WorldWideScience

Sample records for romanska stenskulpturens marginaler

  1. Seroprevalence of Bovine Anaplasmosis Caused by Anaplasma Marginale in Malaysia

    OpenAIRE

    Pong, Samantha; Nik-Him, Nik-Ahmad I. I

    2012-01-01

    Anaplasmosis, also known as yellow fever, is an infectious parasitic disease of cattle caused by the protozoan Anaplasma marginale. Anaplasma marginale infects the erythrocytes and causes severe anaemia, weakness, loss of appetite, fever, depression, abortion, decreased milk production, constipation, jaundice and sometimes death. In Malaysia, data on A. marginale infection is still behind compared to other parasites such as nematodes. Anaplasmosis in livestock has received little attention in...

  2. Identification of Anaplasma marginale type IV secretion system effector proteins.

    Directory of Open Access Journals (Sweden)

    Svetlana Lockwood

    Full Text Available Anaplasma marginale, an obligate intracellular alphaproteobacterium in the order Rickettsiales, is a tick-borne pathogen and the leading cause of anaplasmosis in cattle worldwide. Complete genome sequencing of A. marginale revealed that it has a type IV secretion system (T4SS. The T4SS is one of seven known types of secretion systems utilized by bacteria, with the type III and IV secretion systems particularly prevalent among pathogenic Gram-negative bacteria. The T4SS is predicted to play an important role in the invasion and pathogenesis of A. marginale by translocating effector proteins across its membrane into eukaryotic target cells. However, T4SS effector proteins have not been identified and tested in the laboratory until now.By combining computational methods with phylogenetic analysis and sequence identity searches, we identified a subset of potential T4SS effectors in A. marginale strain St. Maries and chose six for laboratory testing. Four (AM185, AM470, AM705 [AnkA], and AM1141 of these six proteins were translocated in a T4SS-dependent manner using Legionella pneumophila as a reporter system.The algorithm employed to find T4SS effector proteins in A. marginale identified four such proteins that were verified by laboratory testing. L. pneumophila was shown to work as a model system for A. marginale and thus can be used as a screening tool for A. marginale effector proteins. The first T4SS effector proteins for A. marginale have been identified in this work.

  3. Effect of gamma irradiation on anaplasma marginale in bovines

    International Nuclear Information System (INIS)

    Romero, H.Q.; Fernandez, M.V.G. de; Meza, B.R.; Rodriguez, E.

    1981-01-01

    Because the costs of treatment of anaplasmosis are very high, it was considered of great usefulness to obtain the modification of the pathogenecity and the antigenecity of A. marginale by means of gamma radiation ( 60 Co) to obtain a vaccine. This would be reflected favorably in saving lives as well as to obviate losses of meat and dairy production and the elimination of the risks derived from the introduction of selected cattle into the tropics. The main purpose of this study was to determine the optimal modification of the pathogenecity of A. marginale in splenectomized calves and adult cows, among 4 different radiation doses. (author)

  4. Detection and Characterisation of Anaplasma marginale and A. centrale in South Africa

    Directory of Open Access Journals (Sweden)

    Paidashe Hove

    2018-03-01

    Full Text Available Bovine anaplasmosis is endemic in South Africa and it has a negative economic impact on cattle farming. An improved understanding of Anaplasma marginale and Anaplasma marginale variety centrale (A. centrale transmission, together with improved tools for pathogen detection and characterisation, are required to inform best management practices. Direct detection methods currently in use for A. marginale and A. centrale in South Africa are light microscopic examination of tissue and organ smears, conventional, nested, and quantitative real-time polymerase chain reaction (qPCR assays, and a reverse line blot hybridisation assay. Of these, qPCR is the most sensitive for detection of A. marginale and A. centrale in South Africa. Serological assays also feature in routine diagnostics, but cross-reactions prevent accurate species identification. Recently, genetic characterisation has confirmed that A. marginale and A. centrale are separate species. Diversity studies targeting Msp1a repeats for A. marginale and Msp1aS repeats for A. centrale have revealed high genetic variation and point to correspondingly high levels of variation in A. marginale outer membrane proteins (OMPs, which have been shown to be potential vaccine candidates in North American studies. Information on these OMPs is lacking for South African A. marginale strains and should be considered in future recombinant vaccine development studies, ultimately informing the development of regional or global vaccines.

  5. Arnaldo Saraiva y las literaturas marginales y marginalizadas

    Directory of Open Access Journals (Sweden)

    Carlos Nogueira

    2014-04-01

    Full Text Available This article focuses on Arnaldo Saraiva’s studies and teaching in the area of the socalled marginal or marginalized literatures of Portugal and Brazil, and on the unusually significant impact they have had on successive generations of teachers, cultural agents and literary scholars. RESUMEN: El presente trabajo versa sobre los estudios y la actividad docente de Arnaldo Saraiva en el área de las llamadas literaturas marginales o marginalizadas de Portugal y de Brasil, así como el impacto extrañamente significativo que aquellos han tenido en sucesivas generaciones de profesores, agentes culturales o estudiosos de la literatura.

  6. EL MISTICISMO de los espíritus marginales

    Directory of Open Access Journals (Sweden)

    JOSÉ JORGE DE CARVALHO

    2001-01-01

    Full Text Available EL ARTÍCULO OFRECE UNA VISIÓN PANORÁMICA DE LAS MANIFESTACIONES RELIGIOSAS brasileñas marginales con relación al cristianismo dominante, entre las cuales se destacan el espiritismo kardecista y las varias formas de religiones de origen africano, todas de tradición oral. Un punto común a esas expresiones religiosas es la experiencia del trance y la posesión, que busco teorizar con la idea de la apófasis radical. En la segunda mitad del ensayo presento una antología de textos sagrados afrobrasileños, los cuales comento en una perspectiva de simbología comparada. Ellos señalan la presencia de un misticismo análogo al de los místicos de las llamadas "grandes religiones" o "religiones del libro". Propongo, entonces, incluir esas tradiciones marginales como parte constitutiva de la experiencia religiosa de la humanidad como un todo.

  7. Prevalence of Anaplasma marginale in different tick species from Ngorongoro Crater, Tanzania.

    Science.gov (United States)

    Fyumagwa, Robert D; Simmler, Pascale; Meli, Marina L; Hoare, Richard; Hofmann-Lehmann, Regina; Lutz, Hans

    2009-04-06

    In 2001, Ngorongoro Crater was infested with high density of ticks on grassland, livestock and wildlife which was also associated with high mortality. Adult ticks were collected, identified, processed for nucleic acids extraction and a molecular analysis was performed to determine the range of tick species harboring Anaplasma marginale. The real-time PCR was used in the amplification of rickettsia DNA in tick pools (n=527) from 11 identified tick species. Six tick species were detected with A. marginale DNA including Amblyomma gemma, Rhipicephalus appendiculatus, R. compositus, R.decoloratus, R. praetextatus and R. pulchellus. The detection rate in each tick species was 3%, 0.7%, 2%, 13%, 1.8%, and 6.2%, respectively. Five of the positive tick species excluding R.decoloratus have previously not been described to transmit A. marginale. High diversity of tick species detected with A. marginale in Ngorongoro Crater is likely to increase a risk to susceptible animals of contracting the infection.

  8. Transplacental transmission of Anaplasma marginale in beef cattle chronically infected in southern Brazil

    Directory of Open Access Journals (Sweden)

    Hermann Eduardo Gonzalez Grau

    Full Text Available In this study, we have investigated the incidence of transplacental transmission of Anaplasma marginale in chronically infected cows with no history of acute anaplasmosis during gestation. In addition, we evaluated various techniques for detection of transplacental transmission ofA. marginale. Blood samples were collected from 30 cows at three different periods: at the time of artificial insemination, at gestational diagnosis, and after calving. Also, blood was collected from the newborn calves, including one sample before colostrum intake, and another three days after birth. A. marginale-specific antibodies were detected in 100% of the cows with an indirect fluorescent antibody test (IFAT, and in 97% of them, using an indirect enzyme-linked immunosorbent assay (ELISA. Also, we observed that all of the three-day-old newborn calves were seropositive by IFAT. According to polymerase chain reaction, 63.3% of the cows were carriers of A. marginale, as well as 6.7% of the newborn calves. This represented a transplacental transmission rate of 10.5%. Furthermore, a correlation of 93.3% was observed between the two serodiagnostic techniques, demonstrating that both ELISA and IFAT can be used in epidemiological surveys of A. marginale. These results confirm the occurrence of transplacental transmission of A. marginale in chronically infected cows and suggest the importance of this transmission route in areas of enzootic instability.

  9. Transmisión de Anaplasma marginale por garrapatas

    Directory of Open Access Journals (Sweden)

    Kelly A. Brayton

    2012-01-01

    Full Text Available Anaplasma marginale, patógeno de distribución mundial, es transmitido por garrapatas Ixódidas. Comprender su complejo desarrollo dentro de la garrapata vector, permitirá la predicción de brotes y ofrecerá oportunidades para controlar su transmisión. En este trabajo se revisa su ciclo básico de desarrollo junto con los estudios recientes acerca de las diferencias de transmisión entre cepas, que delinean aspectos de la interacción patógeno - vector. Bacterias, virus o protozoarios transmitidos por artrópodos causan enfermedades severas, tanto en humanos como en animales. Las enfermedades infecciosas transmitidas por garrapatas, entre las que incluimos a la Anaplasmosis (A. marginale, babesiosis (Babesia bigemina, B. bovis, B. divergens y Theileriosis (Theileria annulata, T. parva, se encuentran entre las más importantes en el ámbito mundial, con pérdidas cercanas a los siete mil millones de dólares anualmente; y, a pesar de su impacto, permanecen escasamente bajo control, basado primordialmente en la aplicación de acaricidas, para interrumpir su transmisión. La aparición de garrapatas resistentes a múltiples sustancias acaricidas, representa una amenaza en este tipo de control y, como resultado, hay un resurgimiento de la investigación para el desarrollo de nuevas estrategias para su control. Nuevas opciones para prevenir la transmisión de patógenos de animales por garrapatas, será el resultado de entender las interacciones garrapata patógeno; proceso que culmina con el desarrollo de la infección y transmisión exitosa. En todos los casos de patógenos transmitidos por garrapatas, el desarrollo de la infección se realiza coordinamente a los momentos de adhesión y alimentación del vector sobre el animal. Esto sucede por la interdependencia en la señalización entre el patógeno y el vector al alimentarse y, por ello, será susceptible de intervención.

  10. Anaplasma marginale infection in cattle from south-western Amazonia Infecção por Anaplasma marginale em bovinos na Amazônia Sul Ocidental, Brasil

    Directory of Open Access Journals (Sweden)

    Luciana Gatto Brito

    2010-03-01

    Full Text Available The present study provides the first epidemiological data regarding infection by Anaplasma marginale in cattle reared in south-western Brazilian Amazonia. One simple procedure was adapted for the extraction of DNA from blood clots collected in seven microregions of Rondônia State and two mesoregions of Acre State. PCR method was used to asses the frequency of A. marginale infections in 4 to12-month-old cattle. The cattle infection was investigated by polymerase chain reaction (PCR using the specific primer "msp5" for A. marginale. The DNA amplifications revealed that the mean frequency of A. marginale infection was 98.6% (1,627/1,650 in samples from Rondonia, and 92.87% (208/225 in samples from Acre. The high frequency of A. marginale infections in 4 to 12-month-old cattle indicate a situation of enzootic stability in the studied areas and are comparable to those detected by immunodiagnosis in different endemic regions in Brazil. The DNA extraction of clotted blood method described here can be used for epidemiological studies on anaplasmosis and other bovine hemoparasites.O presente estudo fornece os primeiros dados epidemiológicos relativos a infecção por Anaplasma marginale em bovinos criados na Amazônia Sul Ocidental brasileira. Foi adaptado um procedimento simples para a extração de DNA a partir de coágulos sanguíneos coletados em sete microrregiões do estado de Rondônia e duas mesoregiões do estado do Acre. A técnica da reação em cadeia da polimerase (PCR foi aplicada para avaliar a freqüência da infecção por A. marginale em bovinos com idade entre 4 e 12 meses. Após a extração do DNA de cada amostra, a infecção nos bovinos foi investigada pela amplificação do gene "msp5" de A. marginale. As técnicas de amplificação do DNA revelaram que a freqüência de infecção por A. marginale foi de 98,6% (1.627/1.650 nas amostras provenientes de Rondônia e de 92,87% (208/225 nas amostras do Acre. A alta freqüência da

  11. Gamma irradiation attenuation of Anaplasma Marginale and its possible use as vaccine against bovine anaplasmosis

    International Nuclear Information System (INIS)

    Castro Z, J.; Pupiales T, N.

    1986-01-01

    Bovine Anaplasmosis is one of the limiting in the cattle development at Colombia and others tropical countries. Bovine Anaplasmosis is an infectious disease caused by a microorganism called Anaplasma Marginale, it with invades the red globules producing erythrofagocitosis. In this job, were irradiated with different gamma beam intensity; microorganisms of Anaplasma Marginale, those which were used as innocuous. Animals of the groups (I,II,III) presented good protection against the disease; animals of the Group IV presented mild symptoms with subsequent recovery and strong symptoms

  12. Construcción de Distribuciones Multivariadas con Marginales Dependientes Usando Cópulas en R

    OpenAIRE

    Jaramillo-Elorza, M. C; Lozano, J. A

    2014-01-01

    Las cópulas se han convertido en una herramienta popular para la construcción de modelos multivariados en campos donde la dependencia multivariada es de gran interés. El propósito de este trabajo es presentar las cópulas tanto en su concepto teórico, como en su implementación en el software estadístico R y profundizar en la construcción de distribuciones multivariadas con marginales dependientes, usando la clase mvdc del paquete copula, la cual permite utilizar varias y diferentes marginales ...

  13. Anaplasma marginale attenuated by irradiation, its potential use as vaccine

    International Nuclear Information System (INIS)

    Gil, A.; Pupiales, N.; Castro, J.; Higuera, B.; Orrego, J.

    1986-01-01

    Five groups of 5 calves each were inoculated: group 1 (control) with 5 x 10 8 non-irradiated parasites (day 0) and group 2 with the same dose of irradiated (900 Gy) parasites on day 0. Both groups showed clinical signs of the infection, although group 2 was less severely affected. On day 41 group 3 was inoculated with blood (1 x 10 9 parasites) from an animal in group 2. These parasites were irradiated again (900 Gy) prior to inoculation. On day 59 group 4 was inoculated with blood (1 x 10 9 parasites) from the same animal in group 2. This inoculum was irradiated a second time (900 Gy) and the cells were washed and culture ''IN VITRO'' for 4 days prior to inoculation. Parasitaemia increased abruptly in group 3 (peak = 25%) concomitant with a sudden drop in hematocrit. Two animals died, the others required treatment. Group 4 had a transient and low parasitaemia (peak = 2%) and normal hematocrit values. On day 201 all animals including a new control (group 5) of 5 animals, were inoculated with 2 x 10 9 heterologous parasites. All 5 control animals reached 20% parasitaemia and averaged a -40% hematocrit decrease when treated. In contrast, the remaining animals had from -20% to normal hematocrit values and from 5.6% to non-detectable parasitaemias. All inoculated calves showed high antibody titers which increased once the parasitaemia was overcome, and after challenge. It appears that two (900 Gy) irradiations effectively attenuated A. marginale, conferring an active and long lasting protection. However, inoculum cells had to be washed and cultured to prevent hemolitic shock

  14. Knockout of an outer membrane protein operon of anaplasma marginale by transposon mutagenesis

    Science.gov (United States)

    Large amounts of data generated by genomics, transcriptomics and proteomics technologies have increased our understanding of the biology of Anaplasma marginale. However, these data have also led to new assumptions that require testing, ideally through classic genetic mutation. One example is the def...

  15. Detection of genetic diversity of Anaplasma marginale isolates in Minas Gerais, Brazil

    Czech Academy of Sciences Publication Activity Database

    Pohl, A.E.; Cabezas Cruz, Alejandro; Ribeiro, M.F.B.; Goncalves da Silvera, J.; Silaghi, C.; Pfister, K.; Friche Passos, L.M.

    2013-01-01

    Roč. 22, č. 1 (2013), s. 129-135 ISSN 1984-2961 Institutional support: RVO:60077344 Keywords : Anaplasma marginale * MSP1a * DNA sequencing * microsatellites * tandem repeats * Brazil Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.961, year: 2013

  16. Anaplasma phagocytophilum and Anaplasma marginale Elicit Different Gene Expression Responses in Cultured Tick Cells

    Directory of Open Access Journals (Sweden)

    Zorica Zivkovic

    2009-01-01

    Full Text Available The genus Anaplasma (Rickettsiales: Anaplasmataceae includes obligate tick-transmitted intracellular organisms, Anaplasma phagocytophilum and Anaplasma marginale that multiply in both vertebrate and tick host cells. Recently, we showed that A. marginale affects the expression of tick genes that are involved in tick survival and pathogen infection and multiplication. However, the gene expression profile in A. phagocytophilum-infected tick cells is currently poorly characterized. The objectives of this study were to characterize tick gene expression profile in Ixodes scapularis ticks and cultured ISE6 cells in response to infection with A. phagocypthilum and to compare tick gene expression responses in A. phagocytophilum- and A. marginale-infected tick cells by microarray and real-time RT-PCR analyses. The results of these studies demonstrated modulation of tick gene expression by A. phagocytophilum and provided evidence of different gene expression responses in tick cells infected with A. phagocytophilum and A. marginale. These differences in Anaplasma-tick interactions may reflect differences in pathogen life cycle in the tick cells.

  17. Anaplasma Marginale isolation from infected bovine erythrocytes or from its floating culture

    International Nuclear Information System (INIS)

    Canon Q, Y.

    1986-01-01

    Isolation of Anaplasma Marginale is of great importance because this is the cause of anaplasmosis in cattle. Anaplasmosis is a mortal disease and spreads easily. To isolate the anaplasm, four different experiments were developed; in the first experiment, the parasite was isolated from parasitic blood, by means of three methods; osmotic shock, sonic vibration and treatment with hemolisine. In the second experiment, the parasite source was the top of the bacteriologic culture of anaplasma marginale obtained by means of slow centrifugation. In the third experiment, it was used parasitic blood diluted in PBS and liquid nitrogen criopreserved. In the fourth experiment.it was used parasitic blood which was separated by means of sonic oscillation. This method was more adequate to free the parasite from the host cell. Differential centrifugation was the best method to separate parasite of the stroma and ghost cells

  18. Prevalence of Babesia spp. and Anaplasma marginale in cattle in the municipality of Palma, MG

    Directory of Open Access Journals (Sweden)

    Marluce Aparecida Mattos Paula

    2015-12-01

    Full Text Available ABSTRACT. Paula M.A.M., Oliveira F.C.R., Melo Jr O.A. & Frazão-Teixeira E. [Prevalence of Babesia spp. and Anaplasma marginale in cattle in the municipality of Palma, MG.] Prevalência de Babesia spp. e Anaplasma marginale em bovinos no município de Palma, MG. Revista Brasileira de Medicina Veterinária, 37(4: 359-365, 2015. Laboratório de Biologia Estrutural, Instituto Oswaldo Cruz/ Fiocruz, Avenida Brasil, 4365, Manguinhos, Rio de Janeiro, RJ 21040-361, Brasil. E-mail: edwards.teixeira@ioc.fiocruz.br We verified the prevalence of hemoparasites in 40 cattle with ages varying from one month to 12 years old, in two farms of the Municipality of Palma, Minas Gerais state, Brazil. Two blood smear samples were collected from each animal: one from the tail tip and another from the ear tip. The smears were fixed, stained and observed under 100X lighted microscope magnifying glass. Twenty- -seven out of 40 animals studied (67.5% had at least one species of hemoparasite. Among these, 21 (52.5% were infected with Babesia spp., 10 (25% with Anaplasma marginale and four (10% parasitized with both hemoparasites. The studied region is potentially enzootic for the detected parasites and there is high risk for clinical cases of tick-borne disease. Both anatomic points, tail and ear tips, are good spots for blood collection and smear confection for hemoparasite investigation.

  19. Antigenic variation of Anaplasma marginale msp2 occurs by combinatorial gene conversion.

    Science.gov (United States)

    Brayton, Kelly A; Palmer, Guy H; Lundgren, Anna; Yi, Jooyoung; Barbet, Anthony F

    2002-03-01

    The rickettsial pathogen Anaplasma marginale establishes lifelong persistent infection in the mammalian reservoir host, during which time immune escape variants continually arise in part because of variation in the expressed copy of the immunodominant outer membrane protein MSP2. A key question is how the small 1.2 Mb A. marginale genome generates sufficient variants to allow long-term persistence in an immunocompetent reservoir host. The recombination of whole pseudogenes into the single msp2 expression site has been previously identified as one method of generating variants, but is inadequate to generate the number of variants required for persistent infection. In the present study, we demonstrate that recombination of a whole pseudogene is followed by a second level of variation in which small segments of pseudogenes recombine into the expression site by gene conversion. Evidence for four short sequential changes in the hypervariable region of msp2 coupled with the identification of nine pseudogenes from a single strain of A. marginale provides for a combinatorial number of possible expressed MSP2 variants sufficient for lifelong persistence.

  20. Anaplasma marginale major surface protein 1a: a marker of strain diversity with implications for control of bovine anaplasmosis.

    Science.gov (United States)

    Cabezas-Cruz, Alejandro; de la Fuente, José

    2015-04-01

    Classification of bacteria is challenging due to the lack of a theory-based framework. In addition, the adaptation of bacteria to ecological niches often results in selection of strains with diverse virulence, pathogenicity and transmission characteristics. Bacterial strain diversity presents challenges for taxonomic classification, which in turn impacts the ability to develop accurate diagnostics and effective vaccines. Over the past decade, the worldwide diversity of Anaplasma marginale, an economically important tick-borne pathogen of cattle, has become apparent. The extent of A. marginale strain diversity, formerly underappreciated, has contributed to the challenges of classification which, in turn, likely impacts the design and development of improved vaccines. Notably, the A. marginale surface protein 1a (MSP1a) is a model molecule for these studies because it serves as a marker for strain identity, is both an adhesin necessary for infection of cells and an immuno-reactive protein and is also an indicator of the evolution of strain diversity. Herein, we discuss a molecular taxonomic approach for classification of A. marginale strain diversity. Taxonomic analysis of this important molecule provides the opportunity to understand A. marginale strain diversity as it relates geographic and ecological factors and to the development of effective vaccines for control of bovine anaplasmosis worldwide. Copyright © 2015 Elsevier GmbH. All rights reserved.

  1. Anaplasma marginale and Anaplasma phagocytophilum: Rickettsiales pathogens of veterinary and public health significance.

    Science.gov (United States)

    Atif, Farhan Ahmad

    2015-11-01

    Anaplasma marginale and Anaplasma phagocytophilum are the most important tick-borne bacteria of veterinary and public health significance in the family Anaplasmataceae. The objective of current review is to provide knowledge on ecology and epidemiology of A. phagocytophilum and compare major similarities and differences of A. marginale and A. phagocytophilum. Bovine anaplasmosis is globally distributed tick-borne disease of livestock with great economic importance in cattle industry. A. phagocytophilum, a cosmopolitan zoonotic tick transmitted pathogen of wide mammalian hosts. The infection in domestic animals is generally referred as tick-borne fever. Concurrent infections exist in ticks, domestic and wild animals in same geographic area. All age groups are susceptible, but the prevalence increases with age. Movement of susceptible domestic animals from tick free non-endemic regions to disease endemic regions is the major risk factor of bovine anaplasmosis and tick-borne fever. Recreational activities or any other high-risk tick exposure habits as well as blood transfusion are important risk factors of human granulocytic anaplasmosis. After infection, individuals remain life-long carriers. Clinical anaplasmosis is usually diagnosed upon examination of stained blood smears. Generally, detection of serum antibodies followed by molecular diagnosis is usually recommended. There are problems of sensitivity and cross-reactivity with both the Anaplasma species during serological tests. Tetracyclines are the drugs of choice for treatment and elimination of anaplasmosis in animals and humans. Universal vaccine is not available for either A. marginale or A. phagocytophilum, effective against geographically diverse strains. Major control measures for bovine anaplasmosis and tick-borne fever include rearing of tick-resistant breeds, endemic stability, breeding Anaplasma-free herds, identification of regional vectors, domestic/wild reservoirs and control, habitat modification

  2. La sexualidad en los jóvenes de sectores marginales. Un informe de avance

    OpenAIRE

    Aigneren Aburto, José Miguel

    2004-01-01

    La sexualidad en los jovenes de sectores marginales. El problema es la sexualidad de los adolescentes en un mundo de pobreza e inequidad. Este estudio tiene como objetivo general describir los crudos productos sexuales de la miseria y los mitos que envenenan a la juventud marginal. Es un intento de retratar a aquellos adolescentes que conocen el sexo en la escuela del submundo que esconden los cordones de extrema pobreza del Medellín de hoy. Los resultados citados corresponden a realidades co...

  3. El impuesto al valor agregado en los contratos de campos marginales

    OpenAIRE

    Niquinga Salazar, Oscar Javier

    2007-01-01

    Esta investigación dirigida por los métodos de investigación sistemático, exegético, y teleológico, pretende analizar los contratos petroleros de Campos Marginales utilizados por la legislación ecuatoriana y específicamente, el papel de Impuesto al Valor Agregado en la producción de la Curva Base; ésta, se convierte en una figura contractual innovadora que ha producido una interesante discusión a nivel nacional; sin embargo, la propuesta de este trabajo va encaminado a encontra...

  4. Immune responses in cattle vaccinated with gamma-irradiated Anaplasma marginale

    International Nuclear Information System (INIS)

    Sharma, S.P.; Bansal, G.C.

    1986-01-01

    The infectivity and immunogenecity of gamma-irradiated Anaplasma marginale organisms were studied in bovine calves. The severity of Anaplasma infection based on per cent infected red blood cells, haematological values and mortality was more in animals immunized with blood exposed to 60 kR in comparison to those inoculated with blood irradiated at 70, 80 and 90 kR. The immunizing controls demonstrated a significantly high parasitaemia, marked anaemia and more deaths. Marked and prolonged cell-mediated and humoral immune responses detectable in the first 3 weeks of post-immunization may be responsible for conferring of protective immunity. (author)

  5. Identification of a vertically transmitted strain from Anaplasma marginale (UFMG3): Molecular and phylogenetic characterization, and evaluation of virulence.

    Science.gov (United States)

    Silvestre, Bruna T; Silveira, Júlia A G; Meneses, Rodrigo M; Facury-Filho, Elias J; Carvalho, Antônio U; Ribeiro, Múcio F B

    2016-02-01

    Bovine anaplasmosis is a disease caused by the intraerythrocytic rickettsia species Anaplasma marginale and results in great economic losses in tropical and subtropical regions. Vertical transmission is an important phenomenon that contributes to the persistence of different strains of the agent within the same herd. The identification of new strains and genetic characterization studies are essential to understanding their epidemiology and virulence and for vaccine development. The aim of this study was to perform molecular and phylogenetic characterizations of a new vertically transmitted strain from A. marginale and to evaluate its virulence by experimental inoculation of rickettsia-free calves. Thirty newborn Holstein calves were subjected to molecular tests for the detection of A. marginale, Babesia bovis and Babesia bigemina. Calves positive for A. marginale (n=3) were splenectomized and monitored for the clinical manifestations of anaplasmosis. Blood samples from one of the calves that presented rickettsemia of 42.8% and spontaneous recovery of clinical parameters were used for molecular and phylogenetic characterization (msp1a gene), and inoculum production was used for the evaluation of virulence. This strain was identified as UFMG3. Three tandem repeat forms (13 and MGI19) were identified from the analysis of the msp1a gene, in which the form MGI19 appeared twice. Analysis of these repeats revealed the presence of the sequences QASTSS and SSASGQQQESS and of aspartic acid (D) at position 20 of both repeats. Phylogenetic analysis showed a close relationship among the UFMG3, MGI19 and UFMG2 strains. For virulence evaluation, six Holstein calves were inoculated intravenously with 2×10(7)A. marginale UFMG3-infected erythrocytes. The calves showed maximum rickettsemia of 5.1%, a moderate decrease in packed cell volume and spontaneous recovery of clinical parameters without the need for treatment. The results of experimental inoculation suggest that the strain A

  6. Insights into mechanisms of bacterial antigenic variation derived from the complete genome sequence of Anaplasma marginale.

    Science.gov (United States)

    Palmer, Guy H; Futse, James E; Knowles, Donald P; Brayton, Kelly A

    2006-10-01

    Persistence of Anaplasma spp. in the animal reservoir host is required for efficient tick-borne transmission of these pathogens to animals and humans. Using A. marginale infection of its natural reservoir host as a model, persistent infection has been shown to reflect sequential cycles in which antigenic variants emerge, replicate, and are controlled by the immune system. Variation in the immunodominant outer-membrane protein MSP2 is generated by a process of gene conversion, in which unique hypervariable region sequences (HVRs) located in pseudogenes are recombined into a single operon-linked msp2 expression site. Although organisms expressing whole HVRs derived from pseudogenes emerge early in infection, long-term persistent infection is dependent on the generation of complex mosaics in which segments from different HVRs recombine into the expression site. The resulting combinatorial diversity generates the number of variants both predicted and shown to emerge during persistence.

  7. Molecular detection and genetic diversity of bovine Babesia spp., Theileria orientalis, and Anaplasma marginale in beef cattle in Thailand.

    Science.gov (United States)

    Jirapattharasate, Charoonluk; Adjou Moumouni, Paul Franck; Cao, Shinuo; Iguchi, Aiko; Liu, Mingming; Wang, Guanbo; Zhou, Mo; Vudriko, Patrick; Efstratiou, Artemis; Changbunjong, Tanasak; Sungpradit, Sivapong; Ratanakorn, Parntep; Moonarmart, Walasinee; Sedwisai, Poonyapat; Weluwanarak, Thekhawet; Wongsawang, Witsanu; Suzuki, Hiroshi; Xuan, Xuenan

    2017-02-01

    Babesia spp., Theileria orientalis, and Anaplasma marginale are significant tick-borne pathogens that affect the health and productivity of cattle in tropical and subtropical areas. In this study, we used PCR to detect the presence of Babesia bovis, Babesia bigemina, and T. orientalis in 279 beef cattle from Western Thailand and A. marginale in 608 beef cattle from the north, northeastern, and western regions. The PCRs were performed using species-specific primers based on the B. bovis spherical body protein 2 (BboSBP2), B. bigemina rhoptry-associated protein 1a (BbiRAP-1a), T. orientalis major piroplasm surface protein (ToMPSP), and A. marginale major surface protein 4 (AmMSP4) genes. To determine the genetic diversity of the above parasites, amplicons of B. bovis and B. bigemina ITS1-5.8s rRNA gene-ITS2 regions (B. bovis ITS, B. bigemina ITS), ToMPSP, and AmMSP4 genes were sequenced for phylogenetic analysis. PCR results revealed that the prevalence of B. bovis, B. bigemina, T. orientalis, and A. marginale in the Western region was 11.1, 12.5, 7.8, and 39.1 %, respectively. Coinfections of two or three parasites were observed in 17.9 % of the animals sampled. The study revealed that the prevalence of A. marginale in the western region was higher than in the north and northeastern regions (7 %). Sequence analysis showed the BboSBP2 gene to be more conserved than B. bovis ITS in the different isolates and, similarly, the BbiRAP-1a was more conserved than B. bigemina ITS. In the phylogenetic analysis, T. orientalis MPSP sequences were classified into types 3, 5, and 7 as previously reported. A. marginale MSP4 gene sequences shared high identity and similarity with each other and clustered with isolates from other countries. This study provides information on the prevalence and genetic diversity of tick-borne pathogens in beef cattle and highlights the need for effective strategies to control these pathogens in Thailand.

  8. Molecular identification of Anaplasma marginale in two autochthonous South American wild species revealed an identical new genotype and its phylogenetic relationship with those of bovines.

    Science.gov (United States)

    Guillemi, Eliana C; de la Fourniere, Sofía; Orozco, Marcela; Peña Martinez, Jorge; Correa, Elena; Fernandez, Javier; Lopez Arias, Ludmila; Paoletta, Martina; Corona, Belkis; Pinarello, Valérie; Wilkowsky, Silvina E; Farber, Marisa D

    2016-05-26

    Anaplasma marginale is a well-known cattle pathogen of tropical and subtropical world regions. Even though, this obligate intracellular bacterium has been reported in other host species different than bovine, it has never been documented in Myrmecophaga tridactyla (giant anteater) or Hippocamelus antisense (taruca), which are two native endangered species. Samples from two sick wild animals: a Myrmecophaga tridactyla (blood) and a Hippocamelus antisense (blood and serum) were studied for the presence of A. marginale DNA through msp5 gene fragment amplification. Further characterization was done through MSP1a tandem repeats analysis and MLST scheme and the genetic relationship among previously characterized A. marginale sequences were studied by applying, eBURST algorithm and AMOVA analysis. Anaplasma marginale DNA was identified in the Myrmecophaga tridactyla and Hippocamelus antisense samples. Through molecular markers, we identified an identical genotype in both animals that was not previously reported in bovine host. The analysis through eBURST and AMOVA revealed no differentiation between the taruca/anteater isolate and the bovine group. In the present publication we report the identification of A. marginale DNA in a novel ruminant (Hippocamelus antisense) and non-ruminant (Myrmecophaga tridactyla) host species. Genotyping analysis of isolates demonstrated the close relatedness of the new isolate with the circulation population of A. marginale in livestock. Further analysis is needed to understand whether these two hosts contribute to the anaplasmosis epidemiology.

  9. Molecular detection and characterization of Babesia bovis, Babesia bigemina, Theileria species and Anaplasma marginale isolated from cattle in Kenya.

    Science.gov (United States)

    Adjou Moumouni, Paul Franck; Aboge, Gabriel Oluga; Terkawi, Mohamad Alaa; Masatani, Tatsunori; Cao, Shinuo; Kamyingkird, Ketsarin; Jirapattharasate, Charoonluk; Zhou, Mo; Wang, Guanbo; Liu, Mingming; Iguchi, Aiko; Vudriko, Patrick; Ybanez, Adrian Patalinghug; Inokuma, Hisashi; Shirafuji-Umemiya, Rika; Suzuki, Hiroshi; Xuan, Xuenan

    2015-09-30

    Infections with Babesia bovis, Babesia bigemina, Theileria species and Anaplasma marginale are endemic in Kenya yet there is a lack of adequate information on their genotypes. This study established the genetic diversities of the above tick-borne hemoparasites infecting cattle in Kenya. Nested PCR and sequencing were used to determine the prevalence and genetic diversity of the above parasites in 192 cattle blood samples collected from Ngong and Machakos farms. B. bovis spherical body protein 4, B. bigemina rhoptry-associated protein 1a, A. marginale major surface protein 5, Theileria spp. 18S rRNA, T. parva p104 and T. orientalis major piroplasm surface protein were used as the marker genes. B. bovis, B. bigemina, T. parva, T. velifera, T. taurotragi, T. mutans and A. marginale were prevalent in both farms, whereas T. ovis, Theileria sp. (buffalo) and T. orientalis were found only in Ngong farm. Co-infections were observed in more than 50 % of positive samples in both farms. Babesia parasites and A. marginale sequences were highly conserved while T. parva and T. orientalis were polymorphic. Cattle-derived T. parva was detected in Machakos farm. However, cattle and buffalo-derived Theileria were detected in Ngong farm suggesting interactions between cattle and wild buffaloes. Generally, the pathogens detected in Kenya were genetically related to the other African isolates but different from the isolates in other continents. The current findings reaffirm the endemicity and co-infection of cattle with tick-borne hemoparasites, and the role of wildlife in pathogens transmission and population genetics in Kenya.

  10. Subdominant Outer Membrane Antigens in Anaplasma marginale: Conservation, Antigenicity, and Protective Capacity Using Recombinant Protein.

    Directory of Open Access Journals (Sweden)

    Deirdre R Ducken

    Full Text Available Anaplasma marginale is a tick-borne rickettsial pathogen of cattle with a worldwide distribution. Currently a safe and efficacious vaccine is unavailable. Outer membrane protein (OMP extracts or a defined surface protein complex reproducibly induce protective immunity. However, there are several knowledge gaps limiting progress in vaccine development. First, are these OMPs conserved among the diversity of A. marginale strains circulating in endemic regions? Second, are the most highly conserved outer membrane proteins in the immunogens recognized by immunized and protected animals? Lastly, can this subset of OMPs recognized by antibody from protected vaccinates and conserved among strains recapitulate the protection of outer membrane vaccines? To address the first goal, genes encoding OMPs AM202, AM368, AM854, AM936, AM1041, and AM1096, major subdominant components of the outer membrane, were cloned and sequenced from geographically diverse strains and isolates. AM202, AM936, AM854, and AM1096 share 99.9 to 100% amino acid identity. AM1041 has 97.1 to 100% and AM368 has 98.3 to 99.9% amino acid identity. While all four of the most highly conserved OMPs were recognized by IgG from animals immunized with outer membranes, linked surface protein complexes, or unlinked surface protein complexes and shown to be protected from challenge, the highest titers and consistent recognition among vaccinates were to AM854 and AM936. Consequently, animals were immunized with recombinant AM854 and AM936 and challenged. Recombinant vaccinates and purified outer membrane vaccinates had similar IgG and IgG2 responses to both proteins. However, the recombinant vaccinates developed higher bacteremia after challenge as compared to adjuvant-only controls and outer membrane vaccinates. These results provide the first evidence that vaccination with specific antigens may exacerbate disease. Progressing from the protective capacity of outer membrane formulations to

  11. Genetic characterization of Anaplasma marginale strains from Tunisia using single and multiple gene typing reveals novel variants with an extensive genetic diversity.

    Science.gov (United States)

    Ben Said, Mourad; Ben Asker, Alaa; Belkahia, Hanène; Ghribi, Raoua; Selmi, Rachid; Messadi, Lilia

    2018-05-12

    Anaplasma marginale, which is responsible for bovine anaplasmosis in tropical and subtropical regions, is a tick-borne obligatory intraerythrocytic bacterium of cattle and wild ruminants. In Tunisia, information about the genetic diversity and the phylogeny of A. marginale strains are limited to the msp4 gene analysis. The purpose of this study is to investigate A. marginale isolates infecting 16 cattle located in different bioclimatic areas of northern Tunisia with single gene analysis and multilocus sequence typing methods on the basis of seven partial genes (dnaA, ftsZ, groEL, lipA, secY, recA and sucB). The single gene analysis confirmed the presence of different and novel heterogenic A. marginale strains infecting cattle from the north of Tunisia. The concatenated sequence analysis showed a phylogeographical resolution at the global level and that most of the Tunisian sequence types (STs) formed a separate cluster from a South African isolate and from all New World isolates and strains. By combining the characteristics of each single locus with those of the multi-loci scheme, these results provide a more detailed understanding on the diversity and the evolution of Tunisian A. marginale strains. Copyright © 2018 Elsevier GmbH. All rights reserved.

  12. Comparação entre diversos antígenos para o diagnóstico de Anaplasma marginale por ELISA Comparison between several antigens for diagnosis of Anaplasma marginale by ELISA

    Directory of Open Access Journals (Sweden)

    Carlos A.N. Ramos

    2010-01-01

    Full Text Available Anaplasmose bovina é uma doença com grande importância nas regiões tropicais e subtropicais do mundo por determinar perdas econômicas devido à mortalidade e redução da produtividade. É causada por Anaplasma marginale, uma riquétsia intraeritrocítica obrigatória cujo controle requer, além de uma vacina eficiente, uma acurada identificação de bovinos cronicamente infectados. Apesar de existirem atualmente diversos métodos de diagnóstico dessa riquétsia, os métodos sorológicos, em particular o ensaio de imunoadsorção enzimática-ELISAs, são os mais utilizados devido à sua versatilidade e praticidade. No entanto, devido ao grande número de antígenos disponíveis, atualmente torna-se necessária uma avaliação para definir quais antígenos apresentam um melhor desempenho no diagnóstico da anaplasmose. Soros de bovinos positivos e negativos para A. marginale por PCR, e soros de animais provenientes do Brasil e Costa Rica, foram testados em ELISAs baseados em MSP1a, MSP2 e MSP5 recombinantes, um pool das três proteínas recombinantes, e antígeno de lisado de corpúsculos iniciais da riquétsia (CI. Utilizando soro de bovinos positivos para A. marginale por PCR, uma maior sensibilidade foi observada no ELISA CI. No entanto, uma maior especificidade, com soro de bovinos negativos a PCR, foi observada com os ELISAs recombinantes. O porcentual de bovinos positivos do Brasil e Costa Rica foi maior com ELISA CI. Razões para essas diferenças são discutidas.Bovine anaplasmosis is a major disease in tropical and subtropical regions of the world by determine economical loss due mortality and productive reduction. The disease is caused by Anaplasma marginale, an intraerythrocytic rickettsia whose control requires, besides an efficient vaccine, the accurate identification of chronically infected cattle. Although the existence of diverse methods of diagnosis of this rickettsia, the serological methods, in particular the enzyme

  13. Incidencia de los Hábitos Alimenticios en los Niveles de Rendimiento Académico Escolar en las Instituciones Educativas Secundarias Urbano Marginales de Juliaca

    OpenAIRE

    Aguilar Roque, Gaylee Yemira

    2015-01-01

    El presente trabajo de investigación denominado “INCIDENCIA DE LOS HÁBITOS ALIMENTICIOS EN LOS NIVELES DE RENDIMIENTO ACADÉMICO ESCOLAR EN LAS INSTITUCIONES EDUCATIVAS SECUNDARIAS URBANO - MARGINALES DE JULIACA”, cuyo objetivo general es establecer la importancia del consumo de cereales andinos y productos procesados en los niveles de rendimiento académico de los estudiantes de las I.E.S. de las zonas urbano – marginales de la ciudad de Juliaca. Este estudio nos permite establec...

  14. Immune response of calves inoculated with proteins ofAnaplasma marginale bound to an immunostimulant complex

    Directory of Open Access Journals (Sweden)

    Marcela Ribeiro Gasparini

    Full Text Available Despite our current knowledge of the immunology, pathology, and genetics of Anaplasma marginale, prevention in cattle is currently based on old standbys, including live attenuated vaccines, antibiotic treatment, and maintaining enzootic stability in cattle herds. In the present study, we evaluated the use of an immunostimulant complex (ISCOMATRIX adjuvant, associated with a pool of recombinant major surface proteins (rMSP1a, rMSP1b, rMSP4 and rMSP5 to improve the humoral immune response triggered in calves mainly by IgG2. Ten calves were divided in three groups: 4 calves were inoculated with the ISCOMATRIX/rMSPs (G1; 2 calves were inoculated with ISCOMATRIX adjuvant (G2; and 4 calves received saline (G3. Three inoculations were administered at 21-day intervals. In G1, the calves showed significant increases in total IgG, IgG1 and IgG2 levels 21 days after the second inoculation, compared to the control group (p < 0.05, and G1 calves remained above the cut-off value 28 days after the third inoculation (p < 0.05. The post-immunized sera from calves in G1 reacted specifically for each of the rMSPs used. In conclusion, the ISCOMATRIX/rMSPs induced antigen-specific seroconversion in calves. Therefore, additional testing to explore the protection induced by rMSPs, both alone and in conjunction with proteins previously identified as subdominant epitopes, is warranted.

  15. REDES COMUNITARIAS: UN DESAFÍO PARA ESCUELAS URBANO-MARGINALES

    Directory of Open Access Journals (Sweden)

    Mirta Giacobbe Tovani

    2009-01-01

    Full Text Available Las ideas básicas de este trabajo son conocer y comprender el entramado de la red de relaciones entre los distintos actores de las instituciones: escuela y organismos de la comunidad y su incidencia en la calidad educativa / calidad de vida. Analizamos la visión de los distintos actores educativos acerca de la inserción de la escuela en la comunidad. Tomamos como punto de partida el análisis de las relaciones entre calidad educativa y calidad de vida, en poblaciones urbano-marginales. Realizamos en primer lugar una investigación exploratoria, para conocer las características generales de escuelas que reciben población marginal. En una segunda etapa seleccionamos cuatro escuelas, que tomamos como casos e indagamos sus problemáticas. En ellas observamos gran dificultad para la construcción de redes comunitarias desde la institución escolar. Si bien responden a los problemas puntuales, mediante cambios o innovaciones planificados dinámica y flexiblemente, no existen soluciones duraderas debido a la falta de una convocatoria que comprometa a todas las instituciones de la comunidad constituyendo una efectiva relación en red. Estos resultados alcanzados en la investigación son producto de la triangulación de los datos estadísticos, documentales e históricos así como de los procedentes de la observación participante y de la información de las entrevistas en profundidad.

  16. Violencia basada en género en zonas urbanas y urbano-marginales de Lima y Callao, 2007 - 2010

    Directory of Open Access Journals (Sweden)

    Pedro Mascaro-Sánchez

    2012-04-01

    Full Text Available Objetivos: Determinar y comparar las características de la violencia en pobladores de zonas urbanas y urbano-marginales. Diseño: Estudio epidemiológico descriptivo. Institución: Escuela de Obstetricia, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Participantes: Mujeres de Lima y Callao. Intervenciones: Entre los años 2007 y 2010, se aplicó una entrevista estructurada a 3 971 mujeres de zonas urbanas y urbano-marginales de Lima y Callao. Se incluyó mujeres residentes de la zona, excluyéndose aquellas con problemas psicológicos evidentes y problemas del habla. Los datos fueron analizados con estadísticas descriptivas y con el estadístico chi cuadrado, significativo a un nivel p<0,05. Principales medidas de resultados: Violencia física. Resultados: De las entrevistadas, 39% tenía entre 20 y 24 años de edad. El 47% identificó violencia física, siendo similar en zonas urbanas y urbano-marginales. Los empujones y bofetadas fueron la forma más frecuente de violencia en ambas áreas. Con respecto al estudio de la violencia psicológica, fueron más frecuentes la utilización de gritos y celos por posesividad, también en ambas áreas. El gasto de la pareja sin la consulta fue ligeramente mayor para el área urbano marginal (49% que para el área urbana (42%. El intento de tener relaciones sexuales contra su voluntad fue el tipo de violencia más frecuente (37%, más en el área urbana (41% que en el área urbano marginal (34%. Conclusiones: Se evidenció episodios de violencia física, psicológica, económica y sexual similares para el área urbana y el área urbano-marginal, siendo la violencia sexual más frecuente en el área urbana.

  17. Análisis de la dinámica relacional generada por las websites de Internet en el desarrollo de los turismos marginales

    Directory of Open Access Journals (Sweden)

    José Mª Prat

    2012-01-01

    Full Text Available El conocimiento de los actores turísticos del territorio, y de sus relaciones, es un elemento básico para la gestión activa de cualquier destino turístico. Como que, gracias a las nuevas tecnologías de la información y a la popularizacióndel uso de Internet, se han creado una gran cantidad de relaciones sociales gracias a las websites, interrelacionadas, que han permitido una rápida y amplia difusión promocional de aquellos destinos que ofrecen unas alternativas turísticas más marginales, como respuesta a los nuevos planteamientos post-fordistas del turismo, generándose una dinámica relacional que se ha beneficiado del rápido desarrollo de las TIC's. En este trabajo se han analizado dichas relaciones entre websites, en el caso del desarrollo de dos turismos marginales, el naturista y el swinger, en Cap d'Agde, en el sur de Francia, comprobándose la existencia de una relación directa entre la dinámica relacional del territorio y elgrado de desarrollo de los turismos marginales.

  18. Nanoparticle-Based Delivery of Anaplasma marginale Membrane Proteins; VirB9-1 and VirB10 Produced in the Pichia pastoris Expression System.

    Science.gov (United States)

    Zhang, Bing; Cavallaro, Antonio S; Mody, Karishma T; Zhang, Jun; Deringer, James R; Brown, Wendy C; Mahony, Timothy J; Yu, Chengzhong; Mitter, Neena

    2016-11-05

    Bovine anaplasmosis or cattle-tick fever is a tick-borne haemolytic disease caused by the rickettsial haemoparasite Anaplasma marginale in tropical and subtropical areas of the world. While difficult to express, the proteins VirB9-1 and VirB10 are immunogenic components of the outer membrane type IV secretion system that have been identified as candidate antigens for vaccines targeting of A. marginale . Soluble VirB9-1 and VirB10 were successfully expressed using Pichia pastoris . When formulated with the self-adjuvanting silica vesicles, SV-100 (diameter: 50 nm, and pore entrance size: 6 nm), 200 µg of VirB9-1 and VirB10 were adsorbed per milligram of nanoparticle. The VirB9-1 and VirB10, SV-100 formulations were shown to induce higher antibody responses in mice compared to the QuilA formulations. Moreover, intracellular staining of selected cytokines demonstrated that both VirB9-1 and VirB10 formulations induced cell-mediated immune responses in mice. Importantly, the SV-100 VirB9-1 and VirB10 complexes were shown to specifically stimulate bovine T-cell linages derived from calves immunised with A. marginale outer membrane fractions, suggesting formulations will be useful for bovine immunisation and protection studies. Overall this study demonstrates the potential of self-adjuvanting silica vesicle formulations to address current deficiencies in vaccine delivery applications.

  19. Usos marginales de los marcadores del discurso. Su efecto en la comprensión lectora en español como lengua extranjera

    Directory of Open Access Journals (Sweden)

    María Fernanda Pelayo

    2003-04-01

    Full Text Available En este trabajo abordamos lo que hemos denominado usos marginales de los marcadores del discurso y cómo afectan a la comprensión lectora en español como lengua extranjera. Tras un análisis y definición de estos usos no ortodoxos de los marcadores del discurso, realizamos una clasificación preliminar de los mismos. Finalmente, diseñamos y llevamos a cabo un estudio empírico acerca de la manera en que los usos marginales de los marcadores del discurso podrían afectar a la comprensión lectora de textos en español como lengua extranjera. Losresultados obtenidos en este estudio experimental muestran que existe una tendencia bastante generalizada que nos hace aventurarnos a concluir que efectivamente los lectores de español como lengua extranjera muestran tenerproblemas para comprender textos en los que se han empleado usos marginales de los marcadores del discurso. Por otra parte, el uso ortodoxo de los marcadores del discurso parece favorecer la comprensión adecuada del texto.

  20. Uso de inóculo padronizado de Anaplasma marginale e da quimioprofilaxia no controle da anaplasmose bovina

    Directory of Open Access Journals (Sweden)

    Ribeiro M.F.B.

    2003-01-01

    Full Text Available O uso de inóculo homólogo padronizado de Anaplasma marginale foi comparado à prática de quimioprofilaxia com diidrato de oxitetraciclina na redução da riquetsemia e do volume globular (VG causada pela anaplasmose bovina. Os animais que receberam o inóculo (10(7 hemácias com Anaplasma marginaleapresentaram, ao serem desafiados em campo, riquetsemia média de 1,2% e redução média de VG de 23,0%, significativamente inferiores às do grupo-controle (P<0,05. No experimento de quimioprofilaxia os animais que receberam três doses de diidrato de oxitetraciclina (20mg/kg, com intervalos de 25 dias, apresentaram riquetsemia de 2,7% e redução de 36,3% no VG, significativamente inferiores às do grupo-controle (P<0,05. Ambas as medidas preventivas testadas foram eficientes na redução da intensidade da riquetsemia e na queda do VG.

  1. Nanoparticle-Based Delivery of Anaplasma marginale Membrane Proteins; VirB9-1 and VirB10 Produced in the Pichia pastoris Expression System

    Directory of Open Access Journals (Sweden)

    Bing Zhang

    2016-11-01

    Full Text Available Bovine anaplasmosis or cattle-tick fever is a tick-borne haemolytic disease caused by the rickettsial haemoparasite Anaplasma marginale in tropical and subtropical areas of the world. While difficult to express, the proteins VirB9-1 and VirB10 are immunogenic components of the outer membrane type IV secretion system that have been identified as candidate antigens for vaccines targeting of A. marginale. Soluble VirB9-1 and VirB10 were successfully expressed using Pichia pastoris. When formulated with the self-adjuvanting silica vesicles, SV-100 (diameter: 50 nm, and pore entrance size: 6 nm, 200 µg of VirB9-1 and VirB10 were adsorbed per milligram of nanoparticle. The VirB9-1 and VirB10, SV-100 formulations were shown to induce higher antibody responses in mice compared to the QuilA formulations. Moreover, intracellular staining of selected cytokines demonstrated that both VirB9-1 and VirB10 formulations induced cell-mediated immune responses in mice. Importantly, the SV-100 VirB9-1 and VirB10 complexes were shown to specifically stimulate bovine T-cell linages derived from calves immunised with A. marginale outer membrane fractions, suggesting formulations will be useful for bovine immunisation and protection studies. Overall this study demonstrates the potential of self-adjuvanting silica vesicle formulations to address current deficiencies in vaccine delivery applications.

  2. Epitope-based vaccines with the Anaplasma marginale MSP1a functional motif induce a balanced humoral and cellular immune response in mice.

    Directory of Open Access Journals (Sweden)

    Paula S Santos

    Full Text Available Bovine anaplasmosis is a hemoparasitic disease that causes considerable economic loss to the dairy and beef industries. Cattle immunized with the Anaplasma marginale MSP1 outer membrane protein complex presents a protective humoral immune response; however, its efficacy is variable. Immunodominant epitopes seem to be a key-limiting factor for the adaptive immunity. We have successfully demonstrated that critical motifs of the MSP1a functional epitope are essential for antibody recognition of infected animal sera, but its protective immunity is yet to be tested. We have evaluated two synthetic vaccine formulations against A. marginale, using epitope-based approach in mice. Mice infection with bovine anaplasmosis was demonstrated by qPCR analysis of erythrocytes after 15-day exposure. A proof-of-concept was obtained in this murine model, in which peptides conjugated to bovine serum albumin were used for immunization in three 15-day intervals by intraperitoneal injections before challenging with live bacteria. Blood samples were analyzed for the presence of specific IgG2a and IgG1 antibodies, as well as for the rickettsemia analysis. A panel containing the cytokines' transcriptional profile for innate and adaptive immune responses was carried out through qPCR. Immunized BALB/c mice challenged with A. marginale presented stable body weight, reduced number of infected erythrocytes, and no mortality; and among control groups mortality rates ranged from 15% to 29%. Additionally, vaccines have significantly induced higher IgG2a than IgG1 response, followed by increased expression of pro-inflammatory cytokines. This is a successful demonstration of epitope-based vaccines, and protection against anaplasmosis may be associated with elicitation of effector functions of humoral and cellular immune responses in murine model.

  3. Immune response and biochemistry of calves immunized with rMSP1a ( Anaplasma marginale using carbon nanotubes as carrier molecules

    Directory of Open Access Journals (Sweden)

    Bruna Torres Silvestre

    2018-05-01

    Full Text Available Abstract Vaccination against Anaplasma marginale has been considered an important control strategy for bovine anaplasmosis. Recently, mice immunized with rMSP1 a linked to carbon nanotubes (MWNT showed significant immune responses, generating a new possibility for use of an inactivated vaccine. The objective of this study was to investigate the cellular and humoral responses in calves immunized with MWNT+rMSP1a , associated with inactivated vaccine of A. marginale produced in vitro, and evaluate the toxic effects of the MWNT on renal and hepatic function. rMSP1a was covalently linked to MWNT. Inactivated vaccine (AmUFMG2 was produced by cultivating A. marginale in IDE8 cells. Twenty-four Holstein calves were divided (four groups and immunized subcutaneously with PBS and non-carboxylated MWNT (control, G1, AmUFMG2 (G2, MWNT+rMSP1a (G3, and AmUFMG2 with MWNT+rMSP1a (G4. Blood samples were collected for total leukocyte counts, biochemical profiling and evaluation of the cellular and humoral response. Immunization with MWNT+rMSP1a induced increase in the total number of leukocytes, NK cells, in the lymphocyte populations and higher levels of antibodies compared to calves immunized only with AmUFMG2. Furthermore, MWNT did not induce changes in the biochemical profile. These data indicate that MWNT+rMSP1a were able to induce the immune responses more efficiently than AmUFMG2 alone, without generating toxicity.

  4. Deficiencia de Vitamina A y Estado Nutricional Antropométrico en niños MarginalesUrbanos y Rurales en el Estado Zulia, Venezuela

    OpenAIRE

    Amaya-Castellanos, Daisy; Viloria-Castejón, Haydée; Ortega, Pablo; Gómez, Gisela; Urrieta, Jesús R; Lobo, Pablo; Estévez, Jesús

    2002-01-01

    El presente estudio transversal fue realizado para estimar la prevalencia de deficiencia de vitamina A (DVA) y desnutrición proteico-energética en una población infantil (24 a 85 meses) de tres barrios marginales urbanos de Maracaibo Estado Zulia, Venezuela (n=173) y de una zona rural (n=34), vecina a Maracaibo, por medio del análisis del retinol sérico y mediciones antropométricas, aplicando puntuación Z a los indicadores Talla//Edad (ZT//E); Peso//Edad (ZP//E) y Peso//Talla (ZP//T), compara...

  5. Eficácia do dipropionato de imidocarb, da enrofloxacina e do cloridrato de oxitetraciclina no tratamento de bovinos naturalmente infectados por Anaplasma marginale

    Directory of Open Access Journals (Sweden)

    L.R. Alberton

    2015-08-01

    Full Text Available O agente de maior importância, em relação à anaplasmose bovina, é o Anaplasma marginale. Os principais sinais clínicos dessa enfermidade são anemia hemolítica, icterícia, dispneia, taquicardia, febre, fadiga, lacrimejamento, sialorreia, micção frequente, anorexia, perda de peso, aborto e morte. A terapia antimicrobiana é o principal protocolo terapêutico. O objetivo do presente trabalho foi avaliar a eficácia do dipropionato de imidocarb, da enrofloxacina e do cloridrato de oxitetraciclina no tratamento de bovinos leiteiros naturalmente infectados por Anaplasma marginale. Para isso, foram avaliados 48 zebuínos mestiços que apresentavam os sinais clínicos sugestivos da doença. Os animais foram submetidos à coleta de sangue para a realização de hemograma e à extração de DNA para a confirmação da presença de A. marginale, por meio da reação em cadeia pela polimerase (PCR. Os animais foram divididos em três grupos experimentais, para realização dos protocolos terapêuticos, utilizando-se dipropionato de imidocarb, oxitetraciclina e enrofloxacina. Trinta e seis animais (75% apresentaram reação positiva ao PCR. Os animais positivos não apresentaram diferenças significativas quanto ao hemograma e ao leucograma quando comparados com os negativos, no entanto os níveis de proteínas séricas foram inferiores nos animais positivos (P<0,05. Os três protocolos terapêuticos foram capazes de reduzir a infecção ao longo do tratamento (P<0,01, porém, após cinco dias de tratamento, a enrofloxacina apresentou maior efetividade em relação aos demais (P<0,01. Após o final do tratamento, nenhum protocolo foi capaz de eliminar totalmente a infecção pelo A. marginale em bovinos naturalmente infectados e manejados a campo.

  6. Prevalencia y detección por PCR anidada de Anaplasma marginale en bovinos y garrapatas en la zona central del Litoral ecuatoriano

    Directory of Open Access Journals (Sweden)

    Ariel Escobar Troya

    2015-09-01

    Full Text Available La bacteria que provoca la anaplasmosis en bovinos se conoce como Anaplasma marginale, es potencialmente transmitida de forma biológica por garrapatas, moscas y fómites o mediante sangre infectada como consecuencia del uso incorrecto de herramientas quirúrgicas. Hasta la fecha, Ecuador carece de estudios actualizados sobre procedimientos eficientes para el diagnóstico específico y, erradicación de A. marginale a través del control de estos insectos, por lo que resulta de gran importancia desarrollar e implementar trabajos relacionados con el uso de esta herramienta molecular, para la detección de la bacteria en vectores de transmisión que provocan la enfermedad en bovinos. En este trabajo, se extrajo ADN eficazmente con el método de Salting Out. Un total de 255 muestras fueron analizadas por PCR anidada, distribuidas del siguiente modo|108| Riphicephalus (Boophilus microplus, |85| bovinos, de estos el 13.46% y 85.48% dieron positivas para la rickettsia, las muestras de Amblyomma spp. |62| todas fueron negativas. El índice de concordancia Kappa |total de bovinos infestados frente a Riphicephalus (Boophilus microplus|, no fue significativo (0.28. Subsiguientemente, se determinó por χ2 (p=0.66 que la presencia o ausencia de la enfermedad es independiente del lugar de donde proviene el bovino.

  7. Effect of milk production system on the enzootic stability to Anaplasma marginale and Babesia bovis in calves in the Campo das Vertentes region of Minas Gerais state, BrazilEfeito do sistema de produção de leite sobre a estabilidade enzoótica para Anaplasma marginale e Babesia bovis em bezerras na região do Campo das Vertentes de Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Christiane Maria Barcellos Magalhães Rocha

    2012-04-01

    Full Text Available We conducted a cross-sectional observational study, in order to determine the frequency of anti-A. marginale and anti-B. bovis antibodies in calves from four to 12 months of age from ten farms that producing B type milk and an equal number that produce raw milk refrigerated, located in the Campo das Vertentes region of Minas Gerais state, in the period September 2008 to August 2009. Blood smears were performed, serologic testing by indirect immunofluorescence technique (IFAT, given the packed cell volume, rickettsemia, and the clinical scores of animals infected by A. marginale. In the farms that produce B type milk, the overall average frequency of seropositive calves was 94.47% (166/176 and 89.20% (157/176 for A. marginale and B. bovis, respectively. Already on the farms that produce raw milk refrigerated, the overall average frequency of A. marginale was 92.59% (149/161 and for B. bovis from 86.30% (139/161, and there was no significant difference (p > 0.05 in the frequency of calves infected for both hemoparasitic between the two systems of milk production. Statistically significant (p 0.05 among calves from properties that produce B type milk and raw milk refrigerated. The results of this study indicate that, in the Campos das Vertentes region of Minas Gerais, the production system does not interfere with the enzootic stability for A. marginale and B. bovis in calves from dairy farms B milk or raw milk refrigerated, with low probability of anaplasmosis and/or babesiosis in adults animals.Foi realizado um estudo observacional do tipo transversal, com o objetivo de determinar a frequência de anticorpos anti-A. marginale e B. bovis em 337 bezerras com idade entre quatro a 12 meses, oriundas de dez propriedades produtoras de leite B e igual número de fazendas de leite cru refrigerado (leite C, na região do Campo das Vertentes de Minas Gerais, no período de setembro de 2008 a agosto de 2009. Foram realizados esfregaços sangu

  8. Influence des paramètres d'un laser ER: YAG sur l'adaptation marginale d'une restauration à faible contraction

    OpenAIRE

    Peeters, Frédéric

    2013-01-01

    Quarante molaires ont été réparties en cinq groupes. C'est avec un laser de type Er:YAG que des cavités occlusales ont été faites sur les dents des quatre premiers groupes et cela avec certains paramètres définis et spécifiques à chacun. Les dents du dernier groupe quant à elles, ont subi un traitement conventionnel de fraisage. L’obturation des cavités a été faite avec le même matériau, une résine composite à faible taux de contraction. L'adaptation marginale de chaque dent a ensuite été com...

  9. Prevalencia de caries de infancia temprana en niños menores de 6 años de edad, residentes en poblados urbano marginales de Lima Norte

    OpenAIRE

    Villena Sarmiento, Rita; Pachas Barrionuevo, Flor; Sánchez Huamán, Yhedina; Carrasco Loyola, Milagros

    2014-01-01

    La prevalencia de caries de infancia temprana es un problema de salud pública prevenible y que afecta a un gran número de niños. El propósito de este trabajo fue determinar la prevalencia yseveridad de la caries dental en niños de 6-71 meses de edad de comunidades urbano marginales de Lima. Se evaluaron a 332 niños con los criterios de caries dental de la OMS, con equipo noinvasivo, bajo luz natural, y con técnica de rodilla-rodilla para los más pequeños. Fueron calibrados 3 odontólogos en el...

  10. Redes comunitarias: un desafío para escuelas urbano-marginales (COMMUNITY NETWORKS: A CHALLENGE FOR URBAN MARGINAL SCHOOLS

    Directory of Open Access Journals (Sweden)

    Moscoloni Bicchi Nora

    2009-04-01

    Full Text Available Resumen: Las ideas básicas de este trabajo son conocer y comprender el entramado de la red de relaciones entre los distintos actores de las instituciones: escuela y organismos de la comunidad y su incidencia en la calidad educativa / calidad de vida. Analizamos la visión de los distintos actores educativos acerca de la inserción de la escuela en la comunidad. Tomamos como punto de partida el análisis de las relaciones entre calidad educativa y calidad de vida, en poblaciones urbano-marginales. Realizamos en primer lugar una investigación exploratoria, para conocer las características generales de escuelas que reciben población marginal. En una segunda etapa seleccionamos cuatro escuelas, que tomamos como casos e indagamos sus problemáticas. En ellas observamos gran dificultad para la construcción de redes comunitarias desde la institución escolar. Si bien responden a los problemas puntuales, mediante cambios o innovaciones planificados dinámica y flexiblemente, no existen soluciones duraderas debido a la falta de una convocatoria que comprometa a todas las instituciones de la comunidad constituyendo una efectiva relación en red. Estos resultados alcanzados en la investigación son producto de la triangulación de los datos estadísticos, documentales e históricos así como de los procedentes de la observación participante y de la información de las entrevistas en profundidad.Abstract:The basic ideas of this work are to know and understand the fabric of the network of relationships between the different institutions involved in school and community agencies and their impact on the quality of education / quality of life. The vision of the different actors of education about the insertion of the school in the community is analyzed from the point of view of the school. The analysis started studying how the quality of education is related to the quality of life in marginalized urban populations. At first an exploratory research was

  11. Frequency of antibodies to Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax and Borrelia burdgorferi in cattle from the northeastern region of the state of Pará, Brazil Freqüência de anticorpos para Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax e Borrelia burgdorferi em bovinos do nordeste do Estado do Pará, Brasil

    Directory of Open Access Journals (Sweden)

    Daniel S. Guedes Junior

    2008-06-01

    Full Text Available Babesiosis, anaplasmosis, and trypanosomosis are relevant diseases, potentially causing morbidity in cattle, leading to economic losses. Borreliosis is import as a potential zoonosis. The objective of this study was to determine, by indirect enzyme-linked immunosorbent assay (ELISA, the frequency of seropositive cattle to Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax and Borrelia burgdorferi in cattle from the Northeastern region of Pará, Brazil. Sera samples from 246 female adult cattle from municipalities of Castanhal and São Miguel do Guamá were used. Crude antigens ELISAs were used to detect antibodies to all agents, except to A. marginale, to which an indirect ELISA with recombinant major surface 1a protein (MSP1a antigen was used. Overall frequencies of seropositive animals were: B. bigemina - 99.2%; B. bovis - 98.8%; A. marginale - 68.3%; T. vivax - 93.1% and B. burgdorferi - 54.9%. The frequencies of seropositive cattle to B. bovis and B. bigemina suggest a high rate of transmission of these organisms by tick in the studied region, which can be classified as enzootically stable to these hemoprotozoans. The low frequency of seropositive cattle to A. marginale may be attributed to a lower sensitivity of the recombinant antigen ELISA utilized or a distinct rate of inoculation of this rickettsia by ticks, as compared with Babesia sp. transmission. The high frequency of seropositive cattle to T. vivax indicates that this hemoprotozoan is prevalent in herds from the Northeastern region of Pará. The rate of animal that showed homologues antibodies to B. burgdorferi indicates the presence of the tickborne spirochaetal agent in the cattle population in the studied region.A babesiose, a anaplasmose e a tripanossomose são enfermidades relevantes, potencialmente causadoras de morbidade em bovinos, levando a perdas econômicas. A borreliose assume importância como zoonose potencial. O objetivo desse estudo foi determinar

  12. Responsabilidad Social Matriz de indicadores sustentables que refleja el impacto de la forestación en tierras marginales del Partido de Bahía Blanca, Argentina

    Directory of Open Access Journals (Sweden)

    Regina del Carmen Durán Durán

    2009-01-01

    Full Text Available Actualmente, se han empezado a considerar otras obligaciones que tienen las empresas para con su comunidad; se trata de aspectos vinculados con las dimensiones sociales y ambientales. Desde este contexto, nuestro trabajo tiene como punto de partida el concepto de responsabilidad social desde la noción de sustentabilidad. El objetivo es evaluar la forestación como instrumento para mejorar la sostenibilidad de los sistemas productivos tradicionales en tierras marginales del Partido de Bahía Blanca, mitigando los impactos del desarrollo no responsable de la producción primaria. Para ello, se han identificado técnicas de manejo generadoras de externalidades positivas en otras actividades agropecuarias complementarias, donde existen limitantes edafológicas, apoyándose en las tres dimensiones del concepto de sustentabilidad: ecológica, económica, sociopolítica y cultural. De igual forma, se diseñó una matriz de evaluación y ponderación de impactos, que contempla indicadores cuantitativos y cualitativos, de cuya aplicación surge la forestación como una alternativa sustentable

  13. Induced immune response of Escherichia coli BL21 expressing recombinant MSP1a and MSP1b proteins of Anaplasma marginale

    Directory of Open Access Journals (Sweden)

    Katia Tamekuni

    2009-11-01

    Full Text Available This work aims to evaluate the potential of immunization with E. coli BL21 expressing the recombinant rMSP1a and rMSP1b proteins of Anaplasma marginale. E. coli BL21 was transformed with recombinant plasmids pET102/msp1α and pET101/msp1β, and rMSP1a and rMSP1b were expressed after induction by IPTG. BALB/c mice were vaccinated with formolized BL21/rMSP1a and BL21/rMSP1b, and the production in mice sera of whole IgG was determined by ELISA. The mice immunized with BL21/rMSP1a showed a better humoral response for whole IgG when compared to the mice immunized with BL21/rMSP1b; these mice exhibited a small response after the second vaccination. Sera of mice immunized with BL21/rMSP1a reacted via western blot with BL21 and rMSP1a, with molecular masses varying from 70 to 105 kDa. Sera of mice immunized with BL21/rMSP1b reacted with BL21 and rMSP1b with a molecular mass of 100 kDa. These results demonstrate that BL21 containing rMSP1a and rMSP1b in the outer membrane were able to produce an immune response in mice, reinforcing its use in vaccine models against bovine anaplasmosis.Esse trabalho avaliou o potencial de imunização de Escherichia coli BL21 expressando as proteínas recombinantes rMSP1a e rMSP1b de Anaplasma marginale. A E. coli BL21 foi transformada com os plasmídios recombinantes pET102/msp1α e pET101/msp1β e as proteínas rMSP1a e rMSP1b foram expressas após indução com IPTG. Camundongos BALB/c foram vacinados com BL21/rMSP1a e BL21/rMSP1b formolisadas, e a produção de IgG total foi determinada pelo teste de ELISA nos soros dos camundongos imunizados. Os camundongos imunizados com a BL21/rMSP1a mostraram uma melhor resposta humoral para IgG total, comparada à resposta apresentada pelos camundongos imunizados com BL21/rMSP1b; estes camundongos exibiram uma menor resposta após a segunda vacinação. Soros de camundongos imunizados BL21/rMSP1a reagiram pelo western blot com BL21 e rMSP1a, com massa molecular variando de 70 a

  14. EL NIVEL EDUCATIVO Y SOCIOECONÓMICO DEL HOGAR Y HABILIDADES PRE-LECTORAS EN ESCUELAS URBANO Y URBANO-MARGINALES DE LA PROVINCIA DE MENDOZA-ARGENTINA

    Directory of Open Access Journals (Sweden)

    Yanina Canales Jara

    2016-01-01

    Full Text Available En Argentina, las dificultades en la adquisición de la lectura se originan en diferencias lingüísticas asociadas al nivel sociocultural donde se desarrollan los niños. El objetivo de este artículo es analizar, en escolares de 4 y 5 años, la relación entre el nivel educativo y socioeconómico del hogar con habilidades lingüísticas precursoras de la lectura. Esta es una investigación de carácter cuantitativo y de profundidad comparativa. Se evaluaron 120 niños y niñas de salas de 4 y 5 años de Jardín de Infantes de escuelas urbanas (n= 60 y urbano-marginales (n= 60. El nivel socioeconómico del hogar y educativo de los padres se calculó a partir de datos de los registros escolares. En los niños y niñas se evaluó el nivel de vocabulario, conocimiento del nombre y sonido de la letra y conciencia fonológica. Se observó un efecto significativo de la zona sobre el nivel educativo de los padres y el socioeconómico. Se obtuvieron correlaciones positivas del nivel socioeconómico y educativo con el conocimiento del nombre y sonido de la letra. Ambas variables contextuales explicaron parte de la varianza en el conocimiento del nombre y sonido de las letras en niños y niñas de 4 años únicamente: 6% y 13% respectivamente. Los resultados sugieren que las variables contextuales influyen en el conocimiento alfabético pre-escolar que presentan los niños y las niñas y que la intervención pedagógica recibida en la escuela promueve el desarrollo de habilidades lingüísticas. Frente a contextos socioeconómicos heterogéneos, la educación escolar es una variable protectora que regula las desigualdades de orden social promoviendo el desarrollo de habilidades lingüísticas precursoras de la lectura al inicio de la escolaridad.

  15. Caracterização da imunogenicidade das proteínas recombinantes Virb9, Virb10 e fator termo instável de Elongação de Peptídeos de Anaplasma marginale em camundongos

    Directory of Open Access Journals (Sweden)

    Ana Beatriz Canevari Castelão

    2012-10-01

    Full Text Available Considerando as limitações dos atuais métodos de controle contra a anaplasmose bovina, o desenvolvimento de uma vacina efetiva se faz necessário. A partir do advento da análise genômica e proteômica, novas proteínas de membrana de Anaplasma marginale foram identificadas como possíveis candidatas a componentes de uma vacina, tais como, VirB9,VirB10 e Fator Termo Instavél de Elongação de Peptídeos (EF-Tu. Embora estas proteínas ainda não estejam bem caracterizadas na membrana de A. marginale, a produção destas na forma recombinante (rVirB 9, rVirB10 e rEF-Tutem sido realizada, mas as mesmas ainda não foram exploradas em formulações vacinais. Neste trabalho, avaliou-se ouso de rVirB9, rVirB10 e rEF-Tu emulsionadas em adjuvante Montanide em camundongos. Nas condições testadas, verificou-se a indução de forte resposta imune humoral com a produção de IgG1 e IgG2a, sendo que as proporções dos níveis de produção destas subclasses indicam predomínio de IgG1. Entretanto, esplenócitos de animais, que foram injetados com rVirB9 ou rVirB10, produziram interferon-gama acima do limite de detecção do ensaio após estimulação in vitro, sinalizando assim resposta celular específica. Assim, novas avaliações serão realizadas com a finalidade de modular o perfil de resposta imune obtido em bovinos e avaliar a proteção contra A. marginale.

  16. Trouver la bonne distance : étrangère, marginale, ethnologue et parente en Corée du Sud

    Directory of Open Access Journals (Sweden)

    Élise Prébin

    2009-03-01

    Full Text Available Trouver la bonne distance : étrangère, marginale, ethnologue et parente en Corée du Sud. Cet article a pour sujet ma relation à la société sud-coréenne, non seulement en tant qu’anthropologue mais aussi en tant que personne adoptée d’origine coréenne. Il relate la manière dont plusieurs sortes de relations ont dû être gérées pendant le terrain. Il a fallu d’un côté me rapprocher de mes informateurs pour pouvoir mener un terrain classique dans une société inconnue, comprendre une culture autre et traiter un sujet relevant des sciences sociales : le retour des adoptés étrangers dans leur pays d’origine. De l’autre, il a fallu établir une bonne distance avec ma famille biologique coréenne en m’en éloignant momentanément. Ma relation avec elle était en effet instable du fait qu’elle reposait sur une contradiction : mon statut d’étrangère en dépit de l’intimité que supposaient les liens du sang. Pourtant, cette relation continue entre ma famille biologique et moi-même a éclairé certaines ambiguïtés relatives au statut des adoptés dans la société sud-coréenne que le temps limité du terrain n’avait pas permis de saisir. Cet article ébauche donc une réflexion épistémologique sur la pertinence d’éléments biographiques dans le traitement anthropologique de certains sujets. Je montre en l’occurrence comment le don en mariage d’une fille biologique adoptée conjure de manière satisfaisante un don en adoption toujours problématique.Finding the right distance: stranger, marginal, ethnologist and relative in south Korea. The topic of this article is my relation to the South Korean society, not only as a social anthropologist but also as a Korean adoptee. I relate the way I had to manage contrasted relations while conducting fieldwork. On one hand, I endeavoured to get closer to my informants in order to conduct classic fieldwork in an unknown society, to understand a different culture

  17. Diversidad genética de la región variable de los genes msp1a y msp4 en cepas de Anaplasma marginale de México

    Directory of Open Access Journals (Sweden)

    Rafael Jiménez Ocampo

    2012-01-01

    Full Text Available La anaplasmosis es de difícil control debido a la diversidad genética de la rickettsia. La proteína Msp1a, compuesta de repetidos variables de entre 23 y 31 aminoácidos en su región variable y la proteína Msp4, son dos de las proteínas de superficie más estudiadas en A. marginale y han sido ampliamente usadas como marcadores genéticos en la caracterización de cepas de A. marginale de diferentes orígenes geográficos. En este trabajo se analizaron, la región variable de la proteína Msp1a y la proteína Msp4 de 10 cepas mexicanas. En el caso de Msp1a, se observó un patrón de segregación que contiene los repetidos (alpha, beta, beta, gama en diferentes modalidades a lo largo de aislamientos del Golfo de México, principalmente en zonas de estabilidad enzoótica, mientras que la máxima variabilidad se presentó en Tamaulipas, en aislamientos de un brote de la enfermedad, es decir en zonas de inestabilidad. La diversidad observada no es tan extensa como se esperaba y, misma que se puede explicar por la presión que el sistema inmune del hospedero ejerce contra la rickettsia y los mecanismos de esta última para evadirla. En el caso de la proteína Msp4, la secuencia fue altamente conservada tanto en nucleótidos como en aminoácidos para los aislados en estudio, aunque, se observan diferencias con lo previamente reportado en México para este marcador.

  18. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B-cell epitopes are predominantly located in the HVR.

    Science.gov (United States)

    Abbott, Jeffrey R; Palmer, Guy H; Howard, Chris J; Hope, Jayne C; Brown, Wendy C

    2004-12-01

    Organisms in the genus Anaplasma express an immunodominant major surface protein 2 (MSP2), composed of a central hypervariable region (HVR) flanked by highly conserved regions. Throughout Anaplasma marginale infection, recombination results in the sequential appearance of novel MSP2 variants and subsequent control of rickettsemia by the immune response, leading to persistent infection. To determine whether immune evasion and selection for variant organisms is associated with a predominant response against HVR epitopes, T-cell and linear B-cell epitopes were localized by measuring peripheral blood gamma interferon-secreting cells, proliferation, and antibody binding to 27 overlapping peptides spanning MSP2 in 16 cattle. Similar numbers of MSP2-specific CD4(+) T-cell epitopes eliciting responses of similar magnitude were found in conserved and hypervariable regions. T-cell epitope clusters recognized by the majority of animals were identified in the HVR (amino acids [aa] 171 to 229) and conserved regions (aa 101 to 170 and 272 to 361). In contrast, linear B-cell epitopes were concentrated in the HVR, residing within hydrophilic sequences. The pattern of recognition of epitope clusters by T cells and of HVR epitopes by B cells is consistent with the influence of protein structure on epitope recognition.

  19. Allocation of the transmission service cost with base in marginal costs of the transmission network expansion; Asignacion del costo del servicio de transmision con base en costos marginales de expansion de la red de transmision

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Casillas, Manuel E.; Nieva Gomez, Rolando [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2001-07-01

    The transmission charges to the users must be completely defined in those systems where the restructuring has broken up the traditional functions of the companies; in order to introduce competition in the generation and commercialization segments of the electrical energy. The fundamentals of a method used are explained to assure the transmission service cases between their users. The method is based on the marginal expansion costs of the transmission network. Their more known applications have been in competitive markets of energy, in particular, where the energy price is the same one in all the localities. Nevertheless, it can be used under other forms of organization of the electrical industry. In order to illustrate results, the obtained ones from their application to the most important part of the transmission network of the Mexican system that operates interconnected, are presented. [Spanish] Los cargos de transmision a los usuarios deben estar completamente definidos en aquellos sistemas donde la reestructuracion ha desagregado las funciones tradicionales de las empresas; para introducir competencia en los segmentos de generacion y comercializacion de la energia electrica. Se explican los fundamentos de un metodo utilizado para asegurar los casos del servicio de transmision entre sus usuarios. El metodo se basa en los costos marginales de expansion de la red de transmision. Sus aplicaciones mas conocidas han sido en mercados competitivos de energia, en particular, donde el precio de la energia es el mismo en todas las localidades. Sin embargo, puede utilizarse bajo otras formas de organizacion de la industria electrica. Con el proposito de ilustrar resultados, se muestran los obtenidos de su aplicacion a la parte mas importante de la red de transmision del sistema mexicano que opera interconectada.

  20. El nivel educativo y socioeconómico del hogar y habilidades pre-lectoras en escuelas urbano y urbano-marginales de la provincia de Mendoza-Argentina

    Directory of Open Access Journals (Sweden)

    Yanina Canales, Jara

    2016-05-01

    Full Text Available En Argentina, las dificultades en la adquisición de la lectura se originan en diferencias lingüísticas asociadas al nivel sociocultural donde se desarrollan los niños. El objetivo de este artículo es analizar, en escolares de 4 y 5 años, la relación entre el nivel educativo y socioeconómico del hogar con habilidades lingüísticas precursoras de la lectura. Esta es una investigación de carácter cuantitativo y de profundidad comparativa. Se evaluaron 120 niños y niñas de salas de 4 y 5 años de Jardín de Infantes de escuelas urbanas (n= 60 y urbano-marginales (n= 60. El nivel socioeconómico del hogar y educativo de los padres se calculó a partir de datos de los registros escolares. En los niños y niñas se evaluó el nivel de vocabulario, conocimiento del nombre y sonido de la letra y conciencia fonológica. Se observó un efecto significativo de la zona sobre el nivel educativo de los padres y el socioeconómico. Se obtuvieron correlaciones positivas del nivel socioeconómico y educativo con el conocimiento del nombre y sonido de la letra. Ambas variables contextuales explicaron parte de la varianza en el conocimiento del nombre y sonido de las letras en niños y niñas de 4 años únicamente: 6% y 13% respectivamente. Los resultados sugieren que las variables contextuales influyen en el conocimiento alfabético pre-escolar que presentan los niños y las niñas y que la intervención pedagógica recibida en la escuela promueve el desarrollo de habilidades lingüísticas. Frente a contextos socioeconómicos heterogéneos, la educación escolar es una variable protectora que regula las desigualdades de orden social promoviendo el desarrollo de habilidades lingüísticas precursoras de la lectura al inicio de la escolaridad.

  1. Trastornos por consumo de alcohol (AUDIT en adolescentes y jovenes marginales de bandas juveniles de Mexico Transtornos por consumo de álcool (AUDIT em adolescentes e jovens marginais de bandos juvenis do México Alcohol consumption disorder (AUDIT for marginal adolescents and youth from juvenile gangs of Mexico

    Directory of Open Access Journals (Sweden)

    Francisco Rafael Guzmán Facundo

    2007-12-01

    Full Text Available Adolescentes y jóvenes que pertenecen a bandas juveniles con frecuencia son omitidos de las encuestas nacionales sobre consumo de alcohol y drogas. El objetivo del estudio fue conocer los trastornos por consumo de alcohol, y analizar el efecto de factores personales sobre estos, en 125 adolescentes y jóvenes margínales de bandas juveniles de Monterrey, NL. México. Los resultados indicaron que 70% mostró consumo excesivo, 62% se clasificó con consumo perjudicial y el 50% con dependencia. Los factores que más contribuyeron en la predicción del consumo excesivo fueron la edad, sexo y el bajo nivel educativo, para el consumo perjudicial fueron la edad y problemas de salud mental, y para el consumo dependiente fueron la edad, los años de escolaridad y los problemas de salud mental. Estos resultados posibilitarán la reflexión de la necesidad de diseñar programas adecuados dirigidos a la prevención en este grupo de jóvenes marginales.Adolescentes e jovens que pertencem a bandos juvenis com freqüência são omitidos dos estudos nacionais sobre consumo de álcool e drogas. O objetivo da presente pesquisa foi conhecer os transtornos por consumo de álcool e analisar o efeito de fatores pessoais sobre estes, em 125 adolescentes e jovens marginais de bandos juvenis do México. Os resultados mostraram que 70% têm consumo excessivo, 62% se classificou em um consumo prejudicial, e o 50% com dependência. Os fatores que maior contribuíram na predição do consumo excessivo foram a idade, sexo e o baixo nível educacional, para o consumo prejudicial foram a idade e os problemas de saúde mental, e para o consumo dependente foram a idade, os anos de escolaridade e os problemas de saúde mental. Estes resultados possibilitaram a reflexão da necessidade de elaboração de programas adequados direcionados à prevenção neste grupo de jovens.Adolescents and youngers who are involved in gangs, are frequently excluded from the national surveys about

  2. Las calles y los barrios marginales de Daca

    OpenAIRE

    LeBeau, Nellie; Tuckfield, Hugh

    2017-01-01

    Cada año, alrededor de medio millón de personas busca alojamiento en Daca, a causa del nexo entre el cambio climático, la pobreza y la degradación del medio ambiente. Muchas de estas personas terminan viviendo en las calles.

  3. Margins in Swedish district heating systems; Marginaler i Fjaerrvaermesystem

    Energy Technology Data Exchange (ETDEWEB)

    Selinder, Patrik; Zinko, Heimo [ZW Energiteknik AB, Nykoeping (Sweden)

    2003-03-01

    It can be assumed on good reasons that the Swedish district heating nets are designed with relatively large margins concerning the transportable power. This is done historically to be able to transport the necessary power that can be called for on the coldest winter days but which occur rarely and also due to the former (until 2001) applied recommendations for the dimensioning of hot water flows. The aim of this project was to investigate the possibilities of reducing the connecting power to customers, both from a technical and from the customer point of view. The heating system of a building in Sweden is normally dimensioned according to a certain outdoor air temperature (DUT in Swedish). According to the Swedish Building Code, DUT20 is defined for a given location in such a way that if the heating system is designed for this temperature, the room temperature is allowed to decrease by 3 deg C in the average once in 20 years. That means that for economical reasons, a power deficiency is accounted for in the case of strong cold. The value of DUT is depending on the thermal inertia of the building. Buildings with high thermal inertia can have a higher DUT and vice versa. A reduced system size can in principle mean smaller size of pipes and consumer substations and more power available for additional customers to be connected. In principle, that means a more profitable district heating operation. Besides costs, another problem with oversized capacities are possible operational problems due to slow dynamic system responses, for instance at restarting occasions after a pump stop. A smaller valve size will result in a better system dynamic and may result in a more compliant system operation and increased delivery quality. By choosing just right DUT for every building and abandoning safety margins, it is shown in the report that the connecting power can be reduced in especially medium light to heavy buildings with larger time constants. However, this also means that the occasions with power deficiency will occur more often. The lower limit for the reduction of connection power is depending on the level of comfort the customers are prepared to accept. These questions have been discussed with selected customer representatives. The mentioned practice of oversizing of the heating power deliverable to the buildings presents a relatively large margin for reduction of consumable power without decreasing the level of heating comfort too much. In the report this method is recommended under the name 'stingy' (= adequate) dimensioning; it is still according to the recommendation of the Swedish building code based on DUT20 and following the regulations of the Swedish District Heating Association for the domestic hot water dimensioning. The result will be a decrease of about 30% of the connected power in most buildings, and somewhat more in the heaviest buildings. Further reduction of the connecting power will implicate a more strong impact on the heating comfort. We call this 'deficiency dimensioning' and we cannot really recommend it apart from some special customer groups who might accept this heating quality by receiving some kind of economic compensation.

  4. Une étude marginale de littérature

    Directory of Open Access Journals (Sweden)

    Bibiane Fréché

    2011-07-01

    Full Text Available Rencontrer une note, selon un propos célèbre prêté au dramaturge Noel Coward, « is like going downstairs to answer the doorbel while making love ». (p. 11Andréas Pfersmann est maître de conférence à l’Université de la Polynésie française. Il étudie depuis près de vingt ans l’annotation. Tout aussi marginal que marginalisé dans les études françaises, le sujet n’est pas neuf pour autant. Les scientifiques allemands planchent depuis la fin du XIXe siècle sur le sujet et le monde anglo-saxon lui...

  5. Aplicación de modelos estructurales marginales para estimar los efectos de la terapia antirretroviral en 5 cohortes de seroconvertores al virus de la inmunodeficiencia humana Marginal structural models application to estimate the effects of antiretroviral therapy in 5 cohorts of HIV seroconverters

    Directory of Open Access Journals (Sweden)

    Santiago Pérez-Hoyos

    2007-02-01

    Full Text Available Los métodos convencionales tienen limitaciones para ajustar por factores de confusión dependientes del tiempo para evaluar la efectividad poblacional de tratamientos en estudios observacionales. En este trabajo se muestra un nuevo tipo de metodología, los modelos estructurales marginales (MEM, y se estima la efectividad de la terapia antirretroviral de gran actividad (TARGA sobre la incidencia de sida o muerte. Sujetos y métodos: Se identificaron los sujetos sin TARGA seguidos a partir de 1997 en las cohortes de seroconvertores al virus de la inmunodeficiencia humana (VIH del proyecto GEMES (Grupo de Estudio Multicéntrico Español de Seroconvertores. Para estimar el efecto sobre la incidencia de sida o muerte, se obtuvieron los parámetros de un MEM mediante una regresión logística ponderada por probabilidad inversa. La estimación de los pesos se basó en el recuento de CD4, el tiempo desde la seroconversión, el sexo, la edad, la categoría de trasmisión y el tratamiento previo. Resultados: Los 917 sujetos elegibles se siguieron durante una media de 3,4 años, durante los cuales se observaron 139 desenlaces de interés. El 42,1% de los participantes recibió TARGA durante el estudio. La tasa relativa fue de 1,01 (intervalo de confianza &(IC& del 95%, 0,68-1,49 mediante un modelo de Cox convencional sin covariables, y de 0,90 (IC del 95%, 0,61-1,32 mediante un modelo de Cox convencional con covariables cambiantes en el tiempo. La tasa relativa causal estimada por un MEM fue de 0,74 (IC del 95%, 0,49-1,12. Conclusiones: El efecto beneficioso del TARGA encontrado por los MEM está bien establecido, pero los modelos convencionales no pudieron detectarlo. El uso de un MEM permitió ajustar apropiadamente por la variable CD4, que es a la vez una variable de confusión dependiente del tiempo y está afectada por el uso previo de tratamiento.Objectives: Standard methods to evaluate population effectiveness of treatments in observational

  6. Personal and interpersonal risk factors in the consumption of illicit drugs by marginal adolescents and young people from juvenile gangs Factores de riesgo personales e interpersonales en el consumo drogas ilícitas en adolescentes y jóvenes marginales de bandas juveniles Fatores de risco pessoais e interpessoais no consumo de drogas ilícitas em adolescentes e jovens marginais de bandos juvenis

    Directory of Open Access Journals (Sweden)

    Francisco Rafael Guzmán Facundo

    2008-06-01

    Full Text Available Marginal populations are groups which are known to present higher risks of drug consumption. It is possible to identify adolescents and young people from juvenile gangs that constitute this group. The purpose of this study was to analyze the effect of personal and interpersonal risk factors of drug consumption in 175 marginal adolescents and young people who belong to juvenile gangs in Mexico. Results showed a significant effect of personal factors on drug use, with an estimated variation of 26.1%. The factors that presented the highest rates were: gender, age and mental problems. The interpersonal factors (relationships with friends who have maladaptive behaviors and inappropriate relationships with parents showed an effect with an estimated variation of 15%. These results will allow for reflection and, in the future, the elaboration of adequate preventive programs aimed at this group of young people.Grupos reconocidos con mayor riesgo para consumir drogas, son los marginales, dentro de estos podemos localizar a los adolescentes y jóvenes de bandas juveniles. El objetivo del estudio fue analizar el efecto de los factores de riesgo personales e interpersonales sobre el consumo de drogas, en 175 adolescentes y jóvenes margínales de bandas juveniles de México. Los resultados mostraron efecto significativo de los factores personales sobre el consumo de drogas, con una varianza explicada del 26.1%, los factores que mostraron una mayor contribución fueron; el sexo, edad y problemas de salud mental. Los factores interpersonales (relación con amigos con conductas mal adaptadas y relación inapropiada con padres mostraron un efecto sobre el consumo de drogas, con una varianza explicada del 15%. Estos resultados posibilitarán la reflexión y en un futuro diseñar programas adecuados dirigidos a la prevención en este grupo de jóvenes.Grupos reconhecidos com maior risco para o consumo de drogas, são os de populações marginais, e, dentro destas

  7. Franjas marginales de Brassica campestris L. (nabo) en cultivo de repollo. Efecto sobre pulgones y sus parasitoides: Título abreviado: Franjas marginales de Brassica campestris L. ....

    OpenAIRE

    Curis, M. C; Saravia Steudtner, F; Favaro, J. C; Sánchez, D; Bertolaccini, I

    2014-01-01

    La diversidad vegetal en los agroecosistemas afecta la dinámica poblacional de las plagas y de sus enemigos naturales, siendo una alternativa de control el uso de franjas trampa en algunos cultivos. El objetivo del trabajo fue determinar como una franja marginal de Brassicas campestris L. (Brassicales, Brassicaceae), afecta a la población de los pulgones de B. oleracea var. capitata y de sus parasitoides. El estudio se llevó a cabo en Santa Fe, a partir de febrero de 2012. Se estableció en un...

  8. Functional and Immunological Relevance of Anaplasma marginale Major Surface Protein 1a Sequence and Structural Analysis

    Czech Academy of Sciences Publication Activity Database

    Cabezas Cruz, Alejandro; Passos, L.M.F.; Lis, K.; Kenneil, R.; Valdés, James J.; Ferrolho, J.; Tonk, Miray; Pohl, A.E.; Grubhoffer, Libor; Zweygarth, E.; Shkap, V.; Ribeiro, M.F.B.; Estrada-Pena, A.; Kocan, K.M.; de la Fuente, J.

    2013-01-01

    Roč. 8, č. 6 (2013), e65243 E-ISSN 1932-6203 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 EU Projects: European Commission(XE) 238511 - POSTICK Institutional support: RVO:60077344 Keywords : CD4(+) T-lymphocytes * B-cell epitopes * salivary glands Subject RIV: EC - Immunology Impact factor: 3.534, year: 2013

  9. Domingo de Ramos, dalla violenza urbana alla solidarietà marginale

    Directory of Open Access Journals (Sweden)

    Riccardo Badini

    2016-12-01

    Full Text Available The article aims to analyze the poetry of Domingo de Ramos (Peru 1960 through themes like violence, urban decay and migration and presents the translation of an unpublished poem. A path is traced from the vanguards to the socio historical and political context of the  80s Peru, not to mention the innate inclination of the poet for marginal realities.

  10. TAMIZAJE CERVICOUTERINO USANDO PAPANICOLAOU EN MUJERES DE BARRIOS MARGINALES DE LA REGION LORETO

    Directory of Open Access Journals (Sweden)

    Carmen Nuñez-Rengifo

    2011-07-01

    Full Text Available La presente investigación, tiene como objetivo conocer la frecuencia de las mujeres portadoras de lesiones producidas por la infección con Papiloma Virus Humano en las zonas y lugares de difícil acceso geográfico en la región Loreto, donde escasean los recursos y las posibilidades de acceder al servicio de salud sexual y reproductiva son difíciles. Se usó para ello la prueba de Papanicolaou como tamizaje de dichas lesiones. Con ello se pretende reforzar la gestión para la obtención de vacunas contra el PVH, para la nueva generación de mujeres de Loreto; capacitación a los profesionales obstetras para reforzar el manejo en el tratamiento y reducción del cáncer de cuello uterino de la región Loreto. Este estudio tiene un Diseño descriptivo transversal. Se realizó teniendo como estratégica básica los Barridos de Papanicolaou entre los años 2008 y 2009. Se realizaron cientos de intervenciones, lográndose sensibilizar a 25,000 mujeres en Loreto, utilizando la estrategia de Promoción de la Salud, el perifoneo, volanteo, charlas educativas, 5,000 visitas domiciliarias, entre otras. De las 2000 mujeres estudiadas 348 tuvieron algún tipo de normalidad de las células epiteliales. En 45 casos se encontró lesiones intra epiteliales de alto grado ó carcinoma escamoso invasivo.

  11. EL CINE ESPAÑOL COMO FUENTE DOCUMENTAL PARA EL ESTUDIO DE LOS BARRIOS MARGINALES

    Directory of Open Access Journals (Sweden)

    Aramis López Juan

    2008-01-01

    Full Text Available El cine como arte nuevo y técnico se instala en una sociedad moderna que tiene una percepción del mundo basada en la imagen. El cine y la fotografía son los introductores de esta modalidad perceptiva de la modernidad. Esta experiencia sensorial sitúa al hombre en un universo más amplio. El hombre contemporáneo comprende los mecanismos representativos del cine, sus códigos, sus metáforas e iconos. El cine ha nacido al mismo tiempo que los abuelos de los espectadores actuales, ha crecido con sus padres, y es conocido y comprendido universalmente

  12. Nódulos opalinos en facies marginales del salar Olaroz (Puna Argentina

    Directory of Open Access Journals (Sweden)

    Alonso, R.

    1989-04-01

    Full Text Available This article reports the results of a petrological and geochemical study of silica nodules from Quaternary alluvial fallS of the Olaroz Salar. The nodules are mainly constituted by C-T opal, d. (101 spacing to 4,11 A, implying a high-disorder; this is commonly observed in opa! rocks formed in near surface environments, without burial and heating. The chemical composition of the nodules is anomalous when compared with other typical silica-rocks formed in arid continental closed basin, without any eruptive environments (for instance the Cuenca del Tajo in Spain. The siliceous nodules do not have the characteristics of the silcretes and are not associated to the evaporitic facies of the salar. Their genesis is probably related to contamination of groundwater of the alluvial fan with high-silica thermal water. The C-T opal would thus precipitate by either displacing tbe terrigenous host-rock or replacing previous ulexite nodules.Se realiza un estudio petrológico y geoquímico de los nódulos silíceos que se encuentran incluidos en sedimentos terrígenos cuaternarios de la Cuenca de Olaroz (La Puna, Argentina. Estos nódulos se localizan en abanicos aluviales que aparecen encajados, debido a los cambios en el nivel de base que se produce desde el Pleistoceno a la actualidad, durante la evolución de los cuerpos lacustres a salares. Un estudio mediante DRX revela que son rocas constituidas por ópalo C-T, con un espaciado (101 a 4,11 A, que implica un grado de desorden alto, típico de las rocas silíceas formadas en superficie y que no han sufrido enterramiento ni influencia térmica. Su composición química es anómala si se compara con rocas silíceas continentales formadas en ambiente endorreico y fuera de un marco volcánico (Mioceno de la Cuenca del Tajo. No poseyendo características de silcretas y no estando asociadas a la sedimentación evaporítica de los salares, se considera la influencia de aguas termales. La contaminación local y en un momento dado de las aguas freáticas de los abanicos aluviales por aguas termales ricas en sílice, propiciaría junto con la evaporización la precipitación de la silíceo Los nódulos silíceos crecerían desplazando el sedimento terrígeno que constituye la roca caja o reemplazando nódulos previa de ulexita.

  13. Maras y barras : Pandillas y violencia juvenil en los barrios marginales de Centroamérica

    NARCIS (Netherlands)

    Savenije, W.

    2009-01-01

    Street gangs -especially ‘Mara Salvatrucha’ [MS] and 18th Street Gang [18]- and student gangs are feared throughout Central America. This study looks at the violent and criminal acts they engage in, the attraction they hold over other young people, the solidarity among their members, and the

  14. Optimization of fuel cycles: marginal loss values; Optimisation des cycles de combustibles: valeurs marginales des pertes

    Energy Technology Data Exchange (ETDEWEB)

    Gaussens, J [Commissariat a l' Energie Atomique, 75 - Paris (France); Lasteyrie, B de; Doumerc, J [Compagnie pour l' Etude et la Realisation de Combustibles Atomiques, 75 - Paris (France)

    1965-07-01

    Uranium processing from the pit to the fuel element rod entails metal losses at every step. These losses become more and more expensive with the elaboration of the metal. Some of the uranium must be accepted as definitely lost whilst the rest could be recovered and recycled. The high cost of these losses, whether they are recycled or not, and the fact that the higher the enrichment is the higher their costs are, make it necessary to take them into account when optimizing fuel cycles. It is therefore felt important to determine their most desirable level from an economic point of view at the various nuclear fuel processing stages. However, in France as in some other countries, fissile material production is a state concern, whilst fuel element fabrication is carried out by private enterprise. Optimization criteria and the economic value of losses are therefore different for each of the two links in the fabrication chain. One can try in spite of this to reach an optimum which would conform to public interest, without interfering with the firm's sales policy. This entails using the fact that for a given output marginal costs are equal at the optimum. One can therefore adjust the level of the losses to attain this equation of marginal costs, as these are easier to obtain from the firm than a justification of the actual prices. One notices moreover that, although mainly concerned with losses, this global analysis can bring both the state and the firm to a better use of other production factors. An account is given of the theory of this economic optimization method and practical applications in the field of natural uranium-graphite moderated and CO{sub 2} cooled reactor fuel element fabrication are offered. (authors) [French] L'elaboration de l'uranium, de la mine a la cartouche d'element combustible, s'accompagne, a tous les stades, de pertes, de plus en plus onereuses, a mesure que le metal devient plus elabore. Une certaine proportion de l'uranium doit etre consideree comme definitivement perdue, alors que le reste pourrait etre recupere et recycle. Le cout eleve des pertes, recyclees ou non, d'autant plus eleve que l'uranium est plus enrichi, exige qu'il en soit tenu compte dans l'optimisation generale des cycles de combustible. Il importe donc de determiner leur niveau le plus souhaitable economiquement, aux diverses etapes d'elaboration du combustible nucleaire. Mais en France et dans d'autres pays, la production de matieres fissiles est geree par l'Etat, tandis que la fabrication de l'element combustible est effectuee par l'industrie privee. Les criteres d'optimisation et l'interet economique accorde aux pertes sont donc differents pour les deux parties de la chaine de fabrication. Pour tenter neanmoins d'atteindre un optimum conforme a l'interet collectif sans intervenir dans la politique de prix de l'entreprise, on peut utiliser la propriete des couts marginaux d'etre egaux entre eux a l'optimum, pour un volume de production donne. On peut donc ajuster le niveau des pertes pour realiser cette egalite des couts marginaux dont le calcul est plus facile a obtenir de la firme que la justification des prix eux-memes. On s'apercoit d'ailleurs que, bien qu'axee essentiellement sur les pertes, cette analyse globale peut conduire a une meilleure utilisation d'autres facteurs de production. On donne un expose theorique et des exemples pratiques de cette methode d'optimisation economique dans le cadre de la fabrication d'elements combustibles destines a des reacteurs du type: uranium naturel, moderes au graphite et refroidis par le gaz carbonique. (auteurs)

  15. TAMIZAJE CERVICOUTERINO USANDO PAPANICOLAOU EN MUJERES DE BARRIOS MARGINALES DE LA REGION LORETO

    Directory of Open Access Journals (Sweden)

    Carmen Nuñez Rengifo

    2011-06-01

    Full Text Available La presente investigación, tiene como objetivo conocer la frecuencia de las mujeres portadoras de lesiones producidas por la infección con Papiloma Virus Humano en las zonas y lugares de difícil acceso geográfico en la región Loreto, donde escasean los recursos y las posibilidades de acceder al servicio de salud sexual y reproductiva son difíciles. Se usó para ello la prueba de Papanicolaou como tamizaje de dichas lesiones. Con ello se pretende reforzar la gestión para la obtención de vacunas contra el PVH, para la nueva generación de mujeres de Loreto; capacitación a los profesionales obstetras para reforzar el manejo en el tratamiento y reducción del cáncer de cuello uterino de la región Loreto. Este estudio tiene un Diseño descriptivo transversal. Se realizó teniendo como estratégica básica los Barridos de Papanicolaou entre los años 2008 y 2009. Se realizaron cientos de intervenciones, lográndose sensibilizar a 25,000 mujeres en Loreto, utilizando la estrategia de Promoción de la Salud, el perifoneo, volanteo, charlas educativas, 5,000 visitas domiciliarias, entre otras. De las 2000 mujeres estudiadas 348 tuvieron algún tipo de normalidad de las células epiteliales. En 45 casos se encontró lesiones intra epiteliales de alto grado ó carcinoma escamoso invasivo.

  16. Optimization of fuel cycles: marginal loss values; Optimisation des cycles de combustibles: valeurs marginales des pertes

    Energy Technology Data Exchange (ETDEWEB)

    Gaussens, J. [Commissariat a l' Energie Atomique, 75 - Paris (France); Lasteyrie, B. de; Doumerc, J. [Compagnie pour l' Etude et la Realisation de Combustibles Atomiques, 75 - Paris (France)

    1965-07-01

    Uranium processing from the pit to the fuel element rod entails metal losses at every step. These losses become more and more expensive with the elaboration of the metal. Some of the uranium must be accepted as definitely lost whilst the rest could be recovered and recycled. The high cost of these losses, whether they are recycled or not, and the fact that the higher the enrichment is the higher their costs are, make it necessary to take them into account when optimizing fuel cycles. It is therefore felt important to determine their most desirable level from an economic point of view at the various nuclear fuel processing stages. However, in France as in some other countries, fissile material production is a state concern, whilst fuel element fabrication is carried out by private enterprise. Optimization criteria and the economic value of losses are therefore different for each of the two links in the fabrication chain. One can try in spite of this to reach an optimum which would conform to public interest, without interfering with the firm's sales policy. This entails using the fact that for a given output marginal costs are equal at the optimum. One can therefore adjust the level of the losses to attain this equation of marginal costs, as these are easier to obtain from the firm than a justification of the actual prices. One notices moreover that, although mainly concerned with losses, this global analysis can bring both the state and the firm to a better use of other production factors. An account is given of the theory of this economic optimization method and practical applications in the field of natural uranium-graphite moderated and CO{sub 2} cooled reactor fuel element fabrication are offered. (authors) [French] L'elaboration de l'uranium, de la mine a la cartouche d'element combustible, s'accompagne, a tous les stades, de pertes, de plus en plus onereuses, a mesure que le metal devient plus elabore. Une certaine proportion de l'uranium doit etre consideree comme definitivement perdue, alors que le reste pourrait etre recupere et recycle. Le cout eleve des pertes, recyclees ou non, d'autant plus eleve que l'uranium est plus enrichi, exige qu'il en soit tenu compte dans l'optimisation generale des cycles de combustible. Il importe donc de determiner leur niveau le plus souhaitable economiquement, aux diverses etapes d'elaboration du combustible nucleaire. Mais en France et dans d'autres pays, la production de matieres fissiles est geree par l'Etat, tandis que la fabrication de l'element combustible est effectuee par l'industrie privee. Les criteres d'optimisation et l'interet economique accorde aux pertes sont donc differents pour les deux parties de la chaine de fabrication. Pour tenter neanmoins d'atteindre un optimum conforme a l'interet collectif sans intervenir dans la politique de prix de l'entreprise, on peut utiliser la propriete des couts marginaux d'etre egaux entre eux a l'optimum, pour un volume de production donne. On peut donc ajuster le niveau des pertes pour realiser cette egalite des couts marginaux dont le calcul est plus facile a obtenir de la firme que la justification des prix eux-memes. On s'apercoit d'ailleurs que, bien qu'axee essentiellement sur les pertes, cette analyse globale peut conduire a une meilleure utilisation d'autres facteurs de production. On donne un expose theorique et des exemples pratiques de cette methode d'optimisation economique dans le cadre de la fabrication d'elements combustibles destines a des reacteurs du type: uranium naturel, moderes au graphite et refroidis par le gaz carbonique. (auteurs)

  17. Para un canon de marginales, malos y malditos: Jaime Rest en CEAL y Ediciones Librerías Fausto

    Directory of Open Access Journals (Sweden)

    Maximiliano Crespi

    2009-11-01

    Full Text Available This paper seeks to account for the link between the last period in Jaime Rest's criticism and his work both on the editorial project of Centro Editor de América Latina and on the design of the 'Novel and Short Story' catalog of Ediciones Librerías Fausto. Rest's critical production between the mid 60s and the late 70s is examined, and a detailed description of his work as editor during the same period is presented. The purpose of such comparison is to establish relationships of contiguity and interference between the two areas of work in the context of a cultural and intellectual field marked by repression and censorship

  18. Para un canon de marginales, malos y malditos: Jaime Rest en CEAL y Ediciones Librerías Fausto

    Directory of Open Access Journals (Sweden)

    Maximiliano Crespi

    2009-11-01

    Full Text Available El presente artículo busca dar cuenta de la articulación entre la última etapa del trabajo crítico de Jaime Rest y su labor en el proyecto editorial de Centro Editor de América Latina y en el diseño del catálogo 'Novela y Cuento' de Ediciones Librerías Fausto. Se examina la producción crítica de Rest entre mediados de la década del 60 y fines de los 70 y se presenta una descripción pormenorizada de su trabajo como editor en el periodo delimitado por esas fechas. El objeto de dicho cotejo apunta a establecer relaciones de contigüidad e interferencias entre ambas esferas laborales en el contexto de un campo cultural e intelectual signado por la represión y la censura

  19. La resiliencia en los estudiantes de educación básica, un tema primordial en comunidades marginales

    OpenAIRE

    Silas-Casillas, Juan C.

    2008-01-01

    Este artículo busca ilustrar la manera en que los profesores de jóvenes en situación de marginación se constituyen en "personas significativas en resiliencia". Ejemplifica cómo estos actores clave influyen en la formación y perseverancia de alumnos de educación básica en condiciones de pobreza. La argumentación y discusión conceptual del reporte se nutre principalmente de los elementos de la teoría de la resiliencia y toma evidencias empíricas de las historias de vida de 29 personas que parti...

  20. Emociones en suspenso: maternidad y consumo de pasta base/paco en barrios marginales de Buenos Aires

    Directory of Open Access Journals (Sweden)

    Victoria Castilla

    2012-12-01

    Full Text Available A partir de una investigación etnográfica llevada a cabo en un barrio del Área Metropolitana de Buenos Aires, caracterizado por altos índice de pobreza, vulnerabilidad y marginalidad, en este texto se describen y analizan, desde la perspectiva de las propias usuarias, las caracterísiticas y formas en que el consumo intensivo de PB/paco moldea las dinámicas emocionales vinculadas con la maternidad. En el marco de esta relación consumo-maternidad, destacamos distintos momentos entre los que se encuentran las "emociones maternales en suspenso" vividas durante el consumo intensivo ("giras"; los malestares emocionales asociados a la "culpa" y la "vergüenza" durante el "bajón"; y las emociones maternales intensificadas asociadas a un intenso apego emocional con los hijos y las hijas, sobre todo cuando comienzan a "rescatarse".

  1. Optimización del uso de polimeros para perforar pozos en campos marginales del oriente ecuatoriano

    OpenAIRE

    Silva Zea, Roberto Gonzalo; Gallegos Orta, Ricardo

    2009-01-01

    El presente trabajo tiene por objeto el estudio del comportamiento de un fluido de perforación base polímero, como el PHPA, el cual se utilizo para perforar tres pozos en el Campo Bermejo en la Cuenca Oriente Ecuatoriana. Este tipo de fluido se lo utiliza en forma general para inhibir ciertos tipos de arcillas expansibles y de lutitas problemáticas y se lo puede adaptar para usarlo con otros tipos de aditivos para mejorar la perforación, alcanzar mejores resultados y abaratar costos asoci...

  2. Experiencias de utilización de materiales marginales y especiales en terraplenes viarios en España

    OpenAIRE

    Cano Linares, Herminia; Perucho Martínez, Áurea

    2015-01-01

    La utilización de los materiales existentes a lo largo de la traza de las carreteras es un teMna primordial dentro de la política de Desarrollo Sostenible que se viene impulsando desde hace tiempo a nivel mundial. Dentro del seno de la Asociación Mundial de la Carretera (PIARC-AIPCR) se ha venido investigando en este tema desde hace varias décadas por parte de diferentes Comités Técnicos. Por otra parte, con la modificación del artículo 330 de "Terraplenes" del PG-3 (FOM 1382/2002),...

  3. Impacto ambiental en áreas marginales del río Colorado, provincia de Buenos Aires, Argentina

    Directory of Open Access Journals (Sweden)

    Maira Scherger

    2014-01-01

    climáticos extremos- actúan como catalizador en el proceso de desertificación. El desarrollo sostenible es definido como aquel que satisface las necesidades del presente sin comprometer las necesidades de las futuras generaciones, esto implica la relación inseparable entre la sostenibilidad de un recurso y su contexto económico y social. En el presente trabajo se reconocen las transformaciones espaciales en el Valle Bonaerense del río Colorado a partir de la puesta en valor del río Colorado como recurso y se identifican y seleccionan los componentes ambientales impactados por las actividades agropecuarias. El agua, recurso natural que ofrece el río, ha sido el elemento organizador de este espacio que se caracteriza por la producción agrícola. En las últimas décadas las oportunidades económicas internacionales del mercado, han favorecido el incremento de superficies para tal fin. En consecuencia, el uso intensivo del suelo y la falta de adecuadas políticas de planificación impactan negativamente generando procesos de degradación de suelos que atentan el desarrollo sostenible de la región.

  4. Los personajes de la “otra” ciudad en El rincón de los justos y en dos cuentos de Huilo Ruales Hualca (marginales y marginalidad)

    OpenAIRE

    Rivadeneira Aseicha, Luis Alberto

    2004-01-01

    El propósito principal de nuestra tesis es estudiar, dentro de las tendencias de la nueva narrativa ecuatoriana, la marginalidad urbana en la novela El rincón de los justos, de Jorge Velasco M., y en los cuentos “leyendas olvidadas del reino de la tuentifor” y “el alma al diablo”, de Huilo Ruales H. Para ello, empezamos por describir el enfoque socio-político que vivió nuestro país en la década de los setenta, cuando, paralelamente a la gran riqueza económica que generó el auge petro...

  5. Bayeuxtapetens marginaler - ett utrymme för kommunikation om kvinnligt och manligt? = Medieval margins - a site of communicatin about male and female? / Agneta Ney

    Index Scriptorium Estoniae

    Ney, Agneta

    2006-01-01

    Bayeux' gobeläänist, mis kujutab Inglismaa vallutamist 11. sajandil normannide poolt - uurimus on vastukajaks kunstiteadlase Michael Camille'i arvamusele, et vaibaäärtel on kujutatud misogüüne. Naiste kujutamisest vaibal, oletatavatest põhjustest ja tähendustest

  6. Análisis de la dinámica relacional generada por las websites de Internet en el desarrollo de los turismos marginales

    Directory of Open Access Journals (Sweden)

    José Mª Prat

    2012-04-01

    Full Text Available Knowledge of tourism stakeholders on the territory, and its relations, is a basic element for the active management of any tourist destination. The new information technologies and the popularization of Internet, have created a lot of social relationships among the websites linkeded that have enabled a rapid and widespread promotion of marginal tourist destinations, in response to new approaches to post-fordist tourism, generating a dynamic relationship, benefited of the rapid development of TIC’s. In this paper we have examined these relationships among websites, in the case of development of two marginal tourisms in the south of France, in Cap d’Agde, where both tourisms, naturist and swinger, proving the existence of direct relationship between websites in order to confirm the relational dynamics on the territory and the degree of development of marginal tourisms.

  7. Plan habitacional para las zonas urbano marginales del cantón Milagro en base a una estructura mixta: metálica-bambú-cemento

    OpenAIRE

    Ochoa Gonzalez, Carlos; Freire Freire, Christian; Estrada Aguilar, Leonardo

    2009-01-01

    El presente trabajo pretende contribuir a disminuir la migración de las personas autóctonas del sector descrito hacia las grandes ciudades, por medio del bienestar que representa tener una vivienda propia definitiva. Esta iniciativa nace a raíz de un proyecto implantado por la fundación “Hogar de Cristo”, en el que se ofrece una vivienda de estructura metálica y paredes de paneles de bambú. En la primera parte se presenta la nueva propuesta habitacional, la cual consiste en una estructura met...

  8. Propuesta de dispositivos de tratamiento de base comunitaria para las toxicomanías en barrios urbano-marginales de la ciudad de Quito

    OpenAIRE

    Villacís Rengifo, María Lorena

    2016-01-01

    Nuestro trabajo investigativo pretende trazar abordajes terapéuticos para el tratamiento de las toxicomanías en contextos de alta vulnerabilidad y exclusión social. Por lo tanto, trabaja sobre dos fenómenos sociales complejos y a la vez relacionales: la marginalidad y las toxicomanías. Los analiza mediante el diálogo entre dos campos del saber: la sociología y el psicoanálisis. En el primer capítulo: Marginalidad y Toxicomanías, analizamos la marginalidad desde los planteamient...

  9. Frequency of Anaplasma marginale (Theiler 1910 and Babesia sp in mestizo bovine Zebu, in the Municipality of Ixiamas county Abel Iturralde Department of The La Paz, Bolivia

    Directory of Open Access Journals (Sweden)

    Mercado Alvaro

    2011-08-01

    Full Text Available The present work one carries out in the Municipality of Ixiamas County Abel Iturralde of the department of Peace-Bolivia, between May and August of 2010. The objective was to determine the presence of Anaplama sp and Babesia sp, through sanguine smear, they took 160 samples of blood, 40 bovine of the four areas they have been evaluated. The results indicate the presence of Anaplasma sp 6,90%, 6,20% in females and 9,70% in males, this represents 2,50% for the area TO, 5,00% area B, 17,50% area C and 2,50% area D. According to the category 12,50% in calves, 0,00% in torillos, 4,80% in bulls, 6,20% in cows and 14,30% in heifers. The presence of Babesia sp 3,13%, with relationship to the sex 3,10% in females and 3,22% in males, being observed 2,50% in the area TO, 5,00% in the area B, 5,00% in the area C and 0,00% in the area D, according to the category 0,00% in calves, torillos 4,80% bulls, 2,73% vacates and 7,14% in heifers.

  10. Spanish experiences with marginal and special materials on the construction of road embankments; Experiencias de utilizacion de materiales marginales y especiales en terraplenes viarios en Espana

    Energy Technology Data Exchange (ETDEWEB)

    Cano Linares, H.; Perucho Martinez, A.

    2015-07-01

    The use of existing materials along the alignment of a road is an essential problem within the Sustainable Development policies, which is being promoting worldwide since a long time. In the Word road Association (PIARC-AIPCR) this subject has being investigated by different Technical Committees during last decades. Additionally, the review of the article 330 Embankment of PG-3 (FOM 1382/2002) has opened the door to new non-conventional materials, as wastes and artificial materials, to be used on embankments. This could come to adequate solutions, technically, and environmentally, contributing with national legislation on valorisation policies. In this sense, the use of marginal materials and wastes con represent and important save on natural resources and dumping sites. In Spain, some experiences with marginal materials and wastes have being carried out. The work presented has consisted in compiling and analysing the experiences executed with marginal materials and wastes on Spanish road embankments. Although there are many other cases, 24 cases published with adequate information have being analysed, summarising aspects as: materials problems arrangement solutions or treatments employed. Analysing these experiences and making them public can be a way to transmit confidence, help to improve knowledge, and progress on the preparation of recommendations. This work has being carried out on the frame of the Project Geotechnical Engineering, Materials and Structures and Impact of Infrastructure in Civil engineering (TTIGEM), within the frame Program Border Cooperation Spain-External Borders (POCTEFEX); particularly in the Activity 2 related to Technology Transfer of Construction Materials, including marginal materials and wastes. (Author)

  11. Lactancia materna y hábitos de succión nutritivos y no nutritivos en niños de 0-71 meses de comunidades urbano marginales del cono norte de Lima

    OpenAIRE

    Carrasco Loyola, Milagros B.; Villena Sarmiento, Rita S.

    2014-01-01

    El objetivo del estudio fue identificar las prácticas de lactancia materna y los hábitos de succión no nutritivos en niños de 0-71 meses de centros poblados del Distrito de Carabaillo, Lima-Perú, como parte de un proyecto de investigación de la Facultad de Estomatología de la UPCH. Se empleó una encuesta estructurada a las madres, cuya edad promedio fue de 28,0±5,3 años y el grado de instrucción fue secundaria incompleta (33,8%). La edad promedio de los 133 niños fue 36,4±21,1 meses. El 96,3%...

  12. RELACIÓN ENTRE EL AUSENTISMO POR ENFERMEDAD Y EL RENDIMIENTO ACADÉMICO EN INSTITUCIONES ESCOLARES DEL NIVEL PRIMARIO DE ZONAS URBANO-MARGINALES DEL DISTRITO CUSCO – 2014

    OpenAIRE

    MENDOZA CANALES, FREDY VÍCTOR

    2014-01-01

    CARACTERÍSTICAS DE LA POBLACIÓN RESULTADOS DE ENFERMEDADES AUSENTISMO POR ENFERMEDAD RENDIMIENTO ACADÉMICO RELACIÓN ENTRE AUSENTISMO POR ENFERMEDAD Y RENDIMIENTO ACADÉMICO DISCUSIÓN Y COMENTARIOS

  13. La Integración de la Sociabilidad y Asociatividad en el Trabajo con Familias Marginales The Integration of Sociability and Active Membership in Social Work With Marginal Families

    Directory of Open Access Journals (Sweden)

    Margarita Morandé

    2006-05-01

    Full Text Available El artículo describe el estudio efectuado en Santiago con familias de microcampamentos a partir del trabajo que realiza la Fundación Trabajo en la Calle. Se analizó la presencia de sociabilidad y asociatividad, desde la percepción que otorgan a este trabajo sus beneficiarios. Se utilizó una etnografía interpretativa, cuyas técnicas fueron la entrevista semi-estructurada y la observación participante. Los participantes fueron seis personas que se encontraban viviendo, al momento del estudio, en alguno de los campamentos en los cuales trabaja la Fundación. Y dos personas que pertenecieron a alguno de los campamentos donde trabajó la Fundación y que obtuvieron sus viviendas. Para el análisis de los datos, se elaboró un documento etnográfico, cuya interpretación se hizo a partir de los antecedentes teóricos. Los resultados muestran una integración de las características de sociabilidad y asociatividad en el trabajo realizado por la Fundación, y que ella se percibiría como significativamente positiva para los beneficiarios.The article describes a research that took place in Santiago de Chile with the families who live in small camps of shacks with whom Fundación Trabajo en la Calle has carried out their social work. Two forms of social interaction, sociability and active membership, were analized from the perceptions that their beneficiares have of this way of social work. The methodology applied was ethnographic hermeneutics, and the procedures for data collection were semi-structured interviews, field work and experiential data. The participants were six people who were living in some of the camps were the Foundation was working at the time of the research and two persons who had belonged to one of the camps and at the moment were living in their own housing. An ethnographic document was worked out for the data analysis and it`s interpretation was based on the theoretical framework of this research. Data show that there is an integration of sociability as well as active membership in the social work done by the Foundation and, this is perceived by the families as highly significant.

  14. Sistema constructivo de tecnología intermedia como solución al problema de vivienda en las áreas marginales y socioeconómicamente deprimidas de una ciudad

    Directory of Open Access Journals (Sweden)

    Alva Mejía, Alberto

    1984-07-01

    Full Text Available The constructive system of intermediate technology offers to the population the possibility to construct his dwelling by the way of autoconstruction in stages. Its aim is to project and construct at least 10 % of the demands for housing in Lima, within a three years limit, and to support the creation of Communal Crafts Workshops. The system is to join several prefabricated elements as girders, sheets and concrete arches with vegetal fibres, wooden roof frames, etc.El sistema constructivo de tecnología intermedia ofrece a la población la posibilidad de construir su vivienda bajo la modalidad de autoconstrucción por etapas. Su meta es proyectar y construir, al menos, el 10 % de las viviendas demandadas en la actualidad en Lima con un plazo de 3 años, y apoyar la formación de talleres artesanales comunales. El sistema consiste en la unión de varios elementos prefabricados como son viguetas, láminas y arcos de hormigón con fibras vegetales, tijerales de madera, etcétera.

  15. El caso de la ‘mala vida’, peligrosidad y prevención de conductas marginales en Revista de Criminología, Psiquiatría, Medicina Legal y Ciencias Afines, en Buenos Aires, 1914-1923

    Directory of Open Access Journals (Sweden)

    Mariana Dovio

    2013-11-01

    Full Text Available Analizamos la construcción de la noción de ‘mala vida’ en la ciudad de Buenos Aires, en la Revista de Criminología, Psiquiatría y Medicina Legal, entre 1914 y 1923. Nos dedicaremos a analizar la ‘mala vida’, entendiendo por tal aquellas conductas ubicadas en una zona fronteriza entre el crimen y la locura, a partir de la cuestión de la prevención y la peligrosidad. La primera forma de analizar la ‘mala vida’ se refiere a proyectos de instituciones ligados a la eugenesia para el encierro preventivo de peligrosos, ‘alcoholistas’ y vagabundos. La segunda, a la identificación, en términos morales y físicos, que puede ser vinculada a la confección de proyectos de intervención para los considerados ‘malvivientes’, que pudieran potencialmente dañar de algún modo al cuerpo social.

  16. ORF Alignment: NC_004842 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [Anaplasma ... marginale str. St. Maries] ... Length = 114 ... Query: 16 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWL...DKASGARTEKTEWHSIVVFSEG 75 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWL...DKASGARTEKTEWHSIVVFSEG Sbjct: 1 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWLDKASGARTEKTEWHSIVVFSEG 60 ...

  17. NCBI nr-aa BLAST: CBRC-ACAR-01-1026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1026 ref|YP_153799.1| hypothetical protein AM518 [Anaplasma marginale ...str. St. Maries] gb|AAV86544.1| hypothetical protein AM518 [Anaplasma marginale str. St. Maries] YP_153799.1 3.7 24% ...

  18. NCBI nr-aa BLAST: CBRC-LAFR-01-0905 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0905 ref|YP_153919.1| hypothetical protein AM688 [Anaplasma marginale ...str. St. Maries] gb|AAV86664.1| hypothetical protein AM688 [Anaplasma marginale str. St. Maries] YP_153919.1 5e-08 62% ...

  19. Capacitacion de educadores para areas marginales--I: Caracteristicas y necesidades educativas de los ninos, jovenes y adultos en las poblaciones menos favorecidas, rurales y urbanas. Tercera edicion (Preparation of Educators for Marginal Areas--I: Educational Needs and Characteristics of Children, Youth and Adults in Disadvantaged Populations, Rural and Urban. Third Edition).

    Science.gov (United States)

    Tedesco, Juan Carlos

    Forty percent of the families in Latin America have an income which does not provide essential necessities. Two-thirds of poor families live in the countryside, while the remainder reside in urban slums. The key variable in explaining poverty is education. Without education these families have irregular, unstable, and low paying employment…

  20. Retejiendo lo social en el sureste Mexicano; un ejercicio de intervención y acción comunitaria en dos barrios marginales de Ciudad del Carmen, Campeche / Reweaving the social climate in southeastern Mexico: an exercise in intervention and community...

    OpenAIRE

    Rodríguez, Cristhoper Bogart Márquez; Cortés, Moisés Frutos

    2015-01-01

    DOI: http://dx.doi.org/10.12957/rdc.2015.16956Trabalho enviado em 29 de janeiro de 2015. Aceito em 02 de abril de 2015. Resumen La Isla del Carmen, ubicada en el sureste mexicano, está inmersa desde los años ochenta en un agresivo proceso de modernización que está llegando a un punto de crisis por la agudización de los problemas sociales, económicos y ambientales. El desarrollo económico de la región está en gran medida determinado por la actividad petrolera, de tal suerte que se ha provocad...

  1. Localidad y globalización en la dinámica migratoria hacia los Estados Unidos desde áreas urbano - marginales y rurales: el caso de los municipios de El Progreso y El Negrito en el departamento de Yoro, Honduras

    Directory of Open Access Journals (Sweden)

    Marvin Barahona

    2008-08-01

    Full Text Available ESTE INFORME SE ENFOCA EN EL FENÓMENO MIGRATORIO HACIA LOS Estados Unidos desde los municipios de El Progreso y El Negrito, en el departamento hondureño de Yoro. Destaca las tendencias y consecuencias principales de dicho fenómeno, los sectores de población a los cuales afecta y las características significativas del contexto social, económico y político en el que éste se produce. Se exploran algunos datos relevantes contenidos en la base de datos –en proceso de construcción– del Equipo de Reflexión, Investigación y Comunicación de la Compañía de Jesús en Honduras (ERIC-SJ.

  2. Bovine babesiosis and anaplasmosis complex: diagnosis and evaluation of the risk factors from Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Lucimar Souza Amorim

    Full Text Available Direct diagnoses were made by using - blood smears and nested PCR (nPCR tests on 309 blood samples from crossbred dairy cattle in the municipality of Ibicaraí, Bahia. From diagnostic blood smear slides, the observed parasitic frequencies were 31.1% for Anaplasma marginale and 20.4% for Babesia sp. From nPCR diagnoses, they were 63% for A. marginale, 34% for Babesia bigemina and 20.4% for Babesia bovis. There were significant differences (P <0.01 between the two diagnostic methods (nPCR and blood smear slides. The compliance obtained from the kappa test was 0.41 and 0.48 for A. marginale and Babesia sp., respectively. The tick samples from the six farms analyzed using nPCR were only positive for A. marginale. Evaluation of the risk factors relating to the presence of ticks and the age of the animals showed that there was a significant association (P <0.01 with the frequency of animals infected with both pathogens. Therefore, under the conditions studied, nPCR proved to be a good tool for diagnosing the agents of the bovine babesiosis and anaplasmosis complex because of its sensitivity and specificity in comparison with blood smears. The municipality of Ibicaraí is an area with endemic prevalence of bovine babesiosis and anaplasmosis confirmed by nPCR and A. marginale is the main agent of the disease.

  3. First confirmed report of outbreak of theileriosis/anaplasmosis in a cattle farm in Henan, China.

    Science.gov (United States)

    Cui, Yanyan; Wang, Xiaoxing; Zhang, Yan; Yan, Yaqun; Dong, Haiju; Jian, Fuchun; Shi, Ke; Zhang, Longxian; Wang, Rongjun; Ning, Changshen

    2018-01-01

    Tick-borne diseases (TBDs) impose a significant constraint to livestock production world widely. In this paper, we presented a case of TBD in a cattle farm in Henan, China. 35 blood samples (7 samples sent by veterinarian, 28 samples gathered by our colleagues) were collected from ill, surviving and asymptomatic cattle and microscopic observation and PCR assays were conducted to characterize the pathogens. Genus Ixodes feeding on these cattle were collected and identified. Theileria annulata-like and Anaplasma marginale-like pathogens were observed in the blood smears stained with Giemsa staining under microscope. Furthermore, 5 out of 7 cattle blood samples were found to be positive for T. annulata by PCR. In the 28 blood specimens, three were positive for T. annulata, while A. marginale DNA was detected in nine blood DNA samples. Besides, 56 ticks feeding on cattle were collected from this farm and were all identified as Rhipisephalus microplus, meanwhile, 10 of them were found to be positive for A. marginale. In addition, phylogenetic analysis of the msp4 gene sequences of A. marginale obtained in this study showed that the isolate from cattle (KX840009) fell in the same clade with that of R. microplus (KX904527), sharing 100% similarity. To the best of our knowledge, this is the first confirmed report of outbreak of theileriosis/anaplasmosis in cattle farms in Henan, China. Copyright © 2017. Published by Elsevier B.V.

  4. Validation of an improved anaplasma antibody cELISA kit for detection of anaplasma ovis antibody in domestic sheep at the U.S. Sheep Experiment Station in Dubois, ID

    Science.gov (United States)

    An accurate and simple-to-perform new version of a competitive ELISA (cELISA) kit that became commercially available in 2015 for testing of cattle for antibody to Anaplasma marginale was validated for detection of Anaplasma ovis antibody in domestic sheep. True positives and negatives were identifie...

  5. Lomé et ses environs (Togo) : inondations et évolution du littoral ...

    African Journals Online (AJOL)

    africaines, connaît un développement démographique important. Elle s'est agrandie considérablement et les nouveaux arrivants ont construit leurs habitations dans les zones marginales sans aménagements préalables : plusieurs quartiers se ...

  6. Immunisation of smallholder dairy cattle against anaplasmosis and babesiosis in Malawi

    DEFF Research Database (Denmark)

    Tjørnehøj, Kirsten; Lawrence, J. A.; Kafuwa, P. T.

    1997-01-01

    A field study was conducted in the Southern Region of Malawi to evaluate the possible benefits of immunisation of improved dairy cattle against Anaplasma marginale, Babesia bigemina and Babesia bovis. Friesian crossbred heifers were immunised when they were being reared on Government farms. They ...

  7. Visiones nórdicas de la guerra civil española

    DEFF Research Database (Denmark)

    Heiberg, Morten Rievers

    2014-01-01

    Existe una rica literatura escandinava sobre la Guerra Civil española escrita por voluntarios de las Brigadas Internacionales. Sin embargo, existen pocos estudios científicos y los que hay tratan casi en su totalidad de temas marginales y su calidad no es siempre sobresaliente. El problema parece...

  8. Molecular approaches to detect and study the organisms causing ...

    African Journals Online (AJOL)

    This review will summarise the molecular approaches used to detect and analyse the genomes of Babesia bovis, B. bigemina and Anaplasma marginale which cause bovine babesiosis and anaplasmosis. These tick borne diseases are widely distributed in Africa, Asia, Australia, and Central and South America and for ...

  9. 1964-IJBCS-Article-Alain Aigue

    African Journals Online (AJOL)

    hp

    Theoretical of investigation. Empirical investigation of long rainfall records. Journal des Sciences Hydrologiques,. 49(4) : 591–610. Koutsoyiannis D. 2005. Incertitude, entropie, effet d'échelle et propriétés stochastiques hydrologiques. Propriétés distributionnelles marginales des processus hydrologiques et échelle d'état.

  10. Urban Planning: A Tool for Achieving Spatial Justice in the Cities of the 21st Century

    Directory of Open Access Journals (Sweden)

    Steven Navarrete Cardona

    2014-01-01

    profano, el habitante de los barrios y localidades marginales, que, aunque pague el impuesto predial y de valorización, nunca verá las calles del lugar en que reside pavimentadas o más rutas de transporte público para llegar a su trabajo o a donde le plazca.

  11. La complejidad de la marginalidad y sus derivaciones en el marco de las economías regionales. El caso de la producción caprina en el extremo sur de Mendoza

    Directory of Open Access Journals (Sweden)

    María Eugenia Cepparo

    2014-12-01

    Full Text Available Este trabajo analiza la producción caprina en el departamento de Malargüe, sur de Mendoza, sus vinculaciones con el contexto local y en el marco de las transformaciones y perspectivas de los territorios rurales marginales de nuestras economías regionales. Nos referiremos a la situación actual y a la posibilidad de producción y faenamiento de carne caprina en el departamento. El estudio se enriquece, por una parte, con los aportes del marco conceptual de los procesos derivados de la marginalidad, y por la otra con las dinámicas y contextos de las economías regionales, y dentro de ellas, la de los sistemas productivos marginales que acompañan a las producciones extrapampeanas más tradicionales y destacadas.

  12. TURISMO NATURISTA: UNA APUESTA POR EL TURISMO MARGINAL. EL CASO DEL BARRIO NATURISTA DE CAP D'AGDE EN FRANCIA

    Directory of Open Access Journals (Sweden)

    José María Prat Forga

    2010-01-01

    Full Text Available Dentro de las políticas de desarrollo local, el turismo tiene un peso cada vez mayor, cada vez más a fin de diversificar la oferta se potencian los turismos marginales, siendo uno de sus principales exponentes el turismo naturista. El barrio naturista de Cap d'Agde es uno de los principales centros mundiales de este tipo de turismo, impulsado por el propio gobierno francés. Sin embargo, en este mismo espacio emerge otro turismo, el swinger, paradigma del turismo erótico-sexual, provocando multiplicidad de relaciones no exentas de tensiones y conflictos en los diferentes espacios involucrados. En este artículo analizamos los puntos clave del turismo naturista y del turismo swinger, centrándonos en el barrio naturista de Cap d'Agde, símbolo de estos nuevos turismos marginales emergentes.

  13. [Natural infection by hemoparasites in calves submitted to chemoprophylaxis at 30 days of age].

    Science.gov (United States)

    da Silva, Rosângela A; Corrêa, Fabíola do N; Botteon, Rita de Cássia C M; Botteon, Paulo de Tarso L

    2007-01-01

    The tick-borne disease (TBD) brings great damages to cattle breeding. The most important etiologic agents are Babesia bigemina, B. bovis and Anaplasma marginale, being the tick Boophilus microplus the main vector. This work reports the occurrence of natural infection by hemoparasites of TBD in 36 calves with high ticks natural infestation submitted to chemoprophylaxis with 30 days year-old. The blood smears from animals of different ages were analized and were found B. bigemina (33.3%), B. bovis (11.1%) and A. marginale (13.9%). Six animals had clinical symptoms (16.7%) and one dead (2.8%). The number of clinical cases ocurred in consequence of an association of factors as high infestation of ticks and low passive immunity in period that calves had not developed enough active immunity.

  14. Viarios de cascos históricos: El Puente de las Estrellas en Ponferrada. Castilla y León. España

    Directory of Open Access Journals (Sweden)

    Jesús I. San José Alonso

    2007-11-01

    En este trabajo, se plantean las propuestas peatonales para el gozo urbano, el ocio y la cultura que por si mismas tienen un peso específico importante, no sólo para potenciar el uso de espacios, sino incluso para transformar su carácter, que llega en casos extremos a convertir lugares impersonales e incluso marginales, en verdaderos espacios lúdico-culturales a cielo abierto.

  15. Molecular biological identification of Babesia, Theileria, and Anaplasma species in cattle in Egypt using PCR assays, gene sequence analysis and a novel DNA microarray.

    Science.gov (United States)

    El-Ashker, Maged; Hotzel, Helmut; Gwida, Mayada; El-Beskawy, Mohamed; Silaghi, Cornelia; Tomaso, Herbert

    2015-01-30

    In this preliminary study, a novel DNA microarray system was tested for the diagnosis of bovine piroplasmosis and anaplasmosis in comparison with microscopy and PCR assay results. In the Dakahlia Governorate, Egypt, 164 cattle were investigated for the presence of piroplasms and Anaplasma species. All investigated cattle were clinically examined. Blood samples were screened for the presence of blood parasites using microscopy and PCR assays. Seventy-one animals were acutely ill, whereas 93 were apparently healthy. In acutely ill cattle, Babesia/Theileria species (n=11) and Anaplasma marginale (n=10) were detected. Mixed infections with Babesia/Theileria spp. and A. marginale were present in two further cases. A. marginale infections were also detected in apparently healthy subjects (n=23). The results of PCR assays were confirmed by DNA sequencing. All samples that were positive by PCR for Babesia/Theileria spp. gave also positive results in the microarray analysis. The microarray chips identified Babesia bovis (n=12) and Babesia bigemina (n=2). Cattle with babesiosis were likely to have hemoglobinuria and nervous signs when compared to those with anaplasmosis that frequently had bloody feces. We conclude that clinical examination in combination with microscopy are still very useful in diagnosing acute cases of babesiosis and anaplasmosis, but a combination of molecular biological diagnostic assays will detect even asymptomatic carriers. In perspective, parallel detection of Babesia/Theileria spp. and A. marginale infections using a single microarray system will be a valuable improvement. Copyright © 2015 The Authors. Published by Elsevier B.V. All rights reserved.

  16. Spatio-temporal variations and genetic diversity of Anaplasma spp. in cattle from the North of Tunisia.

    Science.gov (United States)

    Belkahia, Hanène; Ben Said, Mourad; El Mabrouk, Narjesse; Saidani, Mariem; Cherni, Chayma; Ben Hassen, Mariem; Bouattour, Ali; Messadi, Lilia

    2017-09-01

    In cattle, anaplasmosis is a tick-borne rickettsial disease caused by Anaplasma marginale, A. centrale, A. phagocytophilum, and A. bovis. To date, no information concerning the seasonal dynamics of single and/or mixed infections by different Anaplasma species in bovines are available in Tunisia. In this work, a total of 1035 blood bovine samples were collected in spring (n=367), summer (n=248), autumn (n=244) and winter (n=176) from five different governorates belonging to three bioclimatic zones from the North of Tunisia. Molecular survey of A. marginale, A. centrale and A. bovis in cattle showed that average prevalence rates were 4.7% (minimum 4.1% in autumn and maximum 5.6% in summer), 7% (minimum 3.9% in winter and maximum 10.7% in autumn) and 4.9% (minimum 2.7% in spring and maximum 7.3% in summer), respectively. A. phagocytophilum was not detected in all investigated cattle. Seasonal variations of Anaplasma spp. infection and co-infection rates in overall and/or according to each bioclimatic area were recorded. Molecular characterization of A. marginale msp4 gene indicated a high sequence homology of revealed strains with A. marginale sequences from African countries. Alignment of 16S rRNA A. centrale sequences showed that Tunisian strains were identical to the vaccine strain from several sub-Saharan African and European countries. The comparison of the 16S rRNA sequences of A. bovis variants showed a perfect homology between Tunisian variants isolated from cattle, goats and sheep. These present data are essential to estimate the risk of bovine anaplasmosis in order to develop integrated control policies against multi-species pathogen communities, infecting humans and different animal species, in the country. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. La agricultura y el bienestar nacional en el mundo

    Directory of Open Access Journals (Sweden)

    Claudio Bravo Ortega

    2009-01-01

    Full Text Available Las estimaciones de los efectos marginales del bienestar sugieren que el desarrollo agrícola ha tenido importantes efectos positivos en el bienestar nacional, en particular en los países en desarrollo. Los países de la América Latina y del Caribe también se han beneficiado del crecimiento agrícola, pero la producción no agrícola también ha tenido efectos marginales de bienestar, cuya magnitud es mayor que los proporcionados por las actividades agrícolas. Los países industrializados de altos ingresos obtuvieron ganancias marginales positivas de sus actividades no agrícolas, pero los efectos de la agricultura son negativos. Estos cálculos de los efectos marginales de bienestar en las diferentes regiones dependen de estimaciones econométricas de las elasticidades que relacionan las actividades económicas agrícolas y no agrícolas con cuatro elementos propuestos en una función teórica del bienestar nacional: el PIB nacional per capita, el ingreso promedio de los hogares más pobres dentro de los países, los resultados ambientales en lo que se refiere a la contaminación del aire y del agua y la deforestación, y la volatilidad macroeconómica. Los modelos econométricos fueron estimados empleando varias técnicas econométricas que tratan de la causalidad y la heterogeneidad internacional.

  18. Laboratorio de urbanismo emergente: Una mirada sobre los barrios informales de Latinoamérica

    OpenAIRE

    Saez Giraldez, Elia; Roch Peña, Fernando

    2010-01-01

    Se estudian los barrios informales o populares de Latinoamérica, como laboratorios donde comprender procesos urbanos y sociales distintos a los de la ciudad formal contemporánea, lo que puede contribuir a la definición de nuevas herramientas urbanísticas y de sostenibilidad (ambiental, social y urbana) Presentados habitualmente como barrios marginales, degradados y con niveles extremos de pobreza, los barrios populares no son consecuencia de procesos inmobiliarios o de las instituciones, sino...

  19. Estudio de la filtración marginal en la combinación de diferentes adhesivos en obturaciones de clase II y V

    OpenAIRE

    Navarro Majó, José Luis; Jané Noblom, L.; Basilio Monné, J.; Roig Cayón, Miguel; Sentís Vilalta, Juan

    1993-01-01

    Se estudian las filtraciones marginales en obturaciones «in vitro», de clase 11 y V, utilizando cuatro sistemas de adhesión dentinaria diferentes y un composite universal. Se concluye que ninguno de los cuatro productos consigue suprimir totalmente la filtración marginal, que es causada por el composite, a causa de su contracción de polimerización.

  20. LA COGESTION DES RESSOURCES NATURELLES - Abrégé ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    6 oct. 2011 ... L'ENJEU Selon les estimations, de 600 à 900 millions de paysans pauvres habitent les régions marginales, écologiquement fragiles, des pays en développement. Leur survie dépend largement de l'accès aux ressources naturelles qui les entourent, mais la croissance démographique et l'extraction ...

  1. Comparative genomics and transcriptomics of trait-gene association

    Directory of Open Access Journals (Sweden)

    Pierlé Sebastián

    2012-11-01

    Full Text Available Abstract Background The Order Rickettsiales includes important tick-borne pathogens, from Rickettsia rickettsii, which causes Rocky Mountain spotted fever, to Anaplasma marginale, the most prevalent vector-borne pathogen of cattle. Although most pathogens in this Order are transmitted by arthropod vectors, little is known about the microbial determinants of transmission. A. marginale provides unique tools for studying the determinants of transmission, with multiple strain sequences available that display distinct and reproducible transmission phenotypes. The closed core A. marginale genome suggests that any phenotypic differences are due to single nucleotide polymorphisms (SNPs. We combined DNA/RNA comparative genomic approaches using strains with different tick transmission phenotypes and identified genes that segregate with transmissibility. Results Comparison of seven strains with different transmission phenotypes generated a list of SNPs affecting 18 genes and nine promoters. Transcriptional analysis found two candidate genes downstream from promoter SNPs that were differentially transcribed. To corroborate the comparative genomics approach we used three RNA-seq platforms to analyze the transcriptomes from two A. marginale strains with different transmission phenotypes. RNA-seq analysis confirmed the comparative genomics data and found 10 additional genes whose transcription between strains with distinct transmission efficiencies was significantly different. Six regions of the genome that contained no annotation were found to be transcriptionally active, and two of these newly identified transcripts were differentially transcribed. Conclusions This approach identified 30 genes and two novel transcripts potentially involved in tick transmission. We describe the transcriptome of an obligate intracellular bacterium in depth, while employing massive parallel sequencing to dissect an important trait in bacterial pathogenesis.

  2. Disaggregating Tropical Disease Prevalence by Climatic and Vegetative Zones within Tropical West Africa.

    Science.gov (United States)

    Beckley, Carl S; Shaban, Salisu; Palmer, Guy H; Hudak, Andrew T; Noh, Susan M; Futse, James E

    2016-01-01

    Tropical infectious disease prevalence is dependent on many socio-cultural determinants. However, rainfall and temperature frequently underlie overall prevalence, particularly for vector-borne diseases. As a result these diseases have increased prevalence in tropical as compared to temperate regions. Specific to tropical Africa, the tendency to incorrectly infer that tropical diseases are uniformly prevalent has been partially overcome with solid epidemiologic data. This finer resolution data is important in multiple contexts, including understanding risk, predictive value in disease diagnosis, and population immunity. We hypothesized that within the context of a tropical climate, vector-borne pathogen prevalence would significantly differ according to zonal differences in rainfall, temperature, relative humidity and vegetation condition. We then determined if these environmental data were predictive of pathogen prevalence. First we determined the prevalence of three major pathogens of cattle, Anaplasma marginale, Babesia bigemina and Theileria spp, in the three vegetation zones where cattle are predominantly raised in Ghana: Guinea savannah, semi-deciduous forest, and coastal savannah. The prevalence of A. marginale was 63%, 26% for Theileria spp and 2% for B. bigemina. A. marginale and Theileria spp. were significantly more prevalent in the coastal savannah as compared to either the Guinea savanna or the semi-deciduous forest, supporting acceptance of the first hypothesis. To test the predictive power of environmental variables, the data over a three year period were considered in best subsets multiple linear regression models predicting prevalence of each pathogen. Corrected Akaike Information Criteria (AICc) were assigned to the alternative models to compare their utility. Competitive models for each response were averaged using AICc weights. Rainfall was most predictive of pathogen prevalence, and EVI also contributed to A. marginale and B. bigemina prevalence

  3. Disaggregating Tropical Disease Prevalence by Climatic and Vegetative Zones within Tropical West Africa.

    Directory of Open Access Journals (Sweden)

    Carl S Beckley

    Full Text Available Tropical infectious disease prevalence is dependent on many socio-cultural determinants. However, rainfall and temperature frequently underlie overall prevalence, particularly for vector-borne diseases. As a result these diseases have increased prevalence in tropical as compared to temperate regions. Specific to tropical Africa, the tendency to incorrectly infer that tropical diseases are uniformly prevalent has been partially overcome with solid epidemiologic data. This finer resolution data is important in multiple contexts, including understanding risk, predictive value in disease diagnosis, and population immunity. We hypothesized that within the context of a tropical climate, vector-borne pathogen prevalence would significantly differ according to zonal differences in rainfall, temperature, relative humidity and vegetation condition. We then determined if these environmental data were predictive of pathogen prevalence. First we determined the prevalence of three major pathogens of cattle, Anaplasma marginale, Babesia bigemina and Theileria spp, in the three vegetation zones where cattle are predominantly raised in Ghana: Guinea savannah, semi-deciduous forest, and coastal savannah. The prevalence of A. marginale was 63%, 26% for Theileria spp and 2% for B. bigemina. A. marginale and Theileria spp. were significantly more prevalent in the coastal savannah as compared to either the Guinea savanna or the semi-deciduous forest, supporting acceptance of the first hypothesis. To test the predictive power of environmental variables, the data over a three year period were considered in best subsets multiple linear regression models predicting prevalence of each pathogen. Corrected Akaike Information Criteria (AICc were assigned to the alternative models to compare their utility. Competitive models for each response were averaged using AICc weights. Rainfall was most predictive of pathogen prevalence, and EVI also contributed to A. marginale and B

  4. Vergleich zwischen konventionellen und digitalen Abformungen präparierter Zähne : eine in-vivo Studie

    OpenAIRE

    Bosniac, Patricia Alessandra

    2016-01-01

    Das Ziel dieser in-vivo Studie war es, die marginale Diskrepanz von Zirkoniumoxid-Käppchen, die mithilfe zwei direkter und einer indirekten digitalen Abformmethode hergestellt wurden, miteinander zu vergleichen. Insgesamt wurden bei 23 Patienten 63 Zähne zur Aufnahme einer Kronenrestauration präpariert und nachfolgend intraoral digitalisiert sowie konventionell abgeformt. Hierfür wurden die zwei Intraoralscanner CEREC AC Omnicam und Cara TRIOS verwendet. Die konventionelle Abformung wurde ...

  5. Genomic and transcriptomic approaches towards the genetic ...

    African Journals Online (AJOL)

    est une légumineuse indigène sous utilisée enAfrique, mais qui est riche en amidon, avec une quantité raisonnable de proteine. Il reconnu comme étant resistant à la sécheresse, il est capable de pousser et de réaliser un cycle végétatif et reproducteur parfait dans les zones marginales de basse pluiviométrie (<700 mm) ...

  6. Diagnosis of hemoparasitosis trough the spread-smear technique using a drop of blood clot

    OpenAIRE

    Neusa Saltiél Stobbe; Eunice Leonora Chaplin; Maria das Graças de Souza Paiva; Nilton Rogério Santos Silva; Flávio A. Pacheco Araújo; Elinor Fortes

    1992-01-01

    The spread-smear technique using a drop of blood clot and stained by diluted and undimitcd Giemsa stain was evaluated for the search of blood cell types and recognition of Babesia bovis, Babesia bigemina and Anaplasma marginale hemoparasites. The blood clot samples were taken from a 6 month-old calf experimentally inoculated with the blood from a Cattle Tick Fever carrier. The Technique was sumitable for the observation of different blood cells and for the recognition of the hemoparasites.

  7. Genetic Diversity of Tick-Borne Rickettsial Pathogens; Insights Gained from Distant Strains

    Directory of Open Access Journals (Sweden)

    Sebastián Aguilar Pierlé

    2014-01-01

    Full Text Available The ability to capture genetic variation with unprecedented resolution improves our understanding of bacterial populations and their ability to cause disease. The goal of the pathogenomics era is to define genetic diversity that results in disease. Despite the economic losses caused by vector-borne bacteria in the Order Rickettsiales, little is known about the genetic variants responsible for observed phenotypes. The tick-transmitted rickettsial pathogen Anaplasma marginale infects cattle in tropical and subtropical regions worldwide, including Australia. Genomic analysis of North American A. marginale strains reveals a closed core genome defined by high levels of Single Nucleotide Polymorphisms (SNPs. Here we report the first genome sequences and comparative analysis for Australian strains that differ in virulence and transmissibility. A list of genetic differences that segregate with phenotype was evaluated for the ability to distinguish the attenuated strain from virulent field strains. Phylogenetic analyses of the Australian strains revealed a marked evolutionary distance from all previously sequenced strains. SNP analysis showed a strikingly reduced genetic diversity between these strains, with the smallest number of SNPs detected between any two A. marginale strains. The low diversity between these phenotypically distinct bacteria presents a unique opportunity to identify the genetic determinants of virulence and transmission.

  8. Post-mortem hemoparasite detection in free-living Brazilian brown brocket deer (Mazama gouazoubira, Fischer 1814

    Directory of Open Access Journals (Sweden)

    Júlia Angélica Gonçalves da Silveira

    Full Text Available Tick-borne infections can result in serious health problems for wild ruminants, and some of these infectious agents can be considered zoonosis. The aim of the present study was the post-mortem detection of hemoparasites in free-living Mazama gouazoubira from Minas Gerais state, Brazil. The deer samples consisted of free-living M. gouazoubira (n = 9 individuals that died after capture. Necropsy examinations of the carcasses were performed to search for macroscopic alterations. Organ samples were collected for subsequent imprint slides, and nested PCR assays were performed to detect hemoparasite species. Imprint slide assays from four deer showed erythrocytes infected with Piroplasmida small trophozoites, and A. marginale corpuscles were observed in erythrocytes from two animals. A. marginale and trophozoite co-infections occurred in two deer. A nested PCR analysis of the organs showed that six of the nine samples were positive for Theileria sp., five were positive for A. phagocytophilum and three were positive for A. marginale, with co-infection occurring in four deer. The results of the present study demonstrate that post-mortemdiagnostics using imprint slides and molecular assays are an effective method for detecting hemoparasites in organs.

  9. Post-mortem hemoparasite detection in free-living Brazilian brown brocket deer (Mazama gouazoubira, Fischer 1814).

    Science.gov (United States)

    Silveira, Júlia Angélica Gonçalves da; Rabelo, Elida Mara Leite; Lima, Paula Cristina Senra; Chaves, Bárbara Neves; Ribeiro, Múcio Flávio Barbosa

    2014-01-01

    Tick-borne infections can result in serious health problems for wild ruminants, and some of these infectious agents can be considered zoonosis. The aim of the present study was the post-mortem detection of hemoparasites in free-living Mazama gouazoubira from Minas Gerais state, Brazil. The deer samples consisted of free-living M. gouazoubira (n = 9) individuals that died after capture. Necropsy examinations of the carcasses were performed to search for macroscopic alterations. Organ samples were collected for subsequent imprint slides, and nested PCR assays were performed to detect hemoparasite species. Imprint slide assays from four deer showed erythrocytes infected with Piroplasmida small trophozoites, and A. marginale corpuscles were observed in erythrocytes from two animals. A. marginale and trophozoite co-infections occurred in two deer. A nested PCR analysis of the organs showed that six of the nine samples were positive for Theileria sp., five were positive for A. phagocytophilum and three were positive for A. marginale, with co-infection occurring in four deer. The results of the present study demonstrate that post-mortem diagnostics using imprint slides and molecular assays are an effective method for detecting hemoparasites in organs.

  10. Determinación de las características anatómicas de las arterias coronarias de cerdo mediante técnica de inyección con látex

    Directory of Open Access Journals (Sweden)

    Guillermo Rivera

    2015-06-01

    Full Text Available Objetivo: Determinar las características anatómicas de las arterias coronarias del cerdo, mediante inyección con látex. Materiales y métodos: Se usaron 100 corazones de cerdo. Se insertaron sondas Nelaton a través de las arterias coronarias y se les inyectó solución de látex y tinta china. Se determinó el diámetro y el punto de origen para la coronaria derecha, coronaria izquierda, interventricular paraconal y circunfleja. Se cuantificaron el número de ramas diagonales, marginales ventriculares izquierdas y postero laterales. Se determinó frecuencia de ramus intermedius y tipo de dominancia. Se realizó análisis estadístico con un error estándar del 5%, con el Epidat 3,1. Resultados: El 100% de los orígenes anatómicos de las arterias coronarias fueron normales. La dominancia mas frecuente fue la derecha, 73%. El promedio de número de ramas marginales izquierdas, diagonales y posterolaterales fue de 3. La frecuencia de ramus intermedius fue de 12%. El calculo de chi cuadrado de Pearson mostró significancia entre el ramus intermedius y número de ramas marginales izquierdas (p=0,0009. Conclusiones: Las características anatómicas de las arterias coronarias del cerdo son similares a las del humano. El ramus intermedius se comporta como una primera rama marginal izquierda y no como una primera rama diagonal como lo afirman algunos autores.

  11. Uveitis due to anaplasmosis in a newborn Holstein calf Uveíte por anaplasmose em bezerro da raça Holandesa

    Directory of Open Access Journals (Sweden)

    J.L. Laus

    2006-12-01

    Full Text Available Relata-se o caso de um bovino com, aproximadamente, seis horas de vida, apresentando histórico de febre, apatia, inapetência e desconforto ocular. No exame oftálmico rotineiro, encontraram-se valores do teste da lágrima de Schirmer aumentados, diminuição da pressão intra-ocular, hemorragia conjuntival, uveíte anterior, edema corneal e injeção ciliar em ambos os olhos. Coletou-se amostra de sangue para realização de esfregaço sangüíneo, hemograma e bioquímica sérica. No esfregaço visibilizaram-se corpúsculos de Anaplasma marginale em hemácias parasitadas. Quanto à bioquímica sérica, não foram observadas alterações. Os mesmos exames foram realizados na mãe do animal tendo como resultado a positividade para A. marginale. Para o controle da uveíte foi utilizada uma única aplicação de 0,5ml de betametasona a 5%, por via subconjuntival, em cada um dos olhos. Para o tratamento da anaplasmose, seguiu-se o protocolo a base de 10mg/kg de oxitetraciclina, por via intramuscular profunda, a cada 12 horas. Diante os achados oftálmicos e a presença de corpúsculos de A. marginale em hemácias parasitadas, contatou-se, ser um caso de uveíte crônica secundaria a doença sistêmica, factível com Anaplasmose.

  12. Molecular detection of tick-borne bacteria and protozoa in cervids and wild boars from Portugal.

    Science.gov (United States)

    Pereira, André; Parreira, Ricardo; Nunes, Mónica; Casadinho, Afonso; Vieira, Maria Luísa; Campino, Lenea; Maia, Carla

    2016-05-10

    Wildlife can act as reservoir of different tick-borne pathogens, such as bacteria, parasites and viruses. The aim of the present study was to assess the presence of tick-borne bacteria and protozoa with veterinary and zoonotic importance in cervids and wild boars from the Centre and South of Portugal. One hundred and forty one blood samples from free-ranging ungulates including 73 red deer (Cervus elaphus), 65 wild boars (Sus scrofa) and three fallow deer (Dama dama) were tested for the presence of Anaplasma marginale/A. ovis, A. phagocytophilum, Anaplasma/Ehrlichia spp., Babesia/Theileria spp., Borrelia burgdorferi (sensu lato) (s.l.), and Rickettsia spp. DNA by PCR. Anaplasma spp. DNA was detected in 33 (43.4 %) cervids (31 red deer and two fallow deer) and in two (3.1 %) wild boars while Theileria spp. were found in 34 (44.7 %) cervids (32 red deer and two fallow deer) and in three (4.6 %) wild boar blood samples. Sequence analysis of msp4 sequences identified A. marginale, A. ovis, while the analysis of rDNA sequence data disclosed the presence of A. platys and A. phagocytophilum and T. capreoli and Theileria sp. OT3. Anaplasma spp./Theileria spp. mixed infections were found in 17 cervids (22.4 %) and in two wild boars (3.1 %). All samples were negative for Babesia sp., B. burgdorferi (s.l.), Ehrlichia sp. or Rickettsia sp. This is the first detection of Anaplasma marginale, A. ovis, A. phagocytophilum, A. platys, Theileria capreoli and Theileria sp. OT3 in cervids and wild boars from Portugal. Further studies concerning the potential pathogenicity of the different species of  Anaplasma and Theileria infecting wild ungulates, the identification of their vector range, and their putative infectivity to domestic livestock and humans should be undertaken.

  13. Estimates of repeatability and correlations of hemoparasites infection levels for cattle reared in endemic areas for Rhipicephalus microplus.

    Science.gov (United States)

    Giglioti, Rodrigo; de Oliveira, Henrique Nunes; Bilhassi, Talita Barban; Portilho, Amanda Izeli; Okino, Cintia Hiromi; Marcondes, Cintia Righetti; de Sena Oliveira, Marcia Cristina

    2018-01-30

    Rhipicephalus microplus is a vector of cattle tick fever, a disease caused by the protozoans Babesia bovisand B. bigemina, and also anaplasmosis, produced by the Rickettsiales Anaplasma marginale. These tick-borne pathogens cause considerable losses to Brazilian livestock breeders and represent an obstacle to the expanded use of taurine breeds due to their higher sensitivity to ticks and hemoparasites compared to zebu breeds. Differences in the susceptibility to hemoparasites were also verified within breeds, suggesting that may be possible to select a most resistant phenotype. Therefore, repeatability of R. microplus counts and copy number of hemoparasites DNA were estimated, along with correlations between themselves, aiming to verify if those measures can be used as parameters to classify animals according to their parasite resistance degrees. Forty-two Canchim females kept on pastures naturally infested by ticks were evaluated for the level of infestation by R. microplus and infection by B. bovis, B. bigemina, and A. marginale. Twenty-four evaluations were performed once a month, for adult female ticks counts and blood samplings. The experimental period was divided into four phases, according to the animals age range: Phase 1: 8 to 13 months (collections 1 to 6); phase 2: 14 to 19 months (collections 7 to 12); phase 3: 20 to 25 months (collections 13 to 18), and phase 4: 26 to 31 months (collections 19 to 24). Blood samples were submitted to absolute quantification of hemoparasites DNA sequences using qPCR. The hemoparasite and tick counts data were transformed for normalization and were analyzed using mixed models. Among three species of hemoparasites studied, A. marginale presented the highest level of infection. During phase 3, B. bigemina presented higher infection levels (p hemoparasites and ticks. Moreover, the animal age may be an important factor related to resistance against these pathogens. The data obtained shed more light on the resistance to

  14. Proyecto paisajístico de las márgenes del Río Paute en el área urbana de la ciudad de Paute, sector Zhumir-Chicty

    OpenAIRE

    Pesántez, Xavier

    2008-01-01

    Durante varios años ha existido una mala práctica en la utilización de las márgenes de los ríos de nuestras ciudades, han sido vertederos de escombros y de aguas putrefactas, se han construido avenidas marginales, canalizado quebradas, eliminado especies vegetativas, eliminando procesos ecológicos importantes. Esta tesis de diseño paisajístico pretende ser un primer paso en la estructuración del territorio y quizás un modelo para futuras aplicaciones de diseño de espacios más reducidos que s...

  15. Effet du compost à base de Calotropis procera (Aiton) W.T. Aiton sur ...

    African Journals Online (AJOL)

    Objectifs: Une étude à base de compost de Calotropis procera a été menée afin de mesurer l'effet sur la production de l'arachide sur de sols pauvres. Méthodologie et résultats: L'essai a été conduit sur le site de Doyaba au niveau des zones marginales du Tchad avec la variété fleur 11 d'arachide (Arachis hypogaea L.) ...

  16. Cooperativas de pescadores artesanales y habitantes ribereños del Paraná: una experiencia de economía solidaria

    OpenAIRE

    Petean, Julieta; Capatto, Jorge

    2011-01-01

    Los pescadores artesanales y de subsistencia que integran las cooperativas de la costa del Paraná, objeto del presente trabajo, forman parte de un sector de muy bajos ingresos económicos que vive en zonas ribereñas marginales de los centros urbanos costeros o en comunidades dispersas y aisladas ubicadas en áreas casi siempre expuestas a riesgos de inundación. La formación de estas cooperativas forma parte del trabajo desarrollado en torno a la conservación de la diversidad biológica y cultura...

  17. Jefaturas femeninas : una aproximación a la feminización de la pobreza y de la responsabilidad en familias desplazadas por la violencia

    OpenAIRE

    Yuri Romero-Picón; Yuri Chávez-Plazas

    2013-01-01

    Los autores exploran el tema de las jefaturas femeninas en un grupo de mujeres que fueron desplazadas por la violencia y llegaron a vivir a barrios marginales del municipio de Soacha, colombia, donde factores como el bajo nivel de escolaridad, los trabajos mal remunerados a los que tienen acceso, los problemas afectivos y el peso de responder solas con sus hogares agravan su situación de pobreza. En este contexto, la jefatura femenina es un rol que deben asumir para enfrentar la pobreza bajo...

  18. Ciudades hechas a mano

    OpenAIRE

    Andreatta, Verena

    2014-01-01

    Favelas, tugurios, pueblos jóvenes, villas miseria, villas de emergencia, barriadas de ranchitos... son los nombres que reciben los asentamientos marginales en Brasil, Perú, Argentina, Colombia y Venezuela; diversos apelativos y la misma imagen tópica de la pobreza y de la construcción informal de los barrios populares en América Latina. Se trata de un fenómeno que surgió unánimemente en el paisaje urbano de este continente hace casi un siglo, y que tiene su expresión análoga en todas las gra...

  19. Jefaturas femeninas : una aproximación a la feminización de la pobreza y de la responsabilidad en familias desplazadas por la violencia

    Directory of Open Access Journals (Sweden)

    Yuri Romero-Picón

    2013-01-01

    Full Text Available Los autores exploran el tema de las jefaturas femeninas en un grupo de mujeres que fueron desplazadas por la violencia y llegaron a vivir a barrios marginales del municipio de Soacha, colombia, donde factores como el bajo nivel de escolaridad, los trabajos mal remunerados a los que tienen acceso, los problemas afectivos y el peso de responder solas con sus hogares agravan su situación de pobreza. En este contexto, la jefatura femenina es un rol que deben asumir para enfrentar la pobreza bajo el principio de responsabilidad hacia sus hijos y seres queridos.

  20. Jefaturas femeninas: una aproximación a la feminización de la pobreza y de la responsabilidad en familias desplazadas por la violencia

    OpenAIRE

    Romero-Picón, Yuri

    2013-01-01

    Resumen Los autores exploran el tema de las jefaturas femeninas en un grupo de mujeres que fueron desplazadas por la violencia y llegaron a vivir a barrios marginales del municipio de Soacha, Colombia, donde factores como el bajo nivel de escolaridad, los trabajos mal remunerados a los que tienen acceso, los problemas afectivos y el peso de responder solas con sus hogares agravan su situación de pobreza. En este contexto, la jefatura femenina es un rol que deben asumir para enfrentar la pobre...

  1. Análisis del impacto de la implementación de la red internet en el sistema educativo fiscal promario del cantón Pelileo para el periodo 2005-2010

    OpenAIRE

    Viteri Galarza, Fernando Paúl

    2012-01-01

    Sabiendo que la brecha tecnológica existente en los sectores menos favorecidos, como son las áreas rurales y urbano marginales del Ecuador, se incrementa cada vez más debido a una inexistente infraestructura de telecomunicaciones, el gobierno a través del Ministerio de Telecomunicaciones y la sociedad de la información MINTEL, ha ejecutado el proyecto de implementación de la red de internet en el sistema educativo público primario del cantón Pelileo, permitiendo a la comunidad ...

  2. Mercadotecnia transfronteriza de servicios de salud en Tijuana

    Directory of Open Access Journals (Sweden)

    José Guadalupe Vargas Hernández

    2005-07-01

    Full Text Available Este artículo analiza las ventajas competitivas de la venta de servicios de salud en la región fronteriza de Tijuana - San Diego. En tanto muchos mexicanos y en general latinos pudientes viajan a Estados Unidos en procura de medicina especializada, muchos hispanos centroamericanos y norteamericanos provenientes de los sectores marginales buscan en México servicios de salud baratos. Este estudio ahonda en aspectos ideológicos, políticos y culturales de un campo específico de la economía transfronteriza en una zona de amplia integración económica.

  3. Recycling No-man’s-land

    OpenAIRE

    Domènech Rodríguez, Marta; López López, David; Palumbo Fernández, Mariana

    2012-01-01

    La cultura del usar y tirar ha imperado en los últimos tiempos y el culto a lo nuevo ha también la arquitectura. Del mismo modo en que se descartan productos de consumo que todavía por los nuevos modelos, se planifican barrios completamente nuevos sobre suelos no urbanizados que provocan la expansión de las ciudades en forma de mancha de aceite, ignorando la de espacios ya urbanizados que se rechazan por ser tejidos industriales o socialmente marginales. Pero,¿No debería ser imperativo recic...

  4. Virtual&Real: un’ipotesi per la realizzazione di un museo integrato.

    Directory of Open Access Journals (Sweden)

    Luigi Guerra

    2008-07-01

    Full Text Available Nonostante siano numerosi i musei italiani ad avere un sito Web di riferimento, l’analisi effettuata rileva un uso della rete e delle specificità della telematica assolutamente marginale. Il sito Web solo in rari casi si presenta come estensione del museo stesso, per lo più è una semplice vetrina che offre informazioni pratiche. L’ipotesi presentata nell’articolo ipotizza un uso della rete più complesso, in grado di anticipare estendere e consolidare le conoscenze apprese durante la visita al museo reale.

  5. Turismo en el valle del Colca y sus impactos en el desarrollo

    OpenAIRE

    Córdova Aguilar, Hildegardo

    2014-01-01

    El turismo es una actividad que se viene proponiendo como la salida a los cuellos de botella que aparecen en la gestión de los procesos de desarrollo en territorios marginales, tal como es el caso de los Andes. La pobreza de las poblaciones que viven en zonas montañosas obliga a repensar las formas de desarrollo, para que las mismas les permitan una transferencia real de bienes materiales y los lleven a elevar su calidad de vida. Estos bienes, por lo general, no se producen localmente y ello ...

  6. Exorcismos del lenguaje. Letanías e incomunicación: voces de Chernóbil.

    OpenAIRE

    García Pérez, Manuel

    2009-01-01

    Frente a la actual retórica política de discursos informativamente previsibles donde la deslexicalización de los conceptos es cada vez más frecuente, existen publicaciones marginales que reflejan crudos testimonios de realidades objetivables no contempladas por los discursos mediáticos de las actuales socialdemocracias. La inefabilidad del dolor se transcribe entonces en una fragmentación recurrente de estructuras expresivas, más allá de la mitificación de convenciones lingüísticas tan repeti...

  7. La agricultura en la ciudad de Buenos Aires

    OpenAIRE

    Gallardo Araya, Nela Lena

    2012-01-01

    En diferentes lugares de la ciudad existe una amplia gama de experiencias vinculadas con la producción que incluye desde pequeñas macetas en los balcones hasta florecientes terrenos ubicados en espacios públicos y/o privados. Desde las ciencias agropecuarias, los fenómenos vinculados a la agricultura urbana son temas marginales; no obstante, se presentan valiosas discusiones que dan cuenta de la gran diversidad de prácticas y la importancia que tienen en el contexto actual. Uno de los aportes...

  8. Le tourisme à moto : les géographies renouvelées d'un phénomène marginal

    OpenAIRE

    Scol, Jean

    2017-01-01

    Le tourisme à moto répond souvent à des pratiques marginales et codes particuliers pour lesquels la route, le pilotage et la camaraderie jouent des rôles essentiels. Les concentrations sont un exemple représentatif des spécificités et du caractère marginal de ce tourisme. Le tourisme à moto fut, par ailleurs, longtemps ignoré voire rejeté par les territoires et les professionnels du tourisme qui gardaient de la moto et du motocycliste une image négative. Or, les motards ont changé. Ils sont, ...

  9. Reconstrucción paleoambiental y asociaciones de foraminiferos de la formación Tubará (plioceno temprano), sección Arroyo Piedras (norte de Colombia)

    OpenAIRE

    Molinares Blanco, Carlos Eduardo

    2007-01-01

    La Formación Tubará en el Arroyo Piedras (169 m) es dividida en tres segmentos, interpretados como producto de la sedimentación en ambientes marino marginales relacionados con la evolución del paleo-delta del río Magdalena durante el Plioceno Temprano: El segmento inferior, es interpretado como resultado de sedimentación siliciclástica en una llanura aluvial/deltaica; el segmento intermedio, como el resultado de sedimentación lagunar y/o en pantanos costeros y el superior, como la transición ...

  10. Los sistemas aluviales miocenos del borde noreste de la Cuenca de Madrid: sector Cifuentes - Las Inviernas (Guadalajara)

    OpenAIRE

    Alonso-Zarza, Ana María; Calvo Sorando, José Pedro; García del Cura, M. Ángeles; Hoyos,, M.

    1990-01-01

    El relleno mioceno en el borde noreste de la Cuenca de Madrid aparece constituido por varios complejos detríticos que se desarrollan a partir de los relieves mesozoicos de la Cordillera Ibérica, que constituye en este área el borde de la cuenca terciaria. Se definen esencialmente dos tipos de sistemas deposicionales dentro de las áreas marginales de la cuenca: abanicos aluviales y depósitos de ladera. Dentro de los primeros, que constituyen los elementos de mayor envergadura y los contribu...

  11. La subjetividad de la sociedad de trabajo

    OpenAIRE

    Hinkelammert, Franz

    2005-01-01

    El ensayo tiene como propósito lanzar una llamada de atención crítica ante una serie de fenómenos de índole política, económica y social que se gestan actualmente en el orden mundial. Describe, de manera amplia, cómo la globalización alimentada por un nuevo capitalismo evolucionado y la burocracia de las trasnacionales socavan lasensibilidad social del trabajo, el núcleo de identidad cultural de los pueblos y la democracia, transformándolas en fraudulentas y marginales, a la vez que contempla...

  12. Vigencia y garantía de los derechos en las políticas petroleras en el año 2011

    OpenAIRE

    Almeida, Alexandra

    2012-01-01

    Evidencia las consecuencias de la aplicación de la política petrolera impulsada por la reforma de la Ley de Hidrocarburos que incluye la entrega de campos maduros a empresas privadas; la décima ronda de licitaciones para entregar campos marginales y la décimo primera ronda de licitaciones para concesionar los bloques del sur de la Amazonía, lo que conlleva violaciones de los derechos de las poblaciones que residen en los campos de explotación y amenazan a nuevas poblaciones. Estas poblaciones...

  13. Bayesian Analysis of Multivariate Threshold Autoregressive Models with Missing Data

    OpenAIRE

    Calderón Villanueva, Sergio Alejandro

    2014-01-01

    Resumen. En algunos campos, nos vemos forzados a trabajar con datos faltantes en series de tiempo multivaridas, desafortunadamente el análisis en este contexto no puede ser hecho como en caso completo. El análisis de modelos multivaridos autoregresivos de umbrales(MTAR) con entradas exógenas y datos faltantes es llevado a cabo vía el enfoque Bayesiano. Los métodos MCMC son usados para obtener muestras de las distribuciones marginales aposteriori, incluyendo los valores de los umbrales y los d...

  14. TEORIA MICROECONOMICA DE LAS ECONOMIAS CAMPESINAS

    OpenAIRE

    Rubiano, Jorge Enrique; Peña, Enrique

    2012-01-01

    Los autores abordan la irrelevancia de categorías teóricas macroeconómicas sobre los estudios de economía campesina, haciendo énfasis en la importancia macroeconómica y variables de tipo social y cultural inherentes a la misma.La intervención del Estado al interior del sector agro pecuario es implícitamente un cuestionamiento a la teoría de la redistribución de los factores productivos a través de las productividades marginales, pero no se orienta a buscar una redistribución del ingreso y la ...

  15. Almidón modificado de yuca como sustituto económico del agente solidificante para medios de cultivo de tejidos vegetales

    OpenAIRE

    Romay, Gustavo; Matehus, Juan; Gerstl, Armando; Rueda, Rodrigo; Santana, María A

    2006-01-01

    Con una historia de más de cinco décadas, los beneficios del cultivo de tejidos vegetales (CTV) no han llegado a los agricultores de las regiones más necesitadas. El problema radica en la complejidad y costo de aplicación de la técnica. En Venezuela, la yuca (Manihot esculenta Crantz) es cultivada en suelos marginales por agricultores de escasos recursos. Las limitaciones del cultivo son la carencia de semilla sana y los bajos niveles de rendimiento. Esta situación puede superarse mediante el...

  16. Relación del desarrollo cognitivo con el clima familiar y el estrés de la crianza

    OpenAIRE

    Vera Noriega,José Ángel; Morales Nebuay,Dulce Karina; Vera Noriega,Cristina

    2005-01-01

    Se llevo a cabo un estudio con 120 familias en pobreza extrema de las zonas marginales de Hermosillo, Sonora México. Madres de 32 años en promedio respondieron a una escala de funcionamiento familiar, estrés de la crianza y sus niños fueron medidos en desarrollo cognitivo. El objetivo fue evaluar las diferencias significativas entre los tres tipos de familias en su desarrollo cognitivo, el estrés de la crianza y el clima familiar. Se clasificaron las familias en base a la medida de clima fami...

  17. Relationship of the cognitive development with the family clime and stress of the childrearing

    OpenAIRE

    Vera Noriega, José Ángel; Morales Nebuay, Dulce Karina; Vera Noriega, Cristina

    2005-01-01

    Se llevo a cabo un estudio con 120 familias en pobreza extrema de las zonas marginales de Hermosillo, Sonora México. Madres de 32 años en promedio respondieron a una escala de funcionamiento familiar, estrés de la crianza y sus niños fueron medidos en desarrollo cognitivo. El objetivo fue evaluar las diferencias significativas entre los tres tipos de familias en su desarrollo cognitivo, el estrés de la crianza y el clima familiar. Se clasificaron las familias en base a la medida de clima fami...

  18. Resultados de un sistema para la vigilancia de caries de la infancia temprana

    OpenAIRE

    Eduardo BERNABÉ ORTIZ; Elsa Karina DELGADO-ANGULO; Pablo César SÁNCHEZ-BORJAS

    2006-01-01

    Objetivo: Describir los resultados de un sistema, implementado con los estudiantes de la Facultad de Estomatología Roberto Beltrán Neira, para la vigilancia de caries de la infancia temprana (CIT) en niños entre 6 y 36 meses de edad de comunidades urbano-marginales de Sol Naciente de Carabayllo. Materiales y métodos: Sesenta y dos de los 97 niños que aceptaron participar en la evaluación inicial durante el semestre 2004-I, fueron reexaminados a los 12 (semestre 2005-I) y 18 meses (semestre 20...

  19. Infecção natural por hemoparasitos em bezerros submetidos à quimio-profilaxia aos 30 dias de idade Natural infection by hemoparasites in calves submitted to chemo -prophylaxis wonder 30 days of age

    Directory of Open Access Journals (Sweden)

    Rosângela A. Da Silva

    2007-09-01

    Full Text Available O complexo Tristeza Parasitária acarreta grandes prejuízos à pecuária bovina nacional. Os principais agentes etiológicos são Babesia bigemina, B. bovis e Anaplasma marginale, sendo o carrapato Boophilus microplus o principal vetor. Este trabalho relata a ocorrência de infecção natural por hemoparasitos da tristeza parasitária bovina em 36 bezerros com alta infestação natural por carrapatos e submetidos à quimioprofilaxia aos 30 dias de idade. Babesia bigemina (33,3%, B. bovis (11,1% e A. marginale (13,9% foram detectados em esfregaços sangüíneos de 16 animais (44,4% de diferentes idades. Seis bezerros apresentaram sintomas (16,7% e um morreu (2,8%. O número de casos clínicos foi decorrente de uma associação de fatores, destacando-se a alta infestação precoce por carrapatos e a baixa imunidade passiva em período em que os bezerros ainda não haviam desenvolvido imunidade ativa suficiente.The tick-borne disease (TBD brings great damages to cattle breeding. The most important etiologic agents are Babesia bigemina, B. bovis and Anaplasma marginale, being the tick Boophilus microplus the main vector. This work reports the occurrence of natural infection by hemoparasites of TBD in 36 calves with high ticks natural infestation submitted to chemoprophylaxis with 30 days year-old. The blood smears from animals of different ages were analized and were found B. bigemina (33.3%, B. bovis (11.1% and A. marginale (13.9%. Six animals had clinical symptoms (16.7% and one dead (2.8%. The number of clinical cases ocurred in consequence of an association of factors as high infestation of ticks and low passive immunity in period that calves had not developed enough active immunity.

  20. Diagnosis of hemoparasitosis trough the spread-smear technique using a drop of blood clot

    Directory of Open Access Journals (Sweden)

    Neusa Saltiél Stobbe

    1992-12-01

    Full Text Available The spread-smear technique using a drop of blood clot and stained by diluted and undimitcd Giemsa stain was evaluated for the search of blood cell types and recognition of Babesia bovis, Babesia bigemina and Anaplasma marginale hemoparasites. The blood clot samples were taken from a 6 month-old calf experimentally inoculated with the blood from a Cattle Tick Fever carrier. The Technique was sumitable for the observation of different blood cells and for the recognition of the hemoparasites.

  1. Malnutrición de micronutrientes. Estrategias de prevención y control.

    OpenAIRE

    Carlos Hernán Daza

    2009-01-01

    Las deficiencias de vitaminas y minerales afectan especialmente a madres y niños en áreas rurales y marginales de las grandes ciudades de los países en desarrollo, debido al consumo insuficiente de alimentos ricos en estos nutrientes, a infecciones recurrentes y síndromes de mala absorción. La fortificación de alimentos de consumo habitual y la suplementación de nutrientes deficitarios en la alimentación previenen la malnutrición de micronutrientes. En Colombia se fortifica la harina de trigo...

  2. The freedom of knowledge : Asphalt ’s Academic and Children in the Academic Situation

    Directory of Open Access Journals (Sweden)

    Mônica Mesquita

    2013-01-01

    Full Text Available El propósito aquí es discutir sobre el proceso del encuentro que tuvo lugar en la cal le de asfalto de São Paulo - los hijos de asfalto y los académicos de asfalto. Las raíces del principal argumento se centran en la visión sociológica del mundo y en la postura de las etnomatemáticas, que se desarro llaron a través de un proyecto de investigación de doctorado. El acercamiento de posiciones marginales y no marginales y voces produce y es una práctica social activista. El objetivo de observar est e encuentro es alimentar el fin de verbalismo y el comienzo de un conocimien to situado que está acopl ada con nuestra vida cotidiana , con nuestro propio ser de búsqueda de equidad en los actos de investigación.

  3. CO{sub 2} emission costs and Gas/Coal competition for power production; Prezzi delle emissioni di CO{sub 2} e competivita' gas/carbone per la produzione termoelettrica

    Energy Technology Data Exchange (ETDEWEB)

    Santi, Federico [La Sapienza Univ., Roma (Italy). Dipartimento di Ingegneria Nucleare e Conversioni dell' Energia

    2005-05-01

    This paper demonstrates how a CO{sub 2} emission reduction programme can change the competition between the two power production technologies which will probably dominate the future of the Italian power industry: the coal fired USC steam power plant and the natural gas fired CCGT power plant. An economic value of the CO{sub 2} emission is calculated, in order to make the short-run-marginal-cost (or the long-run-marginal-cost). equal for both technologies, under a CO{sub 2} emission trading scheme and following a single-plant specific CO{sub 2} emission homogenizing approach. [Italian] Si dimostra come un programma teso alla riduzione delle emissioni di CO{sub 2} possa mutare la competivita' tra le due tecnologie per la produzione termoelettrica che saranno dominanti nel prossimo futuro in Italia: le centrali a carbone USC e le centrali CCGT a gas naturale. Si calcola il prezzo delle emissioni di CO{sub 2} per valutare il costo marginale di breve periodo (o il costo marginale di lungo periodo) per entrambe le tecnologie, avvalendosi di un programma di emission trading e utilizzando un approccio di omogeneizzazione delle emissioni di CO{sub 2} specifiche di ogni impianto.

  4. Las artes de leer e interpretar las hojas de coca

    Directory of Open Access Journals (Sweden)

    Eugenia Flores

    2017-03-01

    Full Text Available En este artículo quisiera hablar sobre un oficio secreto, subterráneo, clandestino, que es el arte de leer e interpretar las hojas de coca en espacios marginales del valle de Salta. Muestro en estas páginas las diferentes formas y modos en que la coca es utilizada por la población local, diversa y heterogénea, donde tradiciones indígenas ancestrales se manifiestan en prácticas concretas que rozan los límites entre la magia y la terapia. Presto especial interés, a partir del trabajo de campo realizado, a aquellas personas que manejan estas artes de leer las hojas de coca, las cuales en los casos analizados fueron adquiridas a partir de un ritual de paso, que fue el haber sido “tocado por el rayo”. Me interesa particularmente trabajar con estos hombres y mujeres, cuyo arte de hacer con coca es equiparable a las “maneras de hacer”. Estas maneras de hacer con la coca ritual no están visibilizadas y son subterráneas, marginales y silenciosas, en este artículo se pretende dar cuenta de estas prácticas con coca y sus dinámicas relaciones inter e intra comunales. Palabras-claves: Artes; maneras de hacer; coca; ritual.

  5. Evaluation of an indirect ELISA for the diagnosis of Babesia bovis in Uruguay

    International Nuclear Information System (INIS)

    Cardozo, H.; Solari, M.A.; Etchebarne, J.

    1992-01-01

    In initially establishing the FAO/IAEA indirect ELISA for the detection of antibodies to Babesia bovis, the optical density (OD) values of sera from known positive or negative local cattle were compared to the OD values obtained from the negative and positive reference sera provided with the ELISA kit. The percentage of false positive and negative sera were 2.53% and 2.97% respectively. The cut-off values for the negative reference serum in the kit were compared with those of a local negative population. These values were found to be similar. The specificity of the test was evaluated by testing 30 sera from animals experimentally infected with Anaplasma marginale and 30 sera from animals infected with Babesia bigemina. These were no cross-reaction either between A. marginale and B. bovis or between B. bigemina and B. bovis. A serological survey using this ELISA kit was carried out on animals from an enzootic area and an area free from the vecot Boophilus microplus. 53 out of 282 animals (18.8%) in the enzootic area were positive whilst all the animals (113) from the free area were negative. This study would indicate that the FAO/IAEA ELISA kit has a sensitivity of around 98% and specificity of 97%. (author). 8 refs, 2 figs, 2 tabs

  6. LA MARGINALIDAD EN RELACIÓN A LA IDENTIDAD: LA LITERATURA DE PERIFERIA Y EL EMPODERAMIENTO CULTURAL DE SUS SUJETOS

    Directory of Open Access Journals (Sweden)

    Lais Botelho das Neves

    2016-03-01

    Full Text Available El estudio de la cultura brasileña se constituye en un área interdisciplinar y que involucra a un número significativo de obras y autores, de modo que los enfoques propuestos terminan seleccionando sólo algunos considerados más representativos, sin embargo, estos son selecciones arbitrarias y que por lo general desconsideran las contribuciones de las vertientes marginales del pensamiento y de la sociedad. De esta manera, en este artículo se intenta discutir sobre el lugar de la literatura marginal en el interior del pensamiento social brasileño, destacándose, en este sentido, su espacio social y su relevancia en relación a la dimensión capaz de colaborar con la construcción de la identidad de las poblaciones marginados. En este sentido, se verifica que si inicialmente fueron atribuidas connotaciones negativas a la marginalidad, a partir de la ocupación de un espacio de enunciación, eso fue re conceptuado, siendo asumida por individuos marginales, escritores o no, como una dimensión constructora de la identidad.

  7. Prevalence Survey of Selected Bovine Pathogens in Water Buffaloes in the North Region of Brazil

    Directory of Open Access Journals (Sweden)

    Jenevaldo Barbosa da Silva

    2014-01-01

    Full Text Available Although the largest buffalo herd in the occident is in the north region of Brazil, few studies have been conducted to assess the prevalence of selected parasitic diseases in buffalo herd. The present study was therefore conducted to investigate the epidemiological of Toxoplasma gondii, Neospora caninum, Anaplasma marginale, Babesia bigemina, and Babesia bovis in water buffaloes in the north region of Brazil. A total of 4796 buffalo blood samples were randomly collected from five provinces and simultaneously analyzed by the IFAT and ELISA. The serological prevalence of T. gondii and N. caninum was 41.3% and 55.5% in ELISA and 35.7% and 48.8% in IFAT, respectively. The overall prevalence of A. marginale, B. bovis, and B. bigemina was 63%, 25%, and 21% by ELISA and 50.0%, 22.5%, and 18.8% by IFAT, respectively. This study shows valuable information regarding the serological survey of selected bovine pathogens in water buffaloes in the north region of Brazil which will likely be very beneficial for the management and control programs of this disease.

  8. Targeting ticks for control of selected hemoparasitic diseases of cattle.

    Science.gov (United States)

    Kocan, K M

    1995-03-01

    Development in and transmission of hemoparasites by tick vectors are phenomena closely synchronized with the tick feeding cycle. In all known life cycles, initial infection of tick tissues occurs in midgut epithelial cells and transmission is effected as ticks feed after parasites have developed and multiplied in salivary glands. Many factors reviewed affect development and transmission of hemoparasites by ticks including age of ticks, artificial temperature, climate and/or season, tick stage or sex, hemoparasite variation, concurrent infection of ticks with other pathogens, host cell susceptibility, transovarial transmission, effect of hemoparasites on tick biology, and the effect of infecting parasitemia level in cattle on infection rates in ticks. Four hemoparasites of cattle, Anaplasma marginale, Cowdria ruminantium, Theileria parva, and Babesia spp., are all dependent on ticks for biological transmission. Babesia is transmitted transovarially whereas the other three are transmitted transstadially. Mechanical transfer of infective blood via fomites and mouthparts of biting arthropods is also a major means of transmission for Anaplasma marginale but not of the others. Potential control methods for hemoparasites that target parasites as they are developing in their respective tick hosts include tick control, vaccines (against ticks and parasites), and drugs (against ticks and parasites). Successful application of control strategies will be dependent upon thorough understanding of parasite developmental cycles, biology of the tick vectors and the immune response of cattle to ticks and to hemoparasites. The most effective control measures will be those that are targeted against both ticks and the hemoparasites they vector.

  9. Use of multiplex polymerase chain reaction-based assay to conduct epidemiological studies on bovine hemoparasites in Mexico.

    Science.gov (United States)

    Figueroa, J V; Alvarez, J A; Ramos, J A; Vega, C A; Buening, G M

    1993-01-01

    A study was conducted to test the applicability of a Polymerase Chain Reaction (PCR)-based approach for the simultaneous detection of the bovine hemoparasites Babesia bigemina, B. bovis and Anaplasma marginale. Bovine blood samples from cattle ranches of a previously determined enzootic zone in the Yucatan Peninsula of Mexico, were collected from peripheral blood and processed for PCR analysis. Blood samples were subjected to DNA amplification by placing an aliquot in a reaction tube containing oligonucleotide primers specific for DNA of each hemoparasite species. The PCR products were detected by Dot-Blot nucleic acid hybridization utilizing nonradioactive, species-specific, digoxigenin PCR-labeled DNA probes. Four hundred twenty one field samples analyzed by the multiplex PCR-DNA probe assay showed 66.7%, 60.1% and 59.6% prevalence rates for B. bigemina, B. bovis and A. marginale, respectively. The multiplex PCR analysis showed that animals with single, double or triple infection could be detected with the parasite specific DNA probes. The procedure is proposed as a valuable tool for the epidemiological analysis in regions where the hemoparasite species are concurrently infecting cattle.

  10. Multiple-city e Smart-city. OPEN-DOMINO nei territori marginali e interrotti dell’estremo sud / Multiple-city and smart-city. OPEN-DOMINO in the marginal and interrupted areas of the far south

    Directory of Open Access Journals (Sweden)

    Marina Tornatora

    2015-07-01

    Full Text Available Il patrimonio edilizio esistente oggi è inadeguato alle esigenze della contemporaneità e pone all’architettura la necessità di sperimentare modalità d’intervento, implementate dalle nuove tecnologie ma all’interno dei propri strumenti espressivi e del proprio universo tecnico costruttivo. Un’esperienza didattica su un quartiere marginale della periferia meridionale, preso come campione emblematico, è l’occasione per rielaborare il modello base ricorrente - Maison Domino - come un sistema aperto. / Today The existing building is inadequate to contemporary needs and this raises to architecture the need to experiment with methods of intervention, implemented by new technologies but within its own universe of expressive tools and technical constructive. Teaching experience on a marginal neighborhood of the southern suburbs, taken as a typical example, is an opportunity to rework the model recurring basis - Maison Domino - as an open system.

  11. Reduktion av slöseri inom den spanska ölindustrin : – en studie av åtgärder och metoder i spåren av krisen

    OpenAIRE

    Carlström, Carl

    2014-01-01

    Den rådande eurokrisen har påverkat det spanska samhället och den spanska ölindustrin negativt. Industrin står inför utmaningar vad gäller minskad försäljning och förändrade kundpreferenser. I tider då intäkterna och försäljningen minskar finns det många sätt att öka sina marginaler. Ett av detta sätt är att börja arbeta med resurseffektivitet och att se till att slöseriet av de resurser man har minskar. De frågor studien besvarar är hur bryggeriindustrin i Spanien har arbetat för att minska ...

  12. El plurilingüismo y la parodia: dos armas de combate textual para el emperador tertuliano

    OpenAIRE

    González Calvo, Mainor

    2015-01-01

    El Emperador Tertuliano y la Legió'n de los Superlimpios es el texto que mejor propone la heteroglosia en el género novelístico en Costa Rica. Además, esta pluralidad de discursos (de procedencia vallecentraleña y de grupos sociales marginales) son integrados en la novela para dar una visión de la realidad burocrática muy diferente a la promulgada por los medios ideológicos estatales. El plurilingüismo y la parodia (términos explicados por el teórico ruso Mijail Bajtín) son dos armas lingüíst...

  13. Funciones de costos internos y externos en un modelo estratégico de transporte de carga

    Directory of Open Access Journals (Sweden)

    Luis Gabriel Márquez Díaz

    2010-11-01

    Full Text Available Se revisan las funciones de costos internos y externos,con fines de modelación estratégica del transportede carga. Se estudian el costo interno del tiempo, elcosto interno de operación y cinco componentes delcosto externo: costo externo de la congestión, costoexterno de los accidentes, costos de la polución delaire, costo del cambio climático y costo externo dela infraestructura; a partir de estos se deriva la funciónde costo marginal total. Se encuentra que es posibleestimar de forma empírica los parámetros de lasfunciones aplicables al transporte de cargainterregional en Colombia en los modos de transportecarretero, ferroviario y fluvial, y con ellos estudiarlos costos marginales sobre una red estratégica detransporte de carga.

  14. HEMOPARASITOSIS EN GANADERÍA DOBLE PROPÓSITO VENEZOLANA, DIAGNÓSTICO Y CONTROL: UNA REVISIÓN

    Directory of Open Access Journals (Sweden)

    Rita Tamasaukas

    2010-01-01

    Full Text Available Este trabajo de revisión de tesis doctoral incluye resultados de investigaciones realizadas en el periodo 1971 a 2009 sobre cuatro hemoparasitosis causados por protozoarios y rickettsiales en Venezuela y otros países, con énfasis en la infección mixta en rebaños bovinos, y su diagnóstico y control. En Venezuela, las afecciones causadas por agentes hemotrópicos parasitarios están distribuidas en todos los estados del país con vocación ganadera, en especial, en rebaños bovinos y bufalinos. Entre aquellos encontramos a especies del género Anaplasma (Anaplasma marginale, Babesia (Babesia bigemina y B. bovis, y Trypanosoma (Trypanosoma vivax, con una frecuencia endémica y con variaciones estacionales.

  15. Beyrouth-Dubaï

    OpenAIRE

    Brones, Sophie; Moghadam, Amin

    2017-01-01

    Depuis le milieu des années 2000, l’émergence d’un marché de l’art contemporain au Moyen-Orient a généré une recomposition des polarités cultu­relles à l’échelle régionale. Cet article met en perspective deux villes, Dubaï et Beyrouth, dont les développements récents, du point de vue de la structuration des institutions culturelles et de l’urbanisation de zones marginales, témoignent de façons distinctes mais non moins comparables de l’émergence de nouvelles formes d’urbanité. Leur cohérence ...

  16. educativos en México: 1987-2004

    Directory of Open Access Journals (Sweden)

    Edna María Villarreal Peralta

    2008-01-01

    Full Text Available En este trabajo se analiza el impacto del nivel educativo sobre el ingreso salarial en México para el periodo 1987-2004. Para ello, se calcula la evolución de los rendimientos educativos empleando datos de la Encuesta Nacional de Empleo Urbano (ENEU. Se estiman tres modelos alternativos: primero, se toman años de estudio como variable explicativa principal; segundo, se incorporan variables dummies para estado civil y parentesco y, tercero, se consideran niveles educativos. Se obtiene que los mayores rendimientos marginales corresponden a los individuos con nivel educativo más elevado. Asimismo, al estimar los rendimientos por género, se encuentra que los de las mujeres superan a los de los hombres. Por último, aparece una marcada disminución en los rendimientos en los periodos de crisis económica.

  17. EXPRESIONES JUVENILES EN ESPACIOS DE VIOLENCIAS. UNA FORMA DE HACER MEMORIA Y DENUNCIAR EL OLVIDO.(JUVENILE EXPRESSIONS IN SPACES OF VIOLENCE:A MANNER TO MAKE MEMORY AND DENOUNCE OBLIVION.

    Directory of Open Access Journals (Sweden)

    Janeth Restrepo Marín

    2011-12-01

    Full Text Available Éste escrito, resultado de investigación, tiene el objetivo de develar la idea de ciudad - pánico, para enunciar la violencia en Medellín. Sin embargo, a pesar de ser éste el telón de fondo, estas líneas se centrarán en las diversas formas de movilización juvenil que emergen en diferentes barrios marginales de la ciudad como formas de hacer frente a una realidad de exclusión y violencia.AbstractThis writing, a research result, aims to unveil the idea of city-panic, to outline the violence in Medellin. However, despite this being the backdrop, these lines will focus on various forms of youth mobilization that emerge in different marginal neighborhoods of the city as ways to deal with a reality of exclusion and violence

  18. INVESTIGACION Y DESARROLLO DE UN PAQUETE TECNOLOGICO PARA PRODUCIR ETANOL A PARTIR DE ALAMOS HIBRIDOS

    OpenAIRE

    PETIT-BREUILH SEPULVEDA, XIMENA PILAR

    2013-01-01

    El presente proyecto abordó la investigación y desarrollo de la producción de combustible lignocelulósico, específicamente Bioetanol a partir de híbridos de álamos. Una de las principales ventajas del uso de álamos, es que su producción sólo requiere suelos marginales, por lo que no compite directamente con la producción de alimentos o forestal (pino o eucaliptus). Después de varios años de estudio, se han conseguido rotaciones de 2 a 3 años, con producción de biomasa entre 25 y 40 ton/ha/...

  19. Crítica desde el pensamiento complejo a los métodos cuantitativos para el análisis educativo. El caso de los rendimientos educativos

    Directory of Open Access Journals (Sweden)

    Carlos Ricardo Aguilar Astorga

    2017-07-01

    Full Text Available En materia de política educativa es común asociar el nivel salarial de un sujeto respecto de su nivel educativo: sin embargo, dicha relación no es tan lineal como parece, sino que, visto desde el pensamiento complejo, intervienen factores como los costos marginales -a los que cada individuo se enfrenta al asistir a su centro educativo-, los cuales comprueban otra reciprocidad de variables. La forma como se construyen las asignaciones presupuestales en materia educativa en México no se deriva de este hecho, sino que hallan una correlación entre rendimiento educativo y asignación presupuestal por nivel educativo, excluyendo factores explicativos que el pensamiento complejo permite destacar. Tomar esto en consideración, mejoraría la política pública educativa.

  20. Simas, cavernas y pozos para ocultar cadáveres en la Guerra Civil española (1936-1939. Aportaciones desde la Antropología Forense

    Directory of Open Access Journals (Sweden)

    ETXEBERRIA, F., SERRULLA, F., HERRASTI, L.

    2014-01-01

    Full Text Available Son miles las víctimas de la Guerra Civil (1936-1939 que permanecen enterradas en fosas comunes repartidas por todo el territorio. Pero además de las fosas en zonas marginales o en cementerios, se emplearon también pozos artificiales y simas naturales para hacer desaparecer las evidencias de los crímenes cometidos. Este recurso ha sido utilizado a lo largo de toda la historia en situaciones de conflicto y explica algunos hallazgos que se han realizado: la ocultación de los cuerpos en espacios aparentemente imposibles para su localización y rescate posterior. Sin embargo, el avance en las técnicas arqueológicas implicadas en el ámbito de las Ciencias Forenses han posibilitado la adecuada recuperación de estos restos y su posterior análisis.

  1. Análisis Comparativo Entre el Dinero Electronico y el Sistema Bancario Tradicional: Medición en la Ciudad de Guayaquil

    OpenAIRE

    Espol; Peña Chávez, Shirley Katherine; Yulan Fienco, Vanesa Jacqueline

    2017-01-01

    Realizar un análisis comparativo entre el sistema bancario tradicional y el sistema de dinero electrónico, llamado actualmente “efectivo desde mi celular”, el mismo que constituye el nuevo medio de pago que implementó el gobierno de turno; a través del banco central del ecuador a partir de diciembre del 2014, con el propósito de mejorar la inclusión financiera en la población de los sectores marginales del país. el fin de esta investigación es de conocer si realmente se está desempeñando el o...

  2. Anaplasmose bovina: parâmetros clínicos e de patologia clínica em bezerros infectados experimentalmente.: parâmetros clínicos e de patologia clínica em bezerros infectados experimentalmente.

    OpenAIRE

    Leonardo Costa Tavares Coelho

    2007-01-01

    Avaliou-se o comportamento dos parâmetros de patologia clínica em cinco bezerros HPB, com idade entre 90 e 120 dias, inoculados com Anaplasma marginale. O período médio de incubação foi de 13 dias, a duração do período patente, quando foram realizadas as análises, foi de 14 dias e o período convalescente durou 10 dias. Foram avaliadas as alterações no equilíbrio ácido-básico, perfil eletrolítico, parâmetros bioquímicos e hematológicos. Os animais apresentaram anemia, inicialmente normocítica ...

  3. La ficción entre trauma real e imaginario: “Shelter” de José Emilio Pacheco

    Directory of Open Access Journals (Sweden)

    Margherita Cannavacciuolo

    2013-07-01

    Full Text Available The study analyzes the short story “Shelter” (1964 by José Emilio Pacheco (México D.F., 1939, published in the volume La sangre de Medusa y otros cuentos marginales (1991. The apocalypse marks the narrative construction of a traumatic imaginary related with dichotomy between real and imaginary trauma. The protagonist’s fear of a Third World War produces a suspension of reality’s principle and the projection of his interiority, leading to a fracture into the story between the level of imagination and the real experience. The texts reflects the configuration of a discourse where trauma plays as the significant in the organization of subjectivity and fiction.

  4. Effectiveness of enrofloxacin for the treatment of experimentally-induced bovine anaplasmosis Eficácia da enrofloxacina no tratamento da anaplasmose bovina experimental

    Directory of Open Access Journals (Sweden)

    Elias Jorge Facury-Filho

    2012-03-01

    Full Text Available Four groups of six Holstein calves were inoculated with 3.6 × 10(7 erythrocytes parasitized with Anaplasma marginale. The criteria for treatment of calves were increasing A. marginale rickettsemia and 30% reduction of baseline packed cell volume (PCV of each animal. Group 1 (G1 received 7.5 mg.kg-1 of enrofloxacin in a single dose; Group 2 (G2 7.5 mg.kg-1 of enrofloxacin twice every three days; Group 3 (G3 20 mg.kg-1 of long-acting oxytetracycline in a single dose; and Group 4 (G4 a single dose of PBS. Physical examinations, blood smears and PCV were performed daily. On day treatment, G1, G2 and G3 animals had a mean rickettsemia of 17, 23 and 12%, respectively. At 2 days after treatment (DAT G1 and G2 animals showed a significant reduction of rickettsemia (p Quatro grupos de seis bezerros da raça Holandesa foram inoculados com 3,6 × 10(7 eritrócitos parasitados com Anaplasma marginale. Os critérios para o tratamento dos bezerros foram aumento da rickettsemia do A. marginale e redução de 30% do valor basal de volume globular (VG de cada animal. O Grupo 1 (G1 recebeu 7,5 mg.kg-1 de enrofloxacina em dose única; o Grupo 2 (G2, 7,5 mg.kg-1 de enrofloxacina duas vezes a cada três dias; o Grupo 3 (G3, 20 mg.kg-1 de oxitetraciclina de longa ação em dose única; e o Grupo 4 (G4 uma única dose de PBS. Exames físicos, esfregaço sanguíneo e VG foram realizadas diariamente. No dia do tratamento, os animais G1, G2 e G3 apresentaram rickettsemia média de 17, 23 e 12%, respectivamente. Nos primeiros 2 dias após o tratamento (DAT os animais do G1 e G2 mostraram uma redução significativa de rickettsemia (p < 0,05 em relação ao G3. Animais do G3 tiveram altas taxas de rickettsemia nos 2 DAT e uma diminuição lenta até à estabilização em 9 de DAT. O VG médio no G1 e G2 aumentou e estabilizou após 7 e 8 DAT, respectivamente. A estabilização do VG do G3 foi aos 13 DAT. A enrofloxacina e a oxitetraciclina foram efetivas no tratamento da

  5. Lichenized and lichenicolous fungi from Greece collected by M. Skytte Christiansen, Svend Rungby and other Danish botanists

    DEFF Research Database (Denmark)

    Christensen, Steen

    2016-01-01

    Seventy six taxa are reported from 20 localities in Greece. Six taxa are new to Atika (Caloplaca herbidella, Cladonia foliacea, C. subrangiformis, Fulgensia bracteata, Pertusaria amara and Ramalina fastigiata), one is new to the Saronikos Kolpos island Aigina (Cladonia foliacea), one is new...... to the NE Aegean island Lesvos (Umbilicaria spodochroa) and three and 21 taxa are new to the Dodekanisos islands of Kos and Rodos, respectively (Kos: Arthonia cf. punctiformis, Arthopyrenia punctiformis and Collema crispum var. metzleri; Rodos: Arthonia meridionalis, Aspicilia calcarea var. reagens, Bacidia...... incompta, B. laurocerasi, B. punica, Caloplaca aurantia, C. pyracea, Catillaria nigroclavata, Collema cristatum var. marginale, C. subnigrescens, Dirina massiliensis, Gyalecta truncigena, Lecanora horiza, Leptogium massiliense, Milospium graphideorum, Opegrapha celtidicola, Physcia adscendens, Rinodina...

  6. Pluralismo de bienestar y estructuración política de la demanda social

    Directory of Open Access Journals (Sweden)

    Alejandro H. Del Valle

    2008-07-01

    Full Text Available La participación ciudadana y el desarrollo local se presentan en la actualidad como claves para el desarrollo de nuevos modelos de políticas de bienestar, ya que se asume como positivo el rol que podrían cumplir en la profundización de procesos democráticos y, al mismo tiempo, son vistos como alternativas para la incorporación de grupos marginales que se ubican en áreas a las que el estado no podría alcanzar. El presente artículo plantea que, por las características del sistema político éstas propuestas acaban cumpliendo una función política muy distinta a la que defienden sus precursores.

  7. Una experiencia de capacitacion-investigacion a docentes coordinadores de pronoei del callao

    Directory of Open Access Journals (Sweden)

    Carmen Coloma

    1992-06-01

    Full Text Available En 1983la Facultad de Educación de la Pontificia Universidad Católica del Perú conjuntamente con la Fundación de Investigaciones Educativas High Scope, inició un Proyecto de Capacitación a personal no profesional en servicio. Esta experiencia piloto que se realizó en 5 programas no escolarizados de Educación Inicial de sectores urbano marginales de Lima y Callao, permitió validar un modelo de capacitación que tiene principios y estrategias muy particulares y cuyos resultados están relacionados con el mejoramiento de la calidad de servicios educativos, el desempeño de animadoras y la participación de la comunidad, lo cual ha propiciado su extensión a otros sectores y niveles.

  8. Metodología para la oferta de servicio diferenciado por medio del análisis de costo de servir

    Directory of Open Access Journals (Sweden)

    Christopher Mejía-Argueta

    2015-10-01

    Full Text Available El objetivo de esta investigación es generar esquemas logísticos y comerciales rentables, para lo cual se construye una metodología que mide el costo de servir y se determina la rentabilidad a partir de los estados financieros, que va de lo general a lo específico, permitiendo cerrar las brechas identificadas en el análisis de costo de servir para mercados emergentes. La metodología consta de 3 fases y 12 pasos que alinean la estrategia, alcance, procesos y costeo de actividades con la segmentación de cuentas rentables, marginales y no rentables, para generar mayor rentabilidad. Como resultado se construyen herramientas que permiten priorizar a los clientes, así como definir la estrategia logística y comercial ideal para los objetos de estudio (cliente, producto, etc..

  9. El parlache: resultados de una investigación lexicográfica

    Directory of Open Access Journals (Sweden)

    Castañeda Luz Stella

    2005-06-01

    Full Text Available La idea de realizar una investigación sobre la caracterización lexicográfica del parlache, con el fin de elaborar un diccionario, se debe al interés de profundizar en el estudio de una variedad dialectal de origen diastrático, del español colombiano, denominada parlache, que utilizan amplios sectores de la sociedad, pero en especial los jóvenes de los barrios populares y marginales de Medellín y de su Área Metropolitana. En toda sociedad se presentan cambios lingüísticos que van mostrando las transformaciones de la realidad. Ahora bien, en los sectores populares y marginales de Medellín, el surgimiento de los cambios lingüísticos fue tan acelerado, que desbordó los límites normales de este fenómeno debido a la  agudización de la crisis social y al surgimiento de nuevas formas de "trabajo", caracterizadas por un marco de trasgresión de la ley y por un amplio dominio de la cultura de la droga, en donde el sector social más afectado ha sido el de los jóvenes. Por esto, a pesar de que el parlache es una variedad dialectal muy extendida, la mayor parte de sus hablantes y los que lo usan con mayor propiedad son los jóvenes entre 15 y 26 años.

  10. Efecto de plantaciones dendroenergéticas en el carbono a nivel de suelo, en dos suelos contrastantes de la región de Biobío, Chile

    Directory of Open Access Journals (Sweden)

    Edwin Esquivel

    2013-12-01

    Full Text Available La biomasa forestal como fuente de energía proveniente de plantaciones dendroenergéticas, al compararla con combustibles fósiles, presenta la ventaja de producir energía carbono-neutral, dado el secuestro de carbono (C fijado en la biomasa producida y los aportes al suelo. Plantaciones forestales de corta rotación, altas densidades, y localizadas en terrenos marginales pueden representar una excelente oportunidad de producción de biomasa para la producción de energía o combustibles. Sin embargo, los beneficios en el corto plazo del aumento del C a nivel de suelo en sitios marginales han sido cuestionados. Se establecieron plantaciones dendroenergéticas con las especies Eucalyptus camaldulensis, E. nitens, E. globulus, y Acacia melanoxylon a densidades de 5.000, 7.500 y 10.000 plantas por hectárea, en dos sitios de producción forestal marginal con suelos contrastantes (arenales y granítico localizados en la Región del Biobío de Chile. Evaluaciones periódicas durante 4 años a 0-20 y 20-40 cm de profundidad, del nivel de C en cada uno de los suelos evaluados, sugiere efectos de la edad (tiempo desde el establecimiento de la plantación (P < 0,001. A pesar de los cambios observados en el tiempo, la escasa diferencia en los niveles observados de C en el suelo mineral para los 48 meses de estudio comparados a los primeros 2 meses post-plantación, sugiere una rápida capacidad de recuperación de los niveles de C del suelo en un corto periodo.

  11. El parlache: resultados de una investigación lexicográfica

    Directory of Open Access Journals (Sweden)

    Luz Stella Castañeda

    2005-01-01

    Full Text Available La idea de realizar una investigación sobre la caracterización lexicográfica del parlache, con el fin de elaborar un diccionario, se debe al interés de profundizar en el estudio de una variedad dialectal de origen diastrático, del español colombiano, denominada parlache, que utilizan amplios sectores de la sociedad, pero en especial los jóvenes de los barrios populares y marginales de Medellín y de su Área Metropolitana. En toda sociedad se presentan cambios lingüísticos que van mostrando las transformaciones de la realidad. Ahora bien, en los sectores populares y marginales de Medellín, el surgimiento de los cambios lingüísticos fue tan acelerado, que desbordó los límites normales de este fenómeno debido a la agudización de la crisis social y al surgimiento de nuevas formas de “trabajo”, caracterizadas por un marco de trasgresión de la ley y por un amplio dominio de la cultura de la droga, en donde el sector social más afectado ha sido el de los jóvenes. Por esto, a pesar de que el parlache es una variedad dialectal muy extendida, la mayor parte de sus hablantes y los que lo usan con mayor propiedad son los jóvenes entre 15 y 26 años

  12. El parlache: resultados de una investigación lexicográfica

    Directory of Open Access Journals (Sweden)

    LUZ STELLA CASTAÑEDA

    2005-06-01

    Full Text Available La idea de realizar una investigación sobre la caracterización lexicográfica del parlache, con el fin de elaborar un diccionario, se debe al interés de profundizar en el estudio de una variedad dialectal de origen diastrático, del español colombiano, denominada parlache, que utilizan amplios sectores de la sociedad, pero en especial los jóvenes de los barrios populares y marginales de Medellín y de su Área Metropolitana. En toda sociedad se presentan cambios lingüísticos que van mostrando las transformaciones de la realidad. Ahora bien, en los sectores populares y marginales de Medellín, el surgimiento de los cambios lingüísticos fue tan acelerado, que desbordó los límites normales de este fenómeno debido a la agudización de la crisis social y al surgimiento de nuevas formas de “trabajo”, caracterizadas por un marco de trasgresión de la ley y por un amplio dominio de la cultura de la droga, en donde el sector social más afectado ha sido el de los jóvenes. Por esto, a pesar de que el parlache es una variedad dialectal muy extendida, la mayor parte de sus hablantes y los que lo usan con mayor propiedad son los jóvenes entre 15 y 26 años.

  13. Bovine anaplasmosis with emphasis on immune responses and protection

    International Nuclear Information System (INIS)

    Ristic, M.

    1980-01-01

    Anaplasmosis is an infectious and transmissible disease manifested by progressive anaemia and the appearance of other characteristic disease symptoms. It is a world-wide tick-borne disease of cattle and some wild ruminants caused by the rickettsia Anaplasma marginale. By drawing on information obtained from studies of plasmodial cell cultures, a method has recently been developed for short-term in vitro cultivation of A. marginale. An attenuated Anaplasma organism capable of growth in both ovine and bovine erythrocytes was used to demonstrate that the in vitro system provided the necessary requirements for active transfer of the organism from cell to cell. Organismal antigens are found in the erythrocytes of infected animals, whereas soluble antigens are derived from their erythrocytes and serum. Serums from convalescing animals interact with these antigens in agglutination, complement fixation, fluorescent antibody and precipitation tests. Passive transfer of sera from immune to susceptible cattle, however, does not seem to confer protection against the infection and development of the disease. Studies that employed various tests for measuring cell-mediated immune (CMI) responses (leukocyte migration inhibition, blast transformation and cytotoxicity), in association with information collected simultaneously on antibody activity, have shown that both humoral and cellular immune responses are needed for the development of protective immunity in anaplasmosis. It was further shown that an active replication of Anaplasma is essential for induction of these two types of immune responses. Consequently, live virulent and attenuated immunogens fulfil requirements for induction of protective immunity. With the virulent agent, however, development of protective immunity is preceded by induction of auto-immune responses apparently associated with pathogenesis of anaemia in anaplasmosis. Inactivated immunogens derived from blood of infected cattle and used in combination with

  14. What is sauce for the goose is sauce for the gander. Plea of Transport and Logistics Netherlands for a practical and transparent system to calculate societal cost in the transportation sector in order to realize governmental targets for equal treatment of means of transportation; Gelijke monniken, gelijke kappen. Pleidooi van Transport en Logistiek Nederland voor een praktisch en transparant systeem van doorberekening van maatschappelijke kosten in de transportsector om overheidsdoelstellingen te halen bij gelijke behandeling van vervoerswijzen

    Energy Technology Data Exchange (ETDEWEB)

    Ohm, R.; Poppink, P. (eds.)

    2002-07-01

    ; Application requires a set of measures. [Dutch] Dit rapport verdiept zich in de maatschappelijke kosten van het goederentransport voor de Nederlandse samenleving in 2002. TLN borduurt daarbij voort op het rapport 'Efficiente prijzen voor het verkeer' (1999), dat CE in opdracht van het Ministerie van Verkeer en Waterstaat heeft geschreven. Met dit rapport wil TLN een constructieve bijdrage leveren aan de uitwerking van de Witboeken 'Fair payment for infrastructure use' (1998) en 'European transport policy for 2010, Time to decide' (2001) van de Europese Commissie, en de Nederlandse discussies op het punt van de internalisering van de maatschappelijke kosten. Met 'Gelijke monniken, gelijke kappen' is zoveel mogelijk gezocht naar de achterkant van het gelijk en niet naar de uitvergroting van de verschillen tussen de diverse vervoerswijzen. Uiteindelijk gaat het er om dat de transportsector als geheel zijn belangrijke rol voor de samenleving duurzaam kan vervullen, tegen zo laag mogelijke maatschappelijke kosten. Om dat doel te bereiken dienen alle vervoerswijzen gelijk behandeld te worden en de overheid de transportsector via het systeem van heffingen prikkels te geven de marginale maatschappelijke kosten te internaliseren. Daar waar dat niet lukt, zal de overheid de opbrengsten van heffingen ten goede moeten laten komen aan het doel waarvoor ze worden geheven, t.w. bereikbaarheid, leefbaarheid en veiligheid. De volgende punten komen aan de orde:Marginale kosten per definitie kosten van duurste maatregel om doel te bereiken; Geen enkele vervoerswijze betaalt alle marginale kosten; Transportkosten stijgen minste bij wegvervoer en meeste bij binnenvaart; Markt verandert qua modal split, werkgelegenheid en havenoverslag; Marktmodel of overheidsmodel?; Overheidsmodel zorgt voor zwaardere lasten voor spoor en binnenvaart; Onbetaalde rekening valt in praktijk lager uit dan in theorie; Wensen van bedrijfsleven en samenleving zijn door politiek te

  15. El parlache: resultados de una investigación lexicográfica The ‘parlache’: Results of a lexicographical investigation

    Directory of Open Access Journals (Sweden)

    LUZ STELLA CASTAÑEDA

    2005-06-01

    Full Text Available La idea de realizar una investigación sobre la caracterización lexicográfica del parlache, con el fin de elaborar un diccionario, se debe al interés de profundizar en el estudio de una variedad dialectal de origen diastrático, del español colombiano, denominada parlache, que utilizan amplios sectores de la sociedad, pero en especial los jóvenes de los barrios populares y marginales de Medellín y de su Área Metropolitana. En toda sociedad se presentan cambios lingüísticos que van mostrando las transformaciones de la realidad. Ahora bien, en los sectores populares y marginales de Medellín, el surgimiento de los cambios lingüísticos fue tan acelerado, que desbordó los límites normales de este fenómeno debido a la agudización de la crisis social y al surgimiento de nuevas formas de “trabajo”, caracterizadas por un marco de trasgresión de la ley y por un amplio dominio de la cultura de la droga, en donde el sector social más afectado ha sido el de los jóvenes. Por esto, a pesar de que el parlache es una variedad dialectal muy extendida, la mayor parte de sus hablantes y los que lo usan con mayor propiedad son los jóvenes entre 15 y 26 años.The idea of carrying out an investigation on the lexicographical characterization of the parlache in order to elaborate a dictionary, was born by the interest in searching thoroughly on a dialectal variety of diastratic origin from the Colombian Spanish, called parlache, which is widely used by our society, but specifically by youth of popular and outskirt neighbourhoods of Medellin and its metropolitan area. In all the society linguistic changes are occurring which show the transformation of their reality. As a matter of fact, the occurrence of linguistic change in the popular and outskirt districts of Medellin advanced so fast that it surpassed the commonl limits of this phenomenon, due to the worsening of the social crisis, the upspring of new kinds of “work”, marked by legal

  16. Incentivos y desincentivos de la industria farmacéutica privada para la I+D de nuevos medicamentos Incentives and disincentives for research and development of new drugs by the pharmaceutical industry

    Directory of Open Access Journals (Sweden)

    Pasqualina Curcio Curcio

    2008-10-01

    Full Text Available En el trabajo se desarrolló un modelo con los factores que influyen sobre la decisión de I+D de la industria farmacéutica. Los factores son el riesgo de contagio y la posibilidad de controlarlo; la letalidad y la presencia de curas o tratamientos; el ingreso; el número de personas que demandan y los costos de oportunidad de la empresa. Las empresas invertirán en mercados con demandas más inelásticas (enfermedades muy contagiosas sin posibilidad de controlar la transmisión y/o muy letales sin curas o tratamientos y/o donde los demandantes tienen elevados ingresos y/o son numerosos. No invertirá en mercados donde sus costos marginales son superiores a sus ingresos marginales, particularmente cuando sus costos incrementan permanentemente como consecuencia del aumento del costo de oportunidad generado por lo que dejaría de ganar en otros mercados. Para estos casos, las políticas de subsidio de la I+D no son efectivas, por lo tanto, éstas deben orientarse al fortalecimiento de las investigaciones, tanto básica como aplicada, realizadas por las instituciones públicas o sin fines de lucro.The authors present a model with factors that influence research and development decisions by the pharmaceutical industry: risk of disease transmission and possibility of control; case-fatality and the presence of cure or treatments; income; number of persons who demand the medicine; and opportunity costs for the company. Companies tend to invest in markets with inelastic demand (highly contagious diseases with no possibility of controlling transmission and/or very lethal diseases without treatment and/or where there is a large population or high per capita income. Companies tend not to invest in markets where marginal costs exceed marginal income, particularly when costs increase permanently as a consequence of rising opportunity costs generated by foregoing profit in other markets. In such cases, policies to subsidize R&D are not effective, and

  17. Choice of optimum size of installations for dual-purpose production of desalted water and electricity, using nuclear power; Le dimensionnement optimum des installations de production mixte d'eau sessalee et d'electricite faisant intervenir l'energie nucleaire

    Energy Technology Data Exchange (ETDEWEB)

    Gaussens, J [Commissariat a l' Energie Atomique, Paris (France)

    1966-07-01

    'un optimum collectif. Ils se traduisent soit par l'egalite des couts marginaux et des recettes marginales, soit par l'egalite des couts marginaux et des satisfactions marginales (theorie des surplus). Les dimensions des installations determinant souvent le choix des procedes on peut conclure de ces considerations que ces choix sont etroitement fonction: - de la forme de la courbe de demande d'eau - du critere economique choisi (gestionnaire public ou prive, limitation des investissements,...). Ceci rend donc indispensable des etudes de marche accompagnees d'une analyse economique assez fine, prealablement a toute decision du choix des techniques de dessalement. (auteur)

  18. Rendimiento intelectual de niños-infantes antes a adolescentes de clase socio-económica media y baja de Lima y de algunas provincias

    Directory of Open Access Journals (Sweden)

    Alegría Majluf

    1984-06-01

    Full Text Available La recopilación y revisión de un conjunto de estudios comparativos referentes al rendimiento intelectual de niños peruanos (desde la infancia hasta la adolescencia conducidos por diferentes investigadores, muchos de ellos no publicados, muestran que: Los niños de las zonas marginales o de los Pueblos Jóvenes de Lima y de algunas provincias rinden intelectualmente, tanto en pruebas psicométricas y Piagetianas, en forma disminuida y significativamente más baja que los niños de las clases más acomodadas. La disminución intelectual constatada en estos niños tiende a acentuarse aún más con la edad y en las zonas rurales más que en las urbanas. Los varones, en general, muestran un desempeño mejor que las mujeres, aún en la infancia. El desarrollo físico de los niños de la Clase socio-económica baja es, así mismo, poco satisfactorio. Las medidas antropométricas revelan un deficiente desarrollo físico. Los niños que viven en la altura son de menor peso y estatura que los niños que viven en baja altura o en la Costa. Los pre-escolares de las zonas pauperizadas muestran, en general, inmadurez para el aprendizaje y posteriormente retraso en la lectura y en el rendimiento escolar. En conclusión, la disminución generalizada en el rendimiento intelectual, físico y escolar de los niños de las zonas marginales, la que parece acentuarse aún más con la edad y en las zonas rurales, evidencia la necesidad de estudiar en forma más sistemática el perfil del niño peruano para poder obtener normas nacionales y regionales, las que permitirán una mejor planificación de los programas de intervención integral.

  19. Citrate synthase gene sequence: a new tool for phylogenetic analysis and identification of Ehrlichia.

    Science.gov (United States)

    Inokuma, H; Brouqui, P; Drancourt, M; Raoult, D

    2001-09-01

    The sequence of the citrate synthase gene (gltA) of 13 ehrlichial species (Ehrlichia chaffeensis, Ehrlichia canis, Ehrlichia muris, an Ehrlichia species recently detected from Ixodes ovatus, Cowdria ruminantium, Ehrlichia phagocytophila, Ehrlichia equi, the human granulocytic ehrlichiosis [HGE] agent, Anaplasma marginale, Anaplasma centrale, Ehrlichia sennetsu, Ehrlichia risticii, and Neorickettsia helminthoeca) have been determined by degenerate PCR and the Genome Walker method. The ehrlichial gltA genes are 1,197 bp (E. sennetsu and E. risticii) to 1,254 bp (A. marginale and A. centrale) long, and GC contents of the gene vary from 30.5% (Ehrlichia sp. detected from I. ovatus) to 51.0% (A. centrale). The percent identities of the gltA nucleotide sequences among ehrlichial species were 49.7% (E. risticii versus A. centrale) to 99.8% (HGE agent versus E. equi). The percent identities of deduced amino acid sequences were 44.4% (E. sennetsu versus E. muris) to 99.5% (HGE agent versus E. equi), whereas the homology range of 16S rRNA genes was 83.5% (E. risticii versus the Ehrlichia sp. detected from I. ovatus) to 99.9% (HGE agent, E. equi, and E. phagocytophila). The architecture of the phylogenetic trees constructed by gltA nucleotide sequences or amino acid sequences was similar to that derived from the 16S rRNA gene sequences but showed more-significant bootstrap values. Based upon the alignment analysis of the ehrlichial gltA sequences, two sets of primers were designed to amplify tick-borne Ehrlichia and Neorickettsia genogroup Ehrlichia (N. helminthoeca, E. sennetsu, and E. risticii), respectively. Tick-borne Ehrlichia species were specifically identified by restriction fragment length polymorphism (RFLP) patterns of AcsI and XhoI with the exception of E. muris and the very closely related ehrlichia derived from I. ovatus for which sequence analysis of the PCR product is needed. Similarly, Neorickettsia genogroup Ehrlichia species were specifically identified by

  20. Grateloupia lanceola versus Grateloupia turuturu (Gigartinales, Rhodophyta: en la Península Ibérica

    Directory of Open Access Journals (Sweden)

    Bárbara, Ignacio

    2004-12-01

    Full Text Available Grateloupia lanceola was originally described from the southern Iberian Peninsula and northwestern Africa coasts. Its current Iberian distribution only includes some localities in NW (La Coruña and SE (Málaga Spain. The closely related invasive species Grateloupia turuturu is present in Galicia (NW Spain since 1991 and in northern Portugal since 1997. Galicia is the only area in Europe where both especies are sympatric. This paper presents a comparative study of G. lanceola and G. turuturu along the Iberian Peninsula coast. The blade of G. lanceola is purplish red with a characteristic emerald green colour to the base, and usually has scattered paler spots. Moreover, it is 200-450 µm thick, has a sort stipe, and marginal proliferations developed usually only in eroded areas. The lamina of G. turuturu is red or pink through, without paler spots or green areas. It is thinner (130-250 µm, has a long stipe, and frequent congenital marginal proliferations.Grateloupia lanceola, especie descrita de las costas del sur de la Península Ibérica y del noroeste de África, sólo se conoce actualmente de las costas peninsulares en algunas localidades atlánticas del noroeste (La Coruña y mediterráneas del suroeste (Málaga. Por otro lado, la invasora y muy afín Grateloupia turuturu está presente en las costas de Galicia desde 1991 y en el norte de Portugal desde 1997. Galicia es la única región en Europa donde ambas especies conviven, por lo que ha sido posible realizar un estudio comparado que muestra claras diferencias entre ellas. Las láminas de Grateloupia lanceola son de color rojo púrpura, frecuentemente con motas más pálidas en superficie y un característico color verde esmeralda en su base. Estas láminas, de 200-450 µm de grosor, tienen un corto estipe y suelen desarrollar proliferaciones marginales sólo en las zonas erosionadas. Por el contrario, las láminas de G. turuturu son de color rojo más o menos rosado, sin motas

  1. Risk profile for osteoradionecrosis of the mandible in the IMRT era

    Energy Technology Data Exchange (ETDEWEB)

    Studer, Gabriela; Glanzmann, Christoph [University Hospital Zurich, Department of Radiation Oncology, Head Neck Cancer Center, Zurich (Switzerland); Bredell, Marius; Studer, Stephan [University Hospital Zurich, Department of Craniomaxillofacial and Oral Surgery, Head Neck Cancer Center, Zurich (Switzerland); Huber, Gerhard [University Hospital Zurich, Department of Otorhinolaryngology, Head Neck Cancer Center, Head and Neck Surgery, Zurich (Switzerland)

    2016-01-15

    Kieferknochen (3/46) belief sich auf je 7 %, bei OCC-Patienten mit Operation am Kieferknochen auf 29 % (15/60; p = 0,002). Das hoechste ORN-Risiko fand sich dabei fuer marginale oder periosteale Knochenresektionen (39 %, vs. 7 % nach segmentaler oder keiner Resektion; p < 0,0001). Marginale oder periosteale Kieferknochenresektionen gingen in unserer IMRT-Kohorte mit dem hoechsten Risiko fuer die Entwicklung einer ORN einher. (orig.)

  2. Brotes de babesiosis y anaplasmosis bovina diagnosticados en el INTA Salta, Argentina: período 2006-2016

    Directory of Open Access Journals (Sweden)

    ARAOZ V

    2017-12-01

    Full Text Available Se realizó un estudio retrospectivo de brotes de babesiosis y anaplasmosis (tristeza parasitaria bovina, TPB ocurridos entre 2006 y 2016 en el Noroeste argentino (NOA para evaluar algunos aspectos epidemiológicos y clínicos de estas enfermedades. De 4.398 muestras para diagnóstico, 238 (5,4% tuvieron sospechas de TPB, las cuales se confirmaron en 106 (44,3% casos por observación microscópica de los agentes causales. Cuarenta y siete (44,3% brotes se debieron a Anaplasma marginale, 40 (37,7% a Babesia bovis y 14 (13,2% a Babesia bigemina. En cinco (4,7% focos de babesiosis no se determinó la especie causal de Babesia. Los brotes se diagnosticaron en 62 establecimientos ganaderos de cuatro provincias (Salta, Jujuy, Santiago del Estero y Chaco. La mayoría ocurrieron en verano y otoño, con máxima incidencia en abril y nula en setiembre para ambas noxas. Las vacas adultas fueron la categoría de ganado más afectada. En 58% (61/106 de los brotes murió al menos un bovino, con un número promedio de cuatro muertes por brote. Se concluye que la TPB continúa incidiendo negativamente en la producción bovina del NOA. SUMMARY. Bovine babesiosis and anaplasmosis outbreaks diagnosed at INTA Salta, Argentina: 2006-2016. A retrospective study of babesiosis and anaplasmosis outbreaks (tick fever, TF was made, which occurred from 2006 to 2016 in Northwest Argentina (NWA, to evaluate clinical and epidemiological aspects of these diseases. From 4,398 specimens, 238 (5.4% were associated with suspicions of TF and 106 of these cases (44.3% were confirmed as TF outbreaks by microscopic observation of causal agents. Forty seven (44.3% were due to Anaplasma marginale, 40 (37.7% to Babesia bovis and 14 (13.2% to Babesia bigemina. In five (4.7% outbreaks of babesiosis, Babesia species were not determined. Outbreaks were diagnosed at 62 different cattle ranches in four provinces (Salta, Jujuy, Santiago del Estero and Chaco. The outbreaks occurred mostly during

  3. Tristeza parasitária bovina na região sul do Rio Grande do Sul: estudo retrospectivo de 1978-2005 Tick fever in southern Brazil: a retrospective study of 1978-2005

    Directory of Open Access Journals (Sweden)

    Milton Begeres de Almeida

    2006-12-01

    Full Text Available Foi realizado um estudo retrospectivo dos casos de tristeza parasitária bovina (TPB ocorridos no sul do Rio Grande do Sul, área de influência do Laboratório Regional de Diagnóstico (LRD da Faculdade de Veterinária da Universidade Federal de Pelotas entre 1978 e 2005. De um total de 4.884 materiais de bovinos provenientes de necropsias realizadas e órgãos ou sangue enviados ao laboratório 231 (4,7% tiveram o diagnóstico de TPB. Desses 231 surtos foram resgatados os dados de 221 diagnósticos dos quais 91 (41,1% foram causados por Babesia bovis, 11 (4,9% por Babesia bigemina, e 65 (29,41% por Anaplasma marginale. Em outros 33 (14,93% surtos de babesiose não foi informada a espécie de Babesia e em 21 (9,5% surtos foi detectada infecção mista por Babesia sp e A. marginale. Os índices gerais médios de morbidade, mortalidade e letalidade, resgatados em 149 dos 221 surtos da doença, foram de 11,17%, 6,81% e 70,04%, respectivamente. Verificou-se que, na região estudada, a maioria dos surtos ocorre durante os meses de verão e outono, e que os animais com um a três anos de idade são os mais afetados. Os sinais clínicos nos surtos caracterizaram-se por apatia, orelhas caídas, debilidade, febre, anorexia e emagrecimento. Os valores de hematócrito eram baixos. Hemoglobinúria foi frequentemente observada nos casos de babesiose. Sinais neurológicos estavam presentes nos casos de babesiose por B. bovis e se caracterizaram por transtornos da locomoção, tremores musculares, agressividade e quedas com movimentos de pedalagem. As lesões macroscópicas principais relatadas nos casos de babesiose foram esplenomegalia, hepatomegalia, fígado amarelo, hemoglobinúria, icterícia, hemorragias cardíacas e bile espessa. Congestão do córtex cerebral foi relatada nos casos de babesiose por B. bovis. Nesta região, com população de bovinos de aproximadamente 2.630.000 cabeças as perdas anuais por morte de bovinos pela enfermidade podem ser

  4. “LAS AUDIENCIAS DE LA CALLE” ENTRE MERCADOS, CALLES Y MÚSICA EN PERÚ

    Directory of Open Access Journals (Sweden)

    Franklin Cornejo Urbina

    2008-01-01

    Full Text Available Cuando se habla de audiencias de los medios de comunicación entendemos también que ellas cambian en los contextos, donde los televidentes y radioescuchas usan los medios con modos y fines diferentes. Así y como parte de la diversidad de las audiencias he ubicado bajo la definición “audiencias de la calle” a un grupo social, más bien de origen humilde y de rutinas cotidianas colectivo-comunitarias, que incluyen a ex campesinos, niños de la calle, comerciantes ambulantes e inmigrantes empobrecidos que se reúnen, trabajan y pasan gran parte del día en mercados de zonas urbano marginales de Lima, en Perú. El mercado popular es un lugar para las grandes mayorías donde hay encuentros y tensiones entre lo urbano y rural por viejas diferencias étnicas, regionales, locales y comunitarias entre andinos y costeños. La pobreza, la urbanización y el crecimiento de las ciudades han convertido al mercado en un lugar de sobrevivencia, trabajo, y un espacio para afrontar la vida de la ciudad. El presente artículo aborda el tema de los estudios de audiencia desde el mercado popular peruano, sus medios y comunicaciones.

  5. MUSICA E MUSICOTERAPIA

    Directory of Open Access Journals (Sweden)

    Fulvio Šuran

    2014-01-01

    Full Text Available Perché la musica piace? Molte sono le possibili risposte a tale quesito, nessuna però del tutto soddisfacente. Comunque, di certo nessuno avrà da ridire se si risponde con un “perché fa bene”, poiché tale risposta sintetizza un po’ tutte le implicazioni della questione, siano esse di ordine biologico, psicologico, sociologico, estetico o etico. In questo senso le relazioni fra educazione generale, educazione musicale e musicoterapia sono assai strette. Ed è nostra intenzione richiamare l’attenzione su di esse, mostrando che la funzione terapeutica non è una questione semplicemente marginale o accessoria dell’educazione, ma qualcosa di ben più rilevante. Per cui è inconcepibile che ancor oggi si possa pensare ad una compiuta educazione, nella quale la musica non sia in onore. Di più, è impensabile un’educazione priva di spirito musicale, inteso come disposizione ad accogliere e ad esprimere, in ben temperata armonia, pensieri ed azioni.

  6. ¿Pueden los barrios populares contribuir a una estrategia turística y de marca de ciudad?

    Directory of Open Access Journals (Sweden)

    Jaime Hernández García

    2012-11-01

    Full Text Available Los barrios populares son áreas mayoritarias en Colombia y en América Latina, que exhiben dinámicas urbanas, sociales y culturales particulares. Sin importar su tamaño ni su impacto, estos asentamientos han sido tradicionalmente ignorados en cuanto a su contribución a la ciudad y a cualquier estrategia turística y de marca de ciudad. Comúnmente se piensa que estas áreas no ofrecen nada más que pobreza y problemas.Sin embargo, existe investigación que muestra sus potencialidades, más allá de aquellas percepciones tradicionales y marginales; y se cree que pueden contribuir activamente al desarrollo turístico y de marca de ciudad en América Latina. Desde una exploración conceptual sobre urbanización informal y marca de ciudad, confrontada empíricamente en barrios populares de Bogotá, este artículo discute críticamente la contribución que estos asentamientos pueden hacer a una estrategia de turismo y de marca de ciudad más justa, real y auténtica.

  7. La Reforma Tributaria pendiente en Costa Rica: Consideraciones para el diseño del Sistema Tributario

    Directory of Open Access Journals (Sweden)

    Luis Loría

    2009-06-01

    Full Text Available Desde los años 90s, se ha intensificado la discusión acerca de la necesidad de reformas tributarias de diversa índole en Costa Rica. A pesar de que algunas veces se han impulsado reformas ambiciosas, los resultados siempre han sido el fracaso o, en el mejor de los casos, cambios marginales (no necesariamente mejoras a impuestos existentes. A través del tiempo, se han esgrimido los más diversos argumentos para justificar las reformas, obedeciendo, en la mayoría de los casos, a problemas coyunturales y a prioridades de corto plazo del gobierno de turno. Como resultado, el sistema tributario vigente incorpora las cicatrices de experimentos fallidos e iniciativas parcialmente implementadas que se acumulan y se hacen evidentes en una serie de ineficiencias e injusticias. A continuación, identificaremos y analizaremos algunas de las principales ineficiencias e injusticias y discutiremos posibles alternativas para solucionarlas o reducirlas.

  8. ¿Pueden los barrios populares contribuir a una estrategia turística y de marca de ciudad?

    Directory of Open Access Journals (Sweden)

    Jaime Hernández García

    2012-11-01

    Full Text Available Los barrios populares son áreas mayoritarias en Colombia y en América Latina, que exhiben dinámicas urbanas, sociales y culturales particulares. Sin importar su tamaño ni su impacto, estos asentamientos han sido tradicionalmente ignorados en cuanto a su contribución a la ciudad y a cualquier estrategia turística y de marca de ciudad. Comúnmente se piensa que estas áreas no ofrecen nada más que pobreza y problemas. Sin embargo, existe investigación que muestra sus potencialidades, más allá de aquellas percepciones tradicionales y marginales; y se cree que pueden contribuir activamente al desarrollo turístico y de marca de ciudad en América Latina. Desde una exploración conceptual sobre urbanización informal y marca de ciudad, confrontada empíricamente en barrios populares de Bogotá, este artículo discute críticamente la contribución que estos asentamientos pueden hacer a una estrategia de turismo y de marca de ciudad más justa, real y auténtica.

  9. Vulnerabilidad energética en la metrópoli de Buenos Aires

    Directory of Open Access Journals (Sweden)

    Silvina Carrizo

    2014-06-01

    Full Text Available Argentina declaró el uso racional y la eficacia energética una prioridad nacional, en consonancia con las recomendaciones de la Agencia Internacional de la Energía. Buenos Aires se ha comprometido con varios programas internacionales de preparación al cambio climático. Así a distintas escalas surgen iniciativas para modificar las condiciones y modalidades de aprovisionamiento y consumo energéticos, que revelan la precariedad y vulnerabilidad del sistema y los servicios. Este trabajo presenta una reflexión sobre los cambios que se dan en ese sentido, mostrando los inconvenientes del modelo energético argentino en Buenos Aires y las estrategias o medidas que tienden a revertirlos y a preparar la ciudad para situaciones críticas. En general, se trata de iniciativas que se implementan individual o parcialmente, sin que haya un plan integral promovido a escala colectiva. Las correcciones resultan marginales en el conjunto sin aliviar los problemas que se agravan por el crecimiento vertiginoso de las demandas. Entonces la continuidad del modelo energético argentino basado en hidrocarburos, para abastecer infraestructura que trabaja al límite de su capacidad y servir territorios que no se han preparado para las posibles crisis, explicaría la vulnerabilidad del sistema de abastecimiento metropolitano.

  10. The Catholic Church, Political Institutions, and Electoral Outcomes in Oaxaca, Mexico

    Directory of Open Access Journals (Sweden)

    Allyson Lucinda Benton Sheldon

    2011-01-01

    Full Text Available En este artículo, se analizan dos argumentos con respecto al papel que la Iglesia católica ha desempeñado dentro de la política estatal en Oaxaca, México, durante las décadas de 1990 y 2000. En el primero de ellos, se plantea que los obispos tienden a favorecer y a facilitar los procesos de democratización en este estado. En el segundo, se sugiere que la Iglesia pudo haber favorecido involuntariamente el autoritarismo gubernamental al apoyar con entusiasmo la legalización de usos y costumbres en la política local. El análisis estadístico presentado en este trabajo muestra que el grado de presencia católica en los municipios oaxaqueños sólo importa en algunos casos y no siempre en la dirección esperada. Más en concreto, ladefensa de tal legalización en algunas comunidades indígenas donde la presencia del catolicismo prevalece, ha disminuido el apoyo al pri y a los partidos marginales. En cambio, en otras comunidades indígenas, el efecto ha sido el contrario. Finalmente, se concluye que la falta de resultados sistematizados demuestra la capacidad de la Iglesia católica para intervenir en las políticas locales oaxaqueñas.

  11. Regional Analysis of Precipitation by Means of Bivariate Distribution Adjusted by Maximum Entropy; Analisis regional de precipitacion con base en una distribucion bivariada ajustada por maxima entropia

    Energy Technology Data Exchange (ETDEWEB)

    Escalante Sandoval, Carlos A.; Dominguez Esquivel, Jose Y. [Universidad Nacional Autonoma de Mexico (Mexico)

    2001-09-01

    The principle of maximum entropy (POME) is used to derive an alternative method of parameter estimation for the bivariate Gumbel distribution. A simple algorithm for this parameter estimation technique is presented. This method is applied to analyze the precipitation in a region of Mexico. Design events are compered with those obtained by the maximum likelihood procedure. According to the results, the proposed technique is a suitable option to be considered when performing frequency analysis of precipitation with small samples. [Spanish] El principio de maxima entropia, conocido como POME, es utilizado para derivar un procedimiento alternativo de estimacion de parametros de la distribucion bivariada de valores extremos con marginales Gumbel. El modelo se aplica al analisis de la precipitacion maxima en 24 horas en una region de Mexico y los eventos de diseno obtenidos son comparados con los proporcionados por la tecnica de maxima verosimilitud. De acuerdo con los resultados obtenidos, se concluye que la tecnica propuesta representa una buena opcion, sobre todo para el caso de muestras pequenas.

  12. Aux marges du monde arabe

    Directory of Open Access Journals (Sweden)

    Hélène Thiollet

    2004-09-01

    Full Text Available L’étude des migrations contemporaines des Érythréens vers le Yémen au tournant des années quatre-vingt-dix permet d’observer les transformations des dynamiques régionales à l’œuvre dans le monde arabe. Les migrations sont un phénomène sensible aux différents aspects (politiques, économiques, culturels, géographiques de l’intégration régionale. Celle si est envisagée dans cet article à travers une approche doublement marginale : -la marginalité géographique de l’Érythrée arabo-africaine et du Yémen, économi­quement isolé dans la péninsule Arabique, -l’étude des migrations formelles et informelles, élément souvent marginal dans l’étude des institutions et des échanges qui constituent un système régional intégré. Cette étude est fondée sur une série d’entretiens menés au Yémen entre février et avril 2002 auprès des administrations yéménites et de la population érythréenne.

  13. The characterization and manipulation of the bacterial microbiome of the Rocky Mountain wood tick, Dermacentor andersoni.

    Science.gov (United States)

    Clayton, Katie A; Gall, Cory A; Mason, Katheen L; Scoles, Glen A; Brayton, Kelly A

    2015-12-10

    In North America, ticks are the most economically impactful vectors of human and animal pathogens. The Rocky Mountain wood tick, Dermacentor andersoni (Acari: Ixodidae), transmits Rickettsia rickettsii and Anaplasma marginale to humans and cattle, respectively. In recent years, studies have shown that symbiotic organisms are involved in a number of biochemical and physiological functions. Characterizing the bacterial microbiome of D. andersoni is a pivotal step towards understanding symbiont-host interactions. In this study, we have shown by high-throughput sequence analysis that the composition of endosymbionts in the midgut and salivary glands in adult ticks is dynamic over three generations. Four Proteobacteria genera, Rickettsia, Francisella, Arsenophonus, and Acinetobacter, were identified as predominant symbionts in these two tissues. Exposure to therapeutic doses of the broad-spectrum antibiotic, oxytetracycline, affected both proportions of predominant genera and significantly reduced reproductive fitness. Additionally, Acinetobacter, a free-living ubiquitous microbe, invaded the bacterial microbiome at different proportions based on antibiotic treatment status suggesting that microbiome composition may have a role in susceptibility to environmental contaminants. This study characterized the bacterial microbiome in D. andersoni and determined the generational variability within this tick. Furthermore, this study confirmed that microbiome manipulation is associated with tick fitness and may be a potential method for biocontrol.

  14. Micronutrient deficiencies in the English-speaking Caribbean and in Guyana

    Directory of Open Access Journals (Sweden)

    1998-01-01

    Full Text Available Tres estudios recientes analizaron el grado de deficiencia de vitamina A, betacarotenos y hierro en Jamaica, Antigua y Barbuda, Dominica, San Vicente y las Granadinas y Guyana. Todos los estudios fueron efectuados por el Instituto Caribeño de Alimentación y Nutrición, o en colaboración con él. En todas las encuestas, que fueron similares en su estructura y resultados, se recolectaron muestras de sangre con el fin de determinar las deficiencias de micronutrientes. También se aplicaron cuestionarios para recoger información sobre los patrones de alimentación. Los principales grupos estudiados fueron los niños pequeños, los escolares y las mujeres embarazadas. La anemia por deficiencia de hierro fue la deficiencia de micronutrientes más común de las que se encontraron en los tres estudios. Aunque se hallaron pocos casos de deficiencia de vitamina A grave, fueron más comunes las deficiencias marginales. En los tres estudios se hicieron recomendaciones similares para hacer frente a las deficiencias detectadas en los diversos países. Es menester que los gobiernos y otras agencias sigan promoviendo la disponibilidad y el consumo de alimentos ricos en vitamina A y caroteno. Los programas contra la anemia deben dirigirse específicamente hacia los niños de 1 a 4 años de edad y las mujeres embarazadas.

  15. Do Followers Really Matter in Stackelberg Competition?

    Directory of Open Access Journals (Sweden)

    Ludovic Julien

    2011-01-01

    Full Text Available En este artículo se considera un modelo de oligopolio de Stackelberg lineal en T etapas. En primer lugar, se muestra geométrica y analíticamente que bajo las condiciones de demanda de mercado lineal y costos marginales constantes e idénticos el modelo de Stackelberg en T etapas se reduce a un modelo en el que T firmas explotan la demanda residual secuencialmente. En cualquier etapa, los líderes se comportan como si los seguidores no importaran. En segundo lugar, se estudia el bienestar social y la convergencia hacia el equilibrio competitivo. En particular, se considera la velocidad de convergencia a medida que el número de firmas incrementa. La convergencia es más rápida cuando las firmas se relocalizan desde la cohorte más poblada a la menos poblada hasta que el tamaño de las cohortes se iguala.

  16. ABANDONO Y VAGABUNDAJE INFANTIL EN SANTIAGO DE CHILE. 1930-1950

    Directory of Open Access Journals (Sweden)

    Sandra Poblete Naumann

    2011-10-01

    Full Text Available La sociedad chilena de la primera mitad del siglo XX, experimentó diversas y profundas transformaciones agudizándose algunos problemas que aunque existentes con anterioridad no habían alcanzado una trascendencia socio-económica y política tan significativa. Uno de ellos fue el problema del abandono y vagabundaje infantil que cobró mayor intensidad precisamente entre las décadas de 1930 y 1950. La Gran Depresión y la crisis económica producidas por la Segunda Guerra Mundial, generaron un fuerte crecimiento industrial en el país. Sin embargo, este fenómeno asociado a un sostenido proceso de modernización y urbanización arrastró consigo solamente a ciertos sectores y, por ende, gran parte de la sociedad siguió enfrentada a grandes contrastes y desequilibrios, surgiendo importantes cordones marginales especialmente en torno a la ciudad de Santiago.

  17. Morfología y anatomía del gametofito de Didymochlaena truncatula (Dryopteridaceae

    Directory of Open Access Journals (Sweden)

    Aniceto Mendoza

    1999-06-01

    Full Text Available En este trabajo se presenta el estudio de la fase sexual de Didymochlaena truncatula. Las espora son monoletes con perina, elipsoidales, no clorofílicas. Su germinación es tipo Vittaria y su desarrollo protálico es tipo Adiantum, el gametofito adulto es cordiforme-espatulado a cordiforme-reniforme, no presentan ningún tipo de tricoma, los rizoides no tienen cloroplastos, sus gametangios son del tipo común de los helechos leptosporangiados, las primeras hojas del esporofito se forman después de 100 días de haber sido sembradas las esporas, son de forma espatulada con venación dicotómica y tricomas unicelulares marginales, cortos y capitados.Sexual phase development was studied in Didymochlaena truncatula, on the basis of spores collected in Península Moreno and Tebanca, Catemaco, Veracruz, México. The spores are monolete, ellipsoid, with perine, and non-clorophyllic. The germination pattern is of the Vittaria-type and the prothallial development is of the Adiantum-type, the adult gametophytes are cordiform to reniform and without trichomes; the gametangia are typical of the leptosporangiate ferns. The first leaf of the sporophyte appears 100 days after the sowing of the spores, the lamina is spatulate-shaped, with dichotomous venation and short capitate, unicellular marginal hairs.

  18. Paradojas del género y la sexualidad en la filmografía durante la última dictadura militar argentina

    Directory of Open Access Journals (Sweden)

    Débora Carina D’Antonio

    2015-11-01

    Full Text Available En este artículo ofrezco una interpretación acerca de por qué el último gobierno militar argentino promovió por medio de la selección condicionada del financiamiento una serie de películas que ensayaron una visión contradictoria a la del discurso oficial sobre el género y la sexualidad, más aún teniendo en cuenta que la cinematografía es un medio artístico, industrial y comercial partícipe de la cultura de masas y, por lo tanto, de considerable influencia social y cultural. Estas películas, que fueron caracterizadas por los periodistas y críticos de cine como sexi comedias, ligeras o picarescas, no fueron marginales en la industria cinematográfica ya que, por el contrario, representaron un porcentaje nada despreciable de lo producido en esos años.

  19. Estudio de las Características Psicométricas de la forma corta del Test de Beery con el modelo Rasach

    Directory of Open Access Journals (Sweden)

    Luis Miguel Escurra Mayaute

    1993-06-01

    Full Text Available Se realizó el estudio de las principales características de la forma corta del Test de Desarrollo Visomotor de Beery, desarrollada por Salazar y Delgado en 1985, bajo los supuestos del modelo deRasch.Se aplicó la prueba a 1210 sujetos de Lima Metropolitana, (49.9% mujeres y 50.1% hombres pertenecientes a centros educativos estatales y noestatales, de 1°, 2° y 3° grado de primaria y que residen en zonas urbanas y urbanas-marginales.Los resultados confirman que la prueba conformada por 12 ítems, al ser analizados bajo el modelo probabilístico de Rasch obtienen valores que no se adecuan al modelo, en tanto que al eliminar 6 ítems se conforma una escala que cumple con todos los supuestos del modelo. Se computaron los valores de los ítems-parámetros y los persona-parámetros, así como los análisis estadísticos básicos para evaluar la bondad de ajuste al modelo.

  20. Nueva especie del quitón Lepidochitona (Polyplacophora: Ischnochitonidae de Puerto Rico

    Directory of Open Access Journals (Sweden)

    Cedar I García-Ríos

    2010-06-01

    Full Text Available El género Lepidochitona Gray, 1821 tiene dos especies en el Caribe: L. liozonis (Dall & Simpson, 1901 y L. rosea Kaas, 1972. Se describe una tercera especie: Lepidochitona rufoi sp. nov. de Puerto Rico. Lepidochitona rufoi difiere de ambas por tener un tegumento finamente granuloso, menor tamaño, una rádula con dientes centrales muy finos, la forma de la valva anal y el color diferentes. También difiere de L. liozonis por tener espículas marginales más largas.A new species of the chiton Lepidochitona (Polyplacophora: Ischnochitonidae from Puerto Rico. The genus Lepidochitona Gray, 1821 has two species in the Caribbean: L. liozonis (Dall & Simpson, 1901 and L. rosea Kaas, 1972. We describe a third species: Lepidochitona rufoi sp. nov. from Puerto Rico. Lepidochitona rufoi differs from both in having a finely granulose tegmentum, smaller size, a very fine central radula tooth, and different anal plate form and color pattern. It also differs from L. liozonis in having longer marginal spicules. Rev. Biol. Trop. 58 (2: 635-644. Epub 2010 June 02.

  1. eLEARNING - EINE CHANCE FÜR KLEINE UND MITTLERE UNTERNEHMEN

    Directory of Open Access Journals (Sweden)

    Ileana Hamburg

    2005-12-01

    Full Text Available eLearning wird durch seine Flexibilität und Zugänglichkeit als bedeutendes Instrument für die Implementierung lebenslangen Lernens (LLL angesehen. Es kann für kleine und mittelgroße Unternehmen (KMU einen Katalysator des Wandels sein und bietet damit die Chance zur Verbesserung der wirtschaftlichen Leistungsfähigkeit. Darüber hinaus kann eLearning dazu dienen, die Integration von KMU in den europäischen Markt zu fördern. Bis jetzt wird eLearning im Rahmen der beruflichen Aus- und Weiterbildung jedoch nahezu ausschließlich in Großunternehmen genutzt, während es in KMU allenfalls eine marginale Rolle spielt. Im ersten Kapitel dieses Artikels wird auf den Perspektivenwechsel in der beruflichen Aus- und Weiterbildung eingegangen. Im Anschluss daran werden die zentralen Elemente von eLearning vorgestellt (Kap. 2. Die mit eLearning verbundenen Chancen und Herausforderungen für KMU diskutiert (Kap. 3. Abschließend wird auf Erfahrungen mit eLearning in der Praxis am Beispiel von drei EU-finanzierten Projekten eingegangen. Das Hauptaugenmerk liegt dabei auf dem laufenden Projekt ARIEL -Analysing and Reporting the Implementation of Electronic Learning in Europe -, das vom Institut Arbeit und Technik, Gelsenkirchen, (IAT koordiniert wird.

  2. Anna-Caterina Walk: Das Andere im Tatort. Migration und Integration im Fernsehkrimi. Marburg: Tectum Wissenschaftsverlag 2011.

    Directory of Open Access Journals (Sweden)

    Patricia Piberger

    2012-08-01

    Full Text Available Aus medien- und kulturwissenschaftlicher Perspektive widmet sich Anna-Caterina Walk in ihrer knappen Publikation der TV-Krimireihe ‚Tatort‘. Anhand von drei konkreten Folgen analysiert sie, wie das Andere in dieser Serie medial repräsentiert und konstruiert wird. Ihr Ziel ist es, die konkreten Darstellungen und deren Bedeutungen in ihrer Selbstverständlichkeit zu hinterfragen. Dabei sucht sie vor allem nach nicht-stereotypen oder destabilisierenden Bildern und fordert zugleich einen kritischeren Umgang mit Differenzkonstruktionen der Identität innerhalb der einzelnen ‚Tatort‘-Folgen. Zumal der Fokus der Autorin auf kulturellen Andersartigkeiten liegt, kommen Betrachtungen des_der geschlechtlich Anderen eine marginale Position zu und bleiben prinzipiell eher oberflächlich.In her concise publication, Anna-Caterina Walk dedicates herself to the TV crime series Tatort using a media studies and cultural studies perspective. Based on three specific episodes, she analyzes how the ‘other’ is medially represented and constructed in the series. She aims at questioning the self-evidence of specific representations and their meanings. In doing so, she searches, above all, for non-stereotypical or destabilizing images and, at the same time, demands a more critical approach to constructions of difference regarding identity within the individual Tatort episodes. Considerations of the gendered ‘other/s’ are treated only marginally and generally remain superficial, particularly since the author focuses on cultural otherness.

  3. Fisiología hemática

    Directory of Open Access Journals (Sweden)

    Alfonso Magot

    1946-03-01

    Full Text Available Conferencia dictada en el Curso de Fisiología de la Facultad de Medicina de la Universidad Nacional. Fisiología y Fisiopatología del Retículo-endotelio El S. R. E. se deriva del mesenquima, cuyos carácteres conserva potencialmente. Las células que lo componen son fijas o móviles: las fijas se encuentran, unas, células reticulares, formando la trama de ciertos órganos hemopoyéticos o glandulares; otras, adventiciales, alrededor de los capilares de todo el organismo; otras marginales o endoteliales, formando la pared de los capilares sinusoides. Las móviles se mueven entre las mallas del conectivo (histiocitos o en la sangre (monocitos. Dado su carácter de "mesenquima persistente", las células del S. R. E. tienen propiedades similares a las que presentan los organismos unicelulares: amibioísmo, diapedesis, granulopexia, fagocitosis, digestión, absorción, secreción de fermentos, producción de sustancias orgánicas, excreción, respiración y reproducción.

  4. Serologic survey for selected arboviruses and other potential pathogens in wildlife from Mexico.

    Science.gov (United States)

    Aguirre, A A; McLean, R G; Cook, R S; Quan, T J

    1992-07-01

    During 1988 and 1989, a serologic survey of wildlife was conducted in northeastern Mexico to determine the presence, prevalence, and distribution of arboviruses and other selected disease agents. Eighty mammal specimens were tested. Antibodies to vesicular stomatitis-Indiana, Venezuelan equine encephalitis-Mena II, Rio Grande virus, and vesicular stomatitis-New Jersey were detected predominantly in small mammals. Deer and mouflon (Ovis musimon) had antibodies to bluetongue and epizootic hemorrhagic disease. Two species had serologic evidence of recent exposure to Francisella tularensis. A white-tailed deer (Odocoileus virginianus) had antibodies to Anaplasma marginale. All specimens tested for antibodies against Yersinia pestis and Brucella abortus were negative. Sera from 315 birds were tested for antibody against five equine encephalitis viruses and six avian pathogens. During 1988, antibodies to Venezuelan equine encephalitis-Mena II, Venezuelan equine encephalitis-TC83, St. Louis encephalitis, eastern equine encephalitis, and western equine encephalitis were detected in birds of several species. Antibodies to Pasteurella multocida and Newcastle disease virus were also detected. Birds from five species presented antibodies to Mycoplasma meleagridis. Specimens tested for M. gallisepticum, M. synoviae, and Chlamydia psittaci were negative. To the best of our knowledge, this survey represents the first serologic evidence of bluetongue, Cache Valley virus, epizootic hemorrhagic disease, Jamestown Canyon virus, vesicular stomatitis-Indiana, vesicular stomatitis-New Jersey, Rio Grande virus, and tularemia reported among wildlife in Mexico.

  5. La finance et le développement économique

    Directory of Open Access Journals (Sweden)

    Ugo Panizza

    2012-04-01

    Full Text Available Cet article traite de la littérature sur la finance et le développement économique. Il propose tout d’abord une description des rôles de la finance, ainsi qu’une définition de l’efficacité financière. Il poursuit avec une discussion autour de la question suivante : les pays peuvent-ils présenter des secteurs financiers « trop importants » pour la taille de leur économie nationale ? L’article décrit ensuite plusieurs indicateurs du développement financier, puis examine la littérature traitant de la relation entre développement financier et croissance économique. Cet examen de la littérature aborde en détail des indicateurs récents prouvant que la contribution marginale du développement financier à la croissance du PIB devient négative lorsque le crédit au secteur privé atteint 110 % du PIB. L’article propose pour terminer des conclusions politiques à l’intention des pays en développement.

  6. LA OTRA CARA. Políticas públicas, inclusión laboral y jóvenes urbanos de sectores populares en un movimiento social

    Directory of Open Access Journals (Sweden)

    Analia Elizabeth Otero

    2015-04-01

    Full Text Available El propósito del artículo es reflexionar sobre las políticas públicas implementadas desde el gobierno nacional hacia los movimientos sociales en el contexto argentino actual. El interés es debatir la influencia de los programas sociales –en particular el Programa de Ingreso Social con Trabajo (en adelante PAT– en la situación de los jóvenes de sectores urbanos populares. Lo haremos a partir de abordar la compleja relación entre los emprendimientos cooperativos, las políticas de subsidio y las estrategias de los jóvenes participantes en una experiencia territorial. La base empírica resulta de una investigación cualitativa con militantes de un movimiento de trabajadores desocupados. Los hallazgos dan cuenta de múltiples tensiones; mientras que su adscripción a la acción colectiva promueve la autogestión y mediatiza el acceso a planes sociales, como componentes de la fuerza de trabajo en período activo y de formación, los trabajadores desocupados siguen ubicados en posiciones marginales respecto al mercado de empleo.  

  7. Dinámica de los componentes demográficos en Baja California, durante el periodo 1985-1990

    Directory of Open Access Journals (Sweden)

    Gabriel Estrella Valenzuela

    1991-09-01

    Full Text Available En este trabajo se identifican los rangos predominantes en la dinámica de los componentes demográficos del estado de Baja California y sus municipios, durante el período 1985-1990. Para ello, se utilizan y combinan datos de estadísticas vitales, censales y de las Encuestas Demográficas de Baja California de 1986 y 1990. A partir del análisis de la mortalidad y la fecundidad, se logra determinar una tendencia de estabilidad en el componente natural de la dinámica demográfica del estado, con variaciones marginales a nivel municipal. En el rubro de crecimiento social, sin embargo, se observa un notable y claro incremento en la movilidad de la población que se sustenta en dos componentes: un incremento en la tasa de emigración desde el estado en su conjunto y una más elevada y consistente tendencia al incremento en las tasas de inmigración hacia Baja California, que revierte la tendencia decreciente del peso del crecimiento social en la entidad

  8. A specific DNA probe which identifies Babesia bovis in whole blood.

    Science.gov (United States)

    Petchpoo, W; Tan-ariya, P; Boonsaeng, V; Brockelman, C R; Wilairat, P; Panyim, S

    1992-05-01

    A genomic library of Babesia bovis DNA from the Mexican strain M was constructed in plasmid pUN121 and cloned in Escherichia coli. Several recombinants which hybridized strongly to radioactively labeled B. bovis genomic DNA in an in situ screening were selected and further analyzed for those which specifically hybridized to B. bovis DNA. It was found that pMU-B1 had the highest sensitivity, detecting 25 pg of purified B. bovis DNA, and 300 parasites in 10 microliters of whole infected blood, or 0.00025% parasitemia. pMU-B1 contained a 6.0 kb B. bovis DNA insert which did not cross-hybridize to Babesia bigemina, Trypanosoma evansi, Plasmodium falciparum, Anaplasma marginale, Boophilus microplus and cow DNA. In the Southern blot analysis of genomic DNA, pMU-B1 could differentiate between two B. bovis geographic isolates, Mexican strain M and Thai isolate TS4. Thus, the pMU-B1 probe will be useful in the diagnosis of Babesia infection in cattle and ticks, and in the differentiation of B. bovis strains.

  9. PANDILLA 18 Y MARA SALVATRUCHA 13: VIOLENCIA Y DESCIUDADANIZACIÓN

    Directory of Open Access Journals (Sweden)

    Mónica Sánchez González

    2012-12-01

    Full Text Available El presente trabajo es parte de una investigación sobre formas de reestratificación desde la sociedad civil. Aquí se observan las estrategias institucionales para el tratamiento del fenómeno de las pandillas transnacionales llevadas a cabo en El Salvador. Se observa cómo estas estrategias producen mayor violencia, sin presentar opciones organizativas orientadas a mejorar la vida de los jóvenes pandilleros, sin buscar crear formas sociales productivas en el sentido de asegurar a los jóvenes marginales instancias de resistencia a los influjos del sistema capitalista que los excluye. En estos términos, se propone observar las estrategias gubernamentales y sus efectos en la transformación de las pandillas hacia formas más violentas y jerarquizadas, debido a la acción criminalizante de las instituciones del gobierno. Así pues, se propone la observación de la reestratificación institucional de las pandillas, mediante la criminalización y su asimilación al crimen organizado, como elemento que ha producido una tendencia a la jerarquización, la clandestinidad y el aumento de la violencia. 

  10. La evaluación del programa de salud familiar: un enfoque sistémico desde la perspectiva estudiantil

    Directory of Open Access Journals (Sweden)

    Campos Gómez Lenis

    1999-12-01

    Full Text Available

    The evaluation of the program of family extension, it has been a carried out task every time that you culminate a cycle of formation of the program of nursing of the University of Córdoba. This is developed for the same students who with focus system evaluates the context where development the program, the entrances or inputs, the processes, their relationships, the employed communication and their products. They like components are had the subsystem of teaching, attendance, families and environment. The study is descriptive, the designed instruments and applied by the investigators and their outputs permit feedback the program in order to begin a new cycle.

    Salud familiar como programa de extensión de la Facultad de Ciencias de la Salud de la Universidad de Córdoba, se ha desarrollado en comunidades urbanas marginales de los municipios de Montería y Cereté. En éste, a través de los años, se formaron varios grupos estudiantiles que han aplicado el avance en sus conocimientos en acciones tendientes al mejoramiento de la calidad de vida de las familias pertenecientes a éstas, y dentro de los principios de atenci��n primaria y salud familiar.

  11. Antropología y medio ambiente. Revisión de una tradición y nuevas perspectivas de análisis en la problemática ecológica

    Directory of Open Access Journals (Sweden)

    Beatriz Santamarina Campos

    2008-05-01

    Full Text Available Durante los últimos años la producción etnográfica sobre el conflicto medio ambiental ha generado un volumen considerable de aportaciones. En este artículo se contextualiza, en la tradición antropológica, las distintas perspectivas (la ecológica, la simbólica cognitiva y la política que se han ocupado del entorno, de la construcción de la naturaleza y del papel otorgado a la naturaleza en la distribución de relaciones de poder. Todo para situar a las perspectivas de la ecología simbólica y ecología política como los enfoques, desde nuestro punto de vista, más pertinentes para abordar el conflicto medio ambiental. En un mundo donde se imponen visiones hegemónicas y discursos ecológicos globalizados, basados en una racionalidad político-económica que se pretende única, se hace necesario un análisis crítico para descifrar las claves de nuestra práctica cultural y para poner en práctica todo el conocimiento local aprendido, que permita sacar a la luz otros discursos practicables posibles desde lógicas marginales.

  12. Parasites of domestic and wild animals in South Africa. L. Ixodid ticks infesting horses and donkeys.

    Science.gov (United States)

    Horak, Ivan G; Heyne, Heloise; Halajian, Ali; Booysen, Shalaine; Smit, Willem J

    2017-02-28

    The aim of the study was to determine the species spectrum of ixodid ticks that infest horses and donkeys in South Africa and to identify those species that act as vectors of disease to domestic livestock. Ticks were collected opportunistically from 391 horses countrywide by their owners or grooms, or by veterinary students and staff at the Faculty of Veterinary Science, University of Pretoria. Ticks were also collected from 76 donkeys in Limpopo Province, 2 in Gauteng Province and 1 in North West province. All the ticks were identified by means of a stereoscopic microscope. Horses were infested with 17 tick species, 72.1% with Rhipicephalus evertsi evertsi, 19.4% with Amblyomma hebraeum and 15.6% with Rhipicephalus decoloratus. Rhipicephalus evertsi evertsi was recovered from horses in all nine provinces of South Africa and R. decoloratus in eight provinces. Donkeys were infested with eight tick species, and 81.6% were infested with R. evertsi evertsi, 23.7% with A. hebraeum and 10.5% with R. decoloratus. Several tick species collected from the horses and donkeys are the vectors of economically important diseases of livestock. Rhipicephalus evertsi evertsi is the vector of Theileria equi, the causative organism of equine piroplasmosis. It also transmits Anaplasma marginale, the causative organism of anaplasmosis in cattle. Amblyomma hebraeum is the vector of Ehrlichia ruminantium, the causative organism of heartwater in cattle, sheep and goats, whereas R. decoloratus transmits Babesia bigemina, the causative organism of babesiosis in cattle.

  13. PSA-NCAM expression in the teleost optic tectum is related to ecological niche and use of vision in finding food.

    Science.gov (United States)

    Labak, I; Pavić, V; Zjalić, M; Blažetić, S; Viljetić, B; Merdić, E; Heffer, M

    2017-08-01

    In this study, tangential migration and neuronal connectivity organization were analysed in the optic tectum of seven different teleosts through the expression of polysialylated neural cell adhesion molecule (PSA-NCAM) in response to ecological niche and use of vision. Reduced PSA-NCAM expression in rainbow trout Oncorhynchus mykiss optic tectum occurred in efferent layers, while in pike Esox lucius and zebrafish Danio rerio it occurred in afferent and efferent layers. Zander Sander lucioperca and European eel Anguilla anguilla had very low PSA-NCAM expression in all tectal layers except in the stratum marginale. Common carp Cyprinus carpio and wels catfish Silurus glanis had the same intensity of PSA-NCAM expression in all tectal layers. The optic tectum of all studied fishes was also a site of tangential migration with sustained PSA-NCAM and c-series ganglioside expression. Anti-c-series ganglioside immunoreactivity was observed in all tectal layers of all analysed fishes, even in layers where PSA-NCAM expression was reduced. Since the optic tectum is indispensable for visually guided prey capture, stabilization of synaptic contact and decrease of neurogenesis and tangential migration in the visual map are an expected adjustment to ecological niche. The authors hypothesize that this stabilization would probably be achieved by down-regulation of PSA-NCAM rather than c-series of ganglioside. © 2017 The Fisheries Society of the British Isles.

  14. Entrevista: La planeación urbana: una herramienta para encontrar la justicia espacial en las ciudades del siglo XXI

    Directory of Open Access Journals (Sweden)

    Steven Navarrete Cardona

    2014-01-01

    Full Text Available Más allá de ser un ejercicio técnico en el que se definen los parámetros normativos en las espacialidades de la ciudad tanto en el presente como para el futuro (por ejemplo, a través de la creación e implementación de un Plan de Ordenamiento Territorial, la planificación es un ejercicio de poder. Sin duda, la forma en que se organiza la ciudad, sus espacios verdes, la amplitud de las vías de comunicación, los modelos de movilidad a implementar y el patrimonio a renovar, hacen parte clave de las ideas que componen la planificación. ¿Pero qué intereses mueven dicho ejercicio de la planificación? Esto es lo que se pregunta el ciudadano de a pie, el profano, el habitante de los barrios y localidades marginales, que, aunque pague el impuesto predial y de valorización, nunca verá las calles del lugar en que reside pavimentadas o más rutas de transporte público para llegar a su trabajo o a donde le plazca.

  15. Lagrange formalism for a system of several fluids interacting electromagnetically; Formalisme lagrangien pour un systeme de plusieurs fluides en interaction electromagnetique

    Energy Technology Data Exchange (ETDEWEB)

    Vuillemin, M [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1964-07-01

    After giving the Lagrange expression for a conducting fluid in an external electromagnetic field, the author shows that a Lagrange expression exists for describing the evolution of a system of interacting fluids obtained by adding the Lagrange expression of each fluid.to that of the electromagnetic field. By variation are obtained the fluid movement equation coupled to the Maxwell equations. It is shown that the study of small movements around a stationary state can be deduced from the Lagrange equation expanded to the second power order of the perturbation. It is then possible to deduce the normal mode equations and the study the stability by examining the modes which are marginally stable. (author) [French] Apres avoir rappele l'expression, du Lagrangien pour un fluide conducteur dans un champ electromagnetique exterieur, on montre qu'il existe un Lagrangien pour decrire l'evolution d'un systeme de fluides en.interaction que l'on obtient par la superposition du Lagrangien de chaque fluide et du Lagrangien du champ electromagnetique. On obtient par variation, les equations du mouvement des fluides, couplees aux equations de Maxwell. On montre que l'etude des petits mouvements autour d'un etat stationnaire se deduit du Lagrangien developpe au second1 ordre en puissance de la perturbation. On peut alors retrouver les equations des modes normaux et etudier la stabilite en recherchant les modes marginalement stables. (auteur)

  16. Primer registro de Naupactus ruizi (Coleoptera: Curculionoidea asociado con Pinus ponderosa (Gymnospermae: Pinaceae en Patagonia

    Directory of Open Access Journals (Sweden)

    Cecilia A. GOMEZ

    2006-01-01

    Full Text Available Naupactus ruizi (Brèthes es un gorgojo de rostro corto, distribuido en la Argentina y Chile, que habita en ambientes áridos asociado con vegetación xerofítica y alcanza el rango más austral entre los miembros de la tribu Naupactini. Un relevamiento de insectos y de patógenos como plagas potenciales, realizado durante el 2005 en plantaciones de Pinus spp. en la Patagonia andina argentina, resultó en el hallazgo de adultos de N. ruizi que se alimentaban de acículas de Pinus ponderosa Dougl. ex Laws. Este hallazgo es sorprendente dado que las especies de Naupactini, consumen casi exclusivamente angiospermas. Interpretamos que el cambio de huésped, habría ocurrido como consecuencia de una colonización reciente favorecida por la amplia distribución geográfica del gorgojo y su capacidad para sobrevivir en hábitats marginales, donde probablemente las plantas nativas son escasas y el nuevo huésped presenta una gran abundancia local.

  17. LA CONSTRUCCIÓN DEL CONCEPTO DEL DERECHO ALIMENTARIO EN COLOMBIA: UNA MIRADA A TRAVÉS DE LA JURISPRUDENCIA DE LA CORTE CONSTITUCIONAL DE COLOMBIA.

    Directory of Open Access Journals (Sweden)

    Olga Cecilia Restrepo-Yepes

    2013-11-01

    Full Text Available El artículo ofrece desde la perspectiva de la dogmática constitucional, la forma en que la Corte Constitucional de Colombia viene protegiendo el derecho alimentario. Es así que se realiza una revisión de los diferentes aspectos por los cuales puede ser reclamado el derecho y de las maneras en las cuales los jueces contribuyen o no a su protección. La relación entre el derecho alimentario y la protección de este ha debido reconstruirse apelando a referencias marginales ocasionales, quizá demasiado accidentales en momentos determinados, al "derecho alimentario",el cual, por no estar precisamente consolidado en la mente de los operadores jurídicos, se encuentra de manera dispersa y fragmentaria en una casuística considerablemente extensa. Es por esto que este artículo lleva a evaluar el papel del juez constitucional en el proceso de reclamación que los titulares del os derechos han llevado a cabo en las situaciones en las cuales los han visto vulnerados. Mostrar las indecisiones, las vacilaciones, las discrepancias entre losjueces acerca de aspectos que deberían ser axiomáticos en la práctica jurídica parece una tarea relevante y útil en el proceso de consolidación del Estado socialde Derecho y de la protección del derecho mismo.

  18. Editorial

    Directory of Open Access Journals (Sweden)

    Alvaro Correa Arroyave

    1997-09-01

    Full Text Available Una de las ramas de la ingeniería, como lo es la ingeniería civil, se encuentra aportando sus conocimientos a la transformación que experimenta actualmente en pro del desarrollo que obliga la reciente apertura económica. Los retos son cada vez mayores pues se necesitan de soluciones más audaces: la modernización de la malla vial urbana incluyendo la utilización del espacio subterráneo, conservando intactas las estructuras de superficie; la construcción de las dobles calzadas que en algunos tramos demandarán de obras suspendidas y túneles falsos; la utilización de materiales marginales, y la construcción de pequeños galerías para lograr el asentamiento general de las grandes edificaciones, entre otros, son algunos de los ejemplos que tendremos que afrontar en el futuro cercano.

  19. El humor y la guerra. Tiras cómicas y cartoons en el diario Clarín durante el conflicto por las Malvinas

    Directory of Open Access Journals (Sweden)

    Florencia Paula Levín

    2012-03-01

    Full Text Available El año 1982 se inicia en la Argentina en medio de una importante crisis del régimen militar que impulsó a los militares a utilizar el viejo conflicto con Gran Bretaña por las islas Malvinas como un vehículo para movilizar el consenso de la sociedad acallando el creciente descontento que ya se comenzaba a expresar incluso en masivas manifestaciones públicas. En este artículo se abordará el comportamiento del humor gráfico del diario Clarín (entonces el matutino de mayor tirada a nivel nacional y expresión del sentido común de las clases medias en el contexto del conflicto con Gran Bretaña con el objetivo de demostrar que el mismo fue un vehículo que sirvió tanto para expresar, desde la particular óptica y reglas del género, los principales tópicos del discurso oficial y participar de la euforia nacionalista desatada por la “recuperación” de las islas como para habilitar, en lo márgenes de ese espacio, la emergencia de otras ópticas, minoritarias y relativamente marginales, que abrieron un espacio para el distanciamiento crítico del gobierno militar.

  20. A comparison of DNA extraction protocols from blood spotted on FTA cards for the detection of tick-borne pathogens by Reverse Line Blot hybridization.

    Science.gov (United States)

    Hailemariam, Zerihun; Ahmed, Jabbar Sabir; Clausen, Peter-Henning; Nijhof, Ard Menzo

    2017-01-01

    An essential step in the molecular detection of tick-borne pathogens (TBPs) in blood is the extraction of DNA. When cooled storage of blood under field conditions prior to DNA extraction in a dedicated laboratory is not possible, the storage of blood on filter paper forms a promising alternative. We evaluated six DNA extraction methods from blood spotted on FTA Classic ® cards (FTA cards), to determine the optimal protocol for the subsequent molecular detection of TBPs by PCR and the Reverse Line Blot hybridization assay (RLB). Ten-fold serial dilutions of bovine blood infected with Babesia bovis, Theileria mutans, Anaplasma marginale or Ehrlichia ruminantium were made by dilution with uninfected blood and spotted on FTA cards. Subsequently, DNA was extracted from FTA cards using six different DNA extraction protocols. DNA was also isolated from whole blood dilutions using a commercial kit. PCR/RLB results showed that washing of 3mm discs punched from FTA cards with FTA purification reagent followed by DNA extraction using Chelex ® resin was the most sensitive procedure. The detection limit could be improved when more discs were used as starting material for the DNA extraction, whereby the use of sixteen 3mm discs proved to be most practical. The presented best practice method for the extraction of DNA from blood spotted on FTA cards will facilitate epidemiological studies on TBPs. It may be particularly useful for field studies where a cold chain is absent. Copyright © 2016 Elsevier GmbH. All rights reserved.

  1. Problemas económicos de la hiperurbanización

    Directory of Open Access Journals (Sweden)

    Ramón Frediani

    2010-04-01

    Full Text Available El artículo analiza los problemas del fenómeno de hiperurbanización. La causalidad se origina en el cambio tecnológico acelerado y la globalización. Se observa que más del 85% del PBI y del empleo es generado por la actividad comercial, industrial y de servicios dentro de las ciudades.La migración se da desde las ciudades pequeñas hacia las grandes ciudades. Ellas resultan ineficientes desde el punto de vista de la economía nacional, por los crecientes costos de congestión del transporte, saturación de la capacidad instalada de los servicios públicos, incrementos en el precio de la tierra, costos ambientales en polución y contaminación, costos sociales en marginalidad extrema, criminalidad, drogadicción, etc. que llevan al sistema a operar con externalidades negativas, rendimientos decrecientes y costos marginales crecientes. En Argentina el tamaño óptimo de ciudad estaría en 500.000 habitantes, mientras que en poblaciones inferiores a 50.000 habitantes habría deseconomías de escala en la prestación de los servicios públicos.

  2. Evaluación de tierras para reforestación (Horche, Guadalajara mediante un índice de Productividad Agraria

    Directory of Open Access Journals (Sweden)

    Hontoria Fernández, C.

    2002-03-01

    Full Text Available The EU is promoting afforestation in countries, like Spain, with areas vulnerable to land degradation and desertification. This paper aims to set up, by mean of Land Evaluation, the marginal lands in order to know which ones are susceptible to change from farm to forest. The Land Evaluation method used in this paper is an adaptation and update of the Riquier et al. (1970. It has been named «Índice de Productividad Agraria (IPA», by mean of which is possible to evaluate the main kind of extensive land use: herbaceous winter-spring and herbaceous summer crops, tree crops, range, and forest, all of then on dry and irrigated system, and the herbaceous and tree crops under conventional tillage and no tillage. The study area with an extension of 50 km2 is in Horche (southwest Guadalajara, central Spain. The Land survey has let distinguish nine mapping units: Cerrillo, Bachos, Plataformas, Vertientes, Glacis-Terrazas, Pie de ladera, Abanicos aluviales and Vegas (rainfed and irrigated. The IPA shows the Vertientes and Glacis-Terrazas with tree crops, and the Abanicos Aluviales and Cerrillos with herbaceous crops are marginal agricultural lands and are susceptible to change from farm to forest.

    [es] La Unión Europea está promoviendo la reforestación en aquellos países, como España, con áreas vulnerables a la degradación y a la desertificación. El propósito de este artículo es delimitar y definir, mediante un método de Evaluación de Tierras, las áreas marginales con el fin de conocer cuáles son susceptibles al cambio de uso agrícola al forestal. El método de Evaluación de Tierras que se utiliza en este artículo es una adaptación y actualización del de Riquier et al. (1970. Se ha denominado «índice de Productividad Agraria (IPA», y permite la Evaluación para los tipos de uso extensivos: cultivos herbáceos de invierno-primavera, cultivos herbáceos de verano, cultivos leñosos, pastizal y forestal, todos

  3. A proline racemase based PCR for identification of Trypanosoma vivax in cattle blood.

    Directory of Open Access Journals (Sweden)

    Regassa Fikru

    Full Text Available A study was conducted to develop a Trypanosoma vivax (T. vivax specific PCR based on the T. vivax proline racemase (TvPRAC gene. Forward and reverse primers were designed that bind at 764-783 bp and 983-1002 bp of the gene. To assess its specificity, TvPRAC PCR was conducted on DNA extracted from different haemotropic pathogens: T. vivax from Nigeria, Ethiopia and Venezuela, T. congolense Savannah type, T. brucei brucei, T. evansi, T. equiperdum, T. theileri, Theileria parva, Anaplasma marginale, Babesia bovis and Babesia bigemina and from bovine, goat, mouse, camel and human blood. The analytical sensitivity of the TvPRAC PCR was compared with that of the ITS-1 PCR and the 18S PCR-RFLP on a dilution series of T. vivax DNA in water. The diagnostic performance of the three PCRs was compared on 411 Ethiopian bovine blood specimens collected in a former study. TvPRAC PCR proved to be fully specific for T. vivax, irrespective of its geographical origin. Its analytical sensitivity was lower than that of ITS-1 PCR. On these bovine specimens, TvPRAC PCR detected 8.3% T. vivax infections while ITS-1 PCR and 18S PCR-RFLP detected respectively 22.6 and 6.1% T. vivax infections. The study demonstrates that a proline racemase based PCR could be used, preferably in combination with ITS-1 PCR, as a species-specific diagnostic test for T. vivax infections worldwide.

  4. Elección de escuela y costos de cambio

    Directory of Open Access Journals (Sweden)

    Juan Gallegos Mardones

    2017-01-01

    Full Text Available Antecedentes: Los sistemas de vales en educación se basan fundamentalmente en la capacidad de los padres para elegir la escuela de sus hijos. Sin embargo, esta capacidad se reduce cuando enfrentan costos de cambio.Método: Se identificaron los datos de los estudiantes que cursaban cuarto grado en 2000 y octavo grado en 2004, y se verificó si estos, habían cambiado de escuela. Además, comparamos la utilidad que reporta la escuela elegida con respecto a otras, no disponibles en 2000, determinando así la existencia de costos de cambio.Resultados: Encontramos que los costos de cambios son estadísticamente significativos y económicamente relevantes, además, afectan la decisión de cambiar de escuela. También mostramos qué cambios marginales en niveles de utilidad no son suficientemente significativos para cambiar de escuela identificando un eventual umbral.Conclusiones: La preocupación natural de los padres con respecto a la capacidad de reacción está condicionada por la existencia de costos de cambio.

  5. Turismo comunitario pro-pobre en el ejido El Rosario, Reserva de la Biosfera de la Mariposa Monarca

    Directory of Open Access Journals (Sweden)

    Martha Marivel Mendoza Ontiveros

    2015-01-01

    Full Text Available La colonización de zonas ecológicamente frágiles, la expansión de la frontera agraria, la explotación de materias primas y fuentes de energía llevaron a los gobiernos de países emergentes, a partir de los años setenta del siglo pasado, a iniciar políticas de conservación ambiental, así se declararon un gran número de Áreas Naturales Protegidas en México. No obstante, luego de casi cuarenta años, una población en aumento que vive dentro y alrededor de ellas enfrenta pobreza, por lo que el turismo se ha considerado como un instrumento que proporciona los ingresos necesarios para mejorar las condiciones de vida de la población residente. En este trabajo se presentan los resultados de una investigación en la que se buscó conocer la contribución del turismo en los ingresos de las unidades familiares de una comunidad de la Reserva de la Biosfera de la Mariposa Monarca. Por medio de entrevistas a profundidad, se logró saber que los ingresos por la actividad turística son marginales y únicamente benefician a los dueños de los bosques, lo que genera mayores desequilibrios socioeconómicos en la población ante las promesas incumplidas del turismo.

  6. Desarrollo de un proyecto agrícola en la región marginal de la Patagonia Meridional Argentina. El caso de Gobernador Gregores

    Directory of Open Access Journals (Sweden)

    María Eugenia Cepparo de Grosso

    2012-02-01

    Full Text Available Santa Cruz, provincia ubicada en el extremo sur del territorio continental argentino, posee un ambiente fuertemente condicionado por la fragilidad de sus características naturales y una situación socioeconómica tradicionalmente orientada a la monoactividad ganadera en el área rural y a los servicios públicos en los centros urbanos. En ese marco, y durante la década de 1990, surgió una iniciativa apoyada por organismos del Estado y financiada por bancos provinciales para estimular un proyecto agrícola adaptado a las limitadas aptitudes agrícolas de la región. Un reducido número de agricultores, inquietos por generar actividades que diversificaran el tradicional modelo pastoril, experimentaron los dilemas de los comienzos y las crisis de un proyecto de estímulo económico en un territorio marginal. Este trabajo contribuye con una serie de reflexiones acerca de las motivaciones que justifican el estudio de pequeñas sociedades en áreas marginales; de la confrontación entre el marco conceptual de la marginalidad según los países centrales y los periféricos; y del accionar y el compromiso de los actores sociales motivados por una alternativa de desarrollo local en una localidad ubicada en el centro de la Patagonia Meridional Argentina.

  7. La imagen de la mujer pintora en la ilustración popular del siglo XIX

    Directory of Open Access Journals (Sweden)

    María Dolores Bastida de la Calle

    1994-01-01

    Full Text Available El discurso de lo marginal, que el arte del siglo xix reclamaba como algo propio, encontró en la mujer un tópico social de especial significación para un siglo marcado por rápidas transformaciones. En apropiada correspondencia con su carácter de movimiento artístico marginal, la ilustración, y en particular la caricatura, iconografías populares cuyos códigos de representación eran simples y obvios, trataron muy especialmente aquellos tipos sociales que, por encontrase en proceso de evolución, resaltaban sobre el friso estático de la sociedad. La atención que prestaron las publicaciones ilustradas hacia los fenómenos marginales ha supuesto una ayuda notable para la historia social; tales publicaciones, aunque moderadas, disfrutaban de una difusión masiva, por lo que constituyeron una relevante fuerza ideológica y desempeñaron un importante papel en la formulación de una visión crítica.

  8. El Confital (Gran Canaria: una prospección etnográfica

    Directory of Open Access Journals (Sweden)

    Paulo González

    2004-01-01

    Full Text Available Este trabajo forma parte de un proyecto de investigación sobre movimientos sociales en las Islas Canarias aun en realización. Desde una perspectiva política y relacional indaga en el proceso de desalojo que se encuentran viviendo algunos grupos categorizados como poblaciones marginales de la ciudad de Las Palmas de Gran Canaria. El desplazamiento y reubicación de los grupos estigmatizados es derivado de las actividades especulativas relacionadas con elementos macrosociales como es el turismo, factor preponderante en la economía del archipiélago. De esta forma este estudio analiza las relaciones de poder articulando las representaciones sociales de los grupos con los discursos y prácticas de los mismos. Así mismo, el estudio diacrónico permite reconstruir las trayectorias sociales de los individuos y del barrio como miembro social activo, más concretamente en las movilizaciones sociales que éste ha generado. Este es un estudio etnográfico que implementa técnicas combinadas de entrevistas semidirigidas y observación participante.

  9. Borja Gómez, Jaime y Rodríguez Jiménez, Pablo. Historia de la vida privada en Colombia. Tomo I: Las fronteras difusas del siglo XVI a 1880. Bogotá: Taurus, 2011, 396 págs.

    Directory of Open Access Journals (Sweden)

    Didier Francisco Ríos García

    2012-07-01

    Full Text Available Desde mediados de los ochenta cuando Philippe Ariès y George Duby, sacaron a la luz un trabajo sobre la vida privada, se ha generado un nuevo movimiento historiográfico que ha recorrido el mundo, el cual no trata lo que siempre la historia había trabajado, sino que se concentraba en la vida de las vidas secretas de las personas, ya fueran personajes públicos o desconocidas, también se hablo de las situaciones que vivían los sectores marginales de la población, todos visto desde el punto de vista de su vida en los ambientes alejados del escrutinio público, desde su forma de vestir, sus amores, sus aventuras, su alimentación y de las mismos espacios que frecuentaban.

  10. del análisis de costo de servir

    Directory of Open Access Journals (Sweden)

    Christopher Mejía-Argueta

    2015-01-01

    Full Text Available El objetivo de esta investigación es generar esquemas logísticos y comerciales rentables, para lo cual seconstruye una metodología que mide el costo de servir y se determina la rentabilidad a partir de losestados financieros, que va de lo general a lo específico, permitiendo cerrar las brechas identificadas enel análisis de costo de servir para mercados emergentes. La metodología consta de 3 fases y 12 pasos quealinean la estrategia, alcance, procesos y costeo de actividades con la segmentación de cuentas rentables,marginales y no rentables, para generar mayor rentabilidad. Como resultado se construyen herramientasque permiten priorizar a los clientes, así como definir la estrategia logística y comercial ideal para losobjetos de estudio (cliente, producto, etc..© 2015 Universidad ICESI. Publicado por Elsevier España, S.L.U. Este es un artículo Open Access bajo lalicencia CC BY (http://creativecommons.org/licenses/by/4.0/.

  11. Biocombustibles en Argentina, Brasil y Colombia: Avances y limitaciones

    Directory of Open Access Journals (Sweden)

    Silvina Cecilia Carrizo

    2009-01-01

    Full Text Available Los biocombustibles introducen espacios agrícolas en la producción energética. Luego modifican la gobernanza de las redes energéticas y de los territorios productivos. Las principales críticas a los biocombustibles se dirigen a su producción a partir de cultivos tradicionales, pero interesa preguntarse también sobre la sostenibilidad de su producción a partir de cultivos alternativos, que no competirían con los cultivos alimentarios, puesto que se ubicarían en regiones agrícolas marginales. El texto trata sobre las producciones de biocombustibles de los países de América del Sur, en sus contextos internacionales, nacionales y locales. Se profundiza la mirada sobre Argentina, Brasil y Colombia, líderes continentales en el sector. Se analizan la evolución del mercado energético, los actores involucrados y las políticas implementadas. A otra escala, se plantea la puesta en marcha de las cadenas de biocombustibles alternativos.

  12. De cómo occidente diluyó los conocimientos en salud de las mujeres. Repercusiones en el caso de México

    Directory of Open Access Journals (Sweden)

    Georgina Sánchez Ramírez

    2010-12-01

    Full Text Available La mayoría de las mujeres en los países subdesarrollados procuran su salud sin autonomía. El objeto de este trabajo es hacer un análisis a través de la historia de la dilución de los saberes de las mujeres respecto a la salud y el conocimiento de su propio cuerpo, como una herencia de la Práctica Médica occidental. La información se obtuvo de bibliografía especializada en el tema, elaborándose con ella un análisis a partir del enfoque de género y salud, con el cual se muestra cómo desde la belladona hasta la partera, los conocimientos de las mujeres se siguen considerando marginales en el marco de la medicina hegemónica. Most women in underdeveloped countries search for their health without autonomy. The object of this work is to analyze through history the dilution of women’s knowledge about health and knowledge of their own body, as a legacy from the Western Medical Practice. The information is based on specialized literature, thus elaborating an analysis by the focus on gender and health, which shows how from the belladonna to the midwife, women’s knowledge is still considered marginal in the framework of the hegemonic medicine.

  13. De raíz, extracciones y apropiaciones

    Directory of Open Access Journals (Sweden)

    Miguel Rojas Sotelo

    2016-01-01

    Full Text Available Como tercera parte del ensayo, Compresiones: política cultural, economía y mercado, El presente artículo se enfoca en la violencia cultural que ha marginalizado, exotizado, racializado y negado ópticas de carácter no eurocentrado, estas son tenidas en cuenta hoy en medida de su capacidad de adaptación y la posibilidad de captura de esas subjetividades marginales dentro los procesos de globalización y dinámicas de circulación de mercados culturales a escala global. En Colombia, los múltiples desplazamientos al interior del territorio nacional traen a cuento una vez más el debate sobre lo cosmopolita versus lo rural y hacen parte de las discusiones sobre la configuración contemporánea de la nación, sus procesos de inclusión y construcción de unidad en diversidad. Esta sección presenta el caso de Don Abel Rodríguez (1941, el cual funciona como ejemplo, tanto de procesos de adaptación y captura, como de una posibilidad relacional real dentro del espacio híper institucionalizado del mundo del arte.

  14. The development of an enzyme-linked immunosorbent assay for Trypanosoma vivax antibodies and its use in epidemiological surveys

    Directory of Open Access Journals (Sweden)

    Claudio R Madruga

    2006-11-01

    Full Text Available There are data indicating that the distribution of Trypanosoma vivax in the Brazilian territory is expanding with potential to reach other areas, where the vectors are present. The detection of anti-trypanosomal antibodies in serum provides important information of the trypanosomal status in cattle herds. For this reason, an enzyme-linked immunosorbent assay (Tv-ELISA-Ab with crude antigen from one Brazilian isolate of T. vivax was developed and evaluated. The sensitivity and specificity were respectively 97.6 and 96.9%. In the evaluation of cross-reactions, three calves inoculated with T. evansi trypimastigotes blood forms showed optical densities (OD under the cut-off during the whole experimental period, except one at 45 days post-inoculation. With relation to Babesia bovis, B. bigemina, and Anaplasma marginale, which are endemic hemoparasites in the studied area, the cross-reactions were shown to be 5.7, 5.3, and 1.1%, respectively. The first serological survey of Pantanal and state of Pará showed that T. vivax is widespread, although regions within both areas had significantly different prevalences. Therefore, this Tv-ELISA-Ab may be a more appropriate test for epidemiological studies in developing countries because the diagnostic laboratories in most countries may be able to perform an ELISA, which is not true for polymerase chain reaction.

  15. Retrospective study of hemoparasites in cattle in southern Italy by reverse line blot hybridization.

    Science.gov (United States)

    Ceci, Luigi; Iarussi, Fabrizio; Greco, Beatrice; Lacinio, Rosanna; Fornelli, Stefania; Carelli, Grazia

    2014-06-01

    Tick-borne diseases are widespread in tropical and temperate regions and are responsible for important economic losses in those areas. In order to assess the presence and prevalence of various pathogens in southern Italy, we retrospectively analyzed cattle blood samples collected for a previous study in 2000 using reverse line blot (RLB) hybridization. The study had been carried out in three regions of southern Italy on 1,500 randomly selected and apparently healthy adult cattle. RLB showed that 43.7% of the cattle were positive for nine different species of hemoparasites with either a single infection or a mixed infection. Theileria buffeli was the most common species found, being present in 27.3% of the animals, followed by Anaplasma marginale in 18.1%, Anaplasma centrale in 13.8%, Babesia bigemina and Anaplasma bovis in 4.2%, Anaplasma phagocytophilum in 1.7%, Babesia bovis in 1.6%, Babesia major in 0.2% and Babesia divergens in 0.1%. Complete blood counts showed different degrees of anemia in 363 animals (24.2%) and of these, 169 were RLB-positive for at least one pathogen. Among the ticks that were collected from the cattle, the following species were identified: Rhipicephalus bursa, Ixodes ricinus, Hyalomma marginatum, Boophilus annulatus, Dermacentor marginatus and Haemaphysalis (sulcata, parva, inermis and punctata). The results obtained confirmed the spread of endemic tick-borne pathogens in the regions studied.

  16. Molecular detection and identification of hemoparasites in pampas deer (Ozotoceros bezoarticus Linnaeus, 1758) from the Pantanal Brazil.

    Science.gov (United States)

    Silveira, Júlia A G; Rabelo, Elida M L; Lacerda, Ana C R; Borges, Paulo A L; Tomás, Walfrido M; Pellegrin, Aiesca O; Tomich, Renata G P; Ribeiro, Múcio F B

    2013-06-01

    Hemoparasites were surveyed in 60 free-living pampas deer Ozotoceros bezoarticus from the central area of the Pantanal, known as Nhecolândia, State of Mato Grosso do Sul, Brazil, through the analysis of nested PCR assays and nucleotide sequencing. Blood samples were tested for Babesia/Theileria, Anaplasma spp., and Trypanosoma spp. using nPCR assays and sequencing of the 18S rRNA, msp4, ITS, and cathepsin L genes. The identity of each sequence was confirmed by comparison with sequences from GenBank using BLAST software. Forty-six (77%) pampas deer were positive for at least one hemoparasite, according to PCR assays. Co-infection occurred in 13 (22%) animals. Based on the sequencing results, 29 (48%) tested positive for A. marginale. Babesia/Theileria were detected in 23 (38%) samples, and according to the sequencing results 52% (12/23) of the samples were similar to T. cervi, 13% (3/23) were similar to Babesia bovis, and 9% (2/23) were similar to B. bigemina. No samples were amplified with the primers for T. vivax, while 11 (18%) were amplified with the ITS primers for T. evansi. The results showed pampas deer to be co-infected with several hemoparasites, including species that may cause serious disease in cattle. Pampas deer is an endangered species in Brazil, and the consequences of these infections to their health are poorly understood. Copyright © 2013 Elsevier GmbH. All rights reserved.

  17. Prevalence and Significance of Haemoparasitic Infections of Cattle in North- Central, Nigeria

    Directory of Open Access Journals (Sweden)

    J.Kamani.

    Full Text Available The prevalence and significance of hemoparasites of cattle from north-central Nigeria was determined using diagnostic records from Parasitology Division, National Veterinary Research Institute (NVRI Vom, from May 2006 to April 2008. A total of 637 blood samples from cattle from four states (Plateau, Bauchi, Nasarawa and Kaduna of Nigeria in anticoagulant were submitted to the laboratory for parasitological diagnosis. Giemsa stained thin blood smears were examined for hemoparasites. Packed cell volume (PCV for each sample was determined and Hematocrit centrifuge technique (HCT was used to determine the presence of motile parasites. An overall prevalence of 25.7% was recorded for all samples examined. Babesia bigemina and B.bovis accounted for 16.0%, followed by Theileria mutans (3.1%, Trypanosoma spp (T.vivax and T. congolense (2.8%, Anaplasma marginale (1.9%, Microfilaria (1.4%. The hemoparasites identified alone or in combination with others had a significant (P<0.05 effect on the mean PCV of infected animals. Similarly, hemoparasites infection in young animals as well as during the dry season resulted in significant (P<0.05 reduction of PCV values. The result of this study shows these hemoparasites are endemic in cattle in the study area which may result in serious disease conditions when such animals are subjected to stressful condition. [Veterinary World 2010; 3(10.000: 445-448

  18. Estrategias espaciales del activismo en condición fronteriza en el Cono Sur

    Directory of Open Access Journals (Sweden)

    Adriana Dorfman

    2014-07-01

    Full Text Available El presente artículo investiga cómo la condición fronteriza es instrumentalizada por sus habitantes en reivindicaciones ante el estado y los sectores privados. Dicho análisis se basa en las teorías sobre los sistemas territoriales, la territorialidad humana y las redes de poder en las márgenes del estado. En este documento, se evalúan estudios de caso en el Cono Sur, y se concluye que son cuatro las formas territoriales del activismo en condición fronteriza: estrategias para los servicios públicos en fronteras marginales; instrumentalización del imaginario nacionalista; uso táctico del límite y, finalmente, administración ciudadana del imaginario nacionalista. Por fin, se cuestiona la criminalización de la condición fronteriza y se reconoce la legitimidad de las redes que activan la frontera y la instrumentalizan en estrategias en búsqueda de más ciudadanía.

  19. Prevalence of mild serum vitamin B12 deficiency in rural and urban Costa Rican young adults Prevalencia de la deficiencia moderada de vitamina B12 sérica en jóvenes adultos de zonas rurales y urbanas de Costa Rica

    Directory of Open Access Journals (Sweden)

    Ileana Holst-Schumacher

    2007-12-01

    realizó un estudio transversal para determinar los niveles de vitamina B12 en el suero de 400 adultos de 20 a 40 años de edad de zonas urbanas y rurales del valle central de Costa Rica. Adicionalmente, se estudió la ingesta de cobalamina en la dieta y la presencia de anticuerpos IgG contra Helicobacter pylori, como posibles factores determinantes de las concentraciones séricas de vitamina B12. RESULTADOS: La concentración media de vitamina B12 en el suero fue de 268 ± 125 pmol/L; no se encontraron diferencias significativas entre los sexos ni entre las áreas de residencia. Estos datos demostraron una prevalencia general de niveles insuficientes de cobalamina sérica de 42,4% (11,2% con déficit y 31,2% con concentraciones marginales; de las personas estudiadas más de 50% -aunque menos de 75%- tenían una ingesta de vitamina B12 por debajo del valor de las necesidades promedio estimadas para los Estados Unidos de América y 61,2% tenía anticuerpos contra H. pylori. CONCLUSIONES: La prevalencia de deficiencia moderada de vitamina B12 sérica en jóvenes costarricenses es tan elevada como en otros países latinoamericanos. Se necesitan más investigaciones para aclarar los factores etiológicos que producen niveles insuficientes y marginales de cobalamina sérica en los adultos de Costa Rica para poder definir intervenciones sanitarias apropiadas.

  20. Development of loop-mediated isothermal amplification assay for specific and rapid detection of differential goat pox virus and sheep pox virus.

    Science.gov (United States)

    Zhao, Zhixun; Fan, Bin; Wu, Guohua; Yan, Xinmin; Li, Yingguo; Zhou, Xiaoli; Yue, Hua; Dai, Xueling; Zhu, Haixia; Tian, Bo; Li, Jian; Zhang, Qiang

    2014-01-17

    Capripox viruses are economically important pathogens in goat and sheep producing areas of the world, with specific focus on goat pox virus (GTPV), sheep pox virus (SPPV) and the Lumpy Skin Disease virus (LSDV). Clinically, sheep pox and goat pox have the same symptoms and cannot be distinguished serologically. This presents a real need for a rapid, inexpensive, and easy to operate and maintain genotyping tool to facilitate accurate disease diagnosis and surveillance for better management of Capripox outbreaks. A LAMP method was developed for the specific differential detection of GTPV and SPPV using three sets of LAMP primers designed on the basis of ITR sequences. Reactions were performed at 62°C for either 45 or 60 min, and specificity confirmed by successful differential detection of several GTPV and SPPV isolates. No cross reactivity with Orf virus, foot-and-mouth disease virus (FMDV), A. marginale Lushi isolate, Mycoplasma mycoides subsp. capri, Chlamydophila psittaci, Theileria ovis, T. luwenshuni, T. uilenbergi or Babesia sp was noted. RFLP-PCR analysis of 135 preserved epidemic materials revealed 48 samples infected with goat pox and 87 infected with sheep pox, with LAMP test results showing a positive detection for all samples. When utilizing GTPV and SPPV genomic DNA, the universal LAMP primers (GSPV) and GTPV LAMP primers displayed a 100% detection rate; while the SPPV LAMP detection rate was 98.8%, consistent with the laboratory tested results. In summary, the three sets of LAMP primers when combined provide an analytically robust method able to fully distinguish between GTPV and SPPV. The presented LAMP method provides a specific, sensitive and rapid diagnostic tool for the distinction of GTPV and SPPV infections, with the potential to be standardized as a detection method for Capripox viruses in endemic areas.

  1. JOSÉ DONOSO O EL EROS DE LA HOMOFOBIA

    Directory of Open Access Journals (Sweden)

    Miguel Ángel Náter

    2006-04-01

    Full Text Available El artículo destaca la importancia de los "Papeles de Donoso", custodiados en la Universidad de Iwoa, en relación con las ideas de Julio Ortega sobre los mismos, vertidas en el periódico La Tercera de Chile. Además, se realiza una lectura de la homofobia como expresión del eros subrepticio en las novelas El lugar sin límites y El obsceno pájaro de la noche. En contraste con las exposiciones homoeróticas que Ortega señala en los documentos de Donoso, los narradores de las dos novelas más destacadas del escritor chileno expresan un rechazo continuo hacia los personajes marginales, o bien exponen la sodomía como un forma de expresar la inferioridad del subalternoThis article underscores the significance of José Donoso's "Papers", in the custody of Iowa University, in connection whith Julio Ortega's ideas about them, as made known by the newpaper "La Tercera", in Chile. In addition, a reading of homophobia as expression of a surreptitious eros, is made in the novels "El lugar sin límites" and in "El obsceno pájaro de la noche". In contrast to the homoerotic discourse that Ortega detects in Donoso, the narrators in the two best known novels of the Chilean writer express a constant rejection of the marginal characters, or otherwise expose sodomy as a form which expresses the inferiority of the underling

  2. Valorizzazione di un patrimonio culturale periferico: il progetto "Cuore Verde tra i due Laghi" / The enhancement of the peripherial cultural heritage: the project “Cuore Verde tra i due laghi” (Green Heart between the two Lakes

    Directory of Open Access Journals (Sweden)

    Antonella Capriello

    2015-06-01

    Full Text Available Lo studio è indirizzato a esplorare le potenzialità dei metodi partecipativi per la valorizzazione di patrimoni culturali periferici. In rapporto al descritto obiettivo, è stato sviluppato un caso-studio concernente le Comunità rurali tra il Lago Maggiore e il Lago d’Orta. L’area rurale è caratterizzata dalla presenza di un patrimonio culturale periferico rispetto al circuito delle attività turistico-culturali in Piemonte, ma il piano di valorizzazione ha attivato iniziative per vivacizzare il territorio e superare la condizione di marginalità. Il caso-studio si basa sull’applicazione della metodologia Participatory Action Research (PAR per favorire il coinvolgimento di stakeholders locali in posizione marginale. Lo studio individua linee guida per la generalizzazione della metodologia nei processi di valorizzazione di un patrimonio culturale periferico.  The article aims to explore the potential of participative methods to enhance the value of peripheral cultural wealth. Consistent with the described aims, a case study was developed with a focus on the rural communities between Lago Maggiore (Maggiore Lake and Lago d’Orta (Orta Lake. The rural area is characterised by the presence of peripheral cultural heritage comparing tourist and cultural proposals in Piedmont, but a cultural plan has been developed to animate the local context and to overcome the condition of isolation. The case study is based on Participatory Action Research (PAR, involving stakeholders in marginal positions. The results identify best practices to generalize the methodology in order to enhance the value of peripheral cultural wealth.

  3. Nationalism, regionalism and autonomy during the Second Republic | Nacionalismos, regionalismos y autonomía en la Segunda República

    Directory of Open Access Journals (Sweden)

    Justo Beramendi González

    2003-12-01

    Full Text Available The Second Republic introduced a number of innovations as a means of surmounting the main factors of social and political backwardness which had beset the country since the beginning of the liberal revolution in the Þ rst third of the nineteenth century. Prominent among these factors was the emergent plurality of different nations within the State, a phenomenon which had spread following the birth and rapid growth of Catalan and Basque nationalism, and to a much lesser extent, the weak Galician nationalist movement, as well as other marginal momentary upsurges. The aim of this article is to provide a succinct analysis of the changing relationship between the nationalist issue and the structure of the State during this period. | La Segunda República trajo consigo varias innovaciones que pretendían superar, en sentido modernizador, los principales factores de atraso social y político que había venido padeciendo el país desde los inicios de la revolución liberal en el primer tercio del siglo XIX. Entre estos factores, cabe destacar la emergente plurinacionalidad del Estado, que se había ido ensanchando con el nacimiento y rápido desarrollo de los nacionalismos catalán y vasco y, en mucha menor medida, del débil nacionalismo gallego y de otros brotes de momento marginales. El objeto de este artículo es analizar muy sintéticamente cómo evoluciona la relación entre cuestión nacional y estructura del Estado en este período.

  4. DISTRIBUCIÓN DE INGRESOS Y DETERMINACIÓN DE TARIFAS DISTRIBUTION OF INCOME AND DETERMINATION OF TARIFF

    Directory of Open Access Journals (Sweden)

    Daniel Viera Castillo

    2006-12-01

    Full Text Available El presente trabajo pretende demostrar la posibilidad de obtener tarifas de servicios que incorporen la distribución del ingreso y que, simultáneamente, sean eficientes. Se trata de una investigación sustentada en los fundamentos teóricos de la microeconomía y de la economía del bienestar, así como de las restricciones que presenta el hecho de fijar precios basados en costos marginales. El modelo aplicado, sugiere que el precio establecido por una empresa de servicios públicos, correspondiente al ámbito privado o público, puede incorporar a éste los efectos tanto de la distribución del ingreso como aquellos involucrados en la asignación de recursos, introduciendo en él ciertos juicios de valor explícitosThe present work seeks to demonstrate that it is possible to obtain rates that incorporate the distribution of income and that simultaneously they are efficient. It is a work that is sustained in the theoretical foundations of the microeconomics and of the economy of welfare and of the restrictions that it presents to fix prices based on marginal costs. The model that is applied suggests that the price that a company of public services should establish, either private or public, is a price that takes into account, to a certain extent, effects on the distribution of Income, as well as the effects in the assignment of resources, introducing certain explicit judgements value

  5. Satisfacción de necesidades básicas en Villa Maria del Triunfo - Lima

    Directory of Open Access Journals (Sweden)

    J. Antonio Grandez-Urbina

    2013-01-01

    Full Text Available Objetivo: Perú es uno de los países de Latinoamérica que concentra mayor cantidad de habitantes urbanos, y el 27,3% de esta población vive en pobreza. El objetivo de este trabajo es determinar el nivel de satisfacción de necesidades básicas de los Asentamientos Humanos Las Villas de San Gabriel Alto y Manolo Castillo, Lima. Métodos: Se realizó un estudio Descriptivo Observacional Transversal, la muestra fue 115 familias, pertenecientes a los Asentamientos Humanos mencionados anteriormente. Se realizó en los Asentamientos Humanos Las Villas de San Gabriel Alto y Manolo Castillo, Lima, Perú. Familias pertenecientes a los AAHH antes mencionadas. Se utilizó el método de Necesidades Básicas Insatisfechas (NBI utilizado y validado anteriormente en el Censo del 2007-Perú y por el Programa de Lucha Contra la Pobreza en la Zonas Urbano Marginales de Lima Metropolitana (PROPOLI 2005; considerando Acceso a vivienda, Acceso a servicios sanitarios, Acceso a Educación, Capacidad Económica. Se realizó el análisis descriptivo con frecuencias y porcentajes mediante el SPSS 19.0  Resultados: El 99,13% de los hogares posee al menos 1 NBI, 40,87% de los hogares no satisface 2 de las necesidades básicas expuestas.  Conclusión: Un alto porcentaje de los hogares tiene al menos 1 NBI, siendo el primer reporte en estas dos comunidades suburbanas para su posterior utilización en la elaboración de estrategias para su modificación.

  6. SATISFACCIÓN DE NECESIDADES BÁSICAS EN VILLA MARIA DEL TRIUNFO - LIMA

    Directory of Open Access Journals (Sweden)

    J. Antonio Grandez-Urbina

    2012-01-01

    Full Text Available Objetivo: Perú es uno de los países de Latinoamérica que concentra mayor cantidad de habitantes urbanos, y el 27,3% de esta población vive en pobreza. El objetivo de este trabajo es determinar el nivel de satisfacción de necesidades básicas de los Asentamientos Humanos Las Villas de San Gabriel Alto y Manolo Castillo, Lima. Métodos: Se realizó un estudio Descriptivo Observacional Transversal, la muestra fue 115 familias, pertenecientes a los Asentamientos Humanos mencionados anteriormente. Se realizó en los Asentamientos Humanos Las Villas de San Gabriel Alto y Manolo Castillo, Lima, Perú. Familias pertenecientes a los AA.HH. antes mencionados. Se utilizó el método de Necesidades Básicas Insatisfechas (NBI utilizado y validado anteriormente en el Censo del 2007-Perú y por el Programa de Lucha Contra la Pobreza en la Zonas Urbano Marginales de Lima Metropolitana (PROPOLI 2005; considerando Acceso a vivienda, Acceso a servicios sanitarios, Acceso a Educación, Capacidad Económica. Se realizó el análisis descriptivo con frecuencias y porcentajes mediante el SPSS 19.0 Resultados: El 99,13% de los hogares posee al menos 1 NBI, 40,87% de los hogares no satisface 2 de las necesidades básicas expuestas. Conclusión: Un alto porcentaje de los hogares tiene al menos 1 NBI, siendo el primer reporte en estas dos comunidades suburbanas para su posterior utilización en la elaboración de estrategias para su modificación.

  7. LA POLÍTICA HABITACIONAL EN LA AGENDA INTERNACIONAL: EL PAPEL DE CITIES ALLIANCE EN EL CASO DE LA CIUDAD DE NEUQUÉN

    Directory of Open Access Journals (Sweden)

    Gabriela A. Pérez

    2008-12-01

    Full Text Available La influjo de organismos internacionales en la aplicación de políticas orientadas a la solución del “problema de la vivienda” de los sectores pobres en los países latinoamericanos ocurre desde hace varios decenios. El origen suele ubicarse a partir de la década de 1950, cuando en los países de la región se observa la intensificación del crecimiento vegetativo y de las emigraciones rurales-urbanas. El comienzo del milenio encuentra nuevamente a las ciudades de América Latina como escenarios de profundas transformaciones y de problemas complejos, entre los cuales la resolución de las carencias habitacionales se reposiciona en la agenda internacional como un “eje estratégico” para la superación de la pobreza y la precariedad urbana. En este marco destaca el surgimiento de Cities Alliance, una asociación que agrupa a instituciones y organismos de desarrollo con el propósito de asistir a las ciudades a abordar los desafíos urbanos del siglo XXI, entre ellos la eliminación-mejoramiento de los barrios marginales. En la primera parte de la ponencia se presentan los principales rasgos de Cities Alliance destacando: enfoque dominante, orientaciones de las estrategias o modelos de intervención de gobiernos y otros actores, políticas y programas impulsados. En la segunda parte se realizan algunos señalamientos sobre la actual política habitacional en la ciudad de Neuquén a la luz del planteo de Cities Alliance.

  8. El largo camino hacia la Gestión del Conocimiento

    Directory of Open Access Journals (Sweden)

    M.ª DOLORES MUÑOZ

    2003-01-01

    Full Text Available La capacidad de adaptación al cambio es esencial para la supervivencia de las organizaciones y el conocimiento, el elemento clave. Gestionar el conocimiento de la organización demanda modelos integradores que vayan más allá de proporcionar información a las personas. El primer paso es obtener la visión global del conocimiento de la compañía (Krogh, Nonaka y Aben, 2001, sólo entonces es posible determinar acciones para su creación y transferencia. Se presenta una revisión de publicaciones, desde los años 80, sobre Gestión de Conocimiento. Los resultados muestran un desfase entre la investigación aplicada, centrada en el desarrollo de herramientas para la gestión de conocimiento y la creación de modelos que sustenten conceptos y procesos. La inversión en recursos tecnológicos para la gestión de conocimiento ha dado lugar a resultados marginales que no aportan ventaja competitiva a las organizaciones. Problemas básicos como la medición del conocimiento organizacional y el contexto de la organización siguen sin resolverse. Se propone un ciclo de Gestión de Conocimiento que se inicia en el diagnóstico, con la creación del modelo de gestión ajustado a las necesidades y recursos de la compañía. La retroalimentación sobre los resultados cierra el ciclo del conocimiento.

  9. Desconstruyendo jerarquías. Reflexiones autoetnográficas sobre un trabajo de campo en barrios aledaños al ex Centro Clandestino de Detención Tortura y Exterminio de Campo la Ribera (Córdoba, Argentina

    Directory of Open Access Journals (Sweden)

    Vanesa Garbero

    2015-09-01

    Full Text Available En este trabajo me propongo reflexionar sobre el acceso y consecución del trabajo de campo y desmarañar aspectos que hacen a mi subjetividad, como sujeto cognoscente, en el proceso de realización de mi investigación. Es un ejercicio de escritura que se enmarca en el subgénero literario – científico denominado autoetnografía, el cual exhorta a quien investiga a realizar permanentemente su propio socio-análisis, cuestionar su habitus, romper la ilusión de distancia neutral con el objeto conocido, escribir en primera persona y exponer sus emociones y sentimientos para mostrar la relación entre lo personal y lo cultural en la comprensión de fenómenos sociales. El escrito concluye en la vivencia del trabajo de campo como una experiencia transformadora que modifica la manera de ver, sentir y comprender el mundo de el/la investigador/a; a la vez propone que las relaciones de poder que se establecen en la realización de la investigación, en sus diversas manifestaciones, son relaciones complejas, variables y se negocian con los/las colaboradores/as; y en la necesidad de introspección intensa y permanente para revisar las jerarquías, que a pesar de las buenas intenciones, el/la investigador/a puede perpetuar sobre las comunidades marginales en las que trabaja. URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs1503359

  10. Understanding Anaplasmataceae pathogenesis using ‘Omics’ approaches

    Directory of Open Access Journals (Sweden)

    Ludovic ePruneau

    2014-07-01

    Full Text Available This paper examines how Omics approaches improve our understanding of Anaplasmataceae pathogenesis, through a global and integrative strategy to identify genes and proteins involved in biochemical pathways key for pathogen-host-vector interactions.The Anaplasmataceae family comprises obligate intracellular bacteria mainly transmitted by arthropods. These bacteria are responsible for major human and animal endemic and emerging infectious diseases with important economic and public health impacts. In order to improve disease control strategies, it is essential to better understand their pathogenesis. Our work focused on four Anaplasmataceae, which cause important animal, human and zoonotic diseases: Anaplasma marginale, A. phagocytophilum, Ehrlichia chaffeensis and E. ruminantium. Wolbachia spp. an endosymbiont of arthropods was also included in this review as a model of a non-pathogenic Anaplasmataceae.A gap analysis on Omics approaches on Anaplasmataceae was performed, which highlighted a lack of studies on the genes and proteins involved in the infection of hosts and vectors. Furthermore, most of the studies have been done on the pathogen itself, mainly on infectious free-living forms and rarely on intracellular forms. In order to perform a transcriptomic analysis of the intracellular stage of development, researchers developed methods to enrich bacterial transcripts from infected cells. These methods are described in this paper. Bacterial genes encoding outer membrane proteins, post-translational modifications, eukaryotic repeated motif proteins, proteins involved in osmotic and oxidative stress and hypothetical proteins have been identified to play a key role in Anaplasmataceae pathogenesis. Further investigations on the function of these outer membrane proteins and hypothetical proteins will be essential to confirm their role in the pathogenesis. Our work underlines the need for further studies in this domain and on host and vector responses

  11. Le interiezioni (fonosimboli nella prosa rovignese dell'antologia "Istria nobilissima"

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    1989-12-01

    Full Text Available Come risulta da un recente studio di Paola Villani (Villani 1986, le interiezioni (o, come le chiama l'autrice, fonosimboli sono un po' la Cenerentola delle descrizioni linguistiche. Menzionate in modo piu o meno marginale, descritte sommariamente, definite in modo non soddisfacente, esse sembrano riunire in sé lo status «tuttofare» degli avverbi tradizionali (v. Crystal 1971, p. 75 e quello di «small change of linguistic currency», molto appropriatamente attribuito da E. Löfstedt alle preposizioni, «particelle» e parole affini (Löfstedt 1959, p. 163. In un termine, sono elementi linguistici che dai parlanti sono sentiti intuitivamente come indispensabili alla normale comunicazione linguistica, ma nello stesso tempo come elementi con cui non si sa che fare, che non trovano un posto adeguato nell'ambito della classificazione linguistica tradizionale. Eppure, anche le interiezioni hanno le loro funzioni, sia nella lingua scritta (nella quale, secondo· Villani 1986, p. 33, sono state maggiormente studiate che nel linguaggio parlato (in cui hanno valori intraducibili su1 piano della lingua scritta. Prendendo lo spunto dall'interessante e stimolante articolo citat o di P. Villani, abbiamo esaminato il valore pragmatico e testuale delle interiezioni nella prosa in dialetto rovignese, apparsa sui volumi III, VI, VII, X-XII e XIV-XVI dell'antologia «lstria Nobilissima» (si veda la bibliografia, la cui lingua è stata già oggetto di studio in alcuni nostri lavori precedenti. La restrizione alla prosa è dettata dal tema, che è l'analisi degli aspetti comunicativi (pragmatici e testuali.

  12. Un enfoque cualitativo a las barreras de adherencia terapéutica en enfermos crónicos de Guanajuato, México

    Directory of Open Access Journals (Sweden)

    Grever María Ávila-Sansores

    2013-01-01

    Full Text Available El perfil epidemiológico en México está dominado por enfermedades crónico-degenerativas y lesiones, estas a su vez están asociadas a las condiciones de vida actual. La OPS y la OMS aconsejan el estudio de barreras que impiden la atención de calidad. Objetivo: explorar la percepción de las barreras personales y sociales hacia el tratamiento de personas con estados crónicos: diabetes e hipertensión. Materiales y métodos: estudio cualitativo, con un componente descriptivo. La muestra estuvo conformada por diabéticos e hipertensos de colonias marginales. Muestreo de tipo intencional. La recolección de la información se realizó por medio de en trevistas semiestructuradas y audio-grabadas. Se trabajó con 3 grupos focales de 3 personas por grupo. Un 77 % casado, 77 % analfabeta, 77 % labores del hogar, 56 % diabéticos tipo 2,22 % hipertensos, 22 % diabéticos con hipertensión. Las barreras percibidas encontradas fueron: creencias relacionadas con el tratamiento, falta de conocimientos y habilidades para la dieta, descontento con la dieta, falta de apoyo familiar, dificultades económicas, falta de conocimientos sobre la medicación, indiferencia hacia el ejercicio, desconfianza y temor a los estudios de laboratorio. Discusión y conclusión: para Rosentock, en tanto que las claves para la acción incitan a las actividades preventivas para la salud, las barreras percibidas indican los caminos para la acción. Es necesario superar barreras y ayudar al enfermo crónico a convivir con la enfermedad.

  13. Seroprevalencia de Leptospira spp en caninos y humanos de tres barrios de Tunja, Colombia

    Directory of Open Access Journals (Sweden)

    Soledad Bermúdez C.

    2010-12-01

    Full Text Available Objetivo. Establecer la seroprevalencia de Leptospira spp., en la población canina y humana de barrios marginados en la ciudad de Tunja. Materiales y métodos. Se muestrearon 61 sueros caninos en los barrios marginales de la ciudad, parlelamente se muestrearon y encuestaron 46 humanos propietarios de las mascotas. Para el procesamiento de las muestras se empleó la técnica de microaglutinación-lisis (MAT para seis serotipos de Leptospira spp. Resultados. Se encontró una seropositividad del 67.2% en la población de caninos muestreada, la seroprevalencia por serovares arrojada fue del 14.8% para L. icterohemorrágica; 8.2% para L. pomona; 9.85% para L. hardjo; 18% para L. canicola y 6.6% para L. automnalis y 9.8% para L. sejroë. Para los humanos la prevalencia fue del 21.7%, por serovares se encontró que L. automnalis tiene 4.35%; L. hardjo 2.17%, L. sejroë tiene 6.52%, L. icterohaemorragiae 6.52% y L. canicola 2.17%. Conclusiones. Estos resultados demostraron una gran problemática de alto impacto ya que en contraste con prevalencias de otros municipios de Colombia, mostró una elevada positividad en esta zona y dejan una gran preocupación por una rápida diseminación que podria suceder debido al contacto entre los diferentes vectores como lo roedores y caninos.

  14. Make biomass chains part of the solution. Recommendation on Indirect Land Use Change (ILUC); Maak biomassaketens deel van de oplossing. Advies over indirecte veranderingen van landgebruik (ILUC)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-10-15

    This advice builds on previous advice of the Corbey Committee of November 2009: 'Make agriculture part of the solution'. The advise proposes three measures to prevent indirect land use change (ILUC) in the European framework: (1) Calculate an ILUC value for greenhouse gases by assuming that the use of 1 hectare of agricultural land for biofuels principally leads to the use of 1 hectare additional agricultural land; (2) vary the application of the ILUC value proportionally under the following circumstances: (a) efficiency improvement of agricultural production; (b) if marginal or degraded lands are used; (c) if co-products are used, for example for the food chain; (d) if waste flows are used; and (3) protect biodiversity. The measures are elaborated in this advice. [Dutch] Dit advies bouwt voort op een eerder advies van de Commissie Corbey van november 2009: 'Maak landbouw deel van de oplossing'. Het advies stelde drie maatregelen voor waarmee in Europees verband 'indirect land use change' (ILUC) tegengegaan kan worden: (1) Bereken een ILUC-waarde voor broeikasgasemissies door ervan uit te gaan dat het gebruik van 1 hectare landbouwgrond voor biobrandstoffen in principe leidt tot ingebruikneming van 1 hectare extra landbouwgrond; (2) Varieer de toepassing van de ILUC-waarde proportioneel onder de volgende omstandigheden: (a) efficientieverbetering van de landbouwproductie; (b) indien marginale of gedegradeerde gronden in gebruik worden genomen; (c) indien co-producten worden ingezet voor bijvoorbeeld de voedselketen; (d) Indien reststromen ingezet worden; en (3) Bescherm de biodiversiteit. In dit advies worden deze maatregelen verder uitgewerkt.

  15. Toxocariosis humana: seroprevalencia en población de Lima mediante la técnica de ELISA

    Directory of Open Access Journals (Sweden)

    Yrma Espinoza

    2003-12-01

    Full Text Available OBJETIVO: Estimar la seroprevalencia de toxocariosis humana en población de la ciudad de Lima. Diseño: estudio transversal, la selección fue no aleatoria. MATERIAL Y MÉTODOS: En pobladores de la ciudad de Lima que pertenecían a comunidades urbano marginales, se realizó entrevista y examen clínico, y se obtuvo una muestra de suero para procesar la técnica de ELISA para detectar anticuerpos contra Toxocara. También, se solicitó muestras de heces para buscar parásitos intestinales que pudieran originar reacciones cruzadas en la serología. RESULTADOS: Se examinó 553 personas, siendo 23,3% de ellos reactivos. No hubo diferencias en cuanto a sexo ni entre el resultado de ELISA y la presencia de anemia, leucocitosis, eosinofilia y parásitos intestinales. Los mayores de 15 años tuvieron doble probabilidad de resultar reactivos que los menores de 15 años. Disminución de la agudeza visual fue el síntoma más frecuente en los sujetos reactivos. Los parásitos intestinales más frecuentes fueron Blastocystis hominis, Entamoeba coli, Giardia lamblia. CONCLUSIONES: La toxocariosis humana es frecuente en la población de Lima. No se observa asociación estadística entre el hallazgo de anemia y alteraciones de la fórmula leucocitaria con el resultado de ELISA. Es necesario desarrollar programas de difusión para detectar precozmente la infección y así prevenirla.

  16. La representación de la realidad y de la ficción literaria en cuatro novelas de Pío Baroja

    Directory of Open Access Journals (Sweden)

    F. Crippa

    2013-10-01

    Full Text Available ENDuring his literary career, Baroja wrote several short novels. These texts, despite being often considered as marginal, constitute a summary of all the author’s writing abilities and trough them Baroja carried out his personal reconstruction of the true history of Spain with passion and resoluteness. The anthology Cuentos de amor y muerte gathers four of these short novels: El capitán Mala Sombra, La dama de Urtubi, La casa del crimen and El horroroso crimen de Peñaranda del Campo. The aim of this article is to analyze these short novels by showing, on the one hand, their relationships with Baroja’s social, historical and cultural background and, on the other one, the way in which the literary fiction manifests itself within them.>>A lo largo de su carrera literaria, Baroja compuso varias novelas breves. Éstas, a pesar de ser a menudo consideradas obras marginales, se presentan como un concentrado de todas las principales virtudes narrativas del autor y, a través de ellas, Baroja llevó a cabo su personal reconstrucción de la verdadera historia de España con trazos seguros y apasionados. La colección titulada Cuentos de amor y muerte recoge cuatro de estas narraciones: El capitán Mala Sombra, La dama de Urtubi, La casa del crimen y El horroroso crimen de Peñaranda del Campo. El propósito de este artículo es investigar más a fondo en los cuatro relatos para determinar cuáles son las relaciones que ellos mantienen con la realidad social, histórica y cultural contemporánea a Baroja y cómo la ficción literaria interviene y se manifiesta.

  17. Radiological manifestations of rheumatoid arthritis; Die radiologische Manifestation der rheumatoiden Arthritis

    Energy Technology Data Exchange (ETDEWEB)

    Kapp, H.J. [Zentrum fuer Rheumatologie, Schlangenbad (Germany). Abt. Radiologie

    1997-06-01

    Rheumatoid arthritis preferrably becomes manifest at the synovial joints of the limbs, especially at the small joints of the hands and feet, at bursae and synovial sheathes. The pathologic lesions are less frequently found at cartilaginous joints or entheses. The lesions very often are symmetrically distributed and are characterized by the following: 1. A periarticular, spindle-shaped opacity with a density similar to soft-tissue, induced by an inflammatory hypertrophy of the synovia, a serosynovitis, or an edematous impregnation of the periarticular tissue. 2. A juxta-articular osteoporosis, most probably caused by a neighbouring synovialitis accompanied by hyperemia. 3. A diffuse joint cavity narrowing due to a destruction of the articular cartilage by the pannus, a fibrovascular resorptive tissue. 4. Central as well as marginal erosions, caused by destruction of ossous material by the pannus. 5. Subchondral signal cysts, likewise unduced by the pannus. (Orig./AJ) [Deutsch] Die rheumatoide Arthritis manifestiert sich bevorzugt an den synovialen Gelenken der Extremitaeten, insbesondere an den kleinen Gelenken der Haende und Fuesse, an Bursae und an Sehnenscheiden. Seltener finden sich pathologische Veraenderungen an kartilaginaeren Gelenken und an Enthesen. Die Gelenkveraenderungen an Haenden und Fuessen sind oft symmetrisch verteilt und durch folgende Veraenderungen gepraegt: 1. Einer partikulaeren, spindelfoermigen weichteildichten Verschattung, hervorgerufen durch eine entsuendliche Hypertrophie der Synovia, einen Gelenkerguss und einer oedematoesen Durchtraenkung des perartikulaeren Gewebes. 2. Einer gelenknahen Osteoporose, deren Ursache die benachbarte Synovialitis mit Hyperaemie sein duerfte. 3. Einer diffusen Gelenkspaltverschmaelerung des Gelenkknorpels durch den Pannus, einem fibrovaskulaeren Resorptivgewebe. 4. Durch zentrale und marginale Erosionen, die als Folge einer Zerstoerung des Knochens durch den Pannus hervorgerufen werden. 5. Durch

  18. La narrazione orale tra bambini ed adulti: da flusso continuo a vena carsica?

    Directory of Open Access Journals (Sweden)

    Milena Bernardi

    2010-02-01

    Full Text Available Con il segmento di ricerca che viene presentato nella sua prima fase si prende in esame l’ipotesi di un processo, in atto da tempo, di trasformazione e/o di declino della narrazione orale nel rapporto quotidiano tra adulti e bambini, inteso, in questo specifico contesto, come “spia” dei mutamenti degli stili educativi e degli interscambi tra famiglie ed operatori dei servizi in relazione all’alleanza educativa. La complessità dei filoni di studio che rimandano alla voce “narrazione” negli ambiti delle scienze umane esige la precisazione della curvatura “narrativa” scelta per la ricerca in corso: curvatura che appartiene all’epistemologia della letteratura per l’infanzia e della pedagogia della narrazione in quanto permette di imboccare la strada della ricerca pedagogica rivolta innanzi tutto ai significati che il narrare assume nella relazione educativa e poi ai modi ed alle forme della narrazione che coinvolgono l’infanzia. In un’epoca di grande vitalità e visibilità delle narrazioni, tra cui abbondano le produzioni scritte, illustrate, filmate per l’infanzia, sembra esserci una zona marginale e quasi sommersa della comunicazione narrante che rischia di sfumare in una sorta di oblio. E’ la zona della narrazione orale esperita in praesentia da bambini ed adulti insieme, tessuta con fili di parole che restituiscono senso all’intero arco delle esperienze, tentando di riordinare il disordine che spesso connota la realtà, interpretando, stabilendo connessioni, impregnando di quel senso i vissuti, i fatti, le relazioni, le cose e le parole stesse, ancora, nelle voci. Del rischio e delle conseguenze che possono derivare dalla sua mancanza si occupa questo contributo di ricerca che, dal punto di vista metodologico, si è avvalso e si avvale sia di analisi condotte sul corpus dei testi sia della raccolta di dati e informazioni tramite incontri condotti con la modalità del focus group, con educatrici e genitori.

  19. Hacia un nuevo profesional de la vida comunitaria

    Directory of Open Access Journals (Sweden)

    Lyla Piedad Velosa Amature

    2017-07-01

    Full Text Available Con motivo de la celebración de los 55 años de la creación del Departamento de Odontología Preventiva y Social, hoy llamado, Salud Colectiva, se presenta a los lectores un capítulo del libro: Encuentros y diálogos para rehacer la vida. En este volumen de nuestra revista, la facultad le rinde un homenaje a una de las más destacadas profesoras, pionera del trabajo comunitario profundo, quien por más de doce años realizó, a lo largo y ancho de la geografía nacional, y en la localidad de Ciudad Bolívar (Bogotá, Investigación Acción Participativa con las comunidades indígenas y urbano marginales, erigiéndose como pilar fundacional de las aperturas para entender, desde una perspectiva ética y política, el trabajo comunitario. Junto con sus coautores, desarrolló y defendió la propuesta de otro programa curricular para la Facultad de Odontología, titulado Nuevo Profesional de la Vida Comunitaria. En el 2017, este trabajo retoma su importancia y pertinencia como insumo signi cativo para las nuevas agendas académicas y la reconstrucción de los lazos afectivos sociales, en el mapa de la recon guración de los territorios y la materialización de la paz en Colombia.

  20. Detection and phylogenetic characterisation of novel Anaplasma and Ehrlichia species in Amblyomma triguttatum subsp. from four allopatric populations in Australia.

    Science.gov (United States)

    Gofton, Alexander W; Waudby, Helen P; Petit, Sophie; Greay, Telleasha L; Ryan, Una M; Irwin, Peter J

    2017-08-01

    Anaplasma and Ehrlichia spp. are tick-borne pathogens that can cause severe disease in domestic animals, and several species are responsible for emerging zoonoses in the northern hemisphere. Until recently, the only members of these genera reported in Australia (A. marginale, A. centrale, and A. platys) were introduced from other continents, through the importation of domestic animals and their associated ticks. However, unique Anaplasma and Ehrlichia 16S rRNA gene sequences were recently detected for the first time in native Australian ticks, particularly in Amblyomma triguttatum subsp. ticks from southwest Western Australia (WA). We used molecular techniques to survey Am. triguttatum subsp. ticks from four allopatric populations in southern and western Australia for Anaplasma and Ehrlichia species, and described here the phylogeny of these novel organisms. An A. bovis variant (genotype Y11) was detected in ticks from two study sites; Yanchep National Park (12/280, 4.3%) and Barrow Island (1/69, 1.4%). Phylogenetic analysis of 16S rRNA and groEL gene sequences concluded that A. bovis genotype Y11 is a unique genetic variant, distinct from other A. bovis isolates worldwide. Additionally, a novel Ehrlichia species was detected in Am. triguttatum subsp. from three of the four study sites; Yanchep National Park (18/280, 6.4%), Bungendore Park (8/46, 17.4%), and Innes National Park (9/214, 4.2%), but not from Barrow Island. Phylogenetic analysis of 16S, groEL, gltA, and map1 gene sequences revealed that this Ehrlichia sp. is most closely related to, but clearly distinct from, E. ruminantium and Ehrlichia sp. Panola Mountain. We propose to designate this new species 'Candidatus Ehrlichia occidentalis'. Anaplasma bovis genotype Y11 and 'Candidatus E. occidentalis' are the first Anaplasma and Ehrlichia species to be recorded in native Australian ticks. Copyright © 2017 Elsevier GmbH. All rights reserved.

  1. Capital social y políticas de Atención Primaria de la Salud

    Directory of Open Access Journals (Sweden)

    Ernesto Pablo BÁSCOLO

    2016-05-01

    Full Text Available El objetivo de este trabajo es analizar la influencia de la configuración del capital social de las políticas de atención primaria de la salud (APS sobre las condiciones de acceso a los servicios de salud. Se llevó a cabo un estudio de casos múltiples (Cochabamba-Bolivia, Rosario y Vicente López-Argentina retrospectivo (1990-2008. El concepto de capital social fue entendido como el resultado de la relación entre Estado y sociedad. En Rosario se lograron mejoras sustantivas en las condiciones de acceso a partir de la creación de nuevas estructuras en donde profesionales de APS establecieron vínculos de cooperación con actores del Estado municipal, movimientos sociales y gestores y médicos especialistas de hospitales. En Vicente López, las mejoras en las condiciones de acceso a los servicios de salud fueron más limitadas debido a que los cambios en la relación Estado y sociedad solo involucraron a profesionales del primer nivel de atención sin mecanismos de cooperación estables con actores claves de los hospitales, el nivel municipal y los movimientos sociales. Por último, en Cochabamba, las mejoras en las condiciones de acceso fueron marginales debido a que los profesionales del sistema de servicios de salud se opusieron a la alianza establecida entre los movimientos sociales y los actores del Estado municipal para generar cambios en el sistema de salud. Este estudio permite reconocer la influencia de la configuración entre Estado y sociedad para modelar las relaciones de poder que subyacen al proceso de implementación de las reformas del sector salud y sus resultados.

  2. Resiliencia y felicidad de adolescentes frente a la marginación urbana en México

    Directory of Open Access Journals (Sweden)

    Elián Gómez–Azcarate

    2015-06-01

    Full Text Available La marginación urbana en México ha crecido enormemente en los últimos años afectando directamente a los jóvenes. En este estudio empírico se analizó su efecto sobre la resiliencia y felicidad juvenil en función de factores estructurales. Se aplicó el Cuestionario RESI–M y la Escala de Felicidad de un ítem, a 1201 estudiantes mexicanos de secundaria y bachillerato. Los resultados mostraron que la marginación afecta de forma diferenciada las dimensiones de la resiliencia. Además, dentro de los grupos por grado de marginación, hubo diferencias significativas en la resiliencia según sexo, escolaridad y tipo de familia. Los análisis de regresión lineal mostraron el valor predictivo de algunos de los factores estructurales. Se observó cómo las condiciones de vida marginales afectan la capacidad de resiliencia de los adolescentes, aunque no la predicen dado que el individuo puede transformarse a sí mismo y a su realidad adversa ya que la felicidad no se asocia a las condiciones del contexto, excepto en relación a la edad y la familia. Se analiza la influencia diferenciada de los tipos de familias en relación a la marginación y su papel en el desarrollo de la resiliencia para afrontar los retos futuros y evitar el desajuste social. Se aportan elementos para profundiza el estudio de los adolescentes en marginación urbana.

  3. Efectividad de una intervención comunitaria en salud oral: resultados después de 18 meses.

    Directory of Open Access Journals (Sweden)

    Eduardo BERNABÉ ORTIZ

    2006-07-01

    Full Text Available Objetivo: Evaluar la efectividad de una intervención comunitaria en salud oral, dirigida a niños entre 6 y 14 años de edad de comunidades urbano-marginales de Sol Naciente (Carabayllo, realizada por estudiantes de pregrado de la Facultad de Estomatología Roberto Beltrán Neira de la Universidad Peruana Cayetano Heredia. Materiales y métodos: Ciento doce niños fueron cubiertos en la intervención preventivo-promocional hasta la evaluación a los 18 meses. La efectividad fue evaluada midiendo la variación en la prevalencia y experiencia de caries dental, así como también en el nivel de obturaciones, higiene oral y proporción de molares permanentes sellados y obturados al inicio y a los 18 meses de la intervención. Resultados: No hubo variación significativa en la prevalencia y experiencia de caries dental entre ambas evaluaciones. Sin embargo, se encontró una mejora significativa en la proporción de dientes y superficies cariadas que fueron obturados (p < 0,001 y p = 0,015 respectivamente, en el nivel de higiene oral (p < 0,001 y en la proporción de molares permanentes sellados y obturados (p < 0,001 en ambos casos. Conclusiones: Los presentes resultados indican que la intervención fue efectiva en el control de caries dental y en la mejora de los niveles de obturaciones e higiene oral así como de la proporción de molares permanentes sellados y obturados en los niños evaluados. Se requieren futuros estudios para evaluar la efectividad y costos de intervenciones similares en el Perú (Rev Med Hered 2006;17:170-176.

  4. Molecular characterization of the recombinant protein RmLTI-BmCG-LTB: Protective immunity against Rhipicephalus (Boophilus microplus.

    Directory of Open Access Journals (Sweden)

    Bárbara Guimarães Csordas

    Full Text Available The bovine tick Rhipicephalus (Boophilus microplus is found in several tropical and subtropical regions of the world. This parasite transmits pathogens that cause disease, such as babesiosis (Babesia bovis and B. bigemina and anaplasmosis (Anaplasma marginale. Tick infestations cause enormous livestock losses, and controlling tick infestations and the transmission of tick-borne diseases remains a challenge for the livestock industry. Because the currently available commercial vaccines offer only partial protection against R. (B. microplus, there is a need for more efficient vaccines. Several recombinant antigens have been evaluated using different immunization strategies, and they show great promise. This work describes the construction and immunological characterization of a multi-antigen chimera composed of two R. (B. microplus antigens (RmLTI and BmCG and one Escherichia coli antigen (B subunit, LTB. The immunogenic regions of each antigen were selected and combined to encode a single polypeptide. The gene was cloned and expressed in E. coli. For all of the experiments, two groups (treated and control of four Angus heifers (3-6 months old were used. The inoculation was performed via intramuscular injection with 200 μg of purified recombinant chimeric protein and adjuvated. The chimeric protein was recognized by specific antibodies against each subunit and by sera from cattle inoculated with the chimera. Immunization of RmLTI-BmCG-LTB cattle reduced the number of adult female ticks by 6.29% and vaccination of cattle with the chimeric antigen provided 55.6% efficacy against R. (B. microplus infestation. The results of this study indicate that the novel chimeric protein is a potential candidate for the future development of a more effective vaccine against R. (B. microplus.

  5. Emergence of oriental theileriosis in cattle and its transmission through Rhipicephalus (Boophilus microplus in Assam, India

    Directory of Open Access Journals (Sweden)

    Parikshit Kakati

    2015-09-01

    Full Text Available Aim: The aim of the present study was to investigate the presence of Theileria in blood samples of crossbred and indigenous adult cows raised under unorganized small scale farming system in a Babesia and Anaplasma endemic geographical area from Assam, India and to see its transmission through Rhipicephalus (Boophilus microplus ticks. Materials and Methods: For the present study, 57 clinical cases of cattle suspected to be of hemoparasitic infections were taken into consideration. The parasites were identified based on morphology in giemsa stained blood smear followed by polymerase chain reaction (PCR. Sera samples were tested for T. annulata antibodies in plate and Dot-ELISA. PCR was also conducted in eggs of Rhipicephalus (Boophilus microplus tick collected from a Theileria orientalis positive animal. Results: PCR amplified 1124, 776, and 160 bp DNA fragments of B. bigemina (64.91%,T. orientalis(21.05% and A. marginale (14.03%, respectively. This assay further conducted in 12 T. orientalis positive blood samples with primers of Buffeli, Chitose, and Ikeda variants of T. orientalis showed 3 samples positive to Ikeda type and none for Buffeli and Chitose. Babesia bovis and Theileria annulata specific primers also did not amplify any fragment during the PCR assay of the blood samples. Further, all sera samples tested negative to T. annulata antibodies in Plate and Dot-ELISA. PCR conducted in eggs of R (B.microplus tick collected from a T. orientalis positive animal revealed presence of the parasite DNA. Gradual improvement in physical condition leading to complete recovery in 10 out of 12 T. orientalis infected clinical cases treated with buparvaquone(at 2.5mg/kg.b.wt I/M was the feedback obtained from field veterinarians and the cattle owners. Conclusion: The present investigation represents the first report of occurrence of T. orientalis in cattle of Assam with involvement of pathogenic Ikeda strain in clinical outbreaks and its possible natural

  6. Análisis factorial confirmatorio de la Escala de Estilos de Crianza de Steinberg: validez preliminar de constructo

    Directory of Open Access Journals (Sweden)

    César Merino Soto

    2013-09-01

    Full Text Available Se estudió la validez de constructo y confiabilidad interna de la Escala de Estilos de Crianza de L. Steinberg que se administró a una muestra de 224 adolescentes entre 11 y 19 años de un colegio público en Lima. Mediante el análisis factorial confirmatorio de grupo múltiple, la estructura de tres subescalas (Compromiso, Autonomía Psicológica y Control Conductual/Supervisión se mantuvo en general estable, aunque la agrupación teórica de los ítems tendió a estar influenciada por la distribución de los ítems. La confiabilidad alfa para las subescalas solo alcanzó niveles marginales de aceptación y se reconoció el probable impacto del error de medición aleatorio. Los resultados muestran que el instrumento utilizado es una herramienta potencial para la investigación, pero estos hallazgos son preliminares y se requieren estudios adicionales para evaluar la generalización del análisis efectuado. The present study tried to find evidences of construct validity and internal reliability for the Parenting Styles Scale of L. Steinberg. The instrument was applied in a sample of 224 adolescents from 11 to 19 years old from a public school of Lima. With a strategy of multiple group confirmatory factor analysis, the three-subscale structure (Commitment, Psychological Autonomy and Behavior Control/Supervision was in general stable, although the theoretical grouping of the items was influenced by the distribution of the item. The alpha reliability reached marginal levels and the probable impact of the random error was recognized. Results show that this instrument is a potential tool for research, but these findings are preliminary and additional studies are required to evaluate the generalization of the analysis.

  7. Genética, historia, genealogía y cine: la hemofilia de Alexis Románov

    Directory of Open Access Journals (Sweden)

    María Cristina TARRÉS

    2016-11-01

    Full Text Available En el presente trabajo se efectúa un breve recorrido a lo largo de la historia, marcando de los muchos antecedentes de una anomalía en la coagulación sanguínea, algunos de los puntos clave para el establecimiento del conocimiento actual de la hemofilia en toda su extensión, tanto causal como clínica, así como y derivado de esto, de tratamientos de elección y de los futuros.La designación de la hemofilia como “Enfermedad Real” surge de su frecuente aparición en la realeza europea. La Reina Victoria I de Gran Bretaña la trasmitió a su hijo Leopoldo y, a través de sus hijas, a las familias reales española, alemana y rusa, llegando hasta el zarévich Alexis.Su padecimiento, la vinculación a partir de éste con Rasputín, las influencias familiares y político-sociales de tal relación con la familia real y su muerte trágica a manos bolcheviques lo tornan de particular interés.Focalizamos nuestra atención en dos películas en las que Alexis y su hemofilia adquirieron relevancia, complementando con menciones de filmaciones de archivo en las que Alexis participó personalmente y otras en que se intercala el material de archivo con escenas de ficción.El texto y el contexto de esta historia continúan siendo polémicos y aunque fueron muchos los factores que confluyeron en el hecho histórico, una mutación, una emperatriz portadora y un sucesor al trono anhelado y enfermo en tiempos agitados, no son por cierto ingredientes menores ni marginales en tamaño escenario.

