WorldWideScience

Sample records for river sculpin cottus

  1. A second glucagon in the pancreatic islets of the daddy sculpin Cottus scorpius.

    Science.gov (United States)

    Cutfield, S M; Cutfield, J F

    1993-09-01

    The peptide hormone glucagon has been isolated from the islet tissue (Brockmann bodies) of the teleost Cottus scorpius (daddy sculpin) and sequenced. The sequence is HSEGTSNDYSKYLEDRKAQDFVQWLMNN differing at four positions from the glucagon found earlier in the same species by Conlon and coworkers (1987b, Eur. J. Biochem, 164, 117-122). Thus sculpin, in common with anglerfish, possesses two distinct glucagons. Comparative sequence data are presented as a phylogenetic tree.

  2. An individual-based simulation model for mottled sculpin (Cottus bairdi) in a southern Appalachian stream

    Science.gov (United States)

    Brenda Rashleigh; Gary D. Grossman

    2005-01-01

    We describe and analyze a spatially explicit, individual-based model for the local population dynamics of mottled sculpin (Cottus bairdi). The model simulated daily growth, mortality, movement and spawning of individuals within a reach of stream. Juvenile and adult growth was based on consumption bioenergetics of benthic macroinvertebrate prey;...

  3. LABORATORY CULTURE METHODS FOR THE MOTTLED SCULPIN (COTTUS BAIRDI)

    Science.gov (United States)

    Fish from the family Cottidae (Sculpin Family) are being researched to determine their sensitivity to various metals in freshwater systems. The ability to culture them in the lab would facilitate species sensitivity comparisons. We collected adult mottled sculpins (C. bairdi) f...

  4. Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius).

    Science.gov (United States)

    Conlon, J M; Schmidt, W E; Gallwitz, B; Falkmer, S; Thim, L

    1986-12-30

    The primary structure of pancreatic polypeptide from the teleostean fish, Cottus scorpius (daddy sculpin) was established as: YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRYNH2 The presence of a COOH-terminally alpha-amidated amino acid was established using an HPLC method of general applicability. Although the peptide shows strong homology towards anglerfish pancreatic polypeptide (86%), homology towards porcine peptide YY (PYY) (61%) and porcine neuropeptide Y (NPY) (61%) was greater than towards porcine pancreatic polypeptide (PP) (47%). This result supports suggestions that the gene duplication events which led to PP, NPY and PYY formation took place after the time of divergence of fish and mammals.

  5. Population trends and current status of the endangered Pyrenean sculpin Cottus hispaniolensis in the Spanish part of the Garonne drainage

    Directory of Open Access Journals (Sweden)

    Rocaspana Rafel

    2017-01-01

    Full Text Available The status of Pyrenean sculpin Cottus hispaniolensis was assessed in the Spanish part of the Garonne drainage on the basis of its distribution and abundance from 2001 to 2016. Population trends showed a progressive reduction in range extension and density, exacerbated by a severe spate occurred in 2013. However, C. hispaniolensis was resilient to this natural disturbance by compensating for mortality with increasing recruitment. Both occurrence and density of Pyrenean sculpin showed a positive correlation with coarse substrates. Riverine habitat deterioration, mainly channelization, presence of dams and flow regulation are the main factors threatening sculpin populations. Several management measures are proposed.

  6. Gastric evacuation rate, index of fullness, and daily ration of Lake Michigan slimy sculpin (Cottus cognatus) and deepwater sculpin (Myoxocephalus thompsonii)

    Science.gov (United States)

    Mychek-Londer, Justin G.; Bunnell, David B.

    2013-01-01

    Accurate estimates of fish consumption are required to understand trophic interactions and facilitate ecosystem-based fishery management. Despite their importance within the food-web, no method currently exists to estimate daily consumption for Great Lakes slimy (Cottus cognatus) and deepwater sculpin (Myoxocephalus thompsonii). We conducted experiments to estimate gastric evacuation (GEVAC) and collected field data from Lake Michigan to estimate index of fullness [(g prey/g fish weight)100%) to determine daily ration for water temperatures ranging 2–5 °C, coinciding with the winter and early spring season. Exponential GEVAC rates equaