". Apresentam-se os fundamentos antropológicos dessa perspectiva analítica e as diferentes dimensões da produção acadêmica a ela associada, em comparação com as de outras tendências do campo.
Directory of Open Access Journals (Sweden)
Thaís Basso de Brito
2009-06-01
Full Text Available Este estudo foi desenvolvido com o objetivo de investigar a experiência de cuidar de adolescentes e pré-adolescentes portadores de diabetes tipo I, na perspectiva dos seus familiares. Foi utilizada a abordagem fenomenológica, modalidade de pesquisa qualitativa que se propõe a compreender os significados das experiências vividas. Foram entrevistados dez pais (9 mães e 1 pai em hospital de ensino do interior paulista. A experiência de cuidar do filho com diabetes emerge das convergências das descrições dos participantes, sendo descrita em três temas principais: o universo da doença; relação com as pessoas; reflexão sobre a experiência vivida. Os participantes descrevem suas dificuldades e estratégias para manterem a família unida e ainda oferecer suporte aos filhos. Eles acreditam que têm que aceitar e enfrentar os desafios, além de estimularem os filhos para sua segurança e qualidade de vida. Os dados mostraram a necessidade de um suporte profissional, além de um espaço para a discussão de temas tanto para as crianças com diabetes como para seus familiares.This study aimed at investigating the experience of taking care of adolescents and pre-adolescents with type 1 diabetes from the standpoint of their family members. A phenomenological approach, i.e. a type of qualitative analysis aimed at understanding the meaning of life experiences, was used. Ten parents (9 mothers and 1 father were interviewed at a teaching hospital in the interior of São Paulo state. The experience of taking care of a child with diabetes emerged from the converging points reported under 3 main themes: the universe of the disease; personal relationships; reflections on the experience. The participants described their difficulties and the strategies they use for keeping the family together besides providing support to the children. They believe they have to accept and face the challenges, besides motivating their children in order to ensure their
Directory of Open Access Journals (Sweden)
Sandra Tillmann
Full Text Available N-methyl-D-aspartate receptor (NMDA-R antagonists and nitric oxide inhibitors have shown promising efficacy in depression but commonly induce adverse events. To circumvent these, a more indirect disruption of the nitric oxide synthase/postsynaptic density protein 95 kDa complex at the NMDA-R has been proposed. This disruption can be achieved using small molecule inhibitors such as ZL006, which has attracted attention as ischemic stroke therapy in rodents and has been proposed as a potential novel treatment for depression. Based on this, our aim was to translate these findings to animal models of depression to elucidate antidepressant-like properties in more detail. In the present study, we administered ZL006 to two established animal models of depression and control rodents. Following treatment, we measured locomotion in the Open Field and depressive-like behavior in the Forced Swim Test and Tail Suspension Test. Our experimental designs included the use of different species (rats, mice, strains (Flinders Sensitive Line rats, Flinders Resistant Line rats, Wistar Kyoto rats, Wistar Hanover rats, Sprague Dawley rats, B6NTac mice, routes of administration (intraperitoneal, intracerebroventricular, times of administration (single injection, repeated injections, treatment regimens (acute, sustained, and doses (5, 10, 15, 50 mg/kg. ZL006 did not affect behavior in any of the described settings. On a molecular level, ZL006 significantly reduced total nitrate/nitrite concentrations in the cerebellum, supporting that it is capable of reducing nitric oxide metabolites in the brain. Future studies using different experimental parameters are needed to further investigate the behavioral profile of ZL006.
Organizational Processes and Patient Experiences in the Patient-centered Medical Home.
Aysola, Jaya; Schapira, Marilyn M; Huo, Hairong; Werner, Rachel M
2018-06-01
There is increasing emphasis on the use of patient-reported experience data to assess practice performance, particularly in the setting of patient-centered medical homes. Yet we lack understanding of what organizational processes relate to patient experiences. Examine associations between organizational processes practices adopt to become PCMH and patient experiences with care. We analyzed visit data from patients (n=8356) at adult primary care practices (n=22) in a large health system. We evaluated the associations between practice organizational processes and patient experience using generalized estimating equations (GEE) with an exchangeable correlation structure to account for patient clustering by practice in multivariate models, adjusting for several practice-level and patient-level characteristics. We evaluated if these associations varied by race/ethnicity, insurance type, and the degree of patient comorbidity MEASURES:: Predictors include overall PCMH adoption and adoption of six organizational processes: access and communications, patient tracking and registry, care management, test referral tracking, quality improvement and external coordination. Primary outcome was overall patient experience. In our full sample, overall PCMH adoption score was not significantly associated with patient experience outcomes. However, among subpopulations with higher comorbidities, the overall PCMH adoption score was positively associated with overall patient experience measures [0.2 (0.06, 0.4); P=0.006]. Differences by race/ethnicity and insurance type in associations between specific organizational processes and patient experience were noted. Although some organizational processes relate to patients' experiences with care irrespective of the background of the patient, further efforts are needed to align practice efforts with patient experience.
JSC Case Study: Fleet Experience with E-85 Fuel
Hummel, Kirck
2009-01-01
JSC has used E-85 as part of an overall strategy to comply with Presidential Executive Order 13423 and the Energy Policy Act. As a Federal fleet, we are required to reduce our petroleum consumption by 2 percent per year, and increase the use of alternative fuels in our vehicles. With the opening of our onsite dispenser in October 2004, JSC became the second federal fleet in Texas and the fifth NASA center to add E-85 fueling capability. JSC has a relatively small number of GSA Flex Fuel fleet vehicles at the present time (we don't include personal vehicles, or other contractor's non-GSA fleet), and there were no reasonably available retail E-85 fuel stations within a 15-minute drive or within five miles (one way). So we decided to install a small 1000 gallon onsite tank and dispenser. It was difficult to obtain a supplier due to our low monthly fuel consumption, and our fuel supplier contract has changed three times in less than five years. We experiences a couple of fuel contamination and quality control issues. JSC obtained good information on E-85 from the National Ethanol Vehicle Coalition (NEVC). We also spoke with Defense Energy Support Center, (DESC), Lawrence Berkeley Laboratory, and US Army Fort Leonard Wood. E-85 is a liquid fuel that is dispensed into our Flexible Fuel Vehicles identically to regular gasoline, so it was easy for our vehicle drivers to make the transition.
Experiências inovadoras de cuidado no Programa Saúde da Família (PSF: potencialidades e limites
Directory of Open Access Journals (Sweden)
Alice da Costa Uchôa
2009-06-01
Full Text Available Atualmente, o PSF convive com práticas do modelo biomédico e outras marcadoras de mudança. Este artigo aborda experiências inovadoras de cuidado baseada em pesquisa realizada em Natal no período de 2005 a 2007. Teve como objetivo compreender os sentidos da integralidade, discutir o papel da criatividade e sensibilidade dos profissionais e analisar as possibilidades de institucionalização e sustentabilidade. Utilizou análise documental; entrevista semi-estruturada com os protagonistas, observação das unidades e experiências. Dentre as concepções de integralidade encontradas destacam-se: promoção da saúde como mudança do estilo de vida; aproximações dialógicas entre saber científico e popular; fortalecimento da participação popular, auto-cuidado. Houve reconhecimento social expressos em ganho de prêmios, publicações e peças teatrais. Nenhum dos projetos contava com financiamento. Conclui-se que as experiências têm uma vocação para promoção e cuidado, mas ainda não têm sustentabilidade financeira e política.
UPSILON'(10.01) resonance parameters
International Nuclear Information System (INIS)
Niczyporuk, B.; Zeludziewicz, T.; Chen, K.W.; Hartung, R.
1980-09-01
The resonance parameters of the UPSILON'(10.01) were measured using the LENA detector at the DORIS e + e - storage ring. We obtained a mass of M(UPSILON') = (10 013.6 +- 1.2 +- 10.0) MeV and an electronic width of GAMMAsub(ee)(UPSILON') = (0.53 +- 0.07sup(+0.09)sub(-0.05) keV. The upper limit set to the μ-pair branching ratio is 3.8% which implies a lower limit on the total UPSILON' widUPSILON parameters we obtain a mass difference M(UPSILON') - M(UPSILON) = (552.0 +- 1.3 +- 10.0) MeV and GAMMAsub(ee)UPSILON')/ = 0.43 +- 0.07sup(+0.05)sub(-0.00). (orig.)
Directory of Open Access Journals (Sweden)
Andréa de Sousa Gama
2009-11-01
Full Text Available Este estudo analisa as diferentes representações e experiências quanto ao parto vaginal e cesárea de mulheres de diferentes estratos sócio-econômicos, bem como a natureza das relações profissionais de saúde/usuárias no contexto institucional em que estão inseridas. A pesquisa de natureza qualitativa foi desenvolvida em três maternidades do Município do Rio de Janeiro, Brasil, sendo uma pública, uma conveniada com o SUS e uma particular, com mulheres que tiveram os dois tipos de parto. Os resultados revelam que o modelo de organização dos serviços público e privado apresentam variações que produzem diferentes tipos de assistência e de relação entre os profissionais de saúde e as usuárias, dando forma a experiências distintas entre as mulheres pesquisadas. Todavia, ao empreendermos uma crítica assentada nas relações de gênero, podemos verificar que o modelo de assistência ao parto permanece submetendo quem deve ser sujeito e reproduzindo o projeto da medicalização - mesmo que este processo se manifeste de formas diferenciadas entre os grupos estudados -, o que reduz o campo da assistência e inviabiliza um lugar de poder diferenciado das usuárias.This study analyzes the different representations and experiences of women from different social classes, including issues related to their relations with hospital staff in different institutional settings. This qualitative study focused on women who had experienced both types of delivery, in three maternity hospitals in Rio de Janeiro, Brazil (one public, one fully private, and another private under an outsourcing agreement with the public health system. The study showed that variations in public and private service models result in different types of delivery care and different relations with staff, and are reflected in different birthing experiences for the women. However, a critical gender perspective shows that in both cases, the service models reproduce the
Data acquisition system for Experiment E866 at the Brookhaven AGS
International Nuclear Information System (INIS)
Ashktorab, K.; LeVine, M.J.; Scheetz, R.A.
1993-01-01
Experiment E866 consists of two spectrometers and related detectors for investigations of collisions of relativistic beams of Au ions with fixed targets at the Brookhaven AGS. The data acquisition system, consisting of 11 CPUs in a single VME crate, gathers data from 8 Camac crates and 6 Fastbus crates
Influence of dietary selenium and vitamin E on quality of veal.
Czech Academy of Sciences Publication Activity Database
Skřivanová, E.; Marounek, Milan; De Smet, S.; Raes, K.
2007-01-01
Roč. 76, 3 (2007), s. 495-500 ISSN 0309-1740 Institutional research plan: CEZ:AV0Z50450515 Keywords : calves * meat * selenium * vitamin E * oxidative stability Subject RIV: GH - Livestock Nutrition Impact factor: 2.006, year: 2007
National Aeronautics and Space Administration — The Atmospheric Infrared Sounder (AIRS) Level 2 Near Real Time (NRT) Cloud-Cleared Infrared Radiances (AIRS-only) product (AIRS2CCF_NRT_006) differs from the routine...
Energy Technology Data Exchange (ETDEWEB)
Chakin, V., E-mail: vladimir.chakin@kit.edu [Karlsruhe Institute of Technology, Institute for Applied Materials, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Rolli, R.; Moeslang, A.; Klimenkov, M.; Kolb, M.; Vladimirov, P.; Kurinskiy, P.; Schneider, H.-C. [Karlsruhe Institute of Technology, Institute for Applied Materials, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Til, S. van; Magielsen, A.J. [Nuclear Research and Consultancy Group, Westerduinweg 3, Postbus 25, 1755 ZG Petten (Netherlands); Zmitko, M. [The European Joint Undertaking for ITER and the Development of Fusion Energy, c/Josep Pla, no. 2, Torres Diagonal Litoral, Edificio B3, 08019 Barcelona (Spain)
2013-11-15
The current helium cooled pebble bed (HCPB) tritium breeding blanket concept for fusion reactors includes a bed of 1 mm diameter beryllium pebbles to act as a neutron multiplier. Beryllium pebbles, fabricated by the rotating electrode method, were neutron irradiated in the HFR in Petten within the HIDOBE-01 experiment. This study presents tritium release and retention properties and data on microstructure evolution of beryllium pebbles irradiated at 630, 740, 873, 948 K up to a damage dose of 18 dpa, corresponding to a helium accumulation of about 3000 appm. The measured cumulative released activity from the beryllium pebbles irradiated at 948 K was found to be significantly lower than the calculated value. After irradiation at 873 and 948 K scanning electron microscopy (SEM) and transmission electron microscopy (TEM) analyses revealed large pores or bubbles in the bulk and oxide films with a thickness of up to 8 μm at the surface of the beryllium pebbles. The radiation-enhanced diffusion of tritium and the formation of open porosity networks accelerate the tritium release from the beryllium pebbles during the high-flux neutron irradiation.
International Nuclear Information System (INIS)
Penel-Nottaris, E.
2004-07-01
The Jefferson Lab Hall A E89-044 experiment has measured the He 3 (e,e'p) reaction cross-sections. The extraction of the longitudinal and transverse response functions for the two-body break-up He 3 (e,e'p)d reaction in parallel kinematics allows the study of the bound proton electromagnetic properties inside the He 3 nucleus and the involved nuclear mechanisms beyond plane waves approximations, for missing momenta of 0 and +- 300 MeV/c and transferred momenta from 0.8 to 4.1 GeV 2 . Preliminary cross-sections have been obtained after calibration of the experimental setup by fitting theoretical models averaged over the experimental phase-space using a Monte-Carlo simulation. The 8% systematic error on cross-sections is linked mainly to the absolute normalization of the target density: the elastic scattering data analysis will allow to reduce this error. The preliminary results show some disagreement with theoretical predictions for the forward angles kinematics around 0 MeV/c missing momenta and sensitivity to final state interactions and He 3 waves functions for missing momenta of 300 MeV/c. The longitudinal and transverse separation should constraint theoretical models more strongly. (author)
Sustainable E-Participation through participatory experiences in education
Directory of Open Access Journals (Sweden)
Ursula Maier-Rabler
2010-09-01
Full Text Available Normal 0 21 false false false DE-AT X-NONE X-NONE The understanding of participation as a political matter has changed back and forth over the years. The latest twist back to appreciative attributions towards participation is fuelled by the development of the Internet, and especially the Social Web. Citizen participation is unanimously seen as an essential precondition for Deliberative-Collaborative eDemocracy (Petrik, 2010 enabled by Web 2.0. This paper considers participatory culture and its specific political, cultural, societal, and educational characteristics as a prerequisite for e-participation and argues that social media literacy is indispensable for e-participation to be sustainable. Young people’s affinity spaces (Jenkins, et.al., 2006 can only lay down the foundations for social media literacy, but their further development depends on education. Political Education would be well advised to adapt innovative pedagogical approaches to the acquirement of new media literacy. This paper introduces an exemplary educational tool – predominately but not exclusively for political/civic education – namely the website PoliPedia.at. Teachers can use it to deliberately create a balanced space for collaboration between Digital Immigrants and Digital Natives. PoliPedia – as a participative online tool – has the potential to facilitate participation experience in political/civic education and supports social media education. Thereby the embedding of technology in pedagogical and societal conceptualizations is crucial.
Sustainable E-Participation through participatory experiences in education
Directory of Open Access Journals (Sweden)
Ursula Maier-Rabler
2010-09-01
Full Text Available The understanding of participation as a political matter has changed back and forth over the years. The latest twist back to appreciative attributions towards participation is fuelled by the development of the Internet, and especially the Social Web. Citizen participation is unanimously seen as an essential precondition for Deliberative-Collaborative eDemocracy (Petrik, 2010 enabled by Web 2.0. This paper considers participatory culture and its specific political, cultural, societal, and educational characteristics as a prerequisite for e-participation and argues that social media literacy is indispensable for e-participation to be sustainable. Young people’s affinity spaces (Jenkins, et.al., 2006 can only lay down the foundations for social media literacy, but their further development depends on education. Political Education would be well advised to adapt innovative pedagogical approaches to the acquirement of new media literacy. This paper introduces an exemplary educational tool – predominately but not exclusively for political/civic education – namely the website PoliPedia.at. Teachers can use it to deliberately create a balanced space for collaboration between Digital Immigrants and Digital Natives. PoliPedia – as a participative online tool – has the potential to facilitate participation experience in political/civic education and supports social media education. Thereby the embedding of technology in pedagogical and societal conceptualizations is crucial.
Unigene BLAST: CBRC-OANA-01-1313 [SEVENS
Lifescience Database Archive (English)
Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.006 41% ...
NCBI nr-aa BLAST: CBRC-RNOR-01-0219 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-01-0219 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa
NCBI nr-aa BLAST: CBRC-RNOR-01-0216 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-RNOR-01-0216 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa
Neutrino physics with short baseline experiments
International Nuclear Information System (INIS)
Zimmerman, E.D.
2006-01-01
Neutrino physics with low- to medium-energy beams has progressed steadily over the last several years. Neutrino oscillation searches at short baseline (defined as 2 - -> 0.1eV 2 . One positive signal, from the LSND collaboration, exists and is being tested by the MiniBooNE experiment. Neutrino cross-section measurements are being made by MiniBooNE and K2K, which will be important for reducing systematic errors in present and future oscillation measurements. In the near future, dedicated cross- section experiments will begin operating at Fermilab. (author)
NCBI nr-aa BLAST: CBRC-ETEL-01-0698 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0698 ref|YP_441274.1| HesA/MoeB/ThiF family protein [Burkholderia thailand...ensis E264] gb|ABC38646.1| HesA/MoeB/ThiF family protein [Burkholderia thailandensis E264] YP_441274.1 0.73 41% ...
As contribuições teórico-metodológicas de E. P. Thompson: experiência e cultura
Directory of Open Access Journals (Sweden)
Suely Aparecida Martins
2006-01-01
Full Text Available O artigo destaca as contribuições teórico-metodológicas do historiador marxista Edward Palmer Thompson e que podem ser úteis para a pesquisa sociológica. A partir de pesquisa bibliográfica, apresenta-se uma breve biografia do autor e em seguida algumas categorias importantes desenvolvidas por ele, como experiência e cultura. Ressalta-se também a ênfase de Thompson em tratar as categorias teóricas considerando-se a processualidade histórica. Por fim, são levantadas algumas possibilidades de análise da juventude do campo na atualidade a partir das contribuições teórico-metodológicas desse autor.
Energy Technology Data Exchange (ETDEWEB)
Spechty, J.; Perez Rodriguez, J. L.
2012-07-01
E.ON is one of the largest privately-owned energy companies in the world. Its portfolio of nuclear assets in composed of 21 nuclear power plants on 13 sites located in Germany and Sweden, 9 of which are directly operated by E.ON. At present E.ON develops large-scale construction projects in two of the European countries willing to commit to new nuclear build-Finland and UK - for which its experience as the best nuclear power plant operator in Europe is key. (Author)
International Nuclear Information System (INIS)
Kuramoto, Renato Y.R.; Santos, Adimir dos; Jerez, Rogerio; Diniz, Ricardo
2007-01-01
A new methodology for absolute measurement of the effective delayed neutron fraction β eff based on Feynman-α experiments and the two-region model was developed. This method made use of Feynman-α experiments and the two-region model. To examine the present methodology, a series of Feynman-α experiments were conducted at the IPEN/MB-01 research reactor facility. In contrast with other techniques like the slope method, Nelson-number method and 252 Cf-source method, the main advantage of this new methodology is to obtain β eff with the required accuracy and without knowledge of any other parameter. By adopting the present approach, β eff was measured with a 0.67% uncertainty. In addition, the prompt neutron generation time, Λ, and other parameters, was also obtained in an absolute experimental way. In general, the measured parameters are in good agreement with the values found from frequency analysis experiments. The theory-experiment comparison for the β eff measured in this work shows that JENDL3.3 presented the best agreement (within 1%). The reduction of the 235 U thermal yield as proposed by Okajima and Sakurai is completely justified according to the β eff measurements performed in this work
Color transparency after the NE18 and E665 experiments: Outlook and perspectives at CEBAF
Energy Technology Data Exchange (ETDEWEB)
Nemchik, J. [Inst. of Experimental Physicals, Kosice (Czechoslovakia); Nikolaev, N.N.; Zakharov, B.G. [L.D. Landau Inst. for Theoretical Physics, Moscow (Russian Federation)
1994-04-01
CEBAF is a high-luminocity factory of virtual photons with variable virtuality Q{sup 2} and transverse size. This makes CEBAF, in particular after the energy upgrade to (8-12)GeV, an ideal facility for uncovering new phenomena, and opening new windows, at the interface of the perturbative and nonperturbative QCD. The authors discuss color transparency as the case for a broad program on electroproduction of vector mesons {rho}{sup 0}, {omega}{sup 0}, {phi}{sup 0} and their radial excitations {rho}{prime}, {omega}{prime}, {phi}{prime} at CEBAF. They also comment on the second generation of experiments on color transparency in {sup 4}He(e, e{prime}p) scattering, which are also feasible at CEBAF. In 1994, they can make more reliable projections into future because their understanding of the onset of color transparency has greatly been augmented by two experiments completed in 1993: (i) no effect of CT was seen in the SLAC NE18 experiment on A(e, e{prime}p) scattering at virtualities of the exchanged photon Q{sup 2} {approx_lt} 7 GeV{sup 2}, (ii) strong signal of CT was observed in the FNAL E665 experiment on exclusive {rho}{sup 0}-meson production in deep inelastic scattering in the same range of Q{sup 2}. They discuss the impact of these observations on the CEBAF experimental program. They argue they both are good news, both were anticipated theoretically, and both rule in the correct QCD mechanism of the onset of CT.
Status and first results of BNL experiment 777: A search for K+ → π+μ+e- and a study of K+ → μ+e+e-
International Nuclear Information System (INIS)
Baker, N.J.; Gordon, H.A.; Lazarus, D.M.
1987-01-01
Results of our search for short lived neutral particles emitted in K + decay are given. We also seek to make an accurate measurement of the branching ratio for π 0 → e + e - by looking for the decay chain K + → π + π 0 , π 0 → e + e - . The world average branching ratio for this decay is (1.8 +- 0.7) x 10 -7 based on about 30 events from two experiments. Theory predicts that this branching ratio should be of order 6 x 10 -8 . If the branching ratio remains at the 2 x 10 -7 level when measured with smaller errors, this could be an indication of new physics. 24 refs., 7 figs
Detection of the F meson production in the e+e--annihilation at a c.m. energy at 4.4 GeV
International Nuclear Information System (INIS)
Brandelik, R.
1981-01-01
The aim of this thesis had been to detect the F mesons via their decay into eta mesons. For this the eta rate between 4 and 5 GeV c.m. energy had been determined via the decay of the eta mesons into two photons. Energy and direction of the decay photons had been measured in the interior detector of DASP. As result of the analysis three c.m. energy intervals resulted with eta rates different from zero. An exceptionally evident eta signal of sigmasub(eta) = (5.15 +- 1.65)nb+-40% syst. error was measured for c.m. energies around 4.42 GeV and yielded thereby a first evidence for the F production. The detection of the F production resulted finally also in this energy interval from the measurement of the exclusive decay Fsup(+-)->πsup(+-)eta. From the additional detection of a correlation between produced eta mesons and low energy photons γsub(L) (Eγ + e - ->F + Fsup(-*) respectively e + e - ->Fsup(+*)Fsup(-*) was concluded. Thereby finally via a kinematic fit the detection of 6 events succeeded over a background of 0.2 events from e + e - ->F + Fsup(-*) respectively e + e - ->Fsup(+*)Fsup(-*) and Fsup(*)->γsub(L)F, Fsup(+-)->πsup(+-)eta,eta->2γ. Thereby the mass of F and Fsup(*) was determined to msub(F) = (2.04 +- 0.06)GeV and msub(F*) = (2.15 +- 0.06)MeV. The cross section for the 6 signal events was estimated to sigma(e + e - ->F + Fsup(-*))xB.R. (Fsup(+-)->πsup(+-)eta) = (0.41 +- 0.18)nb +-40% syst. error. (orig./HSI) [de
Studies of Nu-mu to Nu-e Oscillation Appearance in the MINOS Experiment
Energy Technology Data Exchange (ETDEWEB)
Pereira e Sousa, Alexandre Bruno [Tufts Univ., Medford, MA (United States)
2006-02-01
The MINOS experiment uses a long baseline neutrino beam, measured 1 km downstream from its origin in the Near Detector at Fermilab, and 734 km later in the large underground Far Detector in the Soudan mine. By comparing these two measurements, MINOS can probe the atmospheric domain of the neutrino oscillation phenomenology with unprecedented precision. Besides the ability to perform a world leading determination of the Δm$2\\atop{23}$ and θ23 parameters, via vμ flux disappearance, MINOS has the potential to make a leading measurement of vμ → ve oscillations in the atmospheric sector by looking for ve appearance at the Far Detector. The observation of ve appearance, tantamount to establishing a non-zero value of the θ13 mixing angle, opens the way to studies of CP violation in the leptonic sector, the neutrino spectral mass pattern ordering and neutrino oscillations in matter, the driving motivations of the next generation of neutrino experiments. In this thesis, we study the MINOS potential for measuring θ13 in the context of the MINOS Mock Data Challenge using a multivariate discriminant analysis method. We show the method's validity in the application to ve event classification and background identification, as well as in its ability to identify a ve signal in a Mock Data sample generated with undisclosed parameters. An independent shower reconstruction method based on three-dimensional hit matching and clustering was developed, providing several useful discriminator variables used in the multivariate analysis method. We also demonstrate that within 2 years of running, MINOS has the potential to improve the current best limit on θ13, from the CHOOZ experiment, by a factor of 2.
NCBI nr-aa BLAST: CBRC-PMAR-01-0503 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PMAR-01-0503 ref|NP_001011594.1| G-protein coupled receptor [Apis mellifera] e...mb|CAB76374.1| G-protein coupled receptor [Apis mellifera] gb|ABI94393.1| tyramine receptor [Apis mellifera]... gb|ABI94394.1| tyramine receptor [Apis mellifera] NP_001011594.1 3e-43 32% ...
Track following of Ξ"- hyperons in nuclear emulsion for the E07 experiment
International Nuclear Information System (INIS)
Mishina, Akihiro; Endo, Yoko; Hoshino, Kaoru
2015-01-01
The E07 experiment is expected to provide knowledge of S = -2 systems with ten times more statistics than that of the past E373 experiment. To achieve this in a reasonable time, an automated track following system is very important. This system consists of three techniques, 'emulsion surface detection', 'alignment of plate by plate connection with K"- beams' and 'followed track recognition in nuclear emulsion'. Ξ"- hyperon candidate tracks are followed from the entrance to the end point in the emulsion. If the system operates properly such that one track is processed in each plate within one minute, all Ξ"- candidate tracks can be followed successfully to their stopping points in a year. The development of softwares for the system is ongoing. (author)
Dicty_cDB: Contig-U16150-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 1 ( AF333962 ) Staphylococcus aureus transcription termination f... 56 0.006 1 ( EJ636634 ) 1093000601508 Global-Ocean-Sampli...7e-06 2 ( BI503955 ) BB170032B20H11.5 Bee Brain Normalized/Subtracted ... 48 7e-06 2 ( EJ528186 ) 1092955203016 Global-Ocean-Sampli... 62 9e-05 2 ( EK235668 ) 1095460199019 Global-Ocean-Sampling_GS-31-01-01-1... 54 9e-05 2 ( EF583994 ) Uncultured...ng_GS-27-01-01-1... 62 1e-04 1 ( DC238926 ) Hodotermopsis sjoestedti cDNA clone: MY0813AHsBod... 62 1... ) EST_lsal_evj_798759 lsalevj mixed_tissue_mixed_st... 36 0.001 4 ( EK080244 ) 1092961100325 Global-Ocean-Sampli
Directory of Open Access Journals (Sweden)
Huajun Zhang
Full Text Available Harmful algal blooms occur all over the world, destroying aquatic ecosystems and threatening other organisms. The culture supernatant of the marine algicidal actinomycete BS01 was able to lysis dinoflagellate Alexandrium tamarense ATGD98-006. Physiological and biochemical responses to oxidative stress in A. tamarense were investigated to elucidate the mechanism involved in BS01 inhibition of algal growth. Transmission electron microscope analysis revealed that there were some chloroplast abnormalities in response to BS01 supernatant. The decrease in cellular-soluble protein content suggested that cell growth was greatly inhibited at high concentration of BS01 supernatant. The increase in the levels of reactive oxygen species (ROS and malondialdehyde contents following exposure to BS01 supernatant indicated that algal cells suffered from oxidative damage. The content of pigment was significantly decreased after 12 h treatment, which indicated that the accumulation of ROS destroyed pigment synthesis. Moreover, the decrease of Fv/Fm ratio suggested that in the photosynthetic system, the dominant sites producing ROS were destroyed by the supernatant of the BS01 culture. The activities of the antioxidant enzymes including superoxide dismutase and peroxidase increased in a short time and decreased slightly with increasing exposure time. A real-time PCR assay showed changes in the transcript abundances of two photosynthetic genes, psbA and psbD. The results showed that BS01 supernatant reduced the expression of the psbA gene after 2 h exposure, but the expression of the psbD gene was increased at concentrations of 1.0 and 1.5%. Our results demonstrated that the expression of the psbA gene was inhibited by the BS01 supernatant, which might block the electron transport chain, significantly enhancing ROS level and excess activity of the antioxidant system. The accumulation of ROS destoryed pigment synthesis and membrane integrity, and inhibited or
SU-E-E-05: Initial Experience On Physics Rotation of Radiological Residents
International Nuclear Information System (INIS)
Zhang, J; Williams, D; DiSantis, D; Hardy, P; Oates, M
2014-01-01
Purpose: The new ABR core exam integrates physics into clinical teaching, with an emphasis on understanding image quality, image artifacts, radiation dose and patient safety for each modality and/or sub-specialty. Accordingly, physics training of radiological residents faces a challenge. A traditional teaching of physics through didactic lectures may not fully fulfill this goal. It is also difficult to incorporate physics teaching in clinical practice due to time constraints. A dedicated physics rotation may be a solution. This study is to evaluate a full week physics workshop developed for the first year radiological residents. Methods: The physics rotation took a full week. It included three major parts, introduction lectures, hand-on experiences and observation of technologist operation. An introduction of basic concepts was given to each modality at the beginning. Hand-on experiments were emphasized and took most of time. During hand-on experiments, residents performed radiation measurements, studied the relationship between patient dose and practice (i.e., fluoroscopy), investigated influence of acquisition parameters (i.g., kV, mAs) on image quality, and evaluated image quality using phantoms A physics test before and after the workshop was also given but not for comparison purpose. Results: The evaluation shows that the physics rotation during the first week of residency in radiology is preferred by all residents. The length of a full week of physics workshop is appropriate. All residents think that the intensive workshop can significantly benefit their coming clinical rotations. Residents become more comfortable regarding the use of radiation and counseling relevant questions such as a pregnant patient risk from a CE PE examination. Conclusion: A dedicated physics rotation, assisting with didactic lectures, may fulfill the requirements of physics of the new ABR core exam. It helps radiologists deeply understand the physics concepts and more efficiently use
SU-E-E-05: Initial Experience On Physics Rotation of Radiological Residents
Energy Technology Data Exchange (ETDEWEB)
Zhang, J; Williams, D; DiSantis, D; Hardy, P; Oates, M [University of Kentucky, Lexington, KY (United States)
2014-06-01
Purpose: The new ABR core exam integrates physics into clinical teaching, with an emphasis on understanding image quality, image artifacts, radiation dose and patient safety for each modality and/or sub-specialty. Accordingly, physics training of radiological residents faces a challenge. A traditional teaching of physics through didactic lectures may not fully fulfill this goal. It is also difficult to incorporate physics teaching in clinical practice due to time constraints. A dedicated physics rotation may be a solution. This study is to evaluate a full week physics workshop developed for the first year radiological residents. Methods: The physics rotation took a full week. It included three major parts, introduction lectures, hand-on experiences and observation of technologist operation. An introduction of basic concepts was given to each modality at the beginning. Hand-on experiments were emphasized and took most of time. During hand-on experiments, residents performed radiation measurements, studied the relationship between patient dose and practice (i.e., fluoroscopy), investigated influence of acquisition parameters (i.g., kV, mAs) on image quality, and evaluated image quality using phantoms A physics test before and after the workshop was also given but not for comparison purpose. Results: The evaluation shows that the physics rotation during the first week of residency in radiology is preferred by all residents. The length of a full week of physics workshop is appropriate. All residents think that the intensive workshop can significantly benefit their coming clinical rotations. Residents become more comfortable regarding the use of radiation and counseling relevant questions such as a pregnant patient risk from a CE PE examination. Conclusion: A dedicated physics rotation, assisting with didactic lectures, may fulfill the requirements of physics of the new ABR core exam. It helps radiologists deeply understand the physics concepts and more efficiently use
RSS technique and its role in supporting the educational process ...
African Journals Online (AJOL)
The spread of e-readers led to turnout to digital resources (e.g. the famous Amazon Kindle reader). ... Publishers have become in line with this trend. ... as well as to support marketing and promotional services for educational institutions.
Out-of-Time Beam Extinction in the MU2E Experiment
Energy Technology Data Exchange (ETDEWEB)
Prebys, E. J. [Fermilab; Werkema, S. [Fermilab
2015-06-01
The Mu2e Experiment at Fermilab will search for the conversion of a muon to an electron in the field of an atomic nucleus with unprecedented sensitivity. The experiment requires a beam consisting of proton bunches 250 ns FW long, separated by 1.7 $\\mu$ sec, with no out-of-time protons at the $10^{10}$ fractional level. Satisfying this "extinction" requirement is very challenging. The formation of the bunches is expected to result in an extinction on the order of $10^5$. The remaining extinction will be accomplished by a system of resonant magnets and collimators, configured such that only in-time beam is delivered to the experiment. Our simulations show that the total extinction achievable by the system is on the order of $10^{12}$, with an efficiency for transmitting in-time beam of 99.6%.
Gene : CBRC-DYAK-01-0060 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-01-0060 Novel 2L A Orphan receptors LSHR_BOVIN 5e-88 33% ref|NP_476702.1| rickets... CG8930-PA, isoform A [Drosophila melanogaster] ref|NP_599102.1| rickets CG8930-PB, isoform B [Droso...phila melanogaster] ref|NP_599103.1| rickets CG8930-PC, isoform C [Drosophila melanogaster] ref|NP_599104.1| rickets
IRPhE/STEK, Reactor Physics Experiments from Fast-Thermal Coupled Facility
International Nuclear Information System (INIS)
Dietze, Klaus; Klippel, Henk Th.; Koning, Arjan; Jacqmin, Robert
2003-01-01
1 - Description: The STEK-experiments have been performed to check neutron data of the most important reactor materials, especially of fission product nuclides, fuel isotopes and structural materials. The measured central reactivity worths (CRW) of small samples were compared with calculated values. These C/E-ratios have been used then for data corrections or in adjustment procedures. The reactors STEK (ECN Petten/ Netherlands) was a fast-thermal coupled facility of zero power. The annular thermal drivers were filled by fuel assemblies and moderated by water. The inner insertion lattices were loaded with pellets of fuel and other materials producing the fast neutron flux. The characteristics of the neutron and adjoint spectra were obtained by special arrangements of these pellets in unit cells. In this way, a hard or soft neutron spectrum or a special energy behavior of the adjoint function could be reached. The samples were moved by means of tubes to the central position (pile-oscillation technique). The original information about the facility and measurements is compiled in RCN-209, ECN-10 The 5 STEK configurations cover a broad energy range due to their increasing softness. The experiments are very valuable because of the extensive program of sample reactivity measurements with many fission product nuclides important in reactor burn-up calculations. At first, analyses of the experiments have been performed in Petten. Newer analyses were done later in Cadarache / CEA France using the European scheme for reactor calculation JEF-2.2 / ECCO / ERANOS (see Note Techniques and JEF/DOC-746). Furthermore, re-analyses were performed in O-arai / JNC Japan with the JNC standard route JENDL-3.2 / SLAROM / CITATION / PERKY. Results obtained with both code systems and different data evaluations (JEF-2.2 and JENDL-3.2) are compared in JEF/DOC-861. It contains the following documents: 31 Reports, 2 publications, 5 JEF documents, 4 conferences. 2 - Related or auxiliary programs
An improved algorithm to generate a Wi-Fi fingerprint database for indoor positioning.
Chen, Lina; Li, Binghao; Zhao, Kai; Rizos, Chris; Zheng, Zhengqi
2013-08-21
The major problem of Wi-Fi fingerprint-based positioning technology is the signal strength fingerprint database creation and maintenance. The significant temporal variation of received signal strength (RSS) is the main factor responsible for the positioning error. A probabilistic approach can be used, but the RSS distribution is required. The Gaussian distribution or an empirically-derived distribution (histogram) is typically used. However, these distributions are either not always correct or require a large amount of data for each reference point. Double peaks of the RSS distribution have been observed in experiments at some reference points. In this paper a new algorithm based on an improved double-peak Gaussian distribution is proposed. Kurtosis testing is used to decide if this new distribution, or the normal Gaussian distribution, should be applied. Test results show that the proposed algorithm can significantly improve the positioning accuracy, as well as reduce the workload of the off-line data training phase.
Summary of sensor evaluation for the Fusion ELectromagnetic Induction eXperiment (FELIX)
International Nuclear Information System (INIS)
Knott, M.J.
1982-08-01
As part of the First Wall/Blanket/Shield Engineering Test Program, a test bed called FELIX (Fusion ELectromagnetic Induction eXperiment) is now under construction at ANL. Its purpose will be to test, evaluate, and develop computer codes for the prediction of electromagnetically induced phenomenon in a magnetic environment modeling that of a fusion reaction. Crucial to this process is the sensing and recording of the various induced effects. Sensor evaluation for FELIX has reached the point where most sensor types have been evaluated and preliminary decisions are being made as to type and quantity for the initial FELIX experiments. These early experiments, the first, flat plate experiment in particular, will be aimed at testing the sensors as well as the pertinent theories involved. The reason for these evaluations, decisions, and proof tests is the harsh electrical and magnetic environment that FELIX presents
Wilburn, Clayton R; Bernard, David W; Zieske, Arthur W; Andrieni, Julia; Miller, Tara; Wang, Ping
2017-06-01
To characterize and quantitate hemoglobin (Hb) variants discovered during biometric hemoglobin A1c (HbA1c) analyses in a large multiethnic population with a focus on the effect of variants on testing method and results. In total, 13,913 individuals had their HbA1c measured via ion-exchange high-performance liquid chromatography. Samples that had a variant Hb detected or HbF fraction more than 25% underwent variant Hb characterization and confirmation by gel electrophoresis. RBC indices were also evaluated for possible concomitant thalassemia. Of the 13,913 individuals evaluated, 524 (3.77%) had an Hb variant. The prevalence of each variant was as follows: HbS trait (n = 396, 2.85%), HbSS disease (n = 4, 0.03%), HbC trait (n = 85, 0.61%), HbCC disease (n = 2, 0.01%), HbSC disease (n = 5, 0.04%), HbE trait (n = 18, 0.13%), HbD or G trait (n = 9, 0.06%), HbS β-thalassemia + disease (n = 1, 0.01%), hereditary persistence of HbF (n = 2, 0.01%), and HbMontgomery trait (n = 1, 0.01%). Concomitant α-thalassemia was detected in 20 (3.82%) of the 524 individuals with an Hb variant. This study represents one of the largest epidemiologic investigations into the prevalence of Hb variants in a North American metropolitan, multiethnic workforce and their dependents and reinforces the importance of method selection in populations with Hb variants. © American Society for Clinical Pathology, 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com
First observation and study of $K^\\pm \\to \\pi^\\pm \\pi^0 e^+ e^-$ decay at the NA48/2 experiment
Misheva, M H; Arcidiacono, R; Balev, S; Batley, J R; Behler, M; Bifani, S; Biino, C; Bizzeti, A; Bloch-Devaux, B; Bocquet, G; Cabibbo, N; Calvetti, M; Cartiglia, N; Ceccucci, A; Cenci, P; Cerri, C; Cheshkov, C; Cheze, J B; Ciemencic, M; Collazuol, G; Costantini, F; Cotta Ramusino, A; Coward, D; Cundy, D; Dabrowski, A; Dalpiaz, P; Damiani, C; De Beer, M; Derre, J; Dibon, H; Dilella, L; Doble, N; Eppard, K; Falaleev, V; Fantechi, R; Fidecaro, M; Fiorini, L; Fiorini, M; Fonseca, T; Martin, M; Frabetti, P L; Gatignon, L; Gersabeck, E; Gianoli, A; Giudici, S; Gonidec, A; Goudzovski, E; Goy Lopez, S; Holder, M; Hris, P; Iacopini, E; Imbergamo, E; Jeitler, M; Kalmus, G; Kekelidze, V; Kleinknecht, K; Kozhuharov, V; Kubis, W; Lamanna, G; Lazzeroni, C; Lenti, M; Litov, L; Madigozhin, D; Maier, A; Mannelli, I; Marchetto, F; Mare, G; Markytan, M; Marouelli, P; Martini, M; Masetti, L; Mazzucato, E; Michetti, A; Mikulec, I; Molokanova, N; Monnier, E; Moosbrugger, U; Morales Morales, C; Munday, D J; Nappi, A; Neuhofer, G; Norton, A; Pa, M; Pepe, M; Peters, A; Petrucci, F; Petrucci, M C; Peyaud, B; Piccini, M; Pierazzini, G; Polenkevich, I; Potrebenikov, Yu; Raggi, M; Renk, B; Rubin, P; Ruggiero, G; Savrie, M; Scarpa, M; Shieh, M; Slater, M W; Sozzi, M; Stoynev, S; Swallow, E; Szleper, M; Valdata-Nappi, M; Vallage, B; Velasco, M; Veltri, M; Venditti, S; Wache, M; Wahl, H; Walker, A; Wanke, R; Widhalm, L; Winhart, A; Winston, R; Wood, M D; Wotton, S A; Yushchenko, A; Zinchenko, M; Ziolkowski, M
2015-01-01
A sample of almost 2000 $K^\\pm \\to \\pi^\\pm \\pi^0 e^+ e^-$ rare decays with a background contamination below 3% is observed for the first time by the NA48/2 experiment at CERN/SPS. The preliminary branching ratio in the full kinematic region is obtained to be $BR(K^\\pm \\to \\pi^\\pm \\pi^0 e^+ e^-)$ = (4.06 ± 0.17) x $10^{-6}$ by analyzing the data set recorded in 3-month NA48/2 run during 2003. The measured value is in agreement with the theoretical prediction within one standard deviation.
Barbosa, Tiago Manuel de Almeida
2017-01-01
Mestrado em Gestão Exame Público realizado em 20 de Dezembro de 2017 As crescentes mudanças e evoluções de tendências, produtos, serviços e tecnologias obrigam a que as organizações estejam atentas e preparadas para acompanhar essas transformações. O consumidor está ele também cada vez mais exigente e procura sobretudo as organizações que correspondam às suas expetativas. Através das Marcas as organizações têm a oportunidade de, pelas suas estratégias, potenciar Experiências aos seus co...
International Nuclear Information System (INIS)
Xu, W.; Anderson, B.; Auberbach, L.; Averett, T.; Bertozzi, W.; Black, T.; Calarco, J.; Cardman, L.; Cates, G.D.; Chai, Z.W.; Chen, J.P.; Choi, S.; Chudakov, E.; Churchwell, S.; Corrado, G.S.; Crawford, C.; Dale, D.; Deur, A.; Djawotho, P.; Donnelly, T.W.; Dutta, D.; Finn, J.M.; Gao, H.; Gilman, R.; Glamazdin, A.V.; Glashausser, C.; Gloeckle, Walter; Golak, J.; Gomez, J.; Gorbenko, V.G.; Hansen, J.O.; Hersman, F.W.; Higinbotham, D.W.; Holmes, R.; Howell, C.R.; Hughes, E.; Humensky, B.; Incerti, S.; Jager, C.W. de; Jensen, J.S.; Jiang, X.; Jones, C.E.; Jones, M.; Kahl, R.; Kamada, H.; Kievsky, A.; Kominis, I.; Korsch, W.; Kramer, K.; Kumbartzki, G.; Kuss, M.; Lakuriqi, E.; Liang, M.; Liyanage, N.; LeRose, J.; Malov, S.; Margaziotis, D.J.; Martin, J.W.; McCormick, K.; McKeown, R. D.; McIlhany, K.; Meziani, Z.E.; Michaels, R.; Miller, G.W.; Mitchell, J.; Nanda, S.; Pace, E.; Pavlin, T.; Petratos, G.G.; Pomatsalyuk, R.I.; Pripstein, D.; Prout, D.; Ransome, R.D.; Roblin, Y.; Rvachev, M.; Saha, A.; Salme, G.; Schnee, M.; Shin, T.; Slifer, K.; Souder, P.A.; Strauch, S.; Suleiman, R.; Sutter, M.; Tipton, B.; Todor, L.; Viviani, M.; Vlahovic, B.; Watson, J.; Williamson, C.F.; Witala, H.; Wojtsekhowski, B.; Xiong, F.; Yeh, J.; Zolnierczuk, P.
2003-01-01
A high precision measurement of the transverse spin-dependent asymmetry A T in 3 (rvec H)e((rvec e),e(prime)) quasielastic scattering was performed in Hall A at Jefferson Lab at values of the squared four-momentum transfer, Q 2 , between 0.1 and 0.6 (GeV/c) 2 . A T is sensitive to the neutron magnetic form factor, G M n . Values of G M n at Q 2 = 0.1 and 0.2 (GeV/c) 2 , extracted using Faddeev calculations, were reported previously. Here, we report the extraction of G M n for the remaining Q 2 -values in the range from 0.3 to 0.6 (GeV/c) 2 using a Plane-Wave Impulse Approximation calculation. The results are in good agreement with recent precision data from experiments using a deuterium target
Design and experiment of high-current low-pressure plasma-cathode e-gun
International Nuclear Information System (INIS)
Xie Wenkai; Li Xiaoyun; Wang Bin; Meng Lin; Yan Yang; Gao Xinyan
2006-01-01
The preliminary design of a new high-power low pressure plasma-cathode e-gun is presented. Based on the hollow cathode effect and low-pressure glow discharge empirical formulas, the hollow cathode, the accelerating gap, and the working gas pressure region are given. The general experimental device of the low-pressure plasma cathode electron-gun generating high current density e-beam source is shown. Experiments has been done in continuous filled-in gases and gases-puff condition, and the discharging current of 150-200 A, the width of 60 μs and the collector current of 30-80 A, the width of 60 μs are obtained. The results show that the new plasma cathode e-gun can take the place of material cathode e-gun, especially in plasma filled microwave tubes. (authors)
Probing the eV-mass range for solar axions with the CAST experiment
International Nuclear Information System (INIS)
Vogel, J.
2009-01-01
The CERN Axion Solar Telescope (CAST) is searching for solar axions, which could be produced in the core of the Sun via the so-called Primakoff effect. For this purpose, CAST uses a decommissioned LHC prototype magnet. In its magnetic field of 9 Tesla axions could be reconverted into X-ray photons. The magnet is mounted on a structure built to follow the Sun during sunrise and sunset for a total of about 3 hours per day. The analysis of the data acquired during the first phase of the experiment with vacuum in the magnetic field region yielded the most restrictive experimental upper limit on the axion-to-photon coupling constant for axion masses up to about 0.02 eV. In order to extend the sensitivity of the experiment to a wider mass range, the CAST experiment continued its search for axions with helium in the magnet bores. In this way it is possible to restore coherence for larger masses. Changing the pressure of the helium gas enables the experiment to scan different axion masses. In the first part of this second phase of CAST, helium-4 has been used and the axion mass region was extended up to 0.4 eV. Therefore the experiment enters the regions favored by axion models. In CAST's ongoing helium-3 phase the studied mass range is now further extended. We will present the final results of CAST's helium-4 phase. Furthermore the latest upgrades of the experiments will be shown and an outlook on CAST's status and prospects will be given. (author)
Yano, T.; Nishino, K.; Kawamura, H.; Ueno, I.; Matsumoto, S.
2015-02-01
This paper reports the experimental results on the instability and associated roll structures (RSs) of Marangoni convection in liquid bridges formed under the microgravity environment on the International Space Station. The geometry of interest is high aspect ratio (AR = height/diameter ≥ 1.0) liquid bridges of high Prandtl number fluids (Pr = 67 and 207) suspended between coaxial disks heated differentially. The unsteady flow field and associated RSs were revealed with the three-dimensional particle tracking velocimetry. It is found that the flow field after the onset of instability exhibits oscillations with azimuthal mode number m = 1 and associated RSs traveling in the axial direction. The RSs travel in the same direction as the surface flow (co-flow direction) for 1.00 ≤ AR ≤ 1.25 while they travel in the opposite direction (counter-flow direction) for AR ≥ 1.50, thus showing the change of traveling directions with AR. This traveling direction for AR ≥ 1.50 is reversed to the co-flow direction when the temperature difference between the disks is increased to the condition far beyond the critical one. This change of traveling directions is accompanied by the increase of the oscillation frequency. The characteristics of the RSs for AR ≥ 1.50, such as the azimuthal mode of oscillation, the dimensionless oscillation frequency, and the traveling direction, are in reasonable agreement with those of the previous sounding rocket experiment for AR = 2.50 and those of the linear stability analysis of an infinite liquid bridge.
Air medical transport personnel experiences with and opinions about research.