  8. Fenómenos televisivos «teenagers»: prototipias adolescentes en series vistas en España Televisual Teenager Phenomena. Adolescent Prototypes in TV Series in Spain

    Directory of Open Access Journals (Sweden)

    Virginia Guarinos Galán

    2009-10-01

    Full Text Available Este trabajo se justifica doblemente: como parte de una investigación superior sobre análisis de tipos de personajes hasta el momento marginales en series de ficción televisivas y como contribución a la reflexión de la invasión del adolescente en la pantalla televisiva como reclamo en busca de un sector de audiencias. Su objetivo es mostrar los prototipos de adolescentes que se generan en los productos audiovisuales televisivos que se emiten en la actualidad en España. Para ello se ha diseñado una metodología basada en un doble movimiento: fase de análisis cuantitativo de series y personajes; y fase de análisis cualitativo y deconstructivo de los personajes adolescentes en su proceso identitario. El resultado confirma la existencia de una potente estandarización de actitudes y apariencias con respecto a los modelos propuestos por series americanas por encima de las españolas. La conclusión habla de la generación de prototipos adolescentes contradictorios. This work is doubly justified: as a part of a bigger research project on types of so far marginalized characters in television drama serials; and as a contribution to the teenage invasion of the TV screen as a call to this kind of audience. The aim of this paper is to show prototypes of adolescents created in televised products broadcast today in Spain. The methodology is based on two factors: a quantitative one about serials and characters, and a qualitative analysis of drama serials and teen characters. The result confirms the existence of a powerful standardized appearance and attitude regarding the models proposed by American series over the Spanish ones. The conclusion discusses the generation of contradictory teenage prototypes.

  9. El maíz en la provincia de Jujuy, Argentina : potencialidad para el desarrollo de cadenas de valor

    Directory of Open Access Journals (Sweden)

    Pablo Ernesto Soler

    2017-10-01

    Full Text Available El maíz es un cultivo originario de América y muy arraigado en las regiones andinas de la Provincia de Jujuy como Quebrada de Humahuaca y Puna donde se emplea para el consumo humano y animal. Con más de 5.000 hectáreas ocupa el cuarto lugar en extensión de cultivos agroalimentarios después de la caña de azúcar, el poroto y la soja. En la región Yungas y Valles se concentra el 90% de la producción, el resto se distribuye entre las regiones de Quebrada de Humahuaca y Puna. La propuesta de producción actual no permite la elaboración local de productos con alto valor agregado. De allí que, se estudia la posibilidad de obtener productos derivados del maíz, mediante la creación de cadenas de valor para las zonas marginales y de baja producción de la provincia, con el objeto de aumentar la utilidad del cultivo.Los datos cualitativos y cuantitativos se obtienen mediante entrevistas y se organizaron según: las características geográficas y poblacionales, la situación de la producción y de los productos; la relación entre los sistemas productivos y otros actores vinculados. Finalmente, las regiones de Quebrada de Humahuaca y Puna son potenciales para la creación de cadenas de valor, aunque la sustentabilidad estará condicionada por el grado de cohesión que se pueda alcanzar entre los actores, por la vinculación con las instituciones de investigación y por el apoyo del gobierno.

  10. Editorial

    Directory of Open Access Journals (Sweden)

    Revista Ingeniería e Investigación

    2000-07-01

    Full Text Available Ingeniería es una palabra que significa retos, audacia, investigación, seguimiento, análisis, crítica, retroalimentación. Los grandes proyectos de Ingeniería llevados a cabo en nuestra topografía agreste con rasgos sísmicos de moderada a alta intensidad, la necesidad defrenar el acelerado deterioro ambiental fruto de prácticas ingenie riles caducas, la cada vez mayor presión sobre la demanda de vías y servicios, la utilización racional del recurso suelo, la valorización de materiales marginales, y aún de desechos y los nuevos procesos de construcción y demolición, constituyen, entre otros, algunos de los constantes retos que debe enfrentar el ingeniero civil y que lo conducen a estar atento al desarrollo de nuevas y más audaces tecnologías que le permitan resolverlos con mayor eficiencia y eficacia. Estas tecnologías, fundamentadas en desarrollos de modelos matemáticos y físicos del comportamiento de esas obras, conllevan a la puesta en marcha de programas de cálculo de los cuales algunos han sido concebidos al interior de los diferentes grupos de Investigación con que cuenta el Departamento de Ingeniería Civil. Este número especial de la Revista de Ingeniería e Investigación presenta los resultados de algunos de estos trabajos.

  11. Primer registro de Naupactus ruizi (Coleoptera: Curculionoidea asociado con Pinus ponderosa (Gymnospermae: Pinaceae en Patagonia First record of Naupactus ruizi (Coleoptera: Curculionoidea associated to Pinus ponderosa (Gymnospermae: Pinaceae in Patagonia

    Directory of Open Access Journals (Sweden)

    Cecilia A. Gómez

    2006-07-01

    Full Text Available Naupactus ruizi (Brèthes es un gorgojo de rostro corto, distribuido en la Argentina y Chile, que habita en ambientes áridos asociado con vegetación xerofítica y alcanza el rango más austral entre los miembros de la tribu Naupactini. Un relevamiento de insectos y de patógenos como plagas potenciales, realizado durante el 2005 en plantaciones de Pinus spp. en la Patagonia andina argentina, resultó en el hallazgo de adultos de N. ruizi que se alimentaban de acículas de Pinus ponderosa Dougl. ex Laws. Este hallazgo es sorprendente dado que las especies de Naupactini, consumen casi exclusivamente angiospermas. Interpretamos que el cambio de huésped, habría ocurrido como consecuencia de una colonización reciente favorecida por la amplia distribución geográfica del gorgojo y su capacidad para sobrevivir en hábitats marginales, donde probablemente las plantas nativas son escasas y el nuevo huésped presenta una gran abundancia local.Naupactus ruizi (Brèthes is a broad-nosed weevil recorded from Argentina and Chile , that inhabits arid environments with xerophitic vegetation and reaches the southern most distribution of the tribe Naupactini. A survey of potential insect pests and pathogens of plantations of Pinus spp. and other forest species, conducted during 2005 in Argentinean Patagonian Andean forestations, allowed to find N. ruizi feeding on pine needles of Pinus ponderosa Dougl. ex Laws. This finding was unexpected, since species of Naupactini consume almost exclusively angiosperms. We interpret that the new host association may represent a recent host shift, probably facilitated by the broad range of the weevil, its capacity to survive in marginal habitats where natural hosts are scarce, and the local abundance of the new host.

  12. Organization of the torus longitudinalis in the rainbow trout (Oncorhynchus mykiss): an immunohistochemical study of the GABAergic system and a DiI tract-tracing study.

    Science.gov (United States)

    Folgueira, Mónica; Sueiro, Catalina; Rodríguez-Moldes, Isabel; Yáñez, Julián; Anadón, Ramón

    2007-07-10

    The torus longitudinalis (TL) is a tectum-associated structure of actinopterygian fishes. The organization of the TL of rainbow trout was studied with Nissl staining, Golgi methods, immunocytochemistry with antibodies to gamma-aminobutyric acid (GABA), glutamic acid decarboxylase (GAD), and the GABA(A) receptor subunits delta and beta2/beta 3, and with tract tracing methods. Two types of neuron were characterized: medium-sized GABAergic neurons and small GABA-negative granule cells. GABA(A) receptor subunit delta-like immunoreactivity delineated two different TL regions, ventrolateral and central. Small GABAergic cells were also observed in marginal and periventricular strata of the optic tectum. These results indicate the presence of local GABAergic inhibitory circuits in the TL system. For tract-tracing, a lipophilic dye (DiI) was applied to the TL and to presumed toropetal nuclei or toral targets. Toropetal neurons were observed in the optic tectum, in pretectal (central, intermediate, and paracommissural) nuclei, in the subvalvular nucleus, and associated with the pretectocerebellar tract. Torofugal fibers were numerous in the stratum marginale of the optic tectum. Toropetal pretectal nuclei also project to the cerebellum, and a few TL cells project to the cerebellar corpus. The pyramidal cells of the trout tectum were also studied by Golgi methods and local DiI labeling. The connections of trout TL revealed here were more similar to those recently reported in carp and holocentrids (Ito et al. [2003] J. Comp. Neurol. 457:202-211; Xue et al. [2003] J. Comp. Neurol. 462:194-212), than to those reported in earlier studies. However, important differences in organization of toropetal nuclei were noted between salmonids and these other teleosts. (c) 2007 Wiley-Liss, Inc.

  13. A new iranian species of Uroleucon Mordvilko, 1914 (Hemiptera, Aphididae from specimens in the Natural History Museum collection

    Directory of Open Access Journals (Sweden)

    Nieto Nafría, Juan M.

    2014-06-01

    Full Text Available Uroleucon (Uromelan helichrysi sp. n. (Hemiptera, Aphididae, Aphidinae: Macrosiphini is established from Iranian apterous and alate viviparous females caught on Helichrysum sp. (Asteraceae and preserved in the collection of the Natural History Museum (BMNH in London. The number of setae on the first tarsal segments (5, the number of caudal setae (20 to 28, the presence of abdominal marginal tubercles on abdominal segments 2 to 4, and the size of the cells of the siphuncular reticulation (relatively small allow the new species to be distinguished from other Palaeartic species of the subgenus Uromelan. Blackman and Eastop’s key to apterae on Helichrysum is modified to include the new species. urn:lsid:zoobank.org:pub:E2B89D59-05FD-4A9E-AD78-B3C302219A10Se establece la especie Uroleucon helichrysi n. sp. (Hemiptera: Aphididae: Aphidinae: Macrosiphini con la descripción de sus hembras vivíparas ápteras y aladas recogidas en Irán sobre Helichrysum sp. (Asteraceae, conservadas en la colección del Natural History Museum de Londres. La nueva especie se diferencia de otras especies paleárticas del subgénero Uromelan por la cantidad de setas en el primer segmento tarsal (5, la cantidad de setas caudales (20 a 28, por el tamaño de las celdillas de la reticulación cornicular (que son relativamente pequeñas y por la presencia de papilas marginales (presentes en los segmentos abdominales 2 a 4 Se incluye una modificación a la clave de Blackman and Eastop para las ápteras que viven sobre Helichrysum. urn:lsid:zoobank.org:pub:E2B89D59-05FD-4A9E-AD78-B3C302219A10

  14. Control de Rhipicephalus microplus (Acari: Ixodidae mediante el uso del hongo entomopatógeno Metarhizium anisopliae (Hypocreales: Clavicipitaceae. Revisión

    Directory of Open Access Journals (Sweden)

    Melina Maribel Ojeda-Chi

    2011-01-01

    Full Text Available Las infestaciones de la garrapata del ganado, Rhipicephalus microplus, producen el mayor problema global de ectoparásitos en ganado de regiones tropicales y subtropicales, provocan importantes pérdidas económicas en la producción de carne, leche y pieles, además incrementan los gastos derivados de los programas de control, y son capaces de transmitir Babesia bovis, B. bigemina y Anaplasma marginale. El control de R. microplus se basa principalmente en el uso de ixodicidas, sin embargo, su uso irracional ha propiciado la aparición de garrapatas resistentes a las principales familias de ixodicidas, siendo necesario desarrollar alternativas de control no químico. Una de estas alternativas es el uso de hongos entomopatógenos, entre los que se encuentra Metarhizium anisopliae (Hypocreales, Clavicipitaceae el cual ha demostrado ser eficiente, tanto en estudios in vitro como in vivo, para el control de las diferentes fases evolutivas de R. microplus, causa disminución en la tasa de oviposición, incrementa el período de incubación y de eclosión, además produce la muerte de larvas y garrapatas adultas con porcentajes de eficiencia de hasta el 100 %. Diferentes estudios demuestran que M. anisopliae representa una alternativa no química sustentable para el control de garrapatas. La presente revisión tiene como objetivo presentar información actualizada sobre el uso de diferentes cepas de M. anisopliae en el control de la garrapata R.microplus.

  15. Componentes émicos del bienestar. Hacia un modelo alternativo de desarrollo

    Directory of Open Access Journals (Sweden)

    Jorge Yamamoto

    2007-12-01

    Full Text Available Se presenta una propuesta alternativa a los modelos establecidos de bienestar y desarrollo a través de una metodología émica y post hoc. Esta se aplica a un corredor migratorio desde comunidades rurales hasta urbano marginales. Se aplicó una batería psicométrica desarrollada para este estudio a 550 participantes y una versión modificada del análisis factorial confirmatorio para satisfacer las demandas de teorización post-hoc del estudio. Se proponen modelos alternativos de necesidades universales, satisfacción subjetiva de vida, recursos y valores. Se encuentra una estructura de tres factores de personalidad. Los resultados son discutidos en relación con las teorías establecidas desde el referente europeo y estadounidense y se reflexiona sobre sus perspectivas para el desarrollo. -- An alternative model of well-being and development using an emic and post-hoc approach is presented. This method was applied to a non-educated corridor sample which includes rural and urban shantytowns (n = 550. A psychometric wellbeing battery was developed for this study. Analytical technique includes a modified version of Confirmatory Factor Analysis in order to meet the demands of the post-hoc theorisation rationale. Alternative models of universal needs, subjective life satisfaction, resources, and values are presented. A three factor personality solution is described. Discussion emphasises the advantages of these results compared to theories and approaches from Europe and United States in theoretical and empirical terms. Implications for development are also discussed.

  16. Tristeza parasitária bovina no Sertão da Paraíba

    Directory of Open Access Journals (Sweden)

    V.M.M. Costa

    2011-03-01

    Full Text Available Descrevem-se 24 surtos de tristeza parasitária bovina no sertão paraibano, sendo 18 de anaplasmose por Anaplasma margimale, dois de babesiose por Babesia bigemina, dois por Babesia não identificada e dois por infecção mista de A. marginale e Babesia sp. Os surtos ocorreram entre agosto de 2007 a outubro de 2009, porém, com uma concentração dos surtos no final do período chuvoso e início do período seco de cada ano, sendo 22 em animais adultos e dois em bezerros de aproximadamente 11 meses. Dois surtos ocorreram em bovinos da raça Nelore, um em animais da raça Gir e os 21 restantes ocorreram em animais das raças Holandês, Pardo Suiço e mestiços das mesmas com zebuínos. Conclui-se que no sertão da Paraíba há áreas de instabilidade enzoótica, ocorrendo surtos de tristeza no final da época de chuvas, principalmente nas áreas de planaltos e serras da região da Borborema e em áreas úmidas como a Bacia do Rio do Peixe, Rio Piranhas e Rio Espinharas em que há a formação de microclimas favoráveis à sobrevivência do carrapato.

  17. Bmcystatin, a cysteine proteinase inhibitor characterized from the tick Boophilus microplus

    International Nuclear Information System (INIS)

    Lima, Cassia A.; Sasaki, Sergio D.; Tanaka, Aparecida S.

    2006-01-01

    The bovine tick Rhipicephalus (Boophilus) microplus is a blood-sucking animal, which is responsible for Babesia spp and Anaplasma marginale transmission for cattle. From a B. microplus fat body cDNA library, 465 selected clones were sequenced randomly and resulted in 60 Contigs. An open reading frame (ORF) contains 98 amino acids named Bmcystatin, due to 70% amino acid identity to a classical type 1 cystatin from Ixodes scapularis tick (GenBank Accession No. DQ066227). The Bmcystatin amino acid sequence analysis showed two cysteine residues, theoretical pI of 5.92 and M r of 11kDa. Bmcystatin gene was cloned in pET 26b vector and the protein expressed using bacteria Escherichia coli BL21 SI. Recombinant Bmcystatin (rBmcystatin) purified by affinity chromatography on Ni-NTA-agarose column and ionic exchange chromatography on HiTrap Q column presented molecular mass of 11kDa, by SDS-PAGE and the N-terminal amino acid sequenced revealed unprocessed N-terminal containing part of pelB signal sequence. Purified rBmcystatin showed to be a C1 cysteine peptidase inhibitor with K i value of 0.1 and 0.6nM for human cathepsin L and VTDCE (vitellin degrading cysteine endopeptidase), respectively. The rBmcystatin expression analyzed by semi-quantitative RT-PCR confirmed the amplification of a specific DNA sequence (294bp) in the fat body and ovary cDNA preparation. On the other hand, a protein band was detected in the fat body, ovary, and the salivary gland extracts using anti-Bmcystatin antibody by Western blot. The present results suggest a possible role of Bmcystatin in the ovary, even though the gene was cloned from the fat body, which could be another site of this protein synthesis

  18. L’architecture rurale lorraine du XIVe siècle à la première moitié du XVIe siècle : de l’identification aux marqueurs chronologiques

    Directory of Open Access Journals (Sweden)

    Ivan Ferraresso

    2012-04-01

    Full Text Available Part marginale du patrimoine lorrain, la maison rurale médiévale est peu étudiée. Les destructions provoquées par les guerres modernes et contemporaines peuvent en partie expliquer sa faible représentation mais quelques traces sont encore perceptibles. Leur étude systématique permettrait de comprendre la chronologie, les mutations et les permanences de l’habitat rural en Lorraine. Or, ces éléments, parfois très morcelés, rendent difficiles l’identification et l’analyse du bâtiment initial. De plus les critères de datation, dont la fiabilité est variable, imposent une étude fouillée du bâtiment pour exploiter les informations les plus infimes.Rural dwellings of the Middle Ages are not an outstanding feature of the heritage in the Lorraine region and have been little studied. The wars of the nineteenth end twentieth centuries explain this relative lack of interest but some surviving traces can still be analysed. This analysis allows for some conclusions as to the chronology, the changes and the permanent features of the region’s rural dwellings. These elements, sometimes broadly scattered, make the identification and analysis of the original dwelling difficult. Dating criteria, of varying reliability, impose an analytical approach in which the building has to be studied in minute detail in order to identify the slightest detail of informative

  19. Las bioconstrucciones de corales y sus facies asociadas durante el Malm en la Cordillera Ibérica Central (provincia de Zaragoza

    Directory of Open Access Journals (Sweden)

    Meléndez, A.

    1987-08-01

    Full Text Available The differents types of bioconstructions and associated facies in the Central Iberian Chain (Higueruelas Formation, Upper Kimmeridgian have been studied. Biohermes of different thickness (decimetric to metric and less lateral continuity are developped, highly colonized by corals, that are associated to oncolitic, bioclastic and oolitic of high energy facies, in marginal areas, near the litoral developpment. At the same time takes place an important set up of mud mounds, with a small coral colonisation, in protected arcas in a inner shelf, or in outer areas, where the action of the waves is not so effective. The environment protection is been generated in some places due to the appearance of oolitic barrier islands.Se estudian los diferentes tipos de bioconstrucciones de corales, y sus facies asociadas, presentes en el sector central de la rama aragonesa de la Cordillera Ibérica, en la Formación Higueruelas (Kimmeridgiense superior. Se desarrollan biohermos de potencias métricas a decimétricas y escasa continuidad lateral, intensamente colonizados por corales coloniales, que se encuentran asociados a facies oncolíticas, bioclásticas y oolíticas de alta energía en zonas marginales, próximas al desarrollo litoral. Al mismo tiempo tiene lugar una importante instalación de mud mounds, con escasa colonización de corales, en zonas protegidas dentro de la plataforma interna o en zonas más externas, donde la acción del oleaje no es efectiva. La protección del medio viene condicionada en algunos puntos por la aparición de islas barrera oolíticas.

  20. Resultados de un sistema para la vigilancia de caries de la infancia temprana

    Directory of Open Access Journals (Sweden)

    Eduardo BERNABÉ ORTIZ

    2006-10-01

    Full Text Available Objetivo: Describir los resultados de un sistema, implementado con los estudiantes de la Facultad de Estomatología Roberto Beltrán Neira, para la vigilancia de caries de la infancia temprana (CIT en niños entre 6 y 36 meses de edad de comunidades urbano-marginales de Sol Naciente de Carabayllo. Materiales y métodos: Sesenta y dos de los 97 niños que aceptaron participar en la evaluación inicial durante el semestre 2004-I, fueron reexaminados a los 12 (semestre 2005-I y 18 meses (semestre 2005-II empleando los criterios diagnósticos recomendados por la Organización Mundial de la Salud. Los resultados del sistema de vigilancia son descritos en términos de prevalencia e incidencia de CIT así como de experiencia de caries dental (índices ceod y ceos. Resultados: La prevalencia inicial de CIT fue de 24,2%, 8,2% y 2,6% por unidad persona, diente y superficie respectivamente, con un ceod de 1,10 + 2,51 dientes y un ceos de 1,50 + 3,71 superficies. Después de 18 meses, la incidencia de CIT fue de 4,3%, 2,6% y 1,3% por unidad persona, diente y superficie, encontrándose un incremento significativo de 0,32 dientes en el ceod (p<0,001 y de 0,74 superficies en el ceos (p=0,001. Conclusiones: Los resultados indican un inicio temprano (prevalencia moderada y desarrollo lento (baja incidencia de la CIT en niños de 6 a 36 meses de las comunidades seleccionadas. Esta información es útil para planificar futuras intervenciones con un enfoque preventivo o recuperativo en este grupo de edad.

  1. Detection of Babesia bovis carrier cattle by using polymerase chain reaction amplification of parasite DNA.

    Science.gov (United States)

    Fahrimal, Y; Goff, W L; Jasmer, D P

    1992-01-01

    Carrier cattle infected with Babesia bovis are difficult to detect because of the low numbers of parasites that occur in peripheral blood. However, diagnosis of low-level infections with the parasite is important for evaluating the efficacies of vaccines and in transmission and epidemiological studies. We used the polymerase chain reaction (PCR) to amplify a portion of the apocytochrome b gene from the parasite and tested the ability of this method to detect carrier cattle. The target sequence is associated with a 7.4-kb DNA element in undigested B. bovis genomic DNA (as shown previously), and the amplified product was detected by Southern and dot blot hybridization. The assay was specific for B. bovis, since no amplification was detected with Babesia bigemina, Trypanosoma brucei, Anaplasma marginale, or leukocyte DNA. The target sequence was amplified in DNA from B. bovis Mexico, Texas, and Australia S and L strains, demonstrating the applicability of the method to strains from different geographic regions. The sensitivity of the method ranged from 1 to 10 infected erythrocytes extracted from 0.5 ml of blood. This sensitivity was about 1,000 times greater than that from the use of unamplified parasite DNA. By the PCR method, six B. bovis carrier cattle were detected 86% of the time (range, 66 to 100%) when they were tested 11 times, while with microscopic examination of thick blood smears, the same carrier cattle were detected only 36% of the time (range, 17 to 66%). The method provides a useful diagnostic tool for detecting B. bovis carrier cattle, and the sensitivity is significantly improved over that of current methods. The results also suggest that characteristics of the apocytchrome b gene may make this a valuable target DNA for PCR-based detection of other hemoparasites. Images PMID:1624551

  2. Simultaneous Detection of Bovine Theileria and Babesia Species by Reverse Line Blot Hybridization

    Science.gov (United States)

    Gubbels, J. M.; de Vos, A. P.; van der Weide, M.; Viseras, J.; Schouls, L. M.; de Vries, E.; Jongejan, F.

    1999-01-01

    A reverse line blot (RLB) assay was developed for the identification of cattle carrying different species of Theileria and Babesia simultaneously. We included Theileria annulata, T. parva, T. mutans, T. taurotragi, and T. velifera in the assay, as well as parasites belonging to the T. sergenti-T. buffeli-T. orientalis group. The Babesia species included were Babesia bovis, B. bigemina, and B. divergens. The assay employs one set of primers for specific amplification of the rRNA gene V4 hypervariable regions of all Theileria and Babesia species. PCR products obtained from blood samples were hybridized to a membrane onto which nine species-specific oligonucleotides were covalently linked. Cross-reactions were not observed between any of the tested species. No DNA sequences from Bos taurus or other hemoparasites (Trypanosoma species, Cowdria ruminantium, Anaplasma marginale, and Ehrlichia species) were amplified. The sensitivity of the assay was determined at 0.000001% parasitemia, enabling detection of the carrier state of most parasites. Mixed DNAs from five different parasites were correctly identified. Moreover, blood samples from cattle experimentally infected with two different parasites reacted only with the corresponding species-specific oligonucleotides. Finally, RLB was used to screen blood samples collected from carrier cattle in two regions of Spain. T. annulata, T. orientalis, and B. bigemina were identified in these samples. In conclusion, the RLB is a versatile technique for simultaneous detection of all bovine tick-borne protozoan parasites. We recommend its use for integrated epidemiological monitoring of tick-borne disease, since RLB can also be used for screening ticks and can easily be expanded to include additional hemoparasite species. PMID:10325324

  3. Epidemiology of Babesia, Anaplasma and Trypanosoma species using a new expanded reverse line blot hybridization assay.

    Science.gov (United States)

    Paoletta, Martina Soledad; López Arias, Ludmila; de la Fournière, Sofía; Guillemi, Eliana Carolina; Luciani, Carlos; Sarmiento, Néstor Fabián; Mosqueda, Juan; Farber, Marisa Diana; Wilkowsky, Silvina Elizabeth

    2018-02-01

    Vector-borne hemoparasitic infections are a major problem that affects livestock industries worldwide, particularly in tropical and subtropical regions. In this work, a reverse line blot (RLB) hybridization assay was developed for the simultaneous detection and identification of Anaplasma, Babesia and bovine trypanosomes, encompassing in this way the most relevant hemoparasites that affect cattle. A total of 186 bovine blood samples collected from two different ecoepidemiological regions of northeast Argentina, with and without tick control, were analyzed with this new RLB. High diversity of parasites, such as Babesia bovis, B. bigemina, Anaplasma marginale and three different Trypanosoma species, was found. High rates of coinfections were also detected, and significant differences were observed not only in the prevalence of parasites but also in the level of coinfections between the two analyzed areas. Regarding the Trypanosoma genus, we provide molecular evidence of the presence of T. vivax and T. theileri for the first time in Argentina. Besides, since the RLB is a prospective tool, it allowed the identification of a yet unknown bovine trypanosome which could not be assigned to any of the bovine species known so far. In the present study we provide new insights on the prevalence of several pathogens that directly impact on livestock production in Argentina. The RLB assay developed here allows to identify simultaneously numerous pathogenic species which can also be easily expanded to detect other blood borne pathogens. These characteristics make the RLB hybridization assay an essential tool for epidemiological survey of all vector-borne pathogens. Copyright © 2017 Elsevier GmbH. All rights reserved.

  4. Detection of Theileria annulata in blood samples of carrier cattle by PCR.

    Science.gov (United States)

    d'Oliveira, C; van der Weide, M; Habela, M A; Jacquiet, P; Jongejan, F

    1995-01-01

    We report the detection of Theileria annulata, the causative agent of tropical theileriosis, by PCR in blood samples obtained from carrier cattle. The assay employs primers specific for the gene encoding the 30-kDa major merozoite surface antigen of T. annulata. A 721-bp fragment was amplified from blood samples taken monthly from calves experimentally infected with one of four different stocks of T. annulata originating in either Mauritania, Portugal, Spain, or Turkey. At the end of the experiment, five animals carried the infection for 12 months and two animals remained infected for 15 months. DNAs from six other Theileria species, T. parva, T. mutans, T. sergenti, T. buffeli, T. velifera, and T. taurotragi, were not amplified. Moreover, DNAs from four other hemoparasites (Anaplasma centrale, Anaplasma marginale, Babesia bovis, and Babesia bigemina) were also not amplified. As a control, primers derived from the small subunit rRNA gene of Theileria spp. amplified a 1.1-kb DNA fragment from all Theileria species examined but not from the other four hemoparasites. As few as two to three parasites per microliter of infected blood in a 50-microliters sample volume were detected by Southern or microplate hybridization with a T. annulata-specific cDNA probe. In addition, 92 field samples obtained from cattle in Spain were tested; 22% were positive in blood smears, 40% were positive by immunofluorescent antibody test, and 75% were positive for T. annulata by PCR. The method provides a useful diagnostic tool for detecting T. annulata carrier cattle. PMID:8567902

  5. Humor y excentricidad en Ṭabaqāt al-Šu‘arā’ al-muḥdaṯīn de Ibn al-Mu‘tazz

    Directory of Open Access Journals (Sweden)

    Garulo, Teresa

    2009-12-01

    Full Text Available The purpose of this paper is to call attention to this book by Ibn al-Mu‘tazz, sometimes neglected, emphasizing its worth as a literary work and as a source for the study of humour in Arabic literature. Ṭabaqāt al-shu‘arā’ al-muḥdathīn is a very curious repository of biographies of ‘Abbāsid poets, with especial attention to the least known among them, but with personalities that might give occasion to tell a good story about their wit or their folly. So we have, at the same time that we receive information about some very famous poets, a remarkable record full of empathy and humour with tales of madmen, profligate people and rogues and scoundrels boasting of their trades.

    Tanto la poesía de Ibn al-Mu‘tazz, como su reflexión teórica sobre el nuevo estilo de poetizar que se inicia con los poetas ‘abbāsíes, han atraído la atención de críticos e investigadores, por la serena armonía de sus versos y la potente visualidad de sus imágenes y metáforas, y, en el caso del Kitāb al-badī‘, por tratarse de la primera obra dedicada a las figuras y tropos que caracterizan la poesía de los poetas postomeyas. Sin embargo, su antología sobre los poetas muḥdaṯūn ha quedado relegada a la posición ancilar de repositorio de nombres de poetas, fundamentalmente menores, de la época ‘abbāsí. En este artículo intento una lectura menos utilitaria de las Ṭabaqāt al-Šu‘arā’ al-muḥdaṯīn para destacar su calidad como obra literaria y, sobre todo, su interés para la historia del humor en la literatura árabe, pues su autor refleja en ella su curiosidad por personajes excéntricos, ridículos o marginales, que sólo se salvan de la condena absoluta por su pasión por la poesía.

  6. Propiedades de crecimiento de las líneas celulares DH82 y RF/6A bajo condiciones normales de laboratorio

    Directory of Open Access Journals (Sweden)

    Samara Machuca Figueroa

    2016-01-01

    Full Text Available La línea celular RF/6A ha sido utilizada en estudios de corto plazo evaluando fármacos o infecciones experimentales con Anaplasma marginale; en contraste, DH82 es utilizada para la multiplicación de Ehrlichia canis. No obstante, se desconocen condiciones específicas de su crecimiento, por lo que se diseñaron varios experimentos para resolver interrogantes de su propagación. Ambas líneas, se adquirieron de la American Type Culture Collection, mantenidas en Medio Mínimo Esencial suplementado con suero fetal bovino, piruvato de Na y NaHCO3 e incubadas en atmósfera de 5% de CO2 en aire, a 37 °C. Los primeros ensayos, en placas de 24 pozos, esclarecieron los valores de dosis mínima inicial, que fueron 62,500 y 8,836 células/pozo para DH82 y RF/6A; así como los de densidad de siembra; cultivos con concentraciones de 5, 10, 20 y 40 células por mm2, cosechados con solución Tripsina-EDTA al alcanzar >95% de confluencia. Los índices estimados fueron: 3,319.32, 1,956.70, 870.73 y 422.14 para DH82 y 62.38, 63.51, 25.31 y 12.16 veces con RF/6A. La cinética del crecimiento, en cajas de Petri de 35 mm Ø, incluyó la siembra de 20 células/mm2, cambio del medio cada 63 h y cosecha cada 21 h para DH82; para RF/6A; la siembra fue 10 células/ mm2, cambio de medio cada 45 h y cosecha cada 15 h. El máximo crecimiento se observó hasta las 336 y 315 h con tiempos de duplicación de 42.9 y 36.9 h respectivamente para DH82 y RF/6A. Los datos permitieron proponer un modelo patrón de cultivo, para estudios futuros.

  7. Molecular Epidemiological Survey and Genetic Characterization of Anaplasma Species in Mongolian Livestock.

    Science.gov (United States)

    Ochirkhuu, Nyamsuren; Konnai, Satoru; Odbileg, Raadan; Murata, Shiro; Ohashi, Kazuhiko

    2017-08-01

    Anaplasma species are obligate intracellular rickettsial pathogens that cause great economic loss to the animal industry. Few studies on Anaplasma infections in Mongolian livestock have been conducted. This study examined the prevalence of Anaplasma marginale, Anaplasma ovis, Anaplasma phagocytophilum, and Anaplasma bovis by polymerase chain reaction assay in 928 blood samples collected from native cattle and dairy cattle (Bos taurus), yaks (Bos grunniens), sheep (Ovis aries), and goats (Capra aegagrus hircus) in four provinces of Ulaanbaatar city in Mongolia. We genetically characterized positive samples through sequencing analysis based on the heat-shock protein groEL, major surface protein 4 (msp4), and 16S rRNA genes. Only A. ovis was detected in Mongolian livestock (cattle, yaks, sheep, and goats), with 413 animals (44.5%) positive for groEL and 308 animals (33.2%) positive for msp4 genes. In the phylogenetic tree, we separated A. ovis sequences into two distinct clusters based on the groEL gene. One cluster comprised sequences derived mainly from sheep and goats, which was similar to that in A. ovis isolates from other countries. The other divergent cluster comprised sequences derived from cattle and yaks and appeared to be newly branched from that in previously published single isolates in Mongolian cattle. In addition, the msp4 gene of A. ovis using same and different samples with groEL gene of the pathogen demonstrated that all sequences derived from all animal species, except for three sequences derived from cattle and yak, were clustered together, and were identical or similar to those in isolates from other countries. We used 16S rRNA gene sequences to investigate the genetically divergent A. ovis and identified high homology of 99.3-100%. However, the sequences derived from cattle did not match those derived from sheep and goats. The results of this study on the prevalence and molecular characterization of A. ovis in Mongolian livestock can facilitate

  8. De la concepción autoritaria y de la concepción democrática en derecho administrativo

    Directory of Open Access Journals (Sweden)

    León Cortiñas Peláez

    2015-10-01

    Full Text Available Contenido: 1. Una renovación de la disciplina. - 1 DE UNA "REVOLUCION" DOCTRINAL. - 2. Una alteración del concepto clásico.• 3. Ante el Estado neoliberal: privatización y zonificación de la actividad. - 4. Desdén hacia la clásica presentación patológica. JI EL GRAN CONTRASTE. - 5. PluridiS'Ciplinariedad y jurisdicción administrativa. - 6. Substrato democrático y raigambre autoritaria. - 7. A La concepción del Estado. - 8. B La Constitución. - 9. e El "Estado Social" y el Estado de Derecho. ~ 10. D El "liberalismo" y la nacionalización. - 11. E Técnica y terminología autoritaria!.. - 12. F Tecnoestructura y presidencialismo. - 13. G La "Daseinsvorsorge" y el "service public" .• 14. H Juridicidad amplia o restringida. - 15. 1 Ambigüedades de la "tecnocracia judicial". - 16. J Una importante fuente "indirecta": objetividad y subjetividad en la doctrina. - 17. K Del estudio pluridisciplinario de la Administración. - 18. L La "neutralidad científica". - 16. M Ciencia y lecciones de la Historia. - 20. a La dicotomía de los derechos público y privado. - 21. b Fetichismo normativo y jusnaturalismo. - 22. c Autogobierno, colegialidad y tecnocracia. - 23: aa Tradición republicana y trasfondo imperial. - 24. bb Un "Estado de servicio". - 25. aaa De la descentralización territorial. - 26. bbb De la descentralización funcional. - 27. cc Voluntad general y presidencialismo. - 28. dd Del acceso al pretorio. - lII ANOTACIONES MARGINALES. - 29. Reservas. - 30. A El principio de legalidad. - 31. B La organización administrativa. - 32. C De las personas colectivas. - 33. D La distinción entre Estado de Derecho y Estado de Policía.• 34. E La "democratización" de las órdenes profesionales.

  9. Edad y crecimiento del híbrido de tilapia Oreochromis niloticus x Oreochromis aureus (Perciformes: Cichlidae en la represa “Zimapán” Hidalgo, México

    Directory of Open Access Journals (Sweden)

    M. A. Gómez-Ponce

    2011-06-01

    Full Text Available La edad y crecimiento de la tilapia Oreochromis niloticus x Oreochromis aureus fueron determinados por medio de la lectura de escamas. Un total de 382 individuos fueron capturados mediante el uso de redes agalleras y atarrayas. Ocho recolectas mensuales se llevaron a cabo entre septiembre 2003-mayo 2004; se registraron los datos de longitud estándar en cm. (Le, el peso total en g (Pt y se obtuvieron muestras de escamas para registrar el largo de la escama en mm. (Lesc y el número de anillos de crecimiento formados. Las tallas y pesos de recolecta variaron entre 38 a 232mm (Le y de 8.7 a 311.9g de peso total (Pt respectivamente. El recuento de los anillos anuales en escamas, permitió establecer cuatro grupos de edad, siendo el grupo de edad 2 el más representativo, con un 34.3% de la población muestreada. El cálculo de los incrementos marginales del crecimiento mensual de las escamas, sugirió la formación de dos anillos, uno de ellos se forma en los meses de noviembre-enero y otro en los meses de abril-mayo, los cuales coinciden con la época de bajas temperaturas y de madurez gonádica respectivamente. Los parámetros de crecimiento quedaron establecidos en: L∞=281.1mm, W∞=877.1g, K=0.33 y T0=0.88/año. Las curvas de crecimiento en longitud y peso se describieron mediante las ecuaciones de von Bertalanffy: Le=28.11 [1- e-0.33(t+0.88] y Pt=877.17 [1-e-0.33(t+0.88]³. Finalmente, se concluyó que los peces que se explotan en la represa mediante captura comercial presentan entre un año y año y medio de edad.

  10. Una aproximación al estado de la partería tradicional en Colombia An approach to the state of traditional midwifery in Colombia

    Directory of Open Access Journals (Sweden)

    Celmira Laza Vásquez

    2012-06-01

    Full Text Available En Colombia coexisten dos sistemas de atención del parto: el formal y el tradicional. El segundo sobrevive dada la baja cobertura de la atención de los eventos relacionados con la gestación, el parto y el puerperio por el sistema formal, y por factores de tipo cultural. Sin embargo, a pesar de la consolidación de la partería tradicional y la figura de la partera en las zonas rurales apartadas y las urbanas marginales, en el país persiste un desconocimiento científico de este evento que cobra trascendencia actual ya que es uno de los que interviene en la presentación de la mortalidad y morbilidad materna y perinatal. El presente artículo se propone discutir acerca de la necesidad del abordaje investigativo en el tema de la partería y la partera tradicional. Así, se presentan los escasos resultados de los avances investigativos en este tema, se plantean algunos saldos pendientes a responder desde investigación científica y el posible aporte que pudiera realizar la partería tradicional al mejoramiento de la salud de la mujer.In Colombia there are two systems of care delivery: the formal and traditional. The second is still in use because of the low health coverage associated with pregnancy, childbirth and the postpartum period provided by the proper system, and other cultural factors. However, despite the consolidation of traditional midwifery and existence of the midwife figure in remote rural areas and urban marginal in the country, the lack of scientific knowledge persist of this event; who takes current impact in the presentation of mortality and maternal and perinatal morbidity. This paper aims to discuss about the need for research addressing the issue of midwives and traditional birth attendant. It presents the few results of the research progress on this subject, we present some outstanding balances to respond from scientific research and the possible contribution that could perform the traditional midwives to improve the

  11. Mejoramiento genético del frijol rojo y negro mesoamericano para Centroamérica y El Caribe

    Directory of Open Access Journals (Sweden)

    Juan C. Rosas

    2000-01-01

    Full Text Available La producción de frijol en Centroamérica es llevada a cabo mayormente en laderas de suelos marginales, limitada por diversos factores bióticos y abióticos. Más de 350,000 t de este grano se producen en cerca de 0,5 millones de hectáreas, con rendimientos promedios de 678 kg/ha. La mayoría de los productores de frijol utilizan bajos insumos y muy pocas fincas están mecanizadas. El autoconsumo es alto; sin embargo, una alta proporción de este grano es comprado por intermediarios. En Honduras, el frijol es el sétimo cultivo en valor económico y es el de mayor rentabilidad entre el maíz, arroz y sorgo. Las dos clases comerciales más importantes en Centroamérica son el frijol rojo y negro pequeños (raza Mesoamérica. El mejoramiento de estos tipos de frijol se ha enfocado en el desarrollo de resistencia a enfermedades (mosaico común, mosaico dorado, antracnosis, mancha angular, roya, mustia hilachosa y bacteriosis común e insectos (principalmente picudo de la vaina; y tolerancia a baja fertilidad, sequía y calor. Programas adecuados de hibridación, evaluación y selección son usados para el desarrollo de cultivares con resistencia múltiple, alto rendimiento, buena adaptación y aceptación comercial. La ampliación de la base genética se obtiene usando fuentes de germoplasma Andino y Mesoamericano en la etapa de hibridación. La selección simultánea por varios caracteres y pruebas multilocalidades son utilizadas. Los viveros y ensayos de adaptación y rendimiento de líneas avanzadas son distribuídos a países de Centroamérica, México, y El Caribe. Las pruebas y validaciones en fincas y la liberación de variedades, son efectuadas por los programas nacionales de frijol de los países miembros de PROFRIJOL, en colaboración con el Zamorano, CIAT y el Bean/Cowpea CRSP

  12. La novela autobiográfica de Mohammed Chukri como fuente para una etnografía de la pobreza urbana en Marruecos

    Directory of Open Access Journals (Sweden)

    Castaño Madroñal, Ángeles

    2005-06-01

    Full Text Available The Naked Bread was the first novel written by Moroccan writer Mohammed Chukri. The author himself has described it as an autobiographical work, for it narrates the misadventures of a kid from the rural Rift migrating with his family to Tangiers, where they settle in a slum. The novel illustrates the passing from rural poverty to urban destitution in the Morocco of the Spanish Protectorate. By analyzing the novel, Castaño Madroñal discusses the validity of literary works as suitable sources of ethnographic data for the social conditions reigning in the underprivileged areas of Moroccan cities. A parallel can be established with current rural migration to urban areas and to countries north of Morocco. The analysis builds upon the hypothesis of an ethnoliterature that draws from literary sources to approach the social reality ethnographically. Ethnoliterature can be a useful source for cultural knowledge prior to ethnographic study. It can also be a tool for cross-cultural comparisons and the anthropological analysis of social communities.

    El Pan Desnudo fue la primera novela del escritor marroquí Mohammed Chukri. El propio autor la ha definido como una novela autobiográfica. En ella se narran las peripecias de un chiquillo de origen rifeño que emigra con su familia desde una zona rural rifeña a Tánger, donde se ubican en un barrio marginal de la ciudad. Se plantea a través del análisis de esta obra la validez de este tipo de textos literarios como fuente etnográfica de una realidad social existente en los barrios marginales de las grandes urbes marroquíes. En el análisis se parte de la hipótesis de una etnoliteratura que nace de las fuentes literarias y permite un acercamiento etnográfico a la realidad social. La etnoliteratura se revelaría como una útil fuente de conocimiento cultural, previo al trabajo etnográfico, así como una herramienta para la comparación transcultural y el análisis antropológico.

  13. La construcción de la ‘Cuestión Gitana Rumana’ en el Área Metropolitana de Barcelona: espacios públicos urbanos, conflictos vecinales y política local The genesis of a 'Romanian Roma Issue' in the Metropolitan Area of Barcelona: urban public spaces, neighbourhood conflicts and local politics

    Directory of Open Access Journals (Sweden)

    Óscar López Catalán

    2012-05-01

    Full Text Available Este artículo tiene la intención de presentar un panorama general de la situación de la población Rrom (gitana rumana en el Área Metropolitana de Barcelona y describir brevemente y analizar las maneras en las que su presencia está siendo gestionada. La metodología utilizada va desde el análisis mediático al trabajo de campo etnográfico. Primero, ofreceré algunas referencias y un contexto general de la presencia y el proceso migratorio de la población rrom inmigrada en España y Barcelona. A continuación, me centraré en la construcción local de la ‘cuestión gitana’, usando brevemente tres ejemplos diferentes e interrelacionados: regulación del espacio público y estrategias económicas marginales; políticas de asentamiento y la idea del nomadismo-movilidad; y finalmente la construcción política y culturalización de conflictos vecinales. Por último, se ofrecen algunas conclusiones y reflexiones sobre la posible evolución de dichos proceso a un nivel local y estatal.This paper intends to present a general overview of the situation of the Romanian Roma Population in Barcelona Metropolitan Area and briefly describe and analyze the ways in which their presence is being managed. First, I will offer some references as well as a general background of the presence and migratory process of the Romanian Roma population in Spain and Barcelona. Next, I will focus on the local construction of the “Roma Issue”, using three different and interrelated examples: public space regulation and marginal economic strategies; settlement policies and the idea of nomadism-mobility; and finally political construction and culturalization of concrete neighbourhood conflicts. Finally, I intend to offer some conclusions as well as some reflections about the possible evolution of these processes both at a local and state level.

  14. Lesiones accidentales en adultos mayores: un reto para los sistemas de salud Accidental injuries in older adults: a challenge for the health systems

    Directory of Open Access Journals (Sweden)

    Ma. Guadalupe Ruelas González

    2008-12-01

    Full Text Available OBJETIVO: Identificar los factores sociodemográficos, de salud y apoyo social relacionados con las lesiones accidentales en adultos mayores residentes de colonias urbanas marginales de las ciudades de Cuernavaca, Chilpancingo, Guadalajara y Culiacán. MATERIAL Y MÉTODOS: En 2004-2005 se llevó a cabo un estudio transversal; mediante muestra no probabilística, se entrevistó a 799 adultos mayores; se emplearon pruebas no paramétricas y un modelo multivariado de regresión logística. RESULTADOS: Del total de entrevistas, 37% notificaron lesiones y la causa principal fueron las caídas (54%. El hogar fue el sitio con mayor número de accidentes (52%. Los factores de riesgo asociados fueron edad avanzada, trabajar, mayor número de enfermedades, mayor consumo de medicamentos, remedios y bebidas alcohólicas, percepción de "mala salud", apoyo familiar inadecuado y ser cuidador de otros. CONCLUSIONES: La multicausalidad obliga, por una parte, a que toda la sociedad participe y, por la otra, a la intervención del área de la salud para prevenir y atender el problema.OBJECTIVE: To identify factors (sociodemographic, health, and social support associated with the presence of accidental injuries in older adults living in deprived urban neighborhoods in four Mexican municipalities. MATERIAL AND METHODS: Cross-sectional survey carried out in 2004-2005, with a non-probabilistic, intentional sample of 799 male and female elderly living in deprived urban areas in four Mexican municipalities. For the statistical analysis, non-parametric tests and multivariate logistic regression models were used. RESULTS: More than a third (37% of the sample reported injuries; with falls being the main cause. Home was the venue where most accidents took place (52%. Risk factors for accidental injuries were: advanced age, working, greater number of illnesses, consumption of more medicines and remedies, self-perception of "poor" health , consumption of alcoholic beverages

  15. Survey of selected pathogens and blood parameters of northern yellowstone elk: Wolf sanitation effect implications

    Science.gov (United States)

    Barber-Meyer, S. M.; White, P.J.; Mech, L.D.

    2007-01-01

    The restoration or conservation of predators could reduce seroprevalences of certain diseases in prey if predation selectively removes animals exhibiting clinical signs. We assessed disease seroprevalences and blood parameters of 115 adult female elk (Cervus elaphus) wintering on the northern range of Yellowstone National Park [YNP] during 2000-2005 and compared them to data collected prior to wolf (Canis lupus) restoration (WR) in 1995 and to two other herds in Montana to assess this prediction. Blood parameters were generally within two standard deviations of the means observed in other Montana herds (Gravelly-Snowcrest [GS] and Garnet Mountain [GM]), but Yellowstone elk had higher seroprevalences of parainfluenza-3 virus (95% CI YNP = 61.1-78.6, GS = 30.3-46.5) and bovine-virus-diarrhea virus type 1 (95% CI YNP = 15.9-31.9, GM = 0). In comparisons between pre-wolf restoration [pre-WR] (i.e., prior to 1995) seroprevalences with those post-wolf restoration [post-WR] in Yellowstone, we found lower seroprevalences for some disease-causing agents post-wolf restoration (e.g., bovine-virus-diarrhea virus type-1 [95% CI pre-WR = 73.1-86.3, post-WR = 15.9-31.9] and bovine-respiratory syncytial virus [95% CI pre-WR = 70.0-83.8, post-WR = 0]), but similar (e.g., Brucella abortus [95% CI pre-WR = 0-4.45, post-WR = 0-4.74] and epizootic hemorrhagic disease virus [95% CI pre-WR = 0, post-WR = 0]) or higher for others (e.g., Anaplasma marginale [95% CI pre-WR = 0, post-WR = 18.5-38.7] and Leptospira spp. [95% CI pre-WR = 0.5-6.5, post-WR = 9.5-23.5]). Though we did not detect an overall strong predation effect through reduced disease seroprevalence using retrospective comparisons with sparse data, our reference values will facilitate future assessments of this issue.

  16. La restauración de los pabellones de entrada del Park Güell

    Directory of Open Access Journals (Sweden)

    Hosta Calderer, Carme

    2002-12-01

    Full Text Available In 1984 Güell Park was declared a World Heritage Site by UNESCO, since when Barcelona Town Council has been carrying out a continuous and thorough process of rehabilitation of all the architectural features, as well as improving access, reforestation of the surrounding hills and putting an end to peripheral uses. The article focuses on the restoration of the lodges on each side of the entrance, the left, hand one is used as the porters lodge and administrative offices, and the one on the right as the porter living quarters. They are two outstanding Gaudi buildings, which are in a bad state of repair since they have been used as private residences from the Twenties lo the Eighties, and, as such, have been modified and butchered. The article outlines the architectural restoration {highlighting the repairs lo the one-way ceiling in the porters lodge, and the consolidation of the interior and the trencadís (Gaudi´ s distinctive decorative effect using pieces of tile which covered roofs, battlements, cornice, etc, recovering original elements or reproducing the faithfully, following detailed studies of the history and materials.En 1984 el Park Güell fue declarado Patrimonio de la Humanidad por la UNESCO, y a partir de entonces el Ayuntamiento de Barcelona ha iniciado un proceso no acabado de rehabilitación en profundidad de todos sus elementos arquitectónicos, así como de mejora de sus accesos, reforestación de las colinas que lo rodean y eliminación de usos marginales. El artículo se centra en la restauración de los dos pabellones que flanquean la puerta, el de la izquierda, destinado a conserjería y administración, y el de la derecha, a vivienda del conserje, dos edificios singulares de Gaudí que se hallaban muy deteriorados (desde los años veinte hasta los ochenta fueron ocupados como vivienda privada y sufrieron muchos cambios y mutilaciones. Se explica el proceso de su restauración constructiva (destacan la reparación del

  17. Los cambios en la representación de la estructura capitalista y su incidencia en la cotidianeidad de la masa marginal entre mediados del siglo XX y la actualidad. El caso de los habitantes de una villa de emergencia de la ciudad de San Nicolás

    Directory of Open Access Journals (Sweden)

    Cánepa Moretti, Elizabeth

    2013-09-01

    Full Text Available El presente trabajo se propone analizar los cambios operados en la forma de representación de la estructura capitalista y de su incidencia en la cotidianeidad de los habitantes de Villa Tranquila, de la ciudad de San Nicolás, a partir de los años de reconversión neoliberal del Estado argentino, sobre todo en la década del ’90.El asentamiento en el que se desarrolla este estudio tiene una historia muy particular, puesto que hace décadas formaba parte de un barrio mucho más grande, llamado Villa Pulmón, nacido a partir del asentamiento de personas provenientes del norte del país, que encontraron empleo en la construcción de la empresa siderúrgica SOMISA. A finales de la última dictadura militar, Villa Pulmón es desalojada, resistiendo sólo el pequeño barrio donde centraremos nuestro estudio, ocupado por aproximadamente 40 familias. En el gran terreno que antes ocupaba la Villa Pulmón se instaló el santuario de la Virgen María, ya en los primeros años de la democracia. Durante el gobierno de Carlos Menem, SOMISA fue privatizada y San Nicolás perdió en parte su perfil industrial para convertirse en una ciudad orientada a los servicios, con gran influencia del turismo religioso al santuario.Este trabajo, además, recoge la memoria construida en Villa Pulmón, referenciada en un Estado nacional con un proyecto industrialista y una presencia fuerte en la gestión de sectores estratégicos de la economía, para contraponerlo con la realidad de los habitantes actuales de Villa Tranquila, entre quienes encontramos las características propias de los sectores urbano-marginales de la actualidad, relacionadas con la desafiliación del mundo del trabajo formal y de otras instituciones que antes marcaban el pulso de la clase trabajadora, como la escuela pública, los sindicatos, etc. Las fuentes utilizadas son, entrevistas a habitantes de Villa Tranquila de distintas edades: mujeres adultas, generalmente madres, y adolescentes varones de

  18. Morfogénesis de la fase sexual del helecho Arachniodes denticulata (Dryopteridaceae

    Directory of Open Access Journals (Sweden)

    Aniceto Mendoza

    1999-12-01

    Full Text Available Se describe la morfología de la espora y desarrollo de la fase sexual de Arachniodes denticulata (Sw. Ching. El material fue recolectado en los estados de Hidalgo, Oaxaca y Veracruz, México (una muestra por cada localidad. Las esporas fueron sembradas en medio de Thompson con agar (30 cajas. Sus esporas son monoletes con perina, elipsoidales, no clorofílicas. Su germinación es tipo Vittaria y su desarrollo protálico tipo Aspidium, el gametofito adulto es cordiforme-espatulado a cordiforme-reniforme; presentan tricomas marginales y superficiales, unicelulares, capitados; los rizoides no tienen cloroplastos; sus gametangios son del tipo común de los helechos leptosporangiados. Después de 200 días de haber sido sembradas las esporas, no se formaron esporofitos. Se concluye que A. denticulata comparte características comunes con A. aristata, A. assamica y con especies de los géneros Cyrtomium, Dryopteris, Polystichum, como son el tipo de germinación y desarrollo protálico, así como la presencia de tricomas unicelulares desde jóvenes protalos. Mientras que Didymochlaena truncatula difiere de las anteriores por presentar un patrón de desarrollo protálico tipo Adiantum y por la ausencia de tricomas en toda su fase sexual.Spore morphology and sexual fase development of Arachniodes denticulata (Sw. Ching are described from material collected in states of Hidalgo, Oaxaca and Veracruz, Mexico (one sample from each locality. The spores were sown in Thompson medium with agar (30 Petri dishes. The spores are monolete, with perine, ellipsoid in shape and non chlorophyllic. The germination is Vittaria-type and the prothallial development Aspidium-type; the gametophytes are cordiform-spatulate to cordiform-reniform in shape, with unicellular capitate trichome in margin and surface; rhizoids without chloroplasts; gametangia are the common type in leptosporangiate homosporous ferns. No sporophytes were observed after 200 days of culture. It is

  19. Perder el lugar: Un caso de estudio del desplazamiento en Colombia

    Directory of Open Access Journals (Sweden)

    Gabriel Ruiz

    2014-03-01

    Full Text Available Losing One’s Place – A Case Study of Colombia’s Displaced CitizenshipThe study of social frameworks where violence is shaped requires an analysis of armed actions not as isolated events but linked to the structural conditions that enable their emergence. The normalization of violence in marginal rural areas not only destroys the place where victims have rights (their home but also the very idea of being holders of rights. The physically forced displacement of these rural inhabitants is thus seen as the concretization of a previous social displacement that had taken their citizenship away in the first place. The effects of these measures of reparation in Colombia are limited (and even counterproductive because violence and forced displacement have only been understood in terms of their physical dimensions and are not directed toward achieving a democratic transformation that would bring the victims back into the political community.Resumen:El estudio de las tramas sociales donde se forma la violencia exige analizar las acciones armadas no de forma aislada sino encadenadas a las condiciones estructurales que posibilitaron su aparición. La normalización de la violencia en los sectores marginales rurales destruye no sólo el lugar de derecho de las víctimas (su hogar sino la idea misma de ser sujetos de derechos. El desplazamiento forzado físico de estas poblaciones se entiende así como la materialización de un desplazamiento social previo que las privó de la condición de ciuda-danía en primer lugar. Los efectos de las medidas de reparación en Colombia son limitados (e incluso contraproducentes porque entienden la violencia y el desplazamiento forzado sólo en su dimensión física y no están orientadas por tanto a lograr una transformación democrática que incorpore a las víctimas dentro de la comunidad política.

  20. Ubicación óptima de generación distribuida en sistemas de energía eléctrica Optimal placement of distributed generation in electric power system

    Directory of Open Access Journals (Sweden)

    Jesús María López–Lezama

    2009-06-01

    Full Text Available En este artículo se presenta una metodología para la ubicación óptima de generación distribuida en sistemas de energía eléctrica. Las barras candidatas para ubicar la generación distribuida son identificadas basándose en los precios marginales locales. Estos precios son obtenidos al resolver un flujo de potencia óptimo (OPF y corresponden a los multiplicadores de Lagrange de las ecuaciones de balance de potencia activa en cada una de las barras del sistema. Para incluir la generación distribuida en el OPF, ésta se ha modelado como una inyección negativa de potencia activa. La metodología consiste en un proceso no lineal iterativo en donde la generación distribuida es ubicada en la barra con el mayor precio marginal. Se consideraron tres tipos de generación distribuida: 1 motores de combustión interna, 2 turbinas a gas y 3 microturbinas. La metodología propuesta es evaluada en el sistema IEEE de 30 barras. Los resultados obtenidos muestran que la generación distribuida contribuye a la disminución de los precios nodales y puede ayudar a solucionar problemas de congestión en la red de transmisión.This paper presents a methodology for optimal placement of distributed generation (DG in electric power system. The candidate buses for DG placementare identified on the bases of locational marginal prices. These prices are obtained by solving an optimal power flow (OPF and correspond to the Lagrange multipliers of the active power balance equations in every bus of the system.In order to consider the distributed generation in the OPF model, the DG was modeled as a negative injection of active power. The methodology consists ofa nonlinear iterative process in which DG is allocated in the bus with the highest locational marginal price. Three types of DG were considered in the model: 1 internal combustion engines, 2 gas turbines and 3 microturbines.The proposed methodology is tested on the IEEE 30 bus test system. The results obtained

  1. Study of microinstabilities due to an anisotropic velocity distribution function of the particles of a homogeneous plasma; Etude des microinstabilities liees a l'anisotropie de la fonction de distribution des vitesses des particules d'un plasma homogene

    Energy Technology Data Exchange (ETDEWEB)

    Hennion, F [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1966-06-01

    A study is made of instabilities in a plasma with an ion velocity distribution function of the form: f{sub oi} = 1 / (2*{pi}*{alpha}{sub p}e{sub i}*{alpha}{sub p}a{sub i}) * {lambda}({nu}{sub p}e - {alpha}{sub p}e{sub i}) * e{sup -}(v{sub pa2}/{alpha}{sub pai2}). The plasma is assumed to have finite dimensions limited by infinitely conductive boundary surfaces. A theoretical and numerical analysis of marginal stability locates the regions of stability as a function of several parameters; i.e. plasma length, ion anisotropy ({tau}) and electron temperature (T{sub e}). A limiting plasma length is found, below which the plasma is stable regardless of its density. For the parameters of the injection experiment M.M.I.I. at Fontenay-aux-roses it is found that the type of instabilities studied here should not occur. (author) [French] L'etude est faite en choisissant une fonction de distribution des ions de la forme f{sub oi} = 1 / (2*{pi}*{alpha}{sub p}e{sub i}*{alpha}{sub p}a{sub i}) * {lambda}({nu}{sub p}e - {alpha}{sub p}e{sub i}) * e{sup -}(v{sub pa2}/{alpha}{sub pai2}) et en supposant une conductivite infinie sur les limites du plasma de dimensions finies. L'etude theorique et numerique de la stabilite marginale determine les domaines de stabilite qui sont etudies en fonction de plusieurs parametres: longueur du plasma, anisotropie des ions ({tau}), temperature electronique (T{sub e}). Il apparait une longueur limite du plasma au-dessous de laquelle le plasma est stable, independemment de la densite. L'application faite avec les valeurs des parametres de l'experience d'injection M.M.I.I, a Fontenay-aux-Roses permet de conclure a la non existence dans cet appareil du type d'instabilite etudie ici. (auteur)

  2. Vibrations et relaxations dans les molécules biologiques. Apports de la diffusion incohérente inélastique de neutrons

    Science.gov (United States)

    Zanotti, J.-M.

    2005-11-01

    Le présent document ne se veut pas un article de revue mais plutôt un élément d'initiation à une technique encore marginale en Biologie. Le lecteur est supposé être un non spécialiste de la diffusion de neutrons poursuivant une thématique à connotation biologique ou biophysique mettant en jeu des phénomènes dynamiques. En raison de la forte section de diffusion incohérente de l'atome d'hydrogène et de l'abondance de cet élément dans les protéines, la diffusion incohérente inélastique de neutrons est une technique irremplaçable pour sonder la dynamique interne des macromolécules biologiques. Après un rappel succinct des éléments théoriques de base, nous décrivons le fonctionnement de différents types de spectromètres inélastiques par temps de vol sur source continue ou pulsée et discutons leurs mérites respectifs. Les deux alternatives utilisées pour décrire la dynamique des protéines sont abordées: (i)l'une en termes de physique statistique, issue de la physique des verres, (ii) la seconde est une interprétation mécanistique. Nous montrons dans ce cas, comment mettre à profit les complémentarités de domaines en vecteur de diffusion et de résolution en énergie de différents spectromètres inélastiques de neutrons (temps de vol, backscattering et spin-écho) pour accéder, à l'aide d'un modèle physique simple, à la dynamique des protéines sur une échelle de temps allant d'une fraction de picoseconde à quelques nanosecondes.

  3. Los linchamientos en las comunidades indígenas (Ecuador: ¿la política perversa de una modernidad marginal?

    Directory of Open Access Journals (Sweden)

    2000-01-01

    Full Text Available LES LYNCHAGES DANS LES COMMUNAUTES INDIGENES (ÉQUATEUR POLITIQUE PERVERSE D 'UNE MODERNITE MARGINALE?. Au cours des dernières années, il s´est produit toute une série de lynchages dans diverses communautés indiennes d'Équateur. En interaction avec de nombreux espaces médiatiques, ces communautés ont su faire en sorte que la violence générée devienne un spectacle public retransmis par radio et par voie télévisuelle. Il s'est ainsi instauré un rapport de force avec l'État qui va au-delà du simple champ politique pour se transformer en une confrontation hautement symbolique dans laquelle s'affirme “un droit de tuer” revendiqué par les Indiens en réponse aux politiques libérales de “laissez-mourir”. En los últimos años se suceden una serie de linchamientos en comunidades indígenas en Ecuador. Las comunidades se integran en el espacio mediático y lo utilizan. La violencia deviene un espectáculo público trasmitido por la radio y la televisión. Se establece un juego de fuerza con el Estado que desborda el campo de lo político hacia un enfrentamiento perverso que contrapone “un derecho de matar” a las políticas neoliberales de “dejar morir”. THE PERVERSE POLITICS OF THE MARGINAL MODERNITY. Over the last few years, there have been a growing number of lynchings in several Indian communities in Ecuador. Taking advantage of the media, these communities have instrumentalized violence which has become a public spectacle broadcasted by radio or television. The Indians have established a relation of power with the State which goes beyond a mere political struggle to transform and shifts into a perverse confrontation where “a right to kill” responds the liberal policy of “let them die”.

  4. Tamaños de muestra para estimar la estructura de tallas de las capturas de langostino colorado en la zona centro-norte de Chile: una aproximación a través de remuestreo Sample sizes for estimating the catch size distribution of squat lobster in north-central Chile: a resampling approach

    Directory of Open Access Journals (Sweden)

    Carlos Montenegro Silva

    2009-01-01

    Full Text Available Se analizó el desempeño de distintos tamaños de muestra para estimar la composición de tallas de las capturas del langostino colorado (Pleuroncodes monodon, a partir de un procedimiento de remuestreo computacional. Se seleccionaron datos recolectados en mayo de 2002 entre los 29°10'S y 32°10'S. A partir de éstos, se probaron siete escenarios de muestreo de viajes de pesca (1-7 viajes, 12 escenarios de número de ejemplares muestreados (25, 50,...300, cada 25 ejemplares y dos estrategias de muestreo de lances de pesca al interior de un viaje de pesca (censo de lances y muestreo sistemático. Se probó la combinación de todos estos escenarios, lo que permitió analizar el desempeño de 168 escenarios de tamaño de muestra para estimar la composición de tallas por sexo. Los resultados indicaron una disminución en el índice de error en la estimación de la distribución de frecuencia de tallas, conforme aumentó el número de viajes de pesca, con disminuciones progresivamente menores entre escenarios adyacentes. Del mismo modo, se verificó una disminución en el índice de error al aumentar el número de ejemplares muestreados, con mejoras marginales sobre los 175 ejemplares.The performances of different sample sizes for estimating the size distribution of squat lobster (Pleuroncodes monodon catches were analyzed using a computer resampling procedure. The data selected were gathered in May 2002 between 29°10'S and 32°10'S. These data were used to test seven sampling scenarios for fishing trips (1-7 trips, twelve scenarios of the number of individuals sampled per tow (25, 50,..., 300, and two within-trip sampling strategies (sampling all tows and systematic tow sampling. By testing the combination of all these scenarios, we were able to analyze the performance of 168 scenarios of sample size for estimating the composition of sizes by sex. The results indicate a lower error index for estimates of the size frequency distribution as the

  5. Blanca Wiethüchter: des-nombrando el paisaje. Políticas y poéticas de la representación en la década de los 80 en Bolivia

    Directory of Open Access Journals (Sweden)

    Mauricio Duarte

    2011-01-01

    Full Text Available This article examines the relationship between poetic writing and the discourse of landscape in Madera Viva y árbol difunto (1982 by Blanca Wiethüchter (1947-2004. Landscape is often understood as a modern device of normative representation in which people and places are classified merely as private property. I argue that Wiethüchter’s poetry establishes a counter-narrative of the landscape through the use of a poetic gaze that reinstates social and marginal imaginaries by recognizing the materiality of such landscape and, most importantly, the political role of imagination in shaping the sense of the real. In doing so, I show how Wiethüchter uses poetic language to claim multiple and conflictive realities that lie beneath the names and harmonic appearances of things. Finally, by analyzing Wiethüchter’ poetic and critical work in dialogue with thinkers and scholars such as García Linera, Mamani, Zavaleta Mercado, and Rivera Cusicanqui, this article contributes to the understanding of the politics of representation during the 1980s in Bolivia.ResumenEste artículo examina la relación entre la escritura poética y el discurso del paisaje en Madera Viva y árbol difunto (1982 de Blanca Wiethüchter (1947-2004. A menudo el paisaje es entendido como un mecanismo moderno de representación normativa en la cual los sujetos y los lugares son clasificados simplemente como propiedad privada. Nuestro argumento propone que la poesía de Wiethüchter establece una contra-narrativa del paisaje a través del uso de una mirada poética que reinstala imaginarios sociales y marginales al reconocer la materialidad del paisaje y, más aún, el rol político de la imaginación en la configuración del sentido de realidad. Al proponer lo anterior, se muestra cómo Wiethüchter usa el lenguage poético para reclamar realidades múltiples y conflictivas anquilosadas bajo la armónica apariencia de las cosas. Finalmente, al analizar la obra poética y cr

  6. The Ongota language – and two ways of looking at the history of the marginal and hunting-gathering peoples of East Africa

    Directory of Open Access Journals (Sweden)

    Graziano Savà

    2015-12-01

    bottom-up”, ovvero un’origine degli Ongota in quanto gruppo marginale o fuori casta.

  7. Políticas públicas de juventud en América Latina: de la construcción de espacios específicos, al desarrollo de una perspectiva generacional

    Directory of Open Access Journals (Sweden)

    Ernesto Rodríguez

    2003-10-01

    Full Text Available El artículo revisa esquemáticamente las principales nociones teóricas utilizadas en la investigación comparada sobre el tema y analiza las experiencias desplegadas durante los años noventa en América Latina en el terreno de las políticas públicas de juventud, distinguiendo las explícitas (implementadas por instituciones especializadas en el tema y las implícitas (implementadas por instituciones no especializadas en el tema. En términos metodológicos, la evaluación distingue tres planos diferentes: la evaluación programática, la evaluación institucional y el uso de recursos (análisis del gasto público en juventud. Sustantivamente, el autor concluye que los impactos logrados hasta el momento han sido marginales (no se ha logrado mejorar las condiciones de vida de los jóvenes ni su participación en la sociedad y ello ha ocurrido por las limitaciones de las propias estrategias vigentes (sectoriales, universales, centralizadas, burocráticas, paternalistas, etc. Seguidamente, propone un enfoque alternativo al vigente, construido sobre la base de un análisis comparado sobre los enfoques promocionales vigentes en el trabajo con jóvenes, con mujeres y con niños. El eje de las propuestas está centrado en la necesidad de superar los clásicos esfuerzos por construir espacios específicos para la juventud (enfoque que ha contribuido a reforzar el aislamiento social de los jóvenes y de trabajar en la incorporación de un enfoque generacional al conjunto de las políticas públicas (emulando el trabajo de las mujeres centrado en la incorporación de la perspectiva de género. Sustantivamente, el autor propone invertir más y mejor en educación y salud (como claves para el desarrollo de capital humano y capital social, en la inserción laboral (como clave de la integración social de los jóvenes, en la prevención de la violencia (como clave de la convivencia pacífica y en la participación ciudadana (como clave del fortalecimiento

  8. Políticas publicas de juventud en America Latina: de la construcción de espacios especificos, al desarrollo de una perspectiva generacional

    Directory of Open Access Journals (Sweden)

    Ernesto Rodríguez

    2003-01-01

    Full Text Available El artículo revisa esquemáticamente las principales nociones teóricas utilizadas en la investigación comparada sobre el tema y analiza las experiencias desplegadas durante los años noventa en América Latina en el terreno de las políticas públicas de juventud, distinguiendo las explícitas (implementadas por instituciones especializadas en el tema y las implícitas (implementadas por instituciones no especializadas en el tema. En términos metodológicos, la evaluación distingue tres planos diferentes: la evaluación programática, la evaluación institucional y el uso de recursos (análisis del gasto público en juventud. Sustantivamente, el autor concluye que los impactos logrados hasta el momento han sido marginales (no se ha logrado mejorar las condiciones de vida de los jóvenes ni su participación en la sociedad y ello ha ocurrido por las limitaciones de las propias estrategias vigentes (sectoriales, universales, centralizadas, burocráticas, paternalistas, etc. Seguidamente, propone un enfoque alternativo al vigente, construido sobre la base de un análisis comparado sobre los enfoques promocionales vigentes en el trabajo con jóvenes, con mujeres y con niños. El eje de las propuestas está centrado en la necesidad de superar los clásicos esfuerzos por construir espacios específicos para la juventud (enfoque que ha contribuido a reforzar el aislamiento social de los jóvenes y de trabajar en la incorporación de un enfoque generacional al conjunto de las políticas públicas (emulando el trabajo de las mujeres centrado en la incorporación de la perspectiva de género. Sustantivamente, el autor propone invertir más y mejor en educación y salud (como claves para el desarrollo de capital humano y capital social, en la inserción laboral (como clave de la integración social de los jóvenes, en la prevención de la violencia (como clave de la convivencia pacífica y en la participación ciudadana (como clave del fortalecimiento

  9. Molecular detection of tick-borne pathogens in cattle from Southwestern Ethiopia.

    Directory of Open Access Journals (Sweden)

    Zerihun Hailemariam

    Full Text Available Tick-borne diseases (TBDs cause significant losses among livestock and impact the livelihoods of resource-poor farming communities worldwide. In Ethiopia, detailed studies on the epidemiology of tick-borne pathogens (TBPs in cattle using sensitive molecular detection methods are scarce. The objective of this study was to determine the prevalence and species composition of bovine TBPs of veterinary significance in local cattle populations. A comprehensive cross-sectional epidemiological study was conducted in cattle populations of Illubabor zone in Southwestern Ethiopia from June to August 2013. For this purpose, blood samples were collected from 392 cattle. A combination of polymerase chain reaction (PCR and a Reverse Line Blot (RLB hybridization assay was employed for the detection of TBPs in these samples. The PCR/RLB results of the 392 blood samples indicated a high overall prevalence of 96.9% for TBPs, including Theileria mutans (66.1%, Theileria orientalis (51.8%, Anaplasma sp. Omatjenne (25.5%, Anaplasma marginale (14.5%, Babesia bigemina (14.0% and Theileria velifera (13.0% and minor occurrences of Ehrlichia ruminantium (0.5% and Ehrlichia minasensis (0.26%. Moreover, three novel Anaplasma genotypes were detected in bovine blood samples. A phylogenetic analysis revealed that they most likely represent three, but at least two, new species. The prevalence of the three novel Anaplasma species, preliminary designated as Anaplasma sp. Hadesa, Anaplasma sp. Saso and Anaplasma sp. Dedessa, was 12.5%, 14.3% and 5.6%, respectively. Overall, a total of 227 cattle (57.9% were found to be co-infected with two or more TBPs simultaneously and 86 different species combinations were observed. The findings show a very high burden of infection of cattle with TBPs in Ethiopia. The high frequency of co-infections suggests that clinical manifestations might be complex. Further research is required to determine the pathogenicity, host cell types and vector of

  10. Morfogénesis de la fase sexual de seis especies mexicanas del género Dryopteris (Dryopteridaceae: Parte II

    Directory of Open Access Journals (Sweden)

    Blanca Pérez-García

    2001-03-01

    Full Text Available Se describe y se compara la morfogénesis de la fase sexual de seis especies mexicanas de Dryopteris. Las esporas de todas las especies estudiadas son monoletes y elipsoidales, la perina es plegada, de color pardo claro a pardo obscuro, su superficie es rugosa y de contornos tuberculados. El patrón de germinación es tipo Vittaria y el desarrollo protálico es tipo Aspidium. Los gametangios son del tipo característicos de los helechos leptosporangiados. Se desarrollaron esporofitos en cinco de las seis especies y solamente en D. pseudo-filix-mas es de origen apogámico (80 días. Se hace un análisis comparativo de las características gametofíticas presentes en las 12 especies mexicanas del género y se concluye que el tipo de germinación Vittaria y el patrón de desarrollo protálico tipo Aspidium y gametofitos con tricomas unicelulares, capitados marginales y superficiales, de aspecto irregular, son características que le dan unidad y caracterizan a los géneros que conforman la familia Dryopteridaceae (Moran, 1995 a excepción del género Didymochlaena.The development of the sexual phase of six Mexican species of Dryopteris is described and compared. Spores of all studied species are monolete, ellipsoid and have a rugose surface; the perine is folded, brown to dark brown, with a tubercled outline. Germination pattern is of the Vittaria-type and the development pattern of the prothallia is of the Aspidium-type. Gametangia are of the common type for the leptosporangiate advanced ferns. First leaves of the sporophytes appear 258-265 after sowing and apparently in Dryopteris pseudo-filix-mas the sporophyte have an apogamic origin (80 days. To make a comparative analysis of gametophytic characteristics in the twelve Mexican species and conclude of germination is of the Vittaria-type and development pattern prothallial is of the Aspidium-type, and unicelular trichomes on margin and superficial gametophytic to yield irregular aspect are

  11. Relación del desarrollo cognitivo con el clima familiar y el estrés de la crianza Relationship of the cognitive development with the family clime and stress of the childrearing

    Directory of Open Access Journals (Sweden)

    José Ángel Vera Noriega

    2005-12-01

    Full Text Available Se llevo a cabo un estudio con 120 familias en pobreza extrema de las zonas marginales de Hermosillo, Sonora México. Madres de 32 años en promedio respondieron a una escala de funcionamiento familiar, estrés de la crianza y sus niños fueron medidos en desarrollo cognitivo. El objetivo fue evaluar las diferencias significativas entre los tres tipos de familias en su desarrollo cognitivo, el estrés de la crianza y el clima familiar. Se clasificaron las familias en base a la medida de clima familiar con un análisis de conglomerados (clusters. Los resultados indican: a tres tipos de climas, que etiquetamos como, disciplinado, cohesionado y sin orientación; b clima sin orientación se asocia a una percepción negativa del niño y de restricciones por la maternidad y presentan las medias mas bajas de desarrollo cognitivo; c el clima cohesivo se asocia con menos estrés en la madre por la crianza y los puntajes mas alto de desarrollo cognitivo.A study was performed over 120 families located in the marginal areas of Hermosillo, Sonora, Mexico. Mothers whose age averaged 32 years old responded to a scale of family performance and childrearing stress; their children were measured throughout cognitive development. This study was aimed to evaluate significant differences with regards to cognitive development, child-rearing stress and family environment among the three types of family. The families were classified based on a measurement of family environment with a cluster analysis. Consequently, the results indicate the following: a Three different types of environment, which were labeled as disciplined, in harmony and without direction; b the environment without direction becomes associated to a negative perception of the child and motherhood restrictions, resulting with the lowest average of cognitive development, thus; c the cohesive environment becomes associated with a lower level of stress in the mother induced by child-rearing and with the

  12. Una estrategia pedagógica para la enseñanza integrada del Español en el segundo ciclo de la Educación General Básica

    Directory of Open Access Journals (Sweden)

    Mireya Barboza-Navarro

    2011-10-01

    Full Text Available Recibido 05 de mayo de 2010 • Aceptado 31 de agosto de 2010 • Corregido 27 de junio de 2011   La enseñanza de la lengua debe constituirse en uno de los objetivos prioritarios del sistema educativo costarricense, en consideración a su papel como herramienta de comunicación y desarrollo del pensamiento. Sin lenguaje no se puede acceder a los demás conocimientos disciplinares del currículo escolar. Una experiencia exitosa desarrollada hace algunos años con estudiantes de segundo ciclo se constituyó en la base para el diseño y ejecución de una actividad de desarrollo profesional que se implementó con el objetivo de dar a conocer, a un grupo de docentes de instituciones públicas, la estrategia integradora, previamente adaptada a los requerimientos ministeriales y a la normativa nacional vigente. El estudio se desarrolla en el marco del paradigma cualitativo y se contempla, dentro de este enfoque, la utilización de la investigación-acción y de la sistematización. Para la participación en la actividad o curso se seleccionó una muestra intencional, por factor de conveniencia, en la cual se da a conocer la estrategia que luego sería replicada con un grupo de estudiantes de zonas urbano marginales. Como técnicas se contemplaron la revisión bibliográfica, el análisis de los programas de estudio y de las normas reguladoras ministeriales, la aplicación de una entrevista a profundidad, las reflexiones de los participantes del curso contenidas en un portafolio y las del grupo de estudiantes con quienes se aplicó la estrategia.Se analizó la información teórica y reguladora mediante una triangulación, además de las apreciaciones y reflexiones de docentes y estudiantes. Se concluye sobre la necesidad de considerar un enfoque comunicativo en la enseñanza del idioma y se recomienda la estrategia desarrollada en los ambientes áulicos costarricenses que se ofrece en este artículo.

  13. El chile poblano criollo en la cultura alimentaria del Alto Atoyac

    Directory of Open Access Journals (Sweden)

    Luis Joaquín Pérez Carrasco

    2017-01-01

    Full Text Available El chile poblano criollo producido en la re-gión Alto Atoyac en Puebla, forma parte de la cultura alimenticia de la población, junto con el maíz y el frijol. Ya sea en fresco o en seco es un componente fundamental en muy diver-sos platillos como: el mole poblano, los chiles en nogada, las rajas con huevo, por mencio-nar algunos. El objetivo del trabajo fue el en-tender las razones sociales y culturales de lo planteado e identificar la problemática del cultivo de chile poblano criollo y los factores que favorecen que los productores persistan en su cultivo en la región. Metodología. Se realizaron entrevistas estructuradas, siguien-do el método de muestreo por “bola de nieve” (Snowball, empleado frecuentemente en es-tudios con poblaciones marginales. Resulta-dos. El sistema de producción predominante en el Alto Atoyac, es el chile poblano criollo intercalado en árboles frutales, con superficies de siembra igual o menor a 100 m2, estrategia usada por los productores para diversificar el riesgo de las enfermedades del cultivo y con ello asegurar la sobrevivencia de sus tradicio-nes culinarias y la permanencia de su semilla con sus propias características. Limitaciones. El trabajo de investigación no pudo abarcar el rendimiento de chile poblano en la región y del perfil del productor. Conclusiones. El chi-le poblano criollo en el Alto Atoyac, se siem-bra en superficies pequeñas y condiciones de temporal, intercalado en árboles frutales y es afectado por la enfermedad pudrición radical o secadera. El productor continúa sembrando su semilla de chile poblano criollo, como estra-tegia para conservar sus tradiciones en la elabo-ración de los alimentos y mitigar en lo posible los daños ocasionados por las enfermedades.

  14. PULSANDO LA CUESTIÓN SOBRE LA VIVIENDA Y EL HÁBITAT / Pressing the housing and habitat question

    Directory of Open Access Journals (Sweden)

    Rosa María Añón Abajas

    2013-11-01

    Full Text Available RESUMEN En la actualidad es reconocible una alarmante situación en lo relativo al problema de la vivienda. No solo en el mundo subdesarrollado, sino también en los contextos que años atrás habían alcanzado un estado de bienestar bien definido, proliferan situaciones de infravivienda, como si hubiesen quedado borrados todos los años empeñados en alcanzarlo. En estas circunstancias, el Consejo Editorial de “proyecto, progreso, arquitectura” consideró necesario dedicar un número a pulsar la cuestión sobre la vivienda y el hábitat. Cuestiones como los hábitats marginales, la inclusión de la participación ciudadana en los procesos de producción del hábitat, o la revisión de los valores vigentes de los logros pasados inexplicablemente olvidados, motivaron el lanzamiento de una convocatoria que ha logrado una alta participación. Desde esta editorial se presentan los artículos seleccionados para cristalizar el noveno número, valorando las aportaciones fundamentales que cada uno ofrece y justificando su puesto en el orden resultante.SUMMARY today an alarming situation can be observed, regarding the housing problem. Substandard housing conditions now proliferate, not only in the developing world, but also where a well-defined state of well-being had been reached years ago. It is as if, every year that had been spent achieving that state has been erased. Under these circumstances, the Editorial Board of “proyecto, progreso, arquitectura” have considered it necessary to dedicate an issue to press home the housing and habitat question. Marginal habitats, the inclusion of citizen participation in the habitat production processes, and the review of the current values of the inexplicably forgotten past achievements, are matters that have motivated the launch of a call which has achieved a high level of participation. The selected articles are presented in this editorial to crystallize the ninth issue, assessing the fundamental

  15. CAMBIOS EN LA DISTRIBUCIÓN DEL INGRESO FAMILIAR EN COSTA RICA DURANTE LA PRIMERA DÉCADA DEL SIGLO XXI

    Directory of Open Access Journals (Sweden)

    Juan Diego Trejos S.

    2013-03-01

    Full Text Available Costa Rica no sigue durante la primera década del siglo XXI la tendencia observada para la mayoría de los países de la región, que experimentan una reducción de la desigualdad en la distribución del ingreso familiar per cápita. Durante la primera mitad de esa década sí se produce una reducción en la desigualdad pero se revierte en el quinquenio siguiente. Para estudiar esos cambios se utiliza una desagregación de la desigualdad, medida por el coeficiente de Gini, por fuentes de ingreso, usando 12 fuentes distintas. Los resultados señalan que la reducción de la desigualdad en la primera mitad de la década, se da en un contexto de crecimiento económico pero estancamiento de los ingresos reales, que se concentra en los estratos de mayores ingresos. Esto implica que la reducción de la desigualdad se concentró en la reducción de los ingresos reales de las fuentes con mayor poder concentrador (elasticidades Gini ingreso mayor a la unidad y cambios marginales positivos, como lo son los ingresos laborales de los más calificados, las rentas del capital y las pensiones contributivas. En la segunda mitad de la década, el repunte de la desigualdad se produce por un aumento significativo de los ingresos reales de todas las fuentes, pero principalmente de las que tienen un impacto concentrador que no puede ser neutralizado por la expansión de las fuentes que reducen la desigualdad (ingresos laborales de los trabajadores no calificados y las transferencias estatales. Los resultados sugieren la necesidad de aplicar una política de salarios mínimos más activa, reforzar los programas de apoyo productivo para el sector informal, ampliar la oferta de trabajadores más calificados a través de la política educativa y ampliar las transferencias monetarias hacia los más pobres, lo que requiere de una reforma tributaria.

  16. Nouvelle interpretation des echinodermes de Collado de Tosas (Gerona, Espagne

    Directory of Open Access Journals (Sweden)

    Meléndez, B.

    1988-12-01

    Full Text Available The revision of the echinoderms from Collado de Tosas, based on the original specimens and additional material, is undertaken. The study shows that the initial attribution to the genus Trochocystites belonging to the Homalozoa Cincta has been induced by the tectonic deformation and the presence of recristallization lamellae in the natural molds. New observations allow to conclude without ambiguity that these skeletal elements are isolated columnals with a broad lumen, of crinoids. The presence of Cambrian in the section, established exclusively on the initial determinations, cannot longer be maintained.Los fósiles de Equinodermos del Collado de Tosas fueron dados a conocer en 1911 por F. Azpeitia que los atribuyó a Trochocystites bohemicus Bar. Posteriormente, M. Faura (1912 hizo notar la presencia de fósiles ordovícicos en esta misma localidad, y propuso una interpretación estratigráfica que incluía un contacto anómalo con el supuesto Cámbrico determinado por los Trochocystites. Todo ello fue revisado por B. Meléndez en 1954, que creyó poder confirmar que los fósiles en cuestión (fig. 1, eran realmente Carpoideos. El estudio de nuevo material recogido in situ, así como de los ejemplares conservados en el Museo del Seminario Conciliar de Barcelona, nos ha llevado a la conclusión de que la atribución inicial de estos discutidos fósiles al género Trochocystites, fue debida a la deformación tectónica que les ha dado forma ovalada, y a la presencia de láminas de recristalización, en disposición radial, en los moldes (fig. 6, lám. 1, que dan la falsa apariencia de placas marginales. Las nuevas observaciones nos permiten afirmar que estos fósiles son placas columnales, aisladas, probablemente del pedúnculo de Crinoides, con cavidad central muy amplia (Iám. 1, figs. 15, aunque eventualmente, también podrían haber pertenecido a Cystideos. En consecuencia, la presencia del Cámbrico en esta localidad, basada únicamente en la

  17. Caracterización palinológica y viabilidad polínica de Physalis peruviana L. y Physalis philadelphica Lam.

    Directory of Open Access Journals (Sweden)

    Lagos Tulio César

    2005-06-01

    Full Text Available

    Physalis peruviana L. y P. philadelphica Lam. son dos solanáceas de importancia económica para Colombia y México. Existen grandes vacíos en el conocimiento de la palinología y viabilidad polínica de estas dos especies. Por lo tanto, el objetivo del presente trabajo fue caracterizar su grano de polen y determinar su viabilidad bajo condiciones con­trastantes de climas frío y cálido. La caracterización del polen se hizo a través de la técnica de acetólisis (en microscopía de luz y por microscopía electrónica de barrido. Se determinaron variables como el eje polar, el diámetro ecuatorial, el número, posición y carácter de las aberturas (NPC, lado de apocolpo/apoporo, forma polínica, contorno en vista polar y en vista ecuatorial, tipos de área polar y de abertura, y el tipo polínico. Estas variables permitieron descri­bir y caracterizar el grano de polen de los genotipos estudiados. Con el empleo de técnicas de fijación de flores en antesis y tinción con acetocarmín, se hizo un análisis de la viabilidad polínica bajo microscopía de luz. Las dos especies presentan un grano de po­len zono-tricolporado, de tamaño mediano en P. pe­ruviana y pequeño en P. philadelphica. Los ambientes marginales reducen la viabilidad del polen pero no afectan su fertilidad.

  18. VALORACIÓN DE LA CIDRA PAPA (Sechium edule COMO ALTERNATIVA DE ALIMENTACIÓN Y RECUPERACIÓN DE VÍNCULOS CON EL CAMPO VALORAÇÃO DA Sechium edule COMO ALTERNATIVA DE ALIMENTAÇÃO E RECUPERAÇÃO DOS VINCULOS COM O CAMPO VALUATION OF Sechium edule AS AN ALIMENTARY ALTERNATIVE AND RECUPERATION OF BONDS TO THE COUNTRY

    Directory of Open Access Journals (Sweden)

    CONSUELO MONTES R

    2011-12-01

    Full Text Available El objetivo de la investigación, fue valorar la cidra papa (Sechium edule como alternativa de alimentación para familias en desplazamiento que viven en asentamientos urbano marginales de Popayán, con el fin de contribuir a la recuperación del conocimiento tradicional asociado al uso y manejo, identificar ecotipos, identificar el significado sociocultural como alternativa para mantener los vínculos con el campo, evaluar productividad y posibilidades de manejo en espacios urbano marginales. El proceso se desarrolló mediante 'investigación participativa', donde los actores participaron en dinámicas recreativas, talleres de sensibilización y socialización, giras de intercambio de saberes, de semillas y generación de conocimientos, lo que permitió obtener información, y la apropiación del proceso. Se definieron como áreas de estudio 3 comunas de Popayán, se seleccionaron 4 asentamientos, se aplicaron 116 encuestas, se realizaron visitas mensuales por asentamiento, entablando diálogos informales con las familias participantes. Se conocieron las posibilidades de manejo de la planta, se incentivó la siembra de la misma aplicando el concepto de agricultura urbana donde se asoció la planta con otras hortalizas. Se pudo constatar que plantas como la cidra se adaptan a las condiciones que ofrecen los asentamientos y que son fuente alternativa para la alimentación de estas poblaciones, se fomentó el consumo de especies sub utilizadas, se hizo intercambio de saberes y se generaron espacios para motivar la conservación de ecotipos y especies de plantas como la cidra, que pueden resistir a las condiciones de marginalidad.0 objetivo da pesquisa, foi avaliar a cidra papa (Sechium edule como alternativa de alimentação para familias deslocadas que moram nos perímetros da cidade de Popayán, com o proposito de contribuir na recuperação do conhecimento tradicional relacionado com a utilização e manejo, identificação de ecotipos e o

  19. Mesure et retroaction sur un qubit multi-niveaux en electrodynamique quantique en circuit non lineair

    Science.gov (United States)

    Boissonneault, Maxime

    intra-resonateur autour de sa valeur d'equilibre. Ces fluctuations sont causees par la compression du champ electromagnetique due a la non-linearite du resonateur, et l'observation de leur effet via la spectroscopie d'un qubit constitue une premiere. Suite aux succes quantitatifs du modele reduit, je montre que deux regimes de parametres ameliorent marginalement la mesure dispersive d'un qubit avec un resonateur lineaire, et significativement une mesure par bifurcation avec un resonateur non lineaire. J'explique le fonctionnement d'une mesure de qubit dans un resonateur lineaire developpee par une equipe experimentale de l'Universite de Yale. Cette mesure, qui utilise les non-linearites induites par le qubit, a une haute fidelite, mais utilise une tres haute puissance et est destructrice. Dans tous ces cas, la structure multi-niveaux du qubit s'avere cruciale pour la mesure. En suggerant des facons d'ameliorer la mesure de qubits supraconducteurs, et en decrivant quantitativement la physique d'un systeme a plusieurs niveaux couple a un resonateur non lineaire excite, les resultats presentes dans cette these sont pertinents autant pour l'utilisation de l'architecture d'electrodynamique quantique en circuit pour l'informatique quantique que pour l'optique quantique. Mots-cles: electrodynamique quantique en circuit, informatique quantique, mesure, qubit supraconducteur, transmon, non-linearite Kerr

  20. PÓCIMAS DE BRUJA EN LA LITERATURA DEL SIGLO DE ORO ESPAÑOL: LA OTRA CARA DE LOS AGENTES TERAPÉUTICOS Y PSICOTRÓPICOS

    Directory of Open Access Journals (Sweden)

    Francisco López-Muñoz

    2017-11-01

    Full Text Available Los textos literarios del Siglo de Oro constituyen una interesante fuente para el estudio de la sociedad española tardorrenacentista y novobarroca, incluyendo sus figuras más marginales. En el presente trabajo, hemos analizado el mundo mágico de brujas y hechiceras desde la perspectiva del uso extraterapéutico de agentes farmacológicos y psicotrópicos, a través de los principales autores áureos, centrándonos, básicamente, en Miguel de Cervantes y Lope de Vega. Se han estudiado los principales agentes empleados en la elaboración de las pócimas venenosas de bruja, destacando las plantas alucinógenas de la familia de las Solanaceae (beleño, mandrágora, belladona, estramonio, solano, eléboro, además de otras, como el acónito, la cicuta, la adelfa, la verbena o la adormidera. Otras sustancias de procedencia animal o mineral también se emplearon en la confección de estos preparados (sapos, arsénico. Finalmente, se han analizado las posibles fuentes documentales en materia científica que pudieron utilizar estos dos destacados literatos, como el Dioscórides comentado por Andrés Laguna en ambos casos, y la Historia Natural de Plinio, comentada por Francisco Hernández y Gerónimo de Huerta, y el opúsculo Il Sapere Util’e Delettevole de Constantino Castriota, en el caso particular de Lope de Vega. WITCHES’ POTIONS IN THE LITERATURE OF THE SPANISH GOLDEN AGE: THE OTHER SIDE OF THE THERAPEUTIC AND PSYCHOTROPIC AGENTS ABSTRACT The literary texts of the Golden Age are an interesting source for the study of Spanish late Renaissance and early Baroque society, including their most marginal figures. In the present work, we have analyzed the magical world of witches and sorceresses from the perspective of extra-therapeutic use of pharmacological and psychotropic substances, through the main golden authors, focusing basically on Miguel de Cervantes and Lope de Vega. The main agents used in the production of witches poisonous potions

  1. Dispepsia funcional: Nuevos conocimientos en la fisiopatogenia con implicaciones terapéuticas Functional dyspepsia: New pathophysiologic knowledge with therapeutic implications

    Directory of Open Access Journals (Sweden)

    Ana C. Hernando-Harder

    2007-08-01

    Full Text Available La dispepsia funcional (DF es un complejo sintomático, heterogéneo y altamente prevalente en la comunidad y en la práctica general. La DF se define como la presencia de síntomas que se piensan originados en la región gastroduodenal, en ausencia de enfermedad orgánica, sistémica o metabólica que pueda explicarlos. Entre los factores fisiopatogénicos se incluyen los trastornos de la acomodación y del vaciamiento gástrico, dismotilidad duodenal, sensibilidad aumentada, factores psicosociales y una asociación con un estado postinfeccioso. Se han hecho numerosos esfuerzos para aumentar los conocimientos en la etiopatogenia del síndrome, incluyendo nuevos aspectos moleculares y genéticos. Sin embargo, el mecanismo etiopatogénico exacto que causa los síntomas en un paciente individual sigue siendo difícil de identificar. Los nuevos criterios de Roma III redefinen y subclasifican la DF basándose en sus síntomas principales, lo cual es de gran valor para la investigación, el desarrollo y el control estandarizados de nuevas estrategias terapéuticas así como la formulación de recomendaciones para la práctica clínica. Las modalidades terapéuticas que se han empleado incluyen: modificaciones dietéticas, agentes farmacológicos dirigidos a actuar sobre distintos blancos dentro del aparato gastrointestinal, del sistema nervioso central y periférico, y terapias psicológicas incluyendo la hipnoterapia. Desafortunadamente, hasta la fecha, todas estas terapias han rendido solamente resultados marginales. Después de excluir enfermedad orgánica, es esencial que el paciente esté informado sobre la naturaleza y el pronóstico benignos de su enfermedad, y esto puede ser, a veces, la inversión más provechosa tanto para el paciente como para su médico.Functional dyspepsia (FD is a heterogeneous, highly prevalent symptom complex in the community and general practice. FD is defined as the presence of symptoms considered as originated in

  2. Edad y crecimiento del híbrido de tilapia Oreochromis niloticus x Oreochromis aureus (Perciformes: Cichlidae en la represa “Zimapán” Hidalgo, México

    Directory of Open Access Journals (Sweden)

    M. A. Gómez-Ponce

    2011-06-01

    Full Text Available La edad y crecimiento de la tilapia Oreochromis niloticus x Oreochromis aureus fueron determinados por medio de la lectura de escamas. Un total de 382 individuos fueron capturados mediante el uso de redes agalleras y atarrayas. Ocho recolectas mensuales se llevaron a cabo entre septiembre 2003-mayo 2004; se registraron los datos de longitud estándar en cm. (Le, el peso total en g (Pt y se obtuvieron muestras de escamas para registrar el largo de la escama en mm. (Lesc y el número de anillos de crecimiento formados. Las tallas y pesos de recolecta variaron entre 38 a 232mm (Le y de 8.7 a 311.9g de peso total (Pt respectivamente. El recuento de los anillos anuales en escamas, permitió establecer cuatro grupos de edad, siendo el grupo de edad 2 el más representativo, con un 34.3% de la población muestreada. El cálculo de los incrementos marginales del crecimiento mensual de las escamas, sugirió la formación de dos anillos, uno de ellos se forma en los meses de noviembre-enero y otro en los meses de abril-mayo, los cuales coinciden con la época de bajas temperaturas y de madurez gonádica respectivamente. Los parámetros de crecimiento quedaron establecidos en: L∞=281.1mm, W∞=877.1g, K=0.33 y T0=0.88/año. Las curvas de crecimiento en longitud y peso se describieron mediante las ecuaciones de von Bertalanffy: Le=28.11 [1- e-0.33(t+0.88] y Pt=877.17 [1-e-0.33(t+0.88]³. Finalmente, se concluyó que los peces que se explotan en la represa mediante captura comercial presentan entre un año y año y medio de edad.Age and growth of the hybrid tilapia Oreochromis niloticus x Oreochromis aureus (Perciformes: Cichlidae in the dam “Zimapan” Mexico. Studies on age and growth in fishes are essential to establish models on population dynamics. The previos issues were determined in this study by scale growth analyses. Between September 2003 and May 2004, 382 organisms were captured using gill and atarraya nets. Eight samples were developed every

  3. Tatuajes y "piercing" Tattoos and piercing

    Directory of Open Access Journals (Sweden)

    L E Valle

    2006-03-01

    Full Text Available A pesar de estar en el siglo XXI se ha retomado el lenguaje con códigos de comunicación arcaicos. Los jóvenes forman su identidad mediante la interacción con sus pares y los tatuajes y "piercing" tienen sus propios códigos, que son interpretados por el grupo que los lleva. Actualmente los tatuajes y los "piercing" encuentran su lugar predominante en la población adolescente, donde se han reinstalado por ser "moda" y generalmente se aceptan por estar generalizados. Asimismo los observamos en poblaciones marginales: de drogadictos y carcelarias. Realizarse un tatuaje y/o "piercing" implica ciertos riesgos, entre los que podemos mencionar la transmisión de infecciones que pueden ser localizadas en las zonas del tatuaje y/o "piercing"; y/o generalizadas como las virósicas algunas de las cuales conllevan riesgos de salud como el virus del HIV, de las hepatitis A,B,C. Pueden observarse también reacciones alérgicas, de hipersensibilidad, liquenoides, granulomatosas y varias como cicatrices hipertróficas y queloides; asimismo desencadenar un primer episodio de psoriasis, lupus, etc. Dentro de las recomendaciones para informar a la población deberíamos incluir: que las regiones del cuerpo más riesgosas para la realización de los mismos (que debieran evitarse son aquellas que asientan en cabeza (incluyendo boca, nariz, cuello y órganos genitales. También es importante tener la vacunación antitetánica actualizada, considerar las condiciones de higiene del local donde se va a asistir y el tipo de material a utilizar, debiendo ser en lo posible material descartable. Los cuidados durante los primeros días post práctica son: mantener la zona limpia y seca, baños cortos, secarse sin frotado y no exponerse al sol por tres o cuatro meses. Asimismo es aconsejable ante cualquier reacción concurrir a la consulta profesional.In spite of being in the XXI century, several archaic codes of communication language have been restablished. Young

  4. Electricity to natural gas competition under customer-side technological change: a marginal cost pricing analysis; Cambiamento tecnologico a valle del contatore e concorrenza fra elettricita' e gas naturale

    Energy Technology Data Exchange (ETDEWEB)

    Gulli' , Francesco [Bocconi Univ., Milan (Italy). Iefe

    2004-07-01

    of specific technological solutions. [Italian] Questo articolo si prefigge di valutare l'impatto del cambiamento tecnologico (a valle del contatore) nell'industria energetica a rete (elettricita' e gas naturale). Le prestazioni degli impianti di generazione elettrica di piccola taglia e delle pompe di calore elettriche sono significamente migliorate negli ultimi dieci anni, rendendo possibile (o maggiormente conveniente) due traiettorie tecnologiche alternative: il sistema basato esclusivamente sull'utilizzo del gas naturale, possibile grazie all'utilizzo di piccoli impianti di cogenerazione che prefigurerebbe una forte decentrazione dell'offerta energetica; il sistema basato esclusivamente (o quasi) sull'utilizzo dell'elettricita', che invece, grazie all'utilizzo della pompa di calore reversibile, accentuerebbe le caratteristiche di centralizzazione dell'offerta. L'articolo confronta le due alternative sulla base dei corrispondenti costi sociali, somma dei costi interni (privati) e dei costi esterni (di natura prevalentemente ambientale), e conclude che, in termini paradigmatici, il sistema totalmente elettrico risulta preferibile ad una forte decentralizzazione basata sulla diffusione della cosiddetta decentrazione distribuita. Il lavoro tiene opportunamente conto della forte incertezza in merito alle stime dei costi esterni (ed in particolare del costo marginale delle emissioni di gas-serra) e suggerisce che l'attuale grande interesse nello sviluppo della generazione distribuita potrebbe essere attribuibile alla presenza di distorsioni di mercato.

  5. Le Dr Nguyễn Văn Luyện et ses confrères Nguyễn Văn Luyện and his Colleagues. Vietnamese Private Medicine in Colonial Vietnam

    Directory of Open Access Journals (Sweden)

    Laurence Monnais

    2010-10-01

    Full Text Available Constituant une première histoire de la médecine libérale indigène dans le Viêt Nam sous domination française, cet article revient sur certains acquis historiographiques et propose de nouvelles avenues pour enrichir la recherche sur l’histoire de la santé en contexte colonial. Il s’interroge d’abord sur les conditions et les motifs qui ont permis l’existence de cette communauté médicale a priori marginale ; il en établit ensuite les principales caractéristiques en termes de formation, de parcours professionnel et d’engagement médico-sanitaire et plus largement social. Ces médecins privés apparaissent alors comme des agents actifs, non seulement compétents mais inventifs, de la médicalisation coloniale dans l’entre-deux guerres, susceptibles d’avoir améliorer de façon substantielle la santé de la population colonisée. Pour donner corps et vie à cette médecine libérale, plusieurs de ses acteurs sont évoqués et en particulier le Dr Nguyễn Văn Luyện (1898-1946. Ces fragments biographiques permettent de révéler la polyvalence, l’expertise, le dynamisme et les engagements en santé publique et en matière de soins d’un nouveau groupe social attentif aux attentes de sa communauté, autant de manifestations probantes en même temps d’une demande en santé en mutation.This paper constitutes the first account on the history of Vietnamese private medical practice during the French domination over Indochina. It aims to revisit multiple historiographies and at the same time to suggest new ways of writing the history of colonial health and health care. First, I analyse the legal and political context in which Vietnamese private doctors could emerge as a professional and as a social group. Then I insist on the main characteristics of this medical community in terms of training, professional life and scientific and social activities. These Vietnamese doctors would appear as active agents and inventive

  6. Galería de asustaniños de carne y hueso. Miedo y fascinación en torno a las categorías de la anormalidad en Andalucía

    Directory of Open Access Journals (Sweden)

    del Campo Tejedor, Alberto

    2015-12-01

    Full Text Available Research into bogeymen conducted in Andalusia in Spain reveals that children have not only been afraid of the Sacamantecas [Fat-extractor], the Hombre del saco [Sack Man] and other famous fictional characters. Their progenitors have also used real individuals to scare them into obedience. The social production of bogeymen operates through stereotypical categorization of marginalized individuals that fall into ‘abnormality’ archetypes: the drunkard, the drug addict, the criminal, the madman, the witch and the gypsy, but also the cripple, the beggar, the vagabond and even the peddler. Analysing the memories of those who were children between the 1930s and the end of the 20th century, this paper connects discourse on bogeymen with the symbolic universe regarding the categories of ‘abnormal’ individuals that appear in legends, stories, superstitions, false rumours and other narratives, spanning the divide between fiction and reality. In the process, we seek to understand the ambivalent images constructed around those who are considered anomalous, deviant, strange, monstrous, perverted and dangerous, and therefore censurable and fearsome, but who also are familiar and live on the sidelines of our daily lives, engendering not only rejection, but also curiosity and fascination.Una investigación llevada a cabo en Andalucía sobre los asustaniños revela que los menores no solo han temido al Sacamantecas, al Hombre del saco y otros personajes ficticios, sino que sus progenitores utilizaron a individuos de carne y hueso para incitarles a la obediencia, a través del miedo. La producción social de asustaniños reales se asienta sobre la categorización estereotípica de ciertos individuos marginales, bajo unos pocos arquetipos de anormalidad: el borracho, el drogadicto, el delincuente, el loco, la bruja, el gitano, pero también el lisiado, el mendigo, el vagabundo, incluso el vendedor ambulante. Centrándonos en el recuerdo de los que fueron ni

  7. Nuevos lenguajes fílmicos en la vieja Europa: el cine social de los hermanos Dardenne

    Directory of Open Access Journals (Sweden)

    Margarita Campillo Díaz

    2013-04-01

    Full Text Available Las películas de los hermanos Dardenne son documentos vivos, poblados de perso-najes marginales y excluidos, que ofrecen enormes posibilidades para reflexionar desde múltiples espacios educativos. Su obra presenta un reconocido estilo personal autoral, tanto en la forma como en las historias que aborda, susceptible de análisis y profundización. Adentrarse en ella y bucear su estilo narrativo es el objetivo de este estudio. Para materializarlo se esboza, al inicio, la tradición europea creadora de nuevas formas de expresión fílmica a lo largo del siglo XX -desde el naturalismo poético francés hasta llegar al movimiento nórdico “Dogma 95”- para explorar, más detenidamente, a continuación la produc-ción de los directores belgas: siguiendo un planteamiento evolutivo que transita desde sus primeros trabajos que antecederán a “La promesa” (1996 hasta su último film, “El niño de la bicicleta”( 2011, en este texto se analizan las obras de ficción de los hermanos y el estilo característico que pre-domina en ellas. Planos cortos, que trans-miten su propia vida interior, y de larga duración para que se pueda seguir atentamente la acción, filmación continua-da en el mismo orden programado en el guión, ausencia de música intrusiva, imá-genes despojadas de toda clase de buenos sentimientos… el sello personal de los Dardenne abre cauces novedosos de expresión comunicativa tan poderosos como creativos.The movies of the Dardenne brothers are living documents filled with marginalized characters that offer a great opportunity to think and reflect from different educational perspectives. Their work has a very personal composition; for being ahead of its time and for the depth of its analysis. With this essay, we try to explore and dive deep in their narrative style. For that, we first draft their influences taken from the European tradition with its new ways of filmic expressions, throughout the XX century: from the poetic

  8. Costes, Beneficios y factores Ligados a la Política de Divulgación de Información Financiera

    Directory of Open Access Journals (Sweden)

    Manuel Larrán Jorge

    2004-12-01

    Full Text Available El objetivo del presente trabajo, basado en una revisión de la literatura empírica más relevante, es el analizar los costes y beneficios asociados a las políticas de divulgación de información financiera, así como los factores que puedan estar más relacionados con la extensión de la información publicada por las empresas. Entre los costes asociados a la oferta informativa se encontrarían los relativos a su confección, publicación y auditoria; así como otra serie de costes indirectos, más difíciles de medir, tales como costes legales, costes políticos y costes asociados a la pérdida de ventaja competitiva. Por otra parte, los beneficios de una mayor cantidad de información se pueden ligar a una reducción de las percepciones de incertidumbre futura y, por tanto, pueden llevar a la reducción del coste de capital, mejora de la liquidez y de la credibilidad de la empresa, así como incrementar la capacidad de obtención de fondos externos. De todas las variables analizadas, el factor tamaño es el que más se repite en los trabajos empíricos como explicativo de las políticas de divulgación más proactivas. Lo anterior no es de extrañar, habida cuenta que conforme mayor sea el tamaño, mayores serán los costes de agencia, costes políticos y costes legales, así como la presión ejercida por los demandantes de información. Por otra parte, menores, en este caso, serán los costes de pérdida de ventaja competitiva y los costes marginales directos derivados de una mayor cantidad de información divulgada. Por tanto, se pude inferir que en las empresas de mayor dimensión los beneficios derivados de la oferta informativa puedan superar estos costes, y justificar la mayor extensión de la información publicada en estos casos. Igualmente, una vez señaladas algunas debilidades o limitaciones de los estudios analizados, en el trabajo se indican algunas posibles líneas de investigación que se podrían seguir en un futuro y en

  9. Factores influyentes en el rendimiento académico de estudiantes del primer año de medicina

    Directory of Open Access Journals (Sweden)

    Delia Jara

    2008-09-01

    S/. 1 500 (mil quinientos soles mensuales, la vivienda fue propia en 23 (57,5% y alquilada en 17 (42,5%. El lugar de la vivienda fue mayoritariamente en zonas urbano marginales 25 (62,5%, seguido de zona residencial 10 (25%, y en asentamientos humanos 5 (12,5%. Conclusiones: La mayoría de los estudiantes de medicina del primer año de estudios participantes del presente estudio procedía de colegios estatales, carecía de hábitos y estrategias de estudio, tenía autoestima moderada a baja, su nivel socioeconómico fue bajo, residía en zonas urbanomarginales, sin vivienda propia, y algunos tenían afecciones físicas que mermaban su salud; todo lo anterior podría influir en el rendimiento académico bajo que presentaron.

  10. La narrazione dell’azione sociale: spunti dal Trattato di Vilfredo Pareto

    Directory of Open Access Journals (Sweden)

    Ilaria Riccioni

    2017-08-01

    interpreti, la complessità dei rapporti e delle manifestazioni collettive. Lo stesso tipo di schema che intercorre tra la mente umana e la realtà: l’intelletto può organizzare la realtà, ma in ultima analisi non la può contenere in tutta la sua complessità. D’altro canto, la rilettura di Pareto è un’immersione in un coacervo di contingenze dal quale emergono: un’Italia pre-giolittiana, ancora molto provinciale e scandita da ritmi di diversa natura, le esigenze di rinnovamento e di conoscenza del giovane Pareto che si scontra con le logiche clientelari di un paese ancora contadino, dominato dall’ossessione dinastica. In questo senso molta dell’opera Paretiana va letta in parallelo anche con la biografia professionale di quello che poi diventò “l’eremita” di Céligny. Una potente vis polemica, quella del giovane Pareto, accompagnata ad una necessità di precisione e una buona dose di illusioni circa il cambiamento dell’Italietta che sotto i suoi occhi non esita a reiterare schemi sociali e politici autoreferenziali e dominati da un’élite di conoscenze, lasciando al merito l’illusione di una partecipazione marginale e pur sempre collegata alla politica o alle conoscenze degli ambienti borghesi. Il comportamento umano è così scopertamente definito da impulsi ed esigenze soggettive, che però diventano il materiale di osservazione di Pareto al fine di smascherare la finzione, la presunta razionalità guidata da interessi personali e preferenze soggettive.

  11. Política, Ciencia, Ética y Sociedad: su conjunción dialéctica en la experiencia del “Contingente Henry Reeve” Politics, Science, Ethics and Society: their dialectical conjunction in the experience of the "CONTINGENT HENRY REEVE"

    Directory of Open Access Journals (Sweden)

    Nereyda Martínez Suárez

    2006-12-01

    Full Text Available La investigación se centra en la caracterización de la actividad profesional del Contingente Médico Internacional “Henry Reeve”, especializado en situaciones de desastre y graves epidemias, tomando en cuenta el condicionamiento histórico social de la génesis del mismo, su desempeño profesional como parte de la sociedad revolucionaria cubana, así como su repercusión internacional; para lo mismo se realizó un estudio teórico, basado en la aplicación de los métodos históricos, de análisis y síntesis de fuentes documentales. El estudio permitió observar que, los servicios médicos no son únicamente un asunto de formación científica, es un asunto de política y de formación humanista. La posibilidad de su realización está condicionada histórica y socialmente de un modo concreto. La ciencia, ética y sociedad constituyen una unidad histórica que se asienta en un tipo cualitativo de política, por lo que la formación actual y futura de médicos y profesionales de la salud en nuestro país, deberá basarse en las necesidades de los campos, aldeas, barrios marginales y pobres de las ciudades del Tercer Mundo, consolidando los valores humanos necesarios en estos profesionales. Los miembros del Contingente Henry Reeve son portadores de profundos conocimientos científicos, de una fortaleza política, altos valores humanos y principios éticos inconfundibles, demostrados a través de estos años de revolución mediante la atención a nuestro pueblo, el cumplimiento de misiones internacionalistas y la colaboración médica en más de 100 países.This investigation is centred in the characterization of the professional activity of the International Medical Contingent ‘‘Henry Reeves'', specialized in disaster situations and serius epidemics, taking into account, its own social and historical nature, its professional acting as a part of the Cuban Revolutionary Society, as well as its international repercussion. For this reason a

  12. Los renacuajos de los anuros (Amphibia altoandinos de Venezuela: morfología externa y claves

    Directory of Open Access Journals (Sweden)

    Abraham Mijares-Urrutia

    1998-03-01

    Full Text Available Se hizo una revisión de las referencias pertinentes y se examinaron una serie de lotes de renacuajos representativos (al menos una especie por cada género de los anuros altoandinos de Venezuela. Se presentan también una lista de 41 caracteres con algunas ilustraciones explicativas, intentando describir en detalle la morfología externa larvaria de esos anuros. Se propone emplear la medición de ángulos respecto al eje longitudinal del cuerpo para establecer la forma de la punta de la cola y la ubicación del aparato oral. Igualmente, se tomaron 19 medidas para determinar las proporciones morfológicas. Se incluye una clave para identificar a partir exclusi-vamente de caracteres morfológicos externos (presencia/ausencia, tamaño, forma, número, ubicación, etc., los cuales no se modifican (o apenas se modifican ligeramente a lo largo de los estadios de desarrollo larvario más jóvenes e intermedios. Esta clave sirve para identificar los renacuajos al nivel de familia y género de las ranas y sapos que habitan en la región antes mencionada. La clave abarca seis familias y 11 géneros. Adicionalmente, y como un modelo de este trabajo, se describe e ilustra por primera vez el renacuajo de Hyla pelidna, coincidiendo bastante bien con las características larvarias del grupo de H. labialis (fórmula de filas de queratodontes 1/2 o 2/2, papilas marginales en filas múltiples, diastema rostral presente, abertura cloacal diestra y abdominal [separado de la aleta ventral], aletas caudales más anchas que la musculatura caudal a la mitad de su longitud, abertura narinal con un anillo carnoso, liso, no protuberante. Este trabajo representa el primer esfuerzo para compilar en idioma español la morfología larvaria de los anfibios anuros.A literature review and examination of several lots of tadpoles representative of the high Venezuelan Andes species (at least one species per genus allowed identification of 41 useful characters. These are presented

  13. Abordaje de sujetos migrantes y procesos migratorios en libros de texto de Ciencias Sociales. Un análisis de caso

    Directory of Open Access Journals (Sweden)

    María Beatriz Taboada

    2018-01-01

    Full Text Available El presente trabajo recupera avances de la investigación "´Nosotros, los argentinos´: la construcción de la identidad nacional en libros de texto de Ciencias Sociales", en el contexto de la cual hemos analizado el modo en que dicha identidad es construida discursivamente en libros de texto destinados a la enseñanza secundaria, que circulan actualmente en instituciones educativas de la Argentina. Uno de los ejes priorizados en el análisis ha sido la construcción de procesos migratorios vinculados al territorio nacional, con especial atención a sujetos discursivos presentes y desplazamientos territoriales abordados; aspectos que se recuperan en este artículo mediante la selección de un caso específico que forma parte del corpus de la investigación. Para la aproximación propuesta nos hemos posicionado en el análisis crítico del discurso y, desde esa perspectiva, hemos recurrido a herramientas teórico-metodológicas del enfoque histórico del discurso (Wodak, de Cillia, Reisigl y Liebhart, 2009. Desde dicho enfoque entendemos los discursos como prácticas sociales y asumimos que el lenguaje juega un rol fundamental en la estructuración de relaciones de poder en la sociedad. Por ello, proponemos un abordaje de los textos seleccionados que toma en cuenta el modo en que sujetos, relaciones, hechos y procesos son nombrados (estrategias de nominación; los rasgos que se les atribuyen (estrategias de predicación y los argumentos o esquemas argumentativos empleados (estrategias argumentativas. El caso seleccionado responde a una de las tendencias observadas en el corpus general de la investigación para el tratamiento de procesos migratorios, dado que localiza la temática en tiempos lejanos y solo incorpora referencias marginales e imprecisas a la existencia de procesos migratorios en la actualidad. Asimismo, el análisis de las estrategias discursivas empleadas en el libro muestra una esquematización superficial en el abordaje de

  14. VULNERABILIDAD DE LOS NIÑOS DE LA CALLE VULNERABILIDADE DAS CRIANÇAS DE RUA VULNERABILITY OF STREET CHILDREN

    Directory of Open Access Journals (Sweden)

    María Luisa Gómez

    2008-01-01

    Full Text Available Este artículo informa sobre un análisis de 20 entrevistas abiertas, semidirigidas, realizadas a niños de la calle en México D.F., construidas sobre diversos tópicos (Familia, Violencia, Sexualidad, Obtención de Recursos y Adicciones, y considerando dos etapas de su vida (antes de abandonar el hogar y su vida en la calle. Estos grupos se insertan en su entorno en condiciones de vulnerabilidad, en las cuales la satisfacción de las necesidades primarias es el objetivo para la toma de decisiones, por eso la falta de expectativas de futuro. Uno de sus patrones de comportamiento es el consumo de drogas, siendo los solventes los más usuales. El ejercicio de su sexualidad se da en condiciones de inseguridad, por ello son frecuentes los embarazos no deseados y las infecciones genitales. Es este contexto habrá que plantearse la salud reproductiva de estos grupos marginales.Este artigo informa sobre uma análise de 20 entrevistas abertas, semidirigidas, realizadas em crianças de rua na Cidade do México, construídas sobre diversos tópicos (Família, Violência, Sexualidade, Obtenção de Recursos e Drogas, e considerando duas etapas de sua vida (antes de abandonar o lar e sua vida na rua. Estes grupos se inserem no seu entorno em condições de vulnerabilidade, nas quais a satisfação das necessidades primárias é o objetivo para a tomada de decisões, daí a falta de expectativas de futuro. Um de seus padrões de comportamento é o consumo de drogas, sendo os solventes os mais usuais. O exercício de sua sexualidade se dá em condições de insegurança. Por isso são freqüentes as gravidezes não desejadas e as infecções genitais. É neste contexto que haverá de se questionar a saúde reprodutiva destes grupos marginais.This article offers an analysis of 20 semi-directed, open interviews realized with street children in Mexico City, which includes diverse topics (Family, Violence, Sexuality, Obtaining Resources and Addictions and

  15. EFECTOS DE LA REDUCCIÓN DE TARIFAS DE TERMINACIÓN MÓVIL EN EL BIENESTAR EN EL MERCADO DE LAS TELECOMUNICACIONES DE MÉXICO

    Directory of Open Access Journals (Sweden)

    David Harbord

    2013-01-01

    Full Text Available En Europa las tarifas de terminación móvil (TTM están siendo reducidas en mag-nitud para reflejar los costos reales, ya sean marginales o incrementales, de termi-nación de llamadas en redes celulares, lo que se está considerando en términos ge-nerales como un paso intermedio a la adopción del sistema bill-and-keep (es decir, que no existan TTM para las llamadas de celular a celular y de fijo a celular. Otros países alrededor del mundo, como Nueva Zelanda, también están siguiendo este ejemplo. En México, las TTM aún son lo que crea una barrera para la fijación de precios eficientes en redes celulares y fijas, y para una competencia de largo plazo más efectiva. En este artículo revisaremos en primer lugar los debates recientes so-bre tarifas de terminación celular en Europa, y luego presentaremos los resultados de un modelo de bienestar calibrado del mercado celular mexicano, que incluye tres redes de telefonía celular; llamadas desde y hacia redes fijas; discriminación de precios basada en la red, y externalidades de las llamadas. Nuestras simulaciones muestran que la reducción de las tarifas de terminación celular para las llamadas tanto de celular a celular como de fijo a celular, ya sean a costo incremental de largo plazo; tarifas recíprocas de terminación en redes fijas, o al sistema bill-and-keep puede aumentar el bienestar social por más de mil millones de dólares por año en ausencia de externalidades de llamada, y por más de 2.25 mil millones de dólares por año cuando las externalidades de llamada son fuertes. Nuestro análisis ofrece apoyo a un cambio desde el sistema de fijación de precios basado en costos comple-tamente asignados (o completamente distribuidos, como se practica actualmente en México, hacia tarifas de terminación celular mucho más bajas, con el sistema bill-and-keep, que con frecuencia conducirá al mayor incremento en el bienestar. La reducción de las TTM a costo incremental, o la adopci

  16. Nuclear magnetic resonance in the evaluation of the disk luxation in the temporomandibular articulation conditioned for degenerative osseous changes; Resonancia magnetica nuclear en la valoracion de la luxacion discal en la articulacion temporomandibular condicionada por cambios degenerativos oseos

    Energy Technology Data Exchange (ETDEWEB)

    Marchegiani, Silvio; Guzman Urquhart, Romel; Marangoni, Alberto; Alvarez, Federico; Surur, Alberto [Sanatorio Allende, Cordoba (Argentina). Servicio de Diagnostico por Imagenes

    2006-07-01

    incidencia de la patologia de acuerdo al sexo, relacionar las luxaciones del disco interarticular con los cambios degenerativos oseos, relacionar la falta de reduccion del disco luxado en la apertura bucal, con los cambios degenerativos oseos, y evaluar la utilidad de la RM en el estudio de la articulacion temporo-mandibular. Material y metodo: Se evaluaron 215 pacientes, estudiados desde enero de 1999 a agosto de 2004. Se excluyeron a pacientes portadores de material ferromagnetico o que presentaron sindrome de claustrofobia. Se utilizo un equipo Elscint de 2 tesla de campo magnetico, con bobina especifica y secuencias T1 y T2 con supresion grasa. Se evaluaron: luxaciones (reductibles y no reductibles), cambios degenerativos oseos, osteocondritis, cambios degenerativos discales, perforaciones discales, y lesiones retrodiscales. Resultados: De los 215 pacientes, se analizaron 175 pacientes que presentaron anormalidades en el estudio por IRM. Los 40 pacientes restantes fueron excluidos por presentar un estudio de (IRM) normal. De estos 175 pacientes, 146 fueron mujeres y 29 hombres. La luxacion mas comun fue la anterior y la demostracion de las lesiones articulares y la artrosis por IRM fue satisfactoria en todos los casos. Discusion: en nuestro trabajo la disfuncion de la ATM mas comun fue la luxacion anterior, concordando con otros autores. Se encontro una relacion exacta entre las luxaciones no reductibles, con cambios degenerativos oseos. Conclusion: Se demuestra que la IRM es el examen de eleccion para evaluar la ATM. El sexo femenino es el mas afectado por este tipo de patologia. La luxacion del disco es la alteracion mas frecuente encontrada en la disfuncion de la ATM, demostrando que en pacientes con osteofitosis marginales del condilo no fue posible la reduccion del disco. (autor)

  17. Comportamiento de los cultivares de papaya Sunset, Sunrise y de los genotipos Baixinho de Santa Amalia y BH - 65 en la zona sur de la isla de Tenerife

    Directory of Open Access Journals (Sweden)

    Maria Cristina Rodríguez Pastor

    2010-12-01

    Full Text Available Los antecedentes de la papaya (Carica papaya, L. en Canarias vienen a poner de manifiesto, la viabilidad de este cultivo en invernadero y la posibilidad de su mayor expansión a corto plazo, debido a la introducción a lo largo de los últimos años de cultivares comerciales y de gran calidad, procedentes de Hawaii ('Sunrise' y de Brasil 'Baixinho de Santa Amalia' (BSA. En este trabajo se ha estudiado el crecimiento, desarrollo y productividad de los cultivares Sunset, Sunrise, y de los genotipos BH-65 y 'Baixinho de Santa Amalia' y las características morfológicas y organolépticas de sus frutos, con el fin de continuar con la selección de aquellos cultivares que mejor se adapten y cumplan con las exigencias mínimas de mercado, que mantengan una buena productividad en aquellas zonas marginales para la platanera y que sirvan de base para futuros programas de mejora. Los resultados ponen de manifiesto que los mayores porcentajes de floración se obtienen en el mes de Mayo (6 meses después de la plantación en las plantas hermafroditas de todos los cultivares, correspondiendo los mayores porcentajes a 'Sunset' y 'Sunrise' (80 y 90,4%, respectivamente. El número de hojas emitidas mensualmente es semejante en todos los cultivares, entre 7,5 y 7,8. Las plantas femeninas de 'Sunrise' así como las hermafroditas de 'Sunset' tienen mayor diámetro, y además, este último cultivar es más precoz en florecer y sus frutos son de mayor peso y tamaño. Hay que destacar también que en el punto de consumo los frutos del cultivar Sunrise son los que poseen mayor contenido en sólidos solubles totales (10,33 ºBrix. Además, los frutos hermafroditas de 'Sunrise' son los primeros en ser recolectados (422 días desde la plantación. Finalmente, señalar que el cultivar Sunset destaca por ser el más productivo (59,5 kg/pl y por tener mayores rendimientos por hectárea (158,627 kg/ha. No obstante, los genotipos BH-65 y BSA poseen un comportamiento muy

  18. Pricing fair trade products to include unpaid labour and empower women – the example of Nicaraguan sesame and coffee cooperatives

    Directory of Open Access Journals (Sweden)

    Felicity Butler

    2012-05-01

    ón y distribución.La financiación que se ha desarrollado durante dos años ha dado lugar a diversos proyectos orientados a las mujeres. La participación se ha extendido no sólo a las mujeres que realizan trabajo no remunerado, sino también a las mujeres con empleos mal pagados y marginales dentro de las cooperativas. En particular, se cuestiona a quién se debe pagar el dinero generado bajo este esquema, y si debiera utilizar principalmente para desarrollar proyectos individuales o colectivos. Este es un desarrollo innovador que pretende modificar a fondo las relaciones de género y el poder de las mujeres. Es significativo que se está llevando a cabo por vez primera en un país pobre del sur y no en uno rico del norte. DOWNLOAD THIS PAPER FROM SSRN: http://ssrn.com/abstract=2034322

  19. La tradición de los amados de Dios en Qumrán: Antecedentes para un estudio del discípulo amado en el cuarto evangelio

    Directory of Open Access Journals (Sweden)

    César Carbullanca Núñez

    2010-01-01

    Full Text Available El artículo estudia la hipótesis sobre una matriz apocalíptica común relativa al tema del amado de Yahvéh existente en textos qumrámicos y la cristología joánica. De acuerdo a esto, avanza en esta relación que es la hipótesis de trabajo, estudiando los textos encontrados en Qumrán: 4Q377 f.l recto col. II, 5-12; CD-A col. III, 1-21; 4Q213 fr. 1 (4Q213 4QAramaic Leviª; 4Q491C fr. 1;(4Q427; y 4Q522 fr. 9 col. II, que hablan acerca de la tradición "del amado del rey", el que representa una tradición vinculada a grupos marginales samaritanos o esenios norteños que formulan un templo y sacerdocio alternativo al del templo de Jerusalén. El artículo coloca en evidencia aspectos que vinculan la figura del "amado del rey" con una teología que contiene tanto el tema de la exaltación, auto-glorificación como una reflexión acerca de los sufrimientos que ha padecido el siervo de Dios. Esta tradición martirial es concomitante con la categoría profética del emisario ya estudiada por J. Ashton, J. Bühner y por nosotros en un artículo reciente, la cual explica y coloca los fundamentos de posteriores estudios comparativos con la cristología del cuarto evangelio.This paper studies the common apocalyptic matrix hypothesis regarding Yahvéh's beloved in the Qumran literature and Johannine Christology. This analysis advances in this direction by studying the texts found in Qumran: 4Q377 f. 1 recto col. II, 5-12; CD-A col. Ill, 1-21; 4Q213 fr. 1 (4Q213 4QAramaic Leviª; 4Q491C fr. 1;(4Q427; y 4Q522 fr. 9 col. II, which refer to the tradition of the 'beloved of King', who represents a tradition linked to marginal Samaritan groups or northern groups that explain an alternative temple and priesthood to that of Jerusalem. The article exposes features that link the 'beloved of King' figure with a theology that includes exaltation, self-glorification and reflections about the suffering that the servant of God withstands. This martyrdom tradition

  20. Sedimentology and stratigraphy of the middle Eocene Guara carbonate platform near Arguis, South-West Pyrenean foreland: Implications for basin physiography

    Science.gov (United States)

    Huyghe, D.; Castelltort, S.; Serra-Kiel, J.; Filleaudeau, P.-Y.; Emmanuel, L.; Mouthereau, F.; Renard, M.

    2009-04-01

    The Pyrenees results from the collision between Spain and Europe and developed between the upper Cretaceous (Santonian) and the Miocene. Its foreland basins are characterised by a thick fill of detrital and carbonate sediments. The diversity of Eocene deposits in the southern Pyrenean foreland basin is of particular use in facies sedimentology due to their exceptional outcropping quality and well established stratigraphic framework and has been taken as type examples of many different sedimentary environments. Most studies have concerned facies sedimentology of detrital series in turbiditic environments, meandering and braided rivers, alluvial fans, and deltas. In contrast, the Eocene carbonate series have attracted less attention. The marine Guara limestones are a formation of lower to middle Eocene age deposited on the southern border of the western Pyrenean foreland basin (Jaca basin). They were deposited as a retrogradational carbonate platform dominated by large benthic foraminifers near or at the flexural forebulge of the foreland basin as the Pyrenean orogen developed. This formation represents the last episode of carbonate platform in the Pyrenees and remains poorly studied. In the present work our aim is to provide a detailed facies analysis and physiographic reconstructions of the Guara carbonate platform. This is crucial to unravel the respective influences of tectonics, climate and rheology of the lithosphere on the foreland basin tectonic and stratigraphic development, and it brings new constraints on the paleoenvironments and paleogeography during the Lutetian, i.e. at the beginning of the major phase of activity of the Pyrenean orogenesis. Two outcrops were studied in the Sierras Marginales at the localities of Arguis and Lusera. The Lusera section once restored in its initial position is located to the North of the Arguis section in a basinward direction such that comparing time-equivalent facies between these two sections helps us reconstructing

  1. Synthetic Or Reformulated Fuels: a Challenge for Catalysis Carburants de synthèse ou reformulés : un défi pour la catalyse

    Directory of Open Access Journals (Sweden)

    Courty P.

    2006-12-01

    Full Text Available Despite comparative figures for wordwide crude oil and natural gas proven reserves, present time contribution of syngas chemistry to motorfuels remains marginal when the refining industry is faced to main constraints: market demand evolution, stringent specifications and environmental issues. Actually natural gas upgrading via syngas chemistry yields key products (e. g. methanol among which clean motorfuels (ethers, FT products should develop despite the huge investments required, mostly for syngas production. Main challenges and corresponding issues for catalysts and related technologies are identified for Fischer-Tropsch synthesis and motorfuels long-term reformulation. Among other, mastering the chain-growth (FT synthesis improving the FCC products: gasoline, and LCO for Diesel pool. All these issues need significant progresses in catalyst and technology to be solved. Lastly, our economical study, focused on Diesel-fuel production, shows up that clean diesel (from SR-LCO mixtures and FT Diesel reach similar production costs when cheap NG is available. In the future, FT middle distillates should amount to a few percent (5-150 Mt of the 1700-2000 Mt of transport middle distillates expected from oil refining. However they should more and more be a compulsory part of diesel pool if the level of investment for an FT process continues to decrease significantly. Malgré des réserves prouvées en pétrole et en gaz du même ordre de grandeur, la contribution de la chimie du gaz de synthèse à la production de carburants reste marginale, alors que l'industrie du raffinage est confrontée à des contraintes majeures : évolution de la demande, durcissement des spécifications des produits et contraintes environnementales. Cependant, la conversion chimique du gaz, via la chimie du gaz de synthèse, fournit des produits stratégiques (e. g. méthanol parmi lesquels les carburants propres (éthers, produits Fischer-Tropsch devraient se développer, bien

  2. The state of the Hungarian residential market in the time of the global economic crisis Etat du marché résidentiel hongrois en période de crise économique mondiale

    Directory of Open Access Journals (Sweden)

    Mihály Tömöri

    2012-12-01

    Full Text Available Housing in Hungary has undergone significant changes since the years of political and economic transition. During the socialist decades the housing sector was controlled by the state, market forces were marginal or non-existent. Thus, one of the biggest changes in housing was the establishment of a western-type residential market after the regime change. The latest worldwide economic crisis has had a dramatic impact on the Hungarian housing market. The turnover of the Hungarian residential market has declined enormously in the past few years. Those families who financed their housing by foreign currency mortgages are facing the hardest situation. The Hungarian forint has significantly weakened against other currencies having resulted in a dramatic increase in foreign currency mortgage payments. First, the paper briefly reviews the literature on housing theories, then it outlines the most important milestones in the development of the Hungarian residential market. The next part of the paper introduces the most problematic issues and areas concerning housing in Hungary, and finally analyzes the effects and consequences of the present economic crisis.En Hongrie, le logement est confronté à d’importantes mutations depuis les années de transition politique et économique. Durant les décennies du socialisme, ce secteur se trouvait sous le contrôle de l’état et les forces du marché étaient marginales, voire inexistantes. En conséquence, l’un des changements majeurs dans le secteur fut l’établissement d’un marché résidentiel de type occidental à la suite du changement de régime. La dernière crise économique mondiale a eu un impact crucial sur le marché du logement hongrois, dont le chiffre d’affaires a considérablement chuté ces dernières années. Les familles qui finançaient leur logement à l’aide de prêts hypothécaires étrangers se retrouvent dans la situation la plus difficile. La très nette dévaluation du

  3. Energy and nutrient consumption in Mexican women 12-49 years of age: analysis of the National Nutrition Survey 1999 Consumo de energía y nutrimentos en mujeres mexicanas de entre 12 a 49 años de edad: análisis de la Encuesta Nacional de Nutrición 1999

    Directory of Open Access Journals (Sweden)

    Simón Barquera

    2003-01-01

    adecuaciones de macro-nutrimentos fueron significativamente mayores en mujeres no-obesas. CONCLUSIONES: Las diferencias entre las regiones, áreas del país y terciles de nivel socioeconómico reflejan una disponibilidad creciente de alimentos densamente calóricos de bajo costo en grupos marginales. Sin embargo, la energía total, colesterol y la grasa saturada y total se consumieron en mayores cantidades por mujeres del tercil de nivel socioeconómico más alto y áreas urbanas. Estos patrones pueden estar contribuyendo al incremento de la obesidad y otras enfermedades no transmisibles en México.

  4. La participación política de niñ@s y jóvenes-adolescentes: Contribución al debate sobre la democratización de la escuela

    Directory of Open Access Journals (Sweden)

    Graciela Batallán

    2008-12-01

    Full Text Available El artículo profundiza en el carácter inherentemente político de la participación de niñ@s y jóvenes adolescentes en el espacio público en general y en la escuela en particular, problematizando el habitual soslayamiento del que es objeto. Se sostiene que esta invisibilidad se debe al status jurídico dependiente que se les asigna, conjuntamente con limitaciones conceptuales relativas al campo de lo "lo político" bajo el presupuesto de la igualdad de los sujetos ante la ley. A su vez, los ámbitos y las formas que canalizan la participación de las nuevas generaciones en el ámbito escolar se nutren de una concepción infantilizadora que evita el conflicto social y la emergencia de lo político. Las experiencias y debates en torno al bien común devienen marginales a la vida escolar, limitando las potencialidades de la institución en tanto espacio para el ejercicio de la ciudadanía en el presente y la confianza en el "futuro ciudadano".O artigo aprofunda no caráter inerentemente político da participação de crianças e jovens adolescentes no espaço público em geral e na escola em particular, problematizando o habitual soslaiamento do que é objeto. Sustenta-se que esta invisibilidade deve-se ao status jurídico dependente que têm, junto com limitações conceptuais relativas ao campo de "o político ", sob o orçamento que este necessita da igualdade dos sujeitos perante a ley. Por sua vez, os âmbitos e as formas que canalizam a participação das novas gerações na escola, nutrem-se de uma concepção infantilizadora que evita o conflito e sua resolução coletiva. As experiências e debates em torno ao bem comum são marginais na vida escolar e restringem a potencialidade da instituição em tanto espaço específico para o exercício da cidadania no presente e o desenvolvimento da confiança no "futuro cidadão".This article discusses the invisibility but inherently political character of children and young adolescents

  5. Changes in abiotic characteristics of water in the Paranapanema River and three lateral lagoons at mouth zone of the Jurumirim Reservoir during the flood period, São Paulo, Brazil Cambios de las características abióticas del agua del río Paranapanema y de tres lagunas laterales en la zona de la boca de la Reserva de Jurumirim durante el periodo de inundación, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Danielli Cristina Granado

    2012-03-01

    componentes principales. En la laguna de Cavalos se observaron cambios en la calidad del agua de todos los ambientes, tales como una función de dilución después del aumento del nivel de agua y del incremento de nutrientes como resultado de la descomposición de las plantas litorales después de la inmersión. En conclusión, las lagunas marginales y el río fueron influenciados por dos acciones antropogénicas: el almacenamiento de agua en la presa, que actúa como un sistema de amortiguación de pulsos hidrológicos y la ampliación del canal de la asociación de la laguna Camargo con el río, cambiando el nivel de conectividad, y causando una similitud cada vez mayor de la laguna con el sistema lóticos.

  6. Sedimentary connection between rock glaciers and torrential channels: definition, inventory and quantification from a test area in the south-western Swiss Alps

    Science.gov (United States)

    Kummert, Mario; Barboux, Chloé; Delaloye, Reynald

    2017-04-01

    order to validate these estimations, the resulting sediment transfer rates are compared to transfer rates calculated from repeated terrestrial LiDAR surveys on selected study cases. This contribution presents results from the application of this methodology in a test study area in the south-western Swiss Alps. The methodology reveals itself suitable to identify rock glaciers connected to the torrential network. For each of the detected rock glaciers, an estimation of the sediment yield is proposed. The transfer rates range from tens of cubic meters per year for some slow moving and/or partially connected landforms, to several thousands of cubic meters per year. References: Delaloye R. (2004). Contribution à l'étude du pergélisol de montagne en zone marginale. GeoFocus vol. 10, Thèse, Département de Géosciences/Géographie, Université de Fribourg. Delaloye, R., Lambiel, C., Gärtner-Roer, I. (2010). Overview of rock glacier kinematics research in the Swiss Alps. Seasonal rhythm, interannual variations and trends over several decades. Geogr. Helv., 65: 2, 135-145. Delaloye, R., Morard, S., Barboux, C., Abbet, D., Gruber, V., Riedo, M. & Gachet, S. (2013). Rapidly moving rock glaciers in Mattertal. In: Graf, C. (Eds). Mattertal - ein Tal in Bewegung. Publikation zur Jahrestagung der Schweizerischen Geomorphologischen Gesellschaft 29. Juni - 1. Juli 2011, St. Niklaus, Birmensdorf, Eidg. Forschungsanstalt WSL, 113 - 124. Gärtner-Roer, I. (2012). Sediment transfer rates of two active rockglaciers in the Swiss Alps. Geomorphology, 167-168, 45-50. Lugon, R. & Stoffel, M. (2010). Rock glacier dynamics and magnitude-frequency relations of debris flows in a high-elevation watershed : Ritigraben, Swiss Alps. Global and Planetary Change, 73, 202-210.