Fox, Jolene; Thomas, Frank; Carpenter, Judi; Handrahan, Diana
2010-01-01
This study examined air medical transport (AMT) personnel's experiences with and opinions about prehospital and AMT research. A Web-based questionnaire was sent to eight randomly selected AMT programs from each of six Association of Air Medical Services (AAMS) regions. Responders were defined by university association (UA) and AMT professional role. Forty-eight of 54 (89%) contacted programs and 536 of 1,282 (42%) individuals responded. Non-UA responders (74%) had significantly more work experience in emergency medical services (EMS) (13.5 +/- 8.5 vs. 10.8 +/- 8.3 years, P = .002) and AMT (8.3 +/- 6.3 vs. 6.8 +/- 5.7 years, P = .008), whereas UA responders (26%) had more research training (51% vs. 37%, P = .006), experience (79% vs. 59%, P < .001), and grants (7% vs. 2%, P = .006). By AMT role, administrators had the most work experience, and physicians had the most research experience. Research productivity of responders was low, with only 9% having presented and 10% having published research; and UA made no difference in productivity. A majority of responders advocated research: EMS (66%) and AMT (68%), program (53%). Willingness to participate in research was high for both EMS research (87%) and AMT research (92%). Although AMT personnel were strong advocates of and willing to participate in research, few had research knowledge. For AMT personnel, disparity exists between advocating for and producing research. Copyright 2010 Air Medical Journal Associates. Published by Elsevier Inc. All rights reserved.
Performance analysis of orthogonal pairs designed for an expanded eukaryotic genetic code.
Directory of Open Access Journals (Sweden)
Sebastian Nehring
Full Text Available The suppression of amber stop codons with non-canonical amino acids (ncAAs is used for the site-specific introduction of many unusual functions into proteins. Specific orthogonal aminoacyl-tRNA synthetase (o-aaRS/amber suppressor tRNA(CUA pairs (o-pairs for the incorporation of ncAAs in S. cerevisiae were previously selected from an E. coli tyrosyl-tRNA synthetase/tRNA(CUA mutant library. Incorporation fidelity relies on the specificity of the o-aaRSs for their ncAAs and the ability to effectively discriminate against their natural substrate Tyr or any other canonical amino acid.We used o-pairs previously developed for ncAAs carrying reactive alkyne-, azido-, or photocrosslinker side chains to suppress an amber mutant of human superoxide dismutase 1 in S. cerevisiae. We found worse incorporation efficiencies of the alkyne- and the photocrosslinker ncAAs than reported earlier. In our hands, amber suppression with the ncAA containing the azido group did not occur at all. In addition to the incorporation experiments in S. cerevisiae, we analyzed the catalytic properties of the o-aaRSs in vitro. Surprisingly, all o-aaRSs showed much higher preference for their natural substrate Tyr than for any of the tested ncAAs. While it is unclear why efficiently recognized Tyr is not inserted at amber codons, we speculate that metabolically inert ncAAs accumulate in the cell, and for this reason they are incorporated despite being weak substrates for the o-aaRSs.O-pairs have been developed for a whole plethora of ncAAs. However, a systematic and detailed analysis of their catalytic properties is still missing. Our study provides a comprehensive scrutiny of o-pairs developed for the site-specific incorporation of reactive ncAAs in S. cerevisiae. It suggests that future development of o-pairs as efficient biotechnological tools will greatly benefit from sound characterization in vivo and in vitro in parallel to monitoring intracellular ncAA levels.
Unigene BLAST: CBRC-HSAP-01-0117 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-01-0117 gnl|UG|Hs#S1730560 Homo sapiens opsin 1 (cone pigments), medium-wave-sensitive (color blin...dness, deutan) (OPN1MW), mRNA /cds=p(1,1095) /gb=NM_000513 /gi=4503964 /ug=Hs.247787 /len=1095 9e-33 31% ...
Unigene BLAST: CBRC-GGAL-01-0052 [SEVENS
Lifescience Database Archive (English)
Full Text Available ndness, protan) (OPN1LW), mRNA /cds=p(9,1097) /gb=NM_205440 /gi=45382134 /ug=Gga.716 /len=1318 5e-43 30% ... ...CBRC-GGAL-01-0052 gnl|UG|Gga#S19184093 Gallus gallus opsin 1 (cone pigments), long-wave-sensitive (color bli
Unigene BLAST: CBRC-MMUS-01-0101 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-01-0101 gnl|UG|Mm#S8040853 Mus musculus opsin 1 (cone pigments), short-wave-sensitive (color blind...ness, tritan) (Opn1sw), mRNA /cds=p(66,1106) /gb=NM_007538 /gi=31543369 /ug=Mm.56987 /len=2521 3e-33 28% ...
Directory of Open Access Journals (Sweden)
Henrique Debiasi
2010-06-01
Full Text Available O objetivo deste trabalho foi avaliar o efeito de coberturas de inverno e da descompactação mecânica do solo sobre o desempenho de soja e milho, em sistema de plantio direto. Foram conduzidos dois experimentos em Eldorado do Sul, RS, sobre Argissolo Vermelho compactado, nas safras 2005/2006 e 2006/2007. No primeiro, o delineamento experimental foi em blocos ao acaso, com parcelas subdivididas. Os tratamentos consistiram de duas profundidades teóricas de atuação da haste sulcadora da semeadora (0,06 e 0,12 m, subparcela e de três tipos de coberturas do solo no inverno (parcela: pousio, aveia-preta (Avena strigosa e aveia-preta+ervilhaca (Vicia Sativa. Em 2006, a cobertura aveia-preta+ervilhaca foi substituída por nabo-forrageiro (Raphanus sativus. No segundo experimento, realizado em blocos ao acaso, o solo foi escarificado e os tratamentos consistiram do uso de aveia-preta ou nabo-forrageiro como cobertura de inverno. Os cultivos de cobertura reduziram a compactação superficial do solo (0-0,06 m em comparação ao pousio e, na safra 2006/2007, sob condições de baixa disponibilidade hídrica, proporcionaram maior produtividade de milho e soja. Isso não se repetiu em 2006/2007, quando a disponibilidade hídrica foi adequada. O aumento da profundidade de atuação das hastes sulcadoras não influenciou a produtividade da soja e do milho. A escarificação reduziu a produtividade da soja e do milho em relação ao SPD contínuo.The objective of this work was to evaluate the effect of soil winter covers and soil mechanical loosening on soybean and corn yield, in no-tillage system. Two experiments were carried oud in Rio Grande do Sul state, Brazil, in a compacted Argissolo Vermelho (Haplic Acrisol, in the 2005/2006 and 2006/2007 crop seasons. The first experiment was carried out in a complete block design, with a split plot arrangement. The treatments were two theoretical working depths of a driller chisel-type furrow opener (0.06 and 0
Detector system for e-d scattering experiments on the VEPP-3 storage ring
International Nuclear Information System (INIS)
Isaeva, L.G.; Lazarenko, B.A.; Nikolenko, D.M.; Popov, S.G.; Rachek, I.A.; Ukraintsev, Yu.G.; Tsentalovich, E.P.; Wojtsekhowski, B.B.; Nelubin, V.V.
1993-01-01
Experiments on electron scattering from polarized deuterons were carried out on the VEPP-3 storage ring at the Novosibirsk Institute for Nuclear Physics. The e-D coincidences were detected for elastic scattering experiments, and the p-n coincidences for photo disintegration studies. The tensor analyzing power of the elastic scattering was measured in the range of momentum transfer up to 3 f -1 , and of photo disintegration in the range of photon energy up to 500 MeV. The detector system created for these experiments and the data analysis procedures are described in this paper. (orig.)
International Nuclear Information System (INIS)
Barsoum, M.W.; El-Raghy, T.; Farber, L.; Amer, M.; Christini, R.; Adams
1999-01-01
Immersion of Ti 3 SiC 2 samples in molten cryolite at 960 C resulted in the preferential diffusion of Si atoms out of the basal planes to form a partially ordered, cubic phase with approximate chemistry Ti(C 0.67 , Si 0.06 ). The latter forms in domains, wherein the (111) planes are related by mirror planes; i.e., the loss of Si results in the de-twinning of the Ti 3 C 2 layers. Raman spectroscopy, X-ray diffraction, optical, scanning and transmission electron microscopy all indicate that the Si exists the structure topotactically, in such a way that the C atoms remain partially in their ordered position in the cubic phase
Notas sobre narração e experiência em Walter Benjamin
Directory of Open Access Journals (Sweden)
Wagner de Avila Quevedo
2008-12-01
Full Text Available O objetivo deste texto é o de elucidar alguns escritos clássicos sobre o conceito de experiência (Erfahrung em Walter Benjamin, mostrando sua relação com a narração (Erzählung e a memória.
Energy Technology Data Exchange (ETDEWEB)
Til, S. van, E-mail: vantil@nrg.eu [Nuclear Research and Consultancy Group, Westerduinweg 3, Postbus 25, 1755 ZG Petten (Netherlands); Fedorov, A.V.; Stijkel, M.P.; Cobussen, H.L.; Mutnuru, R.K.; Idsert, P. van der [Nuclear Research and Consultancy Group, Westerduinweg 3, Postbus 25, 1755 ZG Petten (Netherlands); Zmitko, M. [The European Joint Undertaking for ITER and The Development of Fusion Energy, c/ Josep Pla, no. 2, Torres Diagonal Litoral, Edificio B3, 08019 Barcelona (Spain)
2013-11-15
In the HIDOBE (HIgh DOse irradiation of BEryllium) irradiation program, various grades of constrained and unconstrained beryllium pebbles, beryllium pellets and titanium-beryllide samples are irradiated in the High Flux Reactor (HFR) in Petten at four different temperatures (between 698 K and 1023 K) for 649 days [1]. The first of two HIDOBE irradiation experiments, HIDOBE-01, was completed after achieving a DEMO relevant helium production level of 3000 appm and the samples are retrieved for postirradiation examination (PIE). This work shows preliminary results of the out-of-pile tritium release analysis performed on different grades of irradiated beryllium pebbles (different in size). Relationships between irradiation temperature, tritium inventory and microstructural evolution have been observed by light microscopy and scanning electron microscopy.
Directory of Open Access Journals (Sweden)
Atos Prinz Falkenbach
2008-12-01
Full Text Available O presente estudo investiga os sentimentos e as experiências de pais e mães de crianças com deficiência. Surge das motivações em compreender o cotidiano dos pais e mães de crianças com deficiência integrante do Projeto de Psicomotricidade Relacional da UNIVATES. De corte qualitativo, trata-se de um estudo etnográfico. Os instrumentos utilizados para a coleta de informações são: entrevistas, diários de campo e análise documental. A temática aborda os seguintes aspectos teóricos: a relação primária, a relação do profissional da saúde e a relação social da criança com necessidades especiais. O processo de coleta de informações permitiu organizar as seguintes categorias: a sentimentos manifestos no nascimento de um filho com deficiência; b comportamento dos profissionais da área da saúde no ato de dar a notícia aos pais; c necessidades dos pais e mães na relação com os demais familiares e a sociedade e sentimentos e e necessidades envolvidas na perspectiva de educar uma criança com deficiência. Conclui-se que os pais e mães das crianças com necessidades especiais reavaliam seus conceitos iniciais, aprendem a valorizar as potencialidades da criança e requisitam contínuos reforços em suas estimas pessoais que os auxiliam no processo educativo de seus filhos.The present study aims at investigating the feelings and experiences of parents of children with disabilities. It was motivated by the idea of understanding the daily life of the parents of children that take part in the Relational Psychomotricity Project at UNIVATES. The protagonists of the study are the parents integrated in the project. The instruments used for data collection in this ethnographic qualitative study were interviews, field reports and analysis of documents. The study approached the following theoretical aspects: the primary relation, the medical relation and the social relation of the child with disability. The information is organized
Observation of an excess of νe, νe events in a beam dump experiment at 400 GeV
Directory of Open Access Journals (Sweden)
P. Alibran
1978-03-01
Full Text Available A beam dump experiment has been performed at CERN in Gargamelle using the neutrino facility to look for penetrating particles produced either directly in the beam interaction or by prompt decay of new particles. A total of 32 interactions with a visible energy greater than 10 GeV has been found, classified, aftercorrections, into 18 charged current νμ or νμ, 5.1 neutral current and 8.9 νe or νe charged current events. An excess of νe events remains after all subtractions from any established sources. Results are presented in terms of the product of the cross section and the leptonic decay branching ratio of the possible source.
E-learning in radiology: An Italian multicentre experience
Energy Technology Data Exchange (ETDEWEB)
Carriero, A., E-mail: profcarriero@virgilio.it [Istituto di Radiologia Diagnostica ed Interventistica, AOU Maggiore della Carità, Corso Mazzini 18, 28100 Novara (Italy); Bonomo, L., E-mail: lbonomo@rm.unicatt.it [Istituto di Radiologia, Università Cattolica del S.Cuore, Largo Gemelli 8, 00168 Roma (Italy); Calliada, F., E-mail: f.calliada@smatteo.pv.it [Istituto di Radiologia c/o IRCCS Policlinico San Matteo Ospedale Generale Regionale, Piazzale Golgi 27100, Pavia (Italy); Campioni, P., E-mail: paolo.campioni@unife.it [Dipartimento di Scienze Chirurgiche, Radiologiche e Anestesiologiche, Sezione di Diagnostica per Immagini, Università di Ferrara Corso della Giovecca No. 203, 44100, Ferrara (Italy); Colosimo, C., E-mail: colosimo@rm.unicatt.it [Istituto di Radiologia, Università Cattolica del S.Cuore, Largo Gemelli 8, 00168 Roma (Italy); Cotroneo, A., E-mail: ar.cotroneo@rad.unich.it [Istituto di Radiologia, Università degli Studi Di Chieti (Italy); Cova, M., E-mail: cova@gnbts.univ.trieste.it [UCO di Radiologia, Ospedale di Cattinara, Strada di Fiume 447, 34149 Trieste (Italy); Ettorre, G.C., E-mail: g.ettorre@unict.it [Dip. Materno-Infantile e Scienze Radiologiche, Az. Ospedaliero-Universitaria Policlinico, Via S. Sofia 86, 95123 Catania (Italy); Fugazzola, C., E-mail: carlo.fugazzola@uninsubria.it [Dipartimento di Radiologia Ospedale Di Circolo, Viale Borri, No. 57, 21100, Varese (Italy); Garlaschi, G., E-mail: giacomog@unige.it [Dipartimento di Medicina interna e Specialità mediche (DIMI) Via L.B. Alberti, 4, 16132 Genova (Italy); Macarini, L., E-mail: l.macarini@unifg.it [Radiologia Universitaria Ospedali Riuniti di Foggia, Viale Pinto, No. 1, 71100, Foggia (Italy); and others
2012-12-15
the band speed and technology of the Internet connection. Conclusions: Technological evolution is overcoming all barriers, and technology is also having a positive impact on the approach to teaching. Our multicentre teaching experience merits the following considerations: the quality of the teaching product was certified by the students’ judgements of its didactic content and the quality of reception; the economic cost of the teaching had a minimal impact on the post-graduate schools (€ 18 per lesson). In terms of breaking down national barriers, it is to be hoped that the coordination and integration of diagnostic imaging e-learning projects, with the participation of post-graduate schools in different European countries, can be developed not only in a spirit of “cultural sharing” and the exchange of teaching experiences.
E-learning in radiology: An Italian multicentre experience
International Nuclear Information System (INIS)
Carriero, A.; Bonomo, L.; Calliada, F.; Campioni, P.; Colosimo, C.; Cotroneo, A.; Cova, M.; Ettorre, G.C.; Fugazzola, C.; Garlaschi, G.; Macarini, L.
2012-01-01
the band speed and technology of the Internet connection. Conclusions: Technological evolution is overcoming all barriers, and technology is also having a positive impact on the approach to teaching. Our multicentre teaching experience merits the following considerations: the quality of the teaching product was certified by the students’ judgements of its didactic content and the quality of reception; the economic cost of the teaching had a minimal impact on the post-graduate schools (€ 18 per lesson). In terms of breaking down national barriers, it is to be hoped that the coordination and integration of diagnostic imaging e-learning projects, with the participation of post-graduate schools in different European countries, can be developed not only in a spirit of “cultural sharing” and the exchange of teaching experiences.
NCBI nr-aa BLAST: CBRC-PVAM-01-0838 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PVAM-01-0838 ref|YP_177982.1| PE-PGRS family protein [Mycobacterium tuberculosis... H37Rv] pir||D70807 hypothetical glycine-rich protein Rv3514 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55607.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177982.1 1e-108 30% ...
NCBI nr-aa BLAST: CBRC-VPAC-01-1582 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-VPAC-01-1582 ref|ZP_02949316.1| stage III sporulation protein AE [Clostridium ...butyricum 5521] ref|ZP_04528905.1| stage III sporulation protein AE [Clostridium butyricum E4 str. BoNT E BL...5262] gb|EDT75716.1| stage III sporulation protein AE [Clostridium butyricum 5521] gb|EEP54825.1| stage III sporulation