  7. Lorenzo Lotto e gli strumenti del mestiere: la periferia come consapevole scelta strategica / Lorenzo Lotto and the tools of the trade: the periphery as a conscious strategic choice

    Directory of Open Access Journals (Sweden)

    David Frapiccini

    2014-06-01

    Full Text Available Con il testamento del 25 marzo 1531 Lorenzo Lotto stabiliva la ripartizione dei modelli in gesso e in cera e dei propri disegni tra tre suoi antichi allievi: il bergamasco Francesco Bonetti, il veneziano Pietro di Giovanni – in quel momento attivo a Ragusa, l’odierna Dubrovnik – e il marchigiano maestro Giulio da Amandola, identificabile con Giulio Vergari. Dalle provenienze dei tre artefici si manifesta una chiara mappa geografica, come se Lotto avesse consapevolmente deciso di lasciare i ferri del mestiere nei luoghi della sua esperienza pittorica: a Bergamo, a Venezia e nelle Marche. Contemporaneamente Lotto frequenta i pittori Alessandro Oliverio, Bonifacio de’ Pitati da Verona e Girolamo da Santa Croce: il secondo, stando alle disposizioni testamentarie, avrebbe dovuto completare le opere rimaste incompiute alla morte di Lotto, mentre al terzo sarebbero andati alcuni strumenti della professione a beneficio dei propri figli. Si viene così a delineare un gruppo di artisti marginale rispetto al contesto lagunare, ma orientato verso committenze di entroterra o di area adriatica. La consapevolezza acquisita da Lotto nell’incidenza territoriale della sua attività spiega la ragione delle reminiscenze iconografiche e formali bergamasche in parte della produzione risalente agli estremi anni marchigiani (1549-1556, ovvero a quella fase inaugurata con l’Assunzione anconetana di San Francesco alle Scale, pala realizzata nel 1549-1550 con la collaborazione di Giuseppe Belli da Ponteranica. With the will of March 25, 1531 Lorenzo Lotto established the distribution of models in plaster and wax and their designs to three of his former pupils: Francesco Bonetti from Bergamo, the Venetian Pietro di Giovanni – at that time active in Ragusa, today's Dubrovnik – and maestro Giulio from Amandola identified with Giulio Vergari. The origins of the three painters manifest a clear geographical map, as if Lotto had consciously decided to leave the

  8. Estratégias gerencias na implantação do Programa de Saúde da Família Estrategias gerenciales en la implantación del Programa Salud de la Familia Managerial strategies in the implantation of Family Health Program

    Directory of Open Access Journals (Sweden)

    Mônica Aguilar Estevam Dias

    2005-10-01

    Full Text Available Estudo que trata do processo de implantação de equipes do Programa Saúde da Família (PSF em uma comunidade no bairro de Santa Cruz, zona oeste do município do Rio de Janeiro, caracterizada por alto risco social e sanitário e marcada pela violência. Tem por objetivos: (1 identificar as estratégias utilizadas pela gerência local na implantação de oito equipes de PSF em uma comunidade no bairro de Santa Cruz; (2 descrever os mecanismos de participação comunitária no processo de implantação do PSF e, (3 analisar a inserção do Enfermeiro na coordenação deste processo. Dentre os achados ressalta-se a importância do controle social no processo de legitimação da estratégia PSF junto à comunidade; a função gerencial do Enfermeiro na construção da autonomia local das equipes de Saúde da Família e as abordagens utilizadas pela gerência local ao introduzir o PSF em comunidades marginalizadas.El estudio trata del proceso de la implantación de los equipos del Programa Salud de la Familia (PSF en una comunidad en el barrio de Santa Cruz, en el distrito municipal de Río de Janeiro y el tiene para los objetivos: (1 identificar las estrategias usadas por la dirección local en la implantación de ocho equipos de PSF en esta comunidad; (2 describir los mecanismos de participación de la comunidad en el proceso de implantación y, (3 analizar la inserción de la Enfermera en la coordinación de este proceso. Entre los resultados, la importancia de los usuarios es puntuada en el legitimo mando social, la función directiva de la Enfermera para la construcción de la autonomía local y los acercamientos usados por la dirección para introducir PSF en las comunidades carentes y marginales.Study that focuses on the implementation process of Family Health Program (FHP in a community of Santa Cruz, district of Rio de Janeiro city. This community is characterized by a high social and sanitary risk marked by violence. The objectives were

  9. Anatomía y desarrollo del fruto en Piriqueta y Turnera (Turneraceae Anatomy and development of fruits in Piriqueta and Turnera (Turneraceae

    Directory of Open Access Journals (Sweden)

    Ana Maria Gonzalez

    2010-12-01

    Full Text Available En este estudio se analiza la anatomía, estructura y desarrollo de los frutos en 12 especies de Piriqueta y 30 especies de Turnera; con el objetivo de identificar la estructura involucrada en la dehiscencia y verificar la existencia de patrones en la organización del fruto entre las especies analizadas. El ovario es sincárpico, tricarpelar, unilocular con placentación parietal, presentando la misma estructura en todas las especies. Ambas epidermis carpelares son uniestratificadas y tienen estomas, el mesófilo es parenquimático con 3 haces dorsales y 3 marginales. Durante el desarrollo del fruto, la epidermis externa forma un epicarpo papiloso en las especies de Piriqueta. El mesocarpio deriva de los estratos medios del ovario, formando un estrato mecánico de braquiesclereidas. Estas esclereidas pueden organizarse como un cilindro continuo determinando frutos de superficie lisa o agruparse en nidos, unidos o no, determinando así frutos granulares, verrugosos, o tuberculados. Las cápsulas son loculicidas, con línea de dehiscencia formada por macroesclereidas dispuestas longitudinalmente en el fruto, paralelas al haz carpelar dorsal. Se concluye que los diferentes tipos de pericarpio son un rasgo post-fecundación, dado que la estructura del ovario es exactamente la misma en todas las especies analizadas. Se analiza la anatomía del fruto en relación al esquema taxonómico actualizado.The aims of this work were to describe the morphology, anatomy and development of the fruits of 12 species of Piriqueta and 30 species of Turnera; to identify the structures related to the process of dehiscence of the capsule; and to verify the occurrence of standards carpological structure between the studied species. The ovary is 3-carpellar, syncarpous, unilocular with parietal placentation and has the same anatomical structure in all studied species. The outer and inner epidermises are single-layered with stomata; the ovarian mesophyll is composed by

  10. Electromagnetic Instabilities in a Collisionless Plasma; Instabilites Electromagnetiques des Plasmas sans Collisions; Ehlektromagnitnye neustojchivosti besstolknovitel'nykh plazm; Inestabilidad Electromagnetica en un Plasma sin Colisiones

    Energy Technology Data Exchange (ETDEWEB)

    Laval, G.; Pellat, R.; Vuillemin, M. [Centre d' Etudes Nucleaires de Fontenay-aux-Roses, Seine (France)

    1966-04-15

    dependent d'une seule coordonnee d'un systeme orthogonal; le courant porte par les particules du plasma est dirige suivant un autre axe de coordonnee. Les perturbations envisagees sont constantes le long des lignes de courant. En geometrie plane, par exemple, les fonctions de distribution des particules ne dependent que de l'energie et du moment suivant OZ de l'Hamiltonien du mouvement d'une particule; l'equilibre est inhomogene suivant OX et les perturbations invariantes en OZ. On construit une fonction de Liapounoff dont la minimisation permet d'obtenir tous les etats de stabilite marginale ainsi qu'une condition suffisante de stabilite. On demontre ainsi les resultats proposes dans la litterature sur des arguments de modes marginaux ou d'equilibres voisins. On calcule egalement le taux de croissance des instabilites. Pour les 'theta-pinch avec champ inverse' on trouve un taux de croissance de l'ordre de [v{sub e}(th)/{lambda}](a{sub e}/{lambda}){sup 3/2}; {lambda} est l'echelle du gradient de densite du plasma, v{sub e}(th) et a{sub e} sont la vitesse thermique et le rayon de Larmor des electrons. Le resultat est en meilleur accord avec les observations experimentales que la theorie resistive de F.K.R. Letaux de croissance des instabilite du 'hard-core pinch' est de l'ordre de [v{sub i}(th)/{lambda}](m{sub e}/{beta}m{sub i}){sup 1/2}(a{sub i}/{lambda}){sup 2}; m{sub e} et m{sub i} sont la masse des electrons et des ions respectivement, {beta} a la definition habituelle. Pour les experiences MEST et EPPE de Fontenay-aux-Roses ce taux de croissance est beaucoup plus lent que celui des tearing-modes resistifs. (author) [Spanish] Se ha estudiado la estabilidad de la plasmas no homogeneos y sin colisiones frente a las perturbaciones electromagneticas. Los parametros macroscopicos del equilibrio dependen solamente de una coordenada de un sistema ortogonal, dado que la direccion de la corriente portada por el plasma sigue otro eje de coordenadas. Las perturbaciones en cuestion

  11. Relations entre les types de dépôts évaporitiques et la présence de couches riches en matière organique (roches-mères potentielles Relationship Between Different Types of Evaporitic Deposits and the Occurrence of Organic-Rich Layers (Potential Source Rocks

    Directory of Open Access Journals (Sweden)

    Busson G.

    2006-11-01

    superposent - au moins au cours de la formation des carbonates, puis des sulfates - des gradients de salinité verticaux (système d'eaux stratifiées. Cartographiquement, ces dépôts ont une polarité salin croissant centripète . Quand elles sont situées en contexte carbonaté, ces évaporites de centre de cuvette s'accompagnent fréquemment d'appareils récifaux pouvant fourmiller dans toute une ceinture annulaire (cf. Salina du Silurien du Michigan. Grâce aux minces couches à matière organique des zones déprimées, grâce aux appareils récifaux et grâce à la couverture salifère, ces bassins ont souvent une certaine prolificité en hydrocarbures. Le troisième type correspond aux évaporites de marge de bassin. Dans ce dispositif, le centre du bassin est resté affamé - voire insatiable - pendant de longues périodes. La sédimentation y est restée marine, souvent caractérisée par la seule présence du plancton et du necton et par une richesse plus ou moins permanente en matière organique. Autour de la cuvette s'organisent, sur des plates-formes marginales parfois fort étendues, des appareils construits (bancs ou récifs, puis des faciès lagunaires, carbonatés et évaporitiques et enfin des détritiques continentaux. Les dépôts montrent une polarité salin croissant centrifuge irréductiblement opposée à la polarité inverse des dépôts de centre de cuvette. Le déficit en les sels les plus solubles est remarquable voire considérable, impliquant le reflux de saumures en profondeur à partir de ces annexes évaporatoires qu'ont dû constituer ces plates-formes d'arrière-récifs. L'appel d'eau à partir de ces annexes évaporatoires n'a pu qu'amener un afflux permanent de nutriments dans tout le bassin. Le reflux des saumures quant à lui a favorisé la pérennité d'un système à deux corps d'eau. Grâce à cet ajustement et à la pérennité du système, la prolificité de tels bassins en matière organique a pu être extrêmement importante. Les

  12. El Cenozoico del alto río Teno, Cordillera Principal, Chile central: estratigrafía, plutonismo y su relación con estructuras profundas The Cenozoic of the upper Teno River, Cordillera Principal, Central Chile: stratigraphy, plutonism and their relation with deep structures

    Directory of Open Access Journals (Sweden)

    José Piquer

    2010-01-01

    Full Text Available La evolución geológica cenozoica del sector central de la Cordillera Principal a ~35°S, se encuentra íntimamente relacionada con la evolución de estructuras profundas, las cuales habrían controlado, en distintas etapas de su historia, tanto la depositación de secuencias volcano-sedimentarias como el ascenso y emplazamiento de cuerpos intrusivos. Estudios estratigráficos en el entorno de estas estructuras, permiten confirmar la edad cenozoica de un conjunto de rocas piroclásticas y sedimentarias que subyacen concordantemente a lavas andesíticas de la Formación Abanico (asignada al Eoceno Tardío-Mioceno Temprano a Medio. Se determinó la existencia de cuatro fases intrusivas principales (diorita, granodiorita, pórfido riodacítico y pórfido dacítico, en ese orden de intrusión, cuyos productos afloran siguiendo una franja de orientación norte-sur. La granodiorita fue datada en 7,8±0,4 Ma (K-Ar en biotita. Pórfidos riodacíticos, considerados como facies marginales de la unidad anterior, se dataron en 7,9±0,4 Ma (K-Ar en fenocristales de plagioclasa. Se reconocieron dos estructuras de importancia regional: el Corrimiento El Fierro, y, más al oeste, se definió el Sistema de Fallas Infiernillo-Los Cipreses. En la caracterización de esta última estructura, se utilizó la modelación magnética de secciones como complemento a la información geológica. Se interpreta que el ascenso de las distintas fases intrusivas mencionadas fue controlado por el Sistema de Fallas Infiernillo-Los Cipreses. Este, al igual que el Corrimiento El Fierro, habría actuado como una falla normal de borde de cuenca durante el Eoceno Tardío-Moceno Medio, controlando la depositación de productos volcánicos y sedimentarios de la Formación Abanico. Ambas fallas fueron reactivadas en modo inverso durante un importante episodio de contracción tectónica y de elevada presión de fluidos inducida por circulación de magmas, en el Mioceno Tard

  13. Como uma Empresa Brasileira está Resolvendo os Problemas de Bairros Urbanos de Forma Sustentável, Uma Comunidade de Cada Vez How a Brazilian Firm is Sustainably Solving the Problems of Urban Slums, One Community at a Time Une entreprise brésilienne résout durablement les problèmes des bidonvilles urbains, communauté par communauté Cómo una empresa brasileña está resolviendo de manera sostenible los problemas de las favelas, comunidad por comunidad

    Directory of Open Access Journals (Sweden)

    Diana de Castro

    2012-06-01

    économie formelle, 2 les gouvernements résolvent les problèmes complexes et onéreux associés aux bidonvilles urbains et collectent les impôts et 3 les propriétaires sont dédommagés pour les terres occupées. La stratégie de régularisation durable des terres mise en oeuvre par Terra Nova constitue ainsi une solution digne et stimulante d’officialisation des droits de propriété.Terra Nova, un emprendimiento social con fines de lucro, ayuda a los habitantes de favelas –asentamientos  urbanos marginales– a obtener el título de propiedad legal de la parcela que ocupan de manera irregular. Gracias a la gestión de todos los aspectos del proceso de regularización de la propiedad, Terra Nova habilita a los residentes de la comunidad a comprar la parcela en la que viven, formalizando un recurso importante y catalizando el crecimiento económico. Este proceso permite al gobierno implementar las infraestructuras indispensables como el agua corriente, sistemas de saneamiento, electricidad y pavimentación de calles. El proceso brinda un triple resultado (beneficios sociales, medioambientales y económicos a estas favelas, transformando recursos muertos en capitales que benefician a todas las partes interesadas: 1 los residentes de la comunidad adquieren una propiedad, pueden acceder al crédito y dan el paso de transición para entrar a la economía formal; 2 los gobiernos resuelven los complejos y costosos problemas asociados con los asentamientos urbanos marginales y recaudan impuestos; y 3 los antiguos propietarios son compensados por la parcela que ha sido ocupada. La metodología de Terra Nova para lograr la regularización sostenible de la propiedad brinda una solución digna y motivadora a la formalización de los derechos de propiedad.A Terra Nova é uma empresa social, com fins lucrativos, que auxilia os moradores de assentamentos precários a obter o título de propriedade das áreas que foram ocupadas irregularmente. Ao gerenciar todos os aspectos do processo de

  14. How a Brazilian Firm is Sustainably Solving the Problems of Urban Slums, One Community at a Time Une entreprise brésilienne résout durablement les problèmes des bidonvilles urbains, communauté par communauté Cómo una empresa brasileña está resolviendo de manera sostenible los problemas de las favelas, comunidad por comunidad

    Directory of Open Access Journals (Sweden)

    Diana de Castro

    2012-06-01

    économie formelle, 2 les gouvernements résolvent les problèmes complexes et onéreux associés aux bidonvilles urbains et collectent les impôts et 3 les propriétaires sont dédommagés pour les terres occupées. La stratégie de régularisation durable des terres mise en oeuvre par Terra Nova constitue ainsi une solution digne et stimulante d’officialisation des droits de propriété.Terra Nova, un emprendimiento social con fines de lucro, ayuda a los habitantes de favelas –asentamientos  urbanos marginales– a obtener el título de propiedad legal de la parcela que ocupan de manera irregular. Gracias a la gestión de todos los aspectos del proceso de regularización de la propiedad, Terra Nova habilita a los residentes de la comunidad a comprar la parcela en la que viven, formalizando un recurso importante y catalizando el crecimiento económico. Este proceso permite al gobierno implementar las infraestructuras indispensables como el agua corriente, sistemas de saneamiento, electricidad y pavimentación de calles. El proceso brinda un triple resultado (beneficios sociales, medioambientales y económicos a estas favelas, transformando recursos muertos en capitales que benefician a todas las partes interesadas: 1 los residentes de la comunidad adquieren una propiedad, pueden acceder al crédito y dan el paso de transición para entrar a la economía formal; 2 los gobiernos resuelven los complejos y costosos problemas asociados con los asentamientos urbanos marginales y recaudan impuestos; y 3 los antiguos propietarios son compensados por la parcela que ha sido ocupada. La metodología de Terra Nova para lograr la regularización sostenible de la propiedad brinda una solución digna y motivadora a la formalización de los derechos de propiedad.A Terra Nova é uma empresa social, com fins lucrativos, que auxilia os moradores de assentamentos precários a obter o título de propriedade das áreas que foram ocupadas irregularmente. Ao gerenciar todos os aspectos do processo de

  15. Comportamiento de los cultivares de papaya Sunset, Sunrise y de los genotipos Baixinho de Santa Amalia y BH - 65 en la zona sur de la isla de Tenerife Behavior of papaya cultivars Sunset, Sunrise and genotypes of 'Baixinho de Santa Amalia' and BH- 65 in the south of Tenerife island

    Directory of Open Access Journals (Sweden)

    Maria Cristina Rodríguez Pastor

    2010-12-01

    Full Text Available Los antecedentes de la papaya (Carica papaya, L. en Canarias vienen a poner de manifiesto, la viabilidad de este cultivo en invernadero y la posibilidad de su mayor expansión a corto plazo, debido a la introducción a lo largo de los últimos años de cultivares comerciales y de gran calidad, procedentes de Hawaii ('Sunrise' y de Brasil 'Baixinho de Santa Amalia' (BSA. En este trabajo se ha estudiado el crecimiento, desarrollo y productividad de los cultivares Sunset, Sunrise, y de los genotipos BH-65 y 'Baixinho de Santa Amalia' y las características morfológicas y organolépticas de sus frutos, con el fin de continuar con la selección de aquellos cultivares que mejor se adapten y cumplan con las exigencias mínimas de mercado, que mantengan una buena productividad en aquellas zonas marginales para la platanera y que sirvan de base para futuros programas de mejora. Los resultados ponen de manifiesto que los mayores porcentajes de floración se obtienen en el mes de Mayo (6 meses después de la plantación en las plantas hermafroditas de todos los cultivares, correspondiendo los mayores porcentajes a 'Sunset' y 'Sunrise' (80 y 90,4%, respectivamente. El número de hojas emitidas mensualmente es semejante en todos los cultivares, entre 7,5 y 7,8. Las plantas femeninas de 'Sunrise' así como las hermafroditas de 'Sunset' tienen mayor diámetro, y además, este último cultivar es más precoz en florecer y sus frutos son de mayor peso y tamaño. Hay que destacar también que en el punto de consumo los frutos del cultivar Sunrise son los que poseen mayor contenido en sólidos solubles totales (10,33 ºBrix. Además, los frutos hermafroditas de 'Sunrise' son los primeros en ser recolectados (422 días desde la plantación. Finalmente, señalar que el cultivar Sunset destaca por ser el más productivo (59,5 kg/pl y por tener mayores rendimientos por hectárea (158,627 kg/ha. No obstante, los genotipos BH-65 y BSA poseen un comportamiento muy

  16. Oligotrophic patterns in southern Chilean lakes: the relevance of nutrients and mixing depth Patrones oligotróficos en lagos del sur de Chile: relevancia de los nutrientes y de la profundidad de mezcla

    Directory of Open Access Journals (Sweden)

    DORIS SOTO

    2002-06-01

    lago en el Llanquihue, los valores de fósforo total variaron entre 1 y 12 myg L-1 en los distintos sitios, mostrando efecto de sitio marginales, P = 0,09 (sitios de cultivo de salmones tuvieron los valores mayores. Sin embargo las concentraciones de clorofila a (Chl-a fueron generalmente bajas (< 2 myg L-1 y no indicaron efectos de sitio. Las concentraciones de nitrógeno orgánico disuelto (DIN fueron menores que 30 myg L-1 y mostraron mejor poder predictivo sobre las variaciones de Chl-a. El análisis entre lagos mostró los valores mas bajos de Chl-a en el lago Yelcho (0,7 µg L-1 y los mayores en el lago Puyehue (2,1 µg L-1. Los valores de P total mostraron un patrón similar sin embargo no hubo tendencias temporales claras en los 9 años de muestreo. La razón molar N/P para las formas disueltas fue generalmente menor que 20. En el experimento en limnocorrales el N tuvo un efecto significativo positivo (P< 0,001 sobre la concentración de Chl-a en cambio ni el P ni la disponibilidad de luz mostraron efectos significativos. Otro resultado notable fue que la concentración de Chl-a fue superior en los limnocorrales control que en el lago. En todos los lagos estudiados los valores de N total no excedieron 20 mymol L-1 y las concentraciones de P total no superaron los 0,8 mymol L-1 lo que sugeriría particularmente una limitación por N como un elemento clave en la regulación de la Chl-a y productividad. Un factor adicional regulador de la productividad y biomasa, y que solo se evalúa indirectamente aquí, sería la gran profundidad de mezcla, característica peculiar de los lagos templados del hemisferio sur y que tiene un mejor poder explicativo, afectando negativamente la concentración de Chl-a de los lagos. Su efecto también puede explicar el aumento de la Chl-a en los limnocorrales con un epilimnion forzadamente muy reducido. Si la gran profundidad de mezcla condiciona la productividad, entonces las tramas tróficas de los lagos de profundo epilimnion

  17. El sistema lacustre de la Formación Mollar en el depocentro triásico de Santa Clara (provincia de Mendoza, Argentina The lacustrine system of the Mollar Formation in the Triassic Santa Clara Depocenter (Mendoza Province, Argentina

    Directory of Open Access Journals (Sweden)

    Luis A Spalletti

    2009-07-01

    Full Text Available El depocentro triásico de Santa Clara, Cuenca Cuyana, se caracteriza por espesos depósitos generados en ambiente lacustre. Uno de ellos, con un registro de más de 345 m, corresponde a la Formación Mollar. El tramo inferior a medio está caracterizado por una monótona sucesión de lutitas bituminosas acumuladas por decantación suspensiva en el 'off shore' anóxico de un cuerpo lacustre hidrológicamente cerrado y que muestra alto contenido de materia orgánica amorfa de origen algal y de restos de plantas terrestres muy degradadas junto a sulfuros de hierro autígenos. Intercalan areniscas finas debidas a corrientes de turbidez diluidas y carbonatas estromatolíticos. En esta sucesión se definen ciclos granocrecientes de pequeña escala (PACs que se atribuyen a episodios de expansión-retracción lacustre controlados por cambios climáticos. Asociaciones de facies heterolíticas representan los depósitos de la transición entre los ambientes de 'nearshore' y 'offshore' lacustre. La sección superior de la Formación Mollar se compone de sucesiones pelíticas con profusa bioturbación que sugieren mayor oxigenación del sustrato y se asignan a ambiente de costa afuera de un sistema lacustre holomíctico hidrológicamente abierto. Intercalan areniscas producto de flujos hiperpicnales. Depósitos de areniscas con abundantes trazas fósiles y estructuras de olas y flujos unidireccionales, representan a sectores marginales del ambiente lacustre. Además de los ciclos de alta frecuencia, en la Formación Mollar se definen tres secuencias asimétricas de mayor escala atribuidas a episodios mayores de expansión-contracción lacustre debidos a la interacción entre factores climáticos y tectónicos. El diseño de superposición granocreciente de la Formación Mollar y la gradual transición a depósitos fluviales de la sobreyacente Formación Montaña refleja asimismo una constante reducción del espacio de acomodación sedimentaria en el

  18. Aquatic macrophytes in the large, sub-tropical Itaipu Reservoir, Brazil

    Directory of Open Access Journals (Sweden)

    Roger Paulo Mormul

    2010-12-01

    haber permitido la colonización natural por otras especies. Además, diferencias en la clasificación de los sistemas y la resolución taxonómica usada en los estudios, que podría producir diferencias en el número de especies registradas. La composición de la asociación de especies varió entre los brazos y se vio afectada por la radiación bajo el agua (medido utilizando un disco de Secchi y la obtención de información. Se encontraron cinco especies no nativas. Dos no son nativas (Urochloa subquadripara y Hydrilla verticillata son de especial preocupación debido a que tienen una alta frecuencia de ocurrencia y ocupan grandes zonas marginales del embalse. Se deben llevar a cabo futuros estudios para determinar el hábitat más frecuentemente colonizado por estas especies. Esto permitiría desarrollar estrategias de manejo para proteger la biota acuática nativa y evitar interferencias con los usos recreativos y comerciales del embalse Itaipú.

  19. Estudios ecológicos en la Cordillera Oriental colombiana III. - La vegetación de la cuenca del lago de Tota (Boyacá Estudios ecológicos en la Cordillera Oriental colombiana III. - La vegetación de la cuenca del lago de Tota (Boyacá

    Directory of Open Access Journals (Sweden)

    Rangel Ch. Orlando

    1986-12-01

    pobres en nutrientes, muy desaturados, con pH ácidos y están sometidos a continuos lavados. La distribución de la vegetación en la cuenca, obedece esencialmente a variaciones topográficas (altitud, relieve y a cambios climáticos asociados, como la temperatura y la radiación solar. En los alrededores de la masa de agua, entre 3.000 y 3.150 m, las fluctuaciones en el contenido de agua en el suelo, la calidad del sustrato en cuanto a nutrientes, la fisiografía y la acción del viento en casos muy particulares son los factores responsables de la disposición de las unidades de vegetación que se inventariaron.  Estas unidades se estudiaron según las recomendaciones metodológicas de BRAUN-BLANQUET (1979 y comprenden desde el Viburno-Alnetum acuminatae o  bosques marginales sobre sitios con buen contenido de agua en el suelo, a continuación de la vegetación de ribera o Polygono-Scirpion californici RANGEL &: AGUIRRE 1983, con dominio de Alnus acuminata subsp. acuminata, hasta el Plantaqini-Hypericetum Ruscoidis o matorrales ralos, sobre sitios pedregosos y muy secos.  En la región paramuna, se inventariaron matorrales del Brachyoto-Calamaqrotietum effusae y "frailejonales" con Espeletia  lopezii. Las unidades de vegetación se describieron de acuerdo con el Código Internacional de Nomenclatura Fitosociológica (BARKMAN et al., 1976. Se realizaron también los análisis de las formas de vida (RAUNKIAER en BRAUN-BLANQUET 1979 y de las características foliares, las cuales permitieron diferenciar tendencias en los fitoclimas y en la textura de la vegetación en cada asociación reseñada.

  20. Patagonia, antropización de un territorio natural

    Directory of Open Access Journals (Sweden)

    Luis Inostroza Pino

    2012-07-01

    Full Text Available La dominación antrópica del territorio como producto de la relación entre base económica, nivel de organización del sistema social y las características ambientales manifiesta en la región de Magallanes cuatro estadios temporales. Un primer estadio correspondiente a la fase de cazadores recolectores, que se desarrolla desde los albores de la ocupación humana - con un breve intento de colonización española en el siglo XVI - y finaliza en el siglo XIX después de la fundación de Punta Arenas. Un segundo estadio de expansión ganadera cimentado sobre la base de la ganadería ovina extensiva que corresponde al periodo más bullente de la economía regional, donde el ecúmene se expande sobre el ecosistema de estepas. Un tercer estadio o fase de explotación petrolera basado en el descubrimiento y posterior explotación de hidrocarburos, que se inicia con las exploraciones de principios del siglo XX que llevaron al descubrimiento de hidrocarburos en 1945. Esta forma de ocupación-explotación comienza a declinar junto con el agotamiento del recurso a finales de la década de 1980. En esta etapa se completa la expansión del modelo de ocupación territorial sobre la totalidad de un ecosistema: la estepa, que deja de ser un ambiente natural después de estas transformaciones y pasa a ser un ecosistema antrópicamente dominado. Actualmente se desarrolla el cuarto estadio o fase de terciarización, que se construye sobre el turismo y apoyado en la diversificación de la ciudad matriz sobre todo tipo de servicios. La base económica vuelve a dar un giro, proyectando nuevas formas de utilización sobre espacios geográficos hasta ahora marginales en la esfera del metabolismo social. El patrón espacial continúa funcionando sobre la base de la ciudad matriz que ejerce el control sobre un amplio hinterland. El turismo tiene su leitmotiv hacia el occidente abriendo la posibilidad de incorporar al tejido productivo una enorme extensión territorial

  1. El cuaternario del Valle Inferior del Manzanares (Cuenca de Madrid, España

    Directory of Open Access Journals (Sweden)

    Silva, P. G.

    2003-08-01

    the water and sediment supply during the end of cold periods with relevant neotectonic and karstic activity, feedback by significant intrabasinal headward erosion processes from the late Middle Pleistocene.Se analiza el tramo Inferior del Manzanares entre Villaverde y su desembocadura en el río Jarama. En este tramo, el valle es de carácter asimétrico con desarrollo de escarpes en Yesos (ea. 60 m en su margen izquierda y de terrazas complejas en su margen derecha. Dentro de ellas la que domina la geomorfología del sector es un nivel de terraza complejo (engrosado que denominamos TCMZ (+ 16-22 m. Se encuentra constituido por al menos cinco secuencias fluviales (Mz de tipo meandriforme. Sobre ellas se solapan a doble vertiente niveles mixtos (Mx desde los + 15 a los + 8 m que poseen un carácter (más braided. En la arquitectura de la TCMZ participan muy significativamente aportes laterales procedentes de los tributarios (Butarque y Culebro, de los relieves marginales (escarpes en yesos y de los propios sistemas de terrazas (derrames de escarpes. La TCMZ es el nivel más alto en este sector sobre el que, además, se instala la propia divisoria del Valle en este sector, constituyendo este hecho el carácter más anómalo del valle. Todos estos caracteres poco usuales son resultado directo de la respuesta del sistema fluvial al proceso de captura que sufrió por parte del Jarama durante el Pleistoceno medio. Los contenidos faunísticos y líticos de la TCMZ permiten situar su desarrollo entre los OIS 10 (? al 5. Una manifiesta crisis paleosísmica a comienzos del OIS 5 acompaña al primer episodio de disección importante en el valle después del proceso de Captura. Las faunas frías e industrias musterienses de los niveles Mx permiten ubicar su desarrollo entre el OIS 4 y 3. En cualquier caso hay que considerar que los episodios de cut & fill que han modelado el paisaje fluvial durante el Pleistoceno superior difícilmente responden a los cambios eustáticos que

  2. Jatropha curcas L., una especie arbórea con potencial energético en Cuba Jatropha curcas L., a tree species with energetic potential in Cuba

    Directory of Open Access Journals (Sweden)

    Odalys C Toral

    2008-09-01

    Full Text Available Jatropha curcas es una especie multipropósito, con innumerables atributos y un potencial considerable. Es una planta de origen tropical, de la familia Euphorbiaceae, que puede crecer tanto en zonas de altas como de bajas precipitaciones anuales. Es altamente resistente a la sequía y se puede cultivar en áreas marginales, por lo que resulta excepcional para la recuperación de tierras degradadas, sin competir con la producción de cultivos para la alimentación humana y animal. Además, se usa como cercas y setos vivos, se le atribuyen propiedades medicinales e insecticidas, e incluso puede ser utilizado como cultivo comercial. Esta especie es de rápido crecimiento y la producción de semillas puede comenzar incluso en el primer año de establecida la plantación, lo que depende de muchos factores, como las precipitaciones y la forma de propagación que se utilice (por semillas o por estacas. Su establecimiento, manejo y productividad en diferentes condiciones climatológicas aún no está bien documentado, principalmente en lo que concierne a sus requerimientos de nutrientes o fertilizantes y, en el caso de Cuba, la mayoría de los estudios relacionados con su agrotecnia y producción están en ciernes. Esta planta aporta muchos productos beneficiosos, especialmente a partir de sus semillas, de las cuales se puede extraer aceite, con una calidad similar al de la palma aceitera. Este aceite puede reemplazar al keroseno, al petróleo y a la leña/carbón con relativo éxito, por lo que se promueve su uso internacionalmente para satisfacer las demandas de las zonas rurales en cuanto a la iluminación, cocina y fuerza motriz. Otros usos muy importantes lo constituyen la producción de biocombustible a partir del aceite, la fabricación de jabón y la extracción de glicerina con fines industriales. Su cultivo y expansión podría proporcionar nuevas fuentes de empleo, así como mejorar el medio ambiente y el nivel y la calidad de vida de la

  3. Sistemas de producción de Spondias purpurea (Anacardiaceae en el centro-occidente de México

    Directory of Open Access Journals (Sweden)

    Blanca C Ramírez Hernández

    2008-06-01

    Full Text Available Describimos las características de los agroecosistemas y rasgos morfológicos, físicos y químicos relacionados con la calidad de los frutos de la guayaba, Spondias purpurea L., que se producen en poblaciones silvestres y cultivadas en el centro-occidente de México. Spondias purpurea se desarrolla en suelos rocosos, poco profundos e infértiles, poco aptos para la agricultura tradicional. En los frutos se registró el peso, longitud axial y radial, pH, sólidos solubles totales (SST, azúcares reductores, proteínas y contenido de minerales. El peso promedio de frutos en las variedades cultivadas (20 g resultó superior al de las silvestres (16 g. Las variedades cultivadas registraron en promedio los valores más altos de pH, SST, azúcares reductores y contenido de proteínas (3.3, 12.15º Brix, 0.38 g/100 g y 1.18 g/100 g, respectivamente que las silvestres (3.0, 8.31º Brix, 0.24 g/100 g y 0.14 g/100 g, respectivamente. La productividad de la especie es aceptable (de 0.15 ton ha-1 a 5.0 ton ha-1 dado que requiere de un mínimo de manejo agronómico. Esta especie tiene un contenido nutrimental comparable al de las especies frutales más importantes; además, produce frutos frescos durante los meses secos de la primavera por lo que S. purpurea es fuente de agua y alimento para la fauna silvestre y doméstica. Estas características resaltan su importancia agronómica y ecológica para los ambientes tropicales y subtropicales en donde puede ser utilizada en programas de reforestación por su capacidad para desarrollarse en suelos rocosos infértiles, y en agroecosistemas en los que se practica agricultura de subsistencia. De hecho, el cultivo de S. purpurea puede ayudar a convertir suelos marginales en productivos.Production systems of Spondias purpurea (Anacardiaceae in Central West México. Morphological, physical and chemical traits related with fruit quality characteristics of Spondias purpurea L. agroecosystems were studied in Central

  4. El anillo verde de Vitoria-Gasteiz

    Directory of Open Access Journals (Sweden)

    Marañón, Blanca

    2001-10-01

    de la periferia de la ciudad, donde coexistían zonas de alto valor ecológico sometidas a agresiones de todo tipo, con otros espacios degradados y marginales, fruto de la expansión urbana e industrial. La restauración ecológico-paisajística de estos espacios y su acondicionamiento para el uso público han permitido configurar un "anillo verde multifunción" en torno a la ciudad que está proporcionando importantes beneficios ambientales, sociales y económicos. El anillo verde ha jugado un papel importante en la integración naturaleza-ciudad, equilibrando la oferta de zonas verdes entre todos los barrios y favoreciendo la conexión entre los espacios verdes urbanos y los espacios naturales del entorno agrícola. Ha propiciado, asimismo, el desarrollo de nuevas actividades relacionadas con el ocio y el esparcimiento y con la formación, educación y sensibilización ambiental; actividades que, por un lado, están suponiendo un revulsivo para el sector empresarial ambiental y la integración socio-laboral de determinados colectivos sociales y, por otro, contribuyen a la conservación de estos espacios, al convertirse los usuarios en sus mayores defensores y guardianes. La utilización de algunos de estos espacios como superficies de laminación de agua en épocas de avenidas para solventar problemas de inundación en las zonas industriales es otro ejemplo del valor añadido obtenido al plantear soluciones integrales. Los excelentes resultados obtenidos tras nueve años de trabajo demuestran la viabilidad técnica y económica y la rentabilidad social de este proyecto, que representa una prueba evidente de la decidida voluntad municipal de avanzar hacia un modelo de ciudad sostenible en armonía con el medio natural que la rodea.

  5. Perspectiva sobre la valorización de los sistemas agrosilvopastoriles en la cuenca del Mediterráneo A perspective on the valorization of agro-silvo-pastoral systems in the Mediterranean Basin

    Directory of Open Access Journals (Sweden)

    A Pardini

    2007-03-01

    Full Text Available Aunque la cuenca del Mediterráneo es la mayor área con clima mediterráneo, al menos otras cinco áreas del mundo comparten los mismos patrones de precipitación y temperatura en América, África y Australia. Debido a ello, muchos cultivos y opciones de manejo adoptados en dicha cuenca son importantes también en regiones de los otros continentes. Por el contrario, la larga historia de la civilización es una peculiaridad de la cuenca del Mediterráneo, donde los cambios lentos causados en la vegetación nativa han llevado a la integración de las actividades humanas sin alterarla. Los cambios graduales han conservado una gran parte de la diversidad biológica y han introducido plantas exóticas que ahora están bien integradas a la vegetación local. Además, la comprensión gradual de la naturaleza nativa ha desarrollado un enfoque de integración de las personas al medio ambiente natural y es parte de la herencia cultural del área. La cuenca mediterránea continúa siendo una región muy importante para el endemismo, que se refleja en el número de especies vegetales, el número de cultivos y razas ganaderas nativas. En consecuencia, diversidad es probablemente la palabra que mejor describe el mundo mediterráneo rural. Los sistemas tradicionales, como el nomadismo y la trashumancia, sobreviven junto a sistemas agropecuarios basados en las tecnologías más avanzadas; existen casos de modernización de las actividades tradicionales y otros de agricultura moderna que conserva las tradiciones. Se presentan algunos estudios de caso que se refieren a países de las costas norte, sur, oeste y este del mar Mediterráneo, para ejemplificar la variabilidad de los sistemas pastoriles o agrícolas, así como sistemas agrosilvopastoriles complejos e integrados. La diversidad fortalecida de algunos sistemas agrosilvopastoriles mediterráneos necesita un manejo complejo que, especialmente en áreas marginales, no puede ser económicamente competitivo

  6. Operating Experience with the VERA Zero-Energy Fast Reactor; Fonctionnement du Reacteur VERA a Neutrons Rapides, de Puissance Zero; Opyt ehkspluatatsii reaktora VERA na bystrykh nejtronakh nulevoj moshchnosti; Experiencia Adquirida con el Reactor Rapido VERA de Potencia Nula

    Energy Technology Data Exchange (ETDEWEB)

    Weale, J. W.; McTaggart, M. H.; Goodfellow, H.; Paterson, W. J. [Atomic Weapons Research Establishment, Aldermaston (United Kingdom)

    1964-02-15

    elements combustibles; incidences des irregularites des faces et de l'heterogeneite de la structure sur l'exactitude avec laquelle on determine la masse critique d'un assemblage equivalent 'ideal'; possibilite de reproduire l'etat critique apres avoir demonte l'assemblage ou separe les deux moities; variation de la reactivite lors de la separation des deux moities, et effets d'un chargement asymetrique; sensibilite de divers compteurs, intensite de la source de neutrons, utilisation d'un accelerateur comme source de neutrons; vitesse de reponse des circuits de securite et restrictions qu'elle peut entrainer pour la vitesse d'assemblage des deux moities; precautions supplementaires qu'il faut prendre pour utiliser le plutonium comme combustible; notes sur l'exactitude des mesures de la reactivite et sur les limitations d'ordre pratique imposees a diverses autres mesures en physique des reacteurs. (author) [Spanish] Los autores describen brevemente las caracteristicas de un reactor rapido de potencia nula de dos mitades, en especial las que determinan la posibilidad de efectuar mediciones de precisidn en la esfera de la fisica de los reactores. Examinan las ventajas e inconvenientes de este tipo de reactor, basandose en la experiencia adquirida durante dos anos de funcionamiento. Exam in an los siguientes temas: ventajas, desde el punto de vista experimental, de la disposicion y de la construccidn en dos mitades; dimensiones y tolerancias de los elementos combustibles, y precisian con la que se puede determinar la posicion de dichos elementos; influencia de las irregularidades marginales y de heterogeneidad estructural sobre la exactitud con la que se determine la masa critica de un conjunto 'ideal' equivalente; posibilidad de reproducir las condiciones criticas despues de desmontar el conjunto o de separar las dos mitades; variaciones de la reactividad cuando se separan las dos mitades, en especial los efectos de una carga asimetrica; sensibilidad de varios contadores

  7. Communitarian educative proposal with robotics: evaluation and learning process outcomes Propuesta comunitaria con robótica educativa: valoración y resultados de aprendizaje

    Directory of Open Access Journals (Sweden)

    María Dolores Castro Rojas

    2012-07-01

    attention to which ideas from our field do help these students build effective projects and significant robotics classroom. Normal.dotm 0 0 1 202 1154 Universidad de Salamanca 9 2 1417 12.0 0 false 18 pt 18 pt 0 0 false false false /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:12.0pt; font-family:"Times New Roman"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin;} El proyecto busca diversificar la oferta educativa de niños, niñas y adolescentes que viven en condiciones de pobreza y riesgo social, mediante una propuesta didáctica con robótica educativa en la que las personas participantes diseñan, construyen y programan prototipos robóticos ambientados en situaciones reales.  Las construcciones se hacen con bloques y operadores mecánicos (LEGO y se programan con un lenguaje iconográfico (Robolab 2.9.  La propuesta se enfoca en los procesos de  diseño, construcción,  programación y la divulgación de resultados y productos. La ejecución y evaluación de la propuesta y de los resultados de aprendizaje se realizó en tres centros comunitarios (Centros Interactivos, que son centros de aprendizaje no formales, ubicados en comunidades urbano marginales. Se observó que al finalizar los talleres los estudiantes elaboran proyectos grupales que representan sitios o eventos, utilizan  mecanismos integrados por diferentes máquinas y operadores para la transmisión de movimiento, los programas para sus prototipos incluyen estructuras de multitareas y ciclos

  8. Socio-economic and environmental sustainability estimate of ENEL project for the S. Maria in Brasimone basin area; Valutazione della sostenibilita' socio-economica e ambientale del progetto ENEL per l'area del bacino di S. Maria del Brasimone

    Energy Technology Data Exchange (ETDEWEB)

    Padovani, L; Beone, F.; Carrabba, P. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente; Lorenzelli, E.; Cialani, C.

    1999-07-01

    traditions; the strengthening of public transports in the project area: the area promotion through marketing operations. Moreover, the realization of the project should be accompanied by other minimization impact measures besides these already foreseen into the ENEL project. [Italian] Nell'ambito delle attivita' preparatorie della Conferenza Nazionale sull'Energia e l'Ambiente (CNEA), che si e' tenuta a Roma nel novembre 1998, il Gruppo Biodiversita' dell'ENEA ed ENEL hanno siglato un accordo volontario di collaborazione con lo scopo di condurre un'analisi di sostenibilita' ambientale e socioeconomica di un progetto di valorizzazione a fini turistici in un sito dismesso, marginale, fragile o abbandonato di proprieta' ENEL. L'attivita' concordata aveva anche lo scopo di costituire un valido contributo all'individuazione delle future linee guida sul turismo sostenibile che la Convenzione sulla Diversita' Biologica (CBD) si appresta a discutere ed eventualmente emanare. Il presente lavoro ha l'obiettivo di proporre un esempio di dialogo territoriale tra attori diversi volto alla possibilita' di avviare uno sviluppo locale improntato su criteri di sostenibilita', nel rispetto delle tradizioni e della diversita' biologica locale. Le azioni proposte da ENEA si configurano nel seguente modo: 1. Integrazione di uno studio di valorizzazione ambientale a fini turistici, inserendo elementi di rispetto ed uso sostenibile della diversita' biologica locale; 2. analisi, attraverso una serie di modelli statistici a medio/lungo termine, sia degli interventi previsti da ENEL che delle eventuali integrazioni suggerite da ENEA; 3. collaborazione alla ricerca di fonti di finanziamento istituzionali (UE), per la realizzazione del progetto dimostrativo di turismo sostenibile nel rispetto della diversita' biologica locale. L' analisi condotta da ENEA ha permesso di giungere alle conclusioni

  9. Socio-economic and environmental sustainability estimate of ENEL project for the S. Maria in Brasimone basin area; Valutazione della sostenibilita' socio-economica e ambientale del progetto ENEL per l'area del bacino di S. Maria del Brasimone

    Energy Technology Data Exchange (ETDEWEB)

    Padovani, L; Beone, F; Carrabba, P [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente; Lorenzelli, E; Cialani, C

    1999-07-01

    traditions; the strengthening of public transports in the project area: the area promotion through marketing operations. Moreover, the realization of the project should be accompanied by other minimization impact measures besides these already foreseen into the ENEL project. [Italian] Nell'ambito delle attivita' preparatorie della Conferenza Nazionale sull'Energia e l'Ambiente (CNEA), che si e' tenuta a Roma nel novembre 1998, il Gruppo Biodiversita' dell'ENEA ed ENEL hanno siglato un accordo volontario di collaborazione con lo scopo di condurre un'analisi di sostenibilita' ambientale e socioeconomica di un progetto di valorizzazione a fini turistici in un sito dismesso, marginale, fragile o abbandonato di proprieta' ENEL. L'attivita' concordata aveva anche lo scopo di costituire un valido contributo all'individuazione delle future linee guida sul turismo sostenibile che la Convenzione sulla Diversita' Biologica (CBD) si appresta a discutere ed eventualmente emanare. Il presente lavoro ha l'obiettivo di proporre un esempio di dialogo territoriale tra attori diversi volto alla possibilita' di avviare uno sviluppo locale improntato su criteri di sostenibilita', nel rispetto delle tradizioni e della diversita' biologica locale. Le azioni proposte da ENEA si configurano nel seguente modo: 1. Integrazione di uno studio di valorizzazione ambientale a fini turistici, inserendo elementi di rispetto ed uso sostenibile della diversita' biologica locale; 2. analisi, attraverso una serie di modelli statistici a medio/lungo termine, sia degli interventi previsti da ENEL che delle eventuali integrazioni suggerite da ENEA; 3. collaborazione alla ricerca di fonti di finanziamento istituzionali (UE), per la realizzazione del progetto dimostrativo di turismo sostenibile nel rispetto della diversita' biologica locale. L' analisi condotta da ENEA ha permesso di giungere alle conclusioni illustrate nel seguito. L' analisi costi-benefici evidenzia come, per i periodi presi in esame, gli unici

  10. Edad y crecimiento del pez Haemulon steindachneri (Perciformis: Haemulidae en el suroeste de la isla de Margarita, Venezuela

    Directory of Open Access Journals (Sweden)

    Misael Morales

    2010-03-01

    Full Text Available La edad y el crecimiento del pez Haemulon steindachneri fueron determinados por medio de los otolitos sagitales (método directo y la distribución de frecuencia de tallas (método indirecto. Un total de 953 individuos fueron capturados por la flota artesanal de Boca del Río, suroeste de la isla de Margarita, entre julio 2005-junio 2006. Se estableció la relación talla-peso y se estimaron los parámetros de crecimiento de las curvas en longitud y peso del modelo de von Bertalanffy. El recuento de los anillos anuales en otolitos, permitió establecer cuatro grupos de edad, siendo el grupo 3+ el más representativo, con un 44.5% de la población muestreada. El cálculo de los incrementos marginales del crecimiento mensual de los otolitos, sugirió la formación de un anillo hialino anual en el mes de abril, el cual coincide con la época máxima de reproducción. No se observó diferencia significativa en las pendientes b (t s=- 1.81; p>0.05 e interceptos a (t s=-1.17; p>0.05 de hembras y machos, con una relación talla-peso para ambos sexos de W=0.0003*L2.89, la que indicó un crecimiento alométrico. Los parámetros de crecimiento quedaron establecidos en: L∞=231mm, W∞=203g, k=0.569año-1 (método directo y L∞=228mm, W∞=195g, k=0.580 año-1 (método indirecto, lo que sugiere que se trata de una especie de vida corta y crecimiento moderadamente rápido. El coeficiente de variación (CV del índice de crecimiento phi prima (Ø’, demostró semejanza de los parámetros de crecimiento en longitud obtenidos por los métodos directo e indirecto; por lo que se recomienda la aplicación del método indirecto, así como el análisis periódico de los parámetros poblacionales.Age and growth of the grunt, Haemulon steindachneri (Perciformis: Haemulidae, from the Southwest area of Margarita Island, Venezuela. Studies on fish age and growth are essential to establish models on population dynamics. We determined age and growth of the grunt

  11. Paleoambientes sedimentarios de la Formación Toro Negro (Neógeno, antepaís fracturado andino, noroeste argentino Sedimentary paleoenvironments of the Toro Negro Formation (Neogene, Andean broken foreland, northwest Argentina

    Directory of Open Access Journals (Sweden)

    Patricia L Ciccioli

    2012-09-01

    Full Text Available La Formación Toro Negro (Neógeno registra parte de la sedimentación de la cuenca de antepaís fracturado de Vinchina (Orogenia Andina en el NW argentino. Esta unidad está compuesta por conglomerados, areniscas y pelitas junto con algunos niveles de brechas y tobas depositados principalmente en ambientes continentales. Once asociaciones de facies (AF fueron reconocidas: ocho corresponden al miembro inferior y tres al superior. La AFI está compuesta por megabrechas intraformacionales y conglomerados depositados en ríos entrelazados gravosos que rellenaron el paleovalle fluvial en el norte del área. La AFII, formada por brechas intraformacionales y areniscas integrando fajas de canales fuertemente incisas dentro una planicie aluvial, fue identificada en las posiciones marginales del mencionado paleovalle. La AFIII, integrada por fajas de canales gravosos con planicies arenosas, corresponde a ríos anastomosados de clima semiárido que evolucionó a un sistema con espesas planicies fangosas con delgados desbordamientos arenosos y canales simples gravosos (AFIV. Por su parte, la AFV consiste de complejos de canales arenosos encapsulados con ciclos grano-crecientes. La AFVI está compuesta por conglomerados y areniscas guijarrosas depositadas en una planicie entrelazada que evoluciona a un sistema fluvial de menor energía (AFVII caracterizado por un aumento de depósitos fangosos con lóbulos arenosos y lentes gravosas. La AFVIII está dominada por sedimentos finos depositados en un lago somero. En el miembro superior, la AFIX corresponde a un sistema fluvial entrelazado profundo gravoso. La AFX está compuesta por facies finas acumuladas en una planicie aluvial fuertemente agradante sobre la que progradan depósitos gruesos correspondiente a un piedemonte dominado por flujos canalizados (AFXI. En la evolución paleoambiental de la Formación Toro Negro se reconocen 3 etapas. La etapa I (Mioceno Temprano corresponde a la formación de un

  12. Evaluation of probabilistic flow in two unsaturated soils

    Science.gov (United States)

    Boateng, Samuel

    2001-11-01

    A variably saturated flow model is coupled to a first-order reliability algorithm to simulate unsaturated flow in two soils. The unsaturated soil properties are considered as uncertain variables with means, standard deviations, and marginal probability distributions. Thus, each simulation constitutes an unsaturated probability flow event. Sensitivities of the uncertain variables are estimated for each event. The unsaturated hydraulic properties of a fine-textured soil and a coarse-textured soil are used. The properties are based on the van Genuchten model. The flow domain has a recharge surface, a seepage boundary along the bottom, and a no-flow boundary along the sides. The uncertain variables are saturated water content, residual water content, van Genuchten model parameters alpha (α) and n, and saturated hydraulic conductivity. The objective is to evaluate the significance of each uncertain variable to the probabilistic flow. Under wet conditions, saturated water content and residual water content are the most significant uncertain variables in the sand. For dry conditions in the sand, however, the van Genuchten model parameters α and n are the most significant. Model parameter n and saturated hydraulic conductivity are the most significant for the wet clay loam. Saturated water content is most significant for the dry clay loam. Résumé. Un modèle d'écoulement variable en milieu saturé est couplé à un algorithme d'exactitude de premier ordre pour simuler les écoulements en milieu non saturé dans deux sols. Les propriétés des sols non saturés sont considérés comme des variables incertaines avec des moyennes, des écarts-types et des distributions de probabilité marginale. Ainsi chaque simulation constitue un événement d'écoulement non saturé probable. La sensibilité des variables incertaines est estimée pour chaque événement. Les propriétés hydrauliques non saturées d'un sol à texture fine et d'un sol à texture grossière sont utilis

  13. Parking Policies in Tourist Cities Politiche della sosta in città turistiche

    Directory of Open Access Journals (Sweden)

    Rosa Anna La Rocca

    2009-05-01

    miglioramento delle condizioni di spostamento e per garantire buoni livelli di sicurezza stradale. La realizzazione di strutture per la sosta in ambito urbano, invece, è regolamentata dal programma urbano dei parcheggi introdotto alla fine degli anni ottanta. All’interno di tali strumenti, le indicazioni relative alla predisposizione di specifiche aree da destinare alla sosta turistica occupa un ruolo marginale. La totalità delle indicazioni relative alla mobilità turistica fanno riferimento a due tipi di interventi: –istituzione di una zona a traffico limitato per la circolazione dei bus turistici; –individuazione delle aree di sosta breve dove è consentito ai visitatori di scendere o salire dal bus. In relazione alla sosta, le indicazioni si riferiscono alla individuazione di aree urbane o di assi stradali dove viene consentito lo stazionamento temporaneo. Molto raramente, per quel che riguarda la situazione italiana nelle principali città turistiche, gli interventi prevedono la realizzazione di specifiche strutture integrate al trasporto pubblico o a modalità di spostamento sostenibile che garantirebbero una migliore distribuzione dei flussi turistici consentendo al contempo al visitatore differenti modalità di visita con positivi effetti anche sulla percezione della visita. Nel tentativo di dimostrare come gli interventi finalizzati alla realizzazione di aree per la sosta dei bus turistici possano essere strumenti di riqualificazione fisica e funzionale della città, l’articolo nella prima parte si focalizza sulla definizione delle caratteristiche della domanda di spostamento turistico in ambito urbano. Nella seconda parte, attraverso una panoramica delle politiche della sosta urbana in Italia si evidenzia la carenza di interventi finalizzati alla realizzazione di una rete per la sosta turistica integrata all’offerta di servizi urbani. Nella parte conclusiva si individuano gli elementi che consentirebbero alle aree di sta di porsi come aree di qualit

  14. Présentation

    Directory of Open Access Journals (Sweden)

    Gregor Perko

    2011-12-01

    intérieur du cadre de la morphologie naturelle, les mots-valises formés à partir de noms propres et de substantifs, phénomène relativement récent en ita- lien ; Thomas Schwaiger, se fondant sur les données tirées de la base « Graz Database on Reduplication », traite des constructions rédupliquées dans une perspective universelle. Deux articles adoptent une perspective contrastive: celui d’Eva Sicherl et Andreja Žele étudie la productivité des diminutifs nominaux en slovène et en anglais ; celui de Marie-Anne Berron et Marie Mouton propose une analyse détaillée de l’importance quantificative et qualificative des procédés de la morphologie marginale dans le slam en France et en Allemagne. Géraldine Walther présente un nouveau modèle général, inscrit dans une approche réalisationnelle, qui permet d’évaluer et de formaliser la (non-canonicité de phénomènes flexionnels. Un deuxième axe se situe sur la frontière séparant la morphologie dérivationnelle de la morphologie flexionnelle. Tatjana Marvin se penche sur le problème de la préservation de l’accent dans les dérivés anglais, mettant en comparaison les approches de Chomsky et de Marantz avec celle de la théorie de l’Optimalité. L’article de Patrizia Cordin explore la façon dont les constructions locatives verbales dans les langues et les dialectes romans, notamment dans le dialecte trentin, ont perdu en partie leur sens spatial au profit d’un sens grammatical plus abstrait (aspect, résultat, intensité etc.. Se focalisant sur la langue indigène d’Australie kayerdild, Erich Round insiste sur l’utilité de la notion de « morphome » qui permet d’instaurer un niveau de représentation linguistique intermédiaire entre les niveaux lexical, morphosyntaxique et morphophonologique. La contribution de Varja Cvetko Orešnik, qui adopte le cadre théorique de l’école ljubljanaise de la syntaxe naturelle, apporte quelques données nouvelles sur la morphophonologie et la

  15. Totally "Online” High School for People at Educational Risk

    Directory of Open Access Journals (Sweden)

    Giancarlo De Agostini

    2010-02-01

    herramientas WEB2, que podría reproducirse fácilmente en cualquier parte, y se proporciona completamente a través de una plataforma tecnológica de fuente abierta GNU de TIC en línea, implementada completamente en línea por el "Colegio Virtual Iberoamericano" (http://cvi.edu.ec, que ofrece servicios a estudiantes vulnerables en riesgo pedagógico que por diferentes motivos no pudieron terminar su enseñanza secundaria. Los estudiantes seleccionados reciben becas, por lo que la enseñanza es totalmente gratuita. El Proyecto Iberoamericano para Institutos en línea comenzó en octubre de 2004 con apoyo de la UNESCO, implementando los últimos seis años (en este caso de educación secundaria en cuatro especialidades, con estudiantes con edades comprendidas entre los 16 y 65 años, situados en casi 50 comunidades rurales y urbano-marginales. También trabajamos en cuatro centros de detención de jóvenes infractores y con chicos y chicas de pandillas callejeras en centros comunitarios. Hasta ahora nuestras alianzas estratégicas (más de 20 se centran con los gobiernos locales y centrales, y con fundaciones nacionales e internacionales. En el futuro próximo planeamos: ampliar la cobertura del instituto en línea al resto del país para ayudar a disminuir la brecha digital y la tasa de abandono escolar (casi el 80 %; reproducir la experiencia en el resto de la región y en otros países en África y Asia; y desarrollar un completo y profesional servicio de biblioteca digital en línea y un departamento en línea y funcional de orientación a estudiantes.

  16. Contribución al conocimiento sobre la Taxonomía, distribución geográfica y ecología de la Tortuga "Bache" (Chelydra Serpentina Acutirostris Contribución al conocimiento sobre la Taxonomía, distribución geográfica y ecología de la Tortuga "Bache" (Chelydra Serpentina Acutirostris

    Directory of Open Access Journals (Sweden)

    Medem Federico

    1977-12-01

    ; en cambio la mayoría de los especímenes de serpentina y osceola tiene la placa gular entera.13. No se encontro una diferencia perceptible respecto a la forma de la cabeza y, especialmente, del hocico de acutirostris y rossignonii; es puntiagudo y sobresaliente en ambas; en cambio el hocico de serpentina y osceola es más corto y romo que en las dos subespecies tropicales, aún en los juveniles.14. Las escamas salientes y encrestadas, situadas en tres (3 hileras en la cola, varían individualmente respecto a su forma y cantidad; no representan ningún carácter subespecífico para distinguir acutirostris de rossignonii.15. Las relaciones entre la longitud y el ancho de las placas marginales que bordean el carapax, tampoco tienen caracteres constantes en acutirostris es igual al ancho en los juveniles pero notablemente mayor que el ancho en losadultos.16. En cambio, la longitud de las marginales es mayor que el ancho en los juveniles y adultos de rossignonii.17. Se discute el estado taxonómico de las cuatro (4 formas del género Chelydra, con énfasis en acutirostris. Tanto Boulenger (1902 como Vaillant (1911 consideraron ésta como una subespecie no válida por "no estar acompañadapor una descripción adecuada", y usaron el nombre de rossignonii.  Igualmente, Carr (1952 consideró a osceola como "una subespecie débilmente definida", mientras Richmond (1958, a base de estudios anatómicos comparados, está convencido que representa no solamente una subespecie sino una especie válida.18. Estamos de acuerdo con Carr, por razón de que la mayoría de los caracteres, considerados como constantes y por eso de valor taxonómico, no lo son. Para distinguir acutirostris de rossignonii existe un solo carácter morfológico externo fácilmente discernible: la configuración de las protuberancias epidermales nucal-cervicales.  El número de las bárbulas submandibulares es muy variable en acutirostris pero más constante en rossignonii, mientras la relación entre la

  17. Structure and annual increase in a population of West Greenland caribou (Rangifer tarandus groenlandicus

    Directory of Open Access Journals (Sweden)

    Henning Thing

    1982-05-01

    bestanden udgøres af simler (2 år+, medens 2-årige og ældre bukke kun udgør 10%. Bukkenes andel i bestanden viser en klar nedgang forårsaget af selektiv jagt og naturlig vinterdødelighed. Brunsten finder sted lige efter dyrenes efterårstræk fra indlandets sommergræsgange ud mod de kystnære vinterområder. Trods marginale fødemuligheder på vintergræsgangene er der en stor kalveproduktion. Dette skyldes sandsynligvis de meget gode beiteforhold, der stadigvæk findes på indlandsområdet i tiden før kælvningen og gennem hele sommerperioden. Ved kælvningen i juni tilføres bestanden op til 40% nye individer, men efter de første to levemåneder er kalvenes andel faldet til 17 - 18%. Den store tilbagegang skyldes især en epidemisk ledbetændelse forsaget af E. coli bakterier. Kalvedødeligheden fra september til maj er kun omkring 2 - 3%, således at den årlige gennemsnitlige rekruttering ligger på ca. 15%. Når der tages højde for de øvrige aldersklassers gennemsnitlige dødelighed udgør bestandstilvæksten ved jagtsæsonens start i august blot 10%. Dødeligheden i det første leveår er af samme størrelse (60% som hos et bredt udsnit af vildrenbestande i andre nordlige områder (Fig. 7. Imidlertid sker reduktionen blandt Sisimiut-bestandens kalve nesten udelukkende i løbet af de første tre måneder efter fødselen, medens kalvedødeligheden i de andre vildrenbestande er mere jævnt fordelt over alle tolv måneder.Kokoonpano ja vuotuinen kasvu lansi-gronlantilaisessa peurakannassa.Abstract in Finnish / Yhteenveto: Yhtena osana suuremmasta ekologisesta tutkimuksesta lansi-gronlantilaisesta peurasta (Rangifer tarandus groenlandicus on Sisimiut-alueella (n. 67° P oleva kanta, jota on tutkittu sukupuoli - ja ikajakoon, tokkasuuruuteen, vasikka - vaadin suhteeseen ja vasikkakasvuun nahden. Sisimiut-kanta lasketaan olevan lukumaaraltaan 2500 ja 3000 elaimen valilla, ja se muodostuu suurimmalta osalta vuotta paaasiallisesti aivan pienista partioista - jopa 5

  18. Los grupos étnicos en la cuenca del Chuquimayo, siglos 15 y 16

    Directory of Open Access Journals (Sweden)

    1973-01-01

    'alimentation était le mais, le manioc, la patate douce et les haricots. La boisson provenait du mais et du manioc. Ces groupes avaient des pâturages et des auquénidés ils tissaient la laine et le coton. L'habillement était constitué par des chemises dont les dimensions variaient d'une nación à l'autre. Il en était de même pour la coiffure qui allait des tresses les plus longues à la coupe totale de la chevelure. 7. Un caractère culturel particulier a certains d'entre eux (Nehipe, Perico et Bagua était le salut effectué en léchant la main de la personne reçue. Ils parlaient plusieurs langues dont la plus commune était le patagon. 8. Ils préféraient se déplacer en utilisant des pirogues plutôt que des sentiers et savaient construire des ponts suspendus de lianes. Ils ont été d'extraordinaires nageurs et traversaient les torrents en portant leur charge sur la tête ou à la main. 9. Ils ne constituèrent jamais des états organisés et unifiés mais d'authentiques seigneuries (behetrías dans lesquelles les groupes vivaient indépendamment les uns des autres. Ils n'ont formé de confédération que dans les cas de danger. Les villages étaient petits et les maisons circulaires avec une charpente de bois et un toit de paille. Chaque famille avait en moyenne trois enfants. 10. Comme tout groupe humain de culture marginal de (marginale non englobé dans un état organisé, ils ont été de grands défenseurs de la liberté pour laquelle ils se sont battus. Ils avaient des lances, des sabres, des dards, des flèches et des boucliers de bais et de peau, tout comme des poignards d'os. Durant les batailles, des hommes et des femmes combattaient dans la nación de Bagua. 11. À partir de 1549 tous ces groupes ethniques ont été répartis sous forme d'encomiendas et remis a plusieurs espagnols qui conquirent et s'approprièrent les terres de Jaén. 12. L'invasion européenne a été à l'origine de graves difficultés psychologiques et biologiques. Le travail

  19. The Control of Fast Reactors: Current Methods and Future Prospects; Controle des Reacteurs a Neutrons Rapides. Methodes Actuelles et Perspectives d'Avenir; Upravlenie reaktorami na bystrykh nejtronakh. sushchestvuyushchie metody i dal'nejshie perspektivy; Control de Reactores Rapidos: Metodos Actuales y Perspectivas

    Energy Technology Data Exchange (ETDEWEB)

    Loewenstein, W. B. [Argonne National Laboratory, IL (United States)

    1964-06-15

    efectividad de los mecanismos de control han evolucionado desde evaluaciones poco precisas hasta calculos muy fidedignos confirmados experimentalmente en conjuntos criticos. El autor describe los resultados experimentales y las tecnicas analiticas, que suelen ser seguras. Los experimentos criticos que precedieron la construccion de los actuales modelos de reactores de neutrones rapidos comprendieron muchas investigaciones sobre la efectividad de sus mecanismos de control y experimentos marginales para sistemas perfeccionados en los que el cuerpo tiene un volumen mayor. El autor cita algunos estudios analiticos provisionales de los que se puede deducir que no habra necesidad de efectuar en lo sucesivo investigaciones experimentales detalladas en maquetas. (author) [Russian] Obsuzhdajutsja prakticheskie aspekty obespechenija sootvetstvujushhej reaktivnosti dlja upravlenija reaktorami na bystryh nejtronah, kotorye sushhestvenno otlichajutsja ot analogichnyh aspektov pri osushhestvlenii kontrolja sistem teplovyh nejtronov. Jeti razlichija vyzvany glavnym obrazom blagodarja nebol'shim sechenijam na bystryh nejtronah. V sistemah na bystryh nejtronah otsutstvujut sil'nye poglotiteli nejtronov. V rezul'tate jetogo takie sil'nye poglotiteli nejtronov v teplovyh reaktorah, kak produkty raspada (naprimer He i Zt)trebujut znachitel'no men'she reaktivnosti na ih kompensaciju, chem poterja reaktivnosti, vyzvannaja deleniem i zahvatom rasshhepljajushhihsja materialov. Poskol'ku atomnye sechenija bystrogo spektra dovol'no maly po sravneniju s sechenijami dlja teplovyh nejtronov atomnaja plotnost' materiala igraet vazhnuju rol' pri vybore materialov dlja regulirujushhih sterzhnej. Opisyvajutsja sushhestvujushhie tipy kontrol'nyh mehanizmov reaktorov na bystryh nejtronah. Jeti sposoby napravleny na vozmozhnost' ispol'zovanija, tam, gde jeto priemlemo,, kontrolja za utechkoj nejtronov. Kogda takoj kontrol' prakticheski neosushhestvim, to pri menjaetsja kontrol' s pomoshh'ju peredvizhenija

  20. Alimentation animale et valeur nutritionnelle induite sur les produits dérivés consommés par l’homme : Les lipides sont-ils principalement concernés ?

    Directory of Open Access Journals (Sweden)

    Bourre Jean-Marie

    2003-09-01

    . Les faibles variations susceptibles d’être éventuellement obtenues ne permettraient toutefois pas de participer significativement à l’amélioration de la couverture de besoins nutritionnels de l’homme. Les produits tripiers font exception, mais ils ne sont plus consommés que marginalement et ne peuvent concourir significativement à la couverture moyenne des besoins en nutriments de l’homme. Toutefois, concernant les poissons, de notables différences peuvent être observées selon les lieux de pêche et les saisons (entre autres, et, par voie de conséquence très probable, selon les élevages (pour les vitamines D et E, l’iode le fer et le sélénium. Pour les œufs, la composition varie beaucoup selon les formulations des aliments donnés aux poules pondeuses (principalement pour les vitamines A, D et E et plusieurs éléments, dont l’iode. Une nouvelle approche se dessine avec les micro-nutriments non indispensables pour l’homme trouvés dans les produits animaux destinés à la consommation humaine. Il s’agit, par exemple, des caroténoïdes liposolubles. Parmi ceux-ci, la lutéine et la zéaxanthine sont présentes dans le jaune de l’œuf, contribuant à sa coloration. Or, des travaux très récents montrent que ces molécules peuvent être quantitativement augmentées dans l’œuf par une alimentation appropriée des poules pondeuses. Point nouveau, la consommation d’œufs ainsi enrichis a permis d’accroître les concentrations des deux caroténoïdes dans le sang de volontaires humains, et par conséquent dans leur rétine. Par ailleurs, on sait que ces substances sont présentes dans l’œil, en particulier dans la rétine. Or, une augmentation de la prise alimentaire de lutéine et de zéaxanthine induit leur accroissement dans la rétine. D’autre part, il est bien connu que la cataracte comme la dégénérescence maculaire liée à l’âge sont presque 2 fois moins fréquentes chez les sujets dont la teneur de ces substances

  1. Análisis económico del sistema de producción de maíz amarillo en el valle del medio y bajo Sinú, departamento de Córdoba

    Directory of Open Access Journals (Sweden)

    Serpa Malvin

    2005-12-01

    agricultores medianos y grandes; sin embargo, en el analisis de costos minimos, los agricultores pequenos resultan ser mas eficientes economicamente que las explotaciones de tamano superior. Con la utilizacion de herramientas estadisticas y econometricas, los resultados indican que la produccion de maiz en Cordoba presenta rendimientos decrecientes de escala; las productividades marginales del gasto obtenidas senalan la conveniencia de reducir gastos totales, en especial en semillas y control de plagas, y aumentarlo en control de malezas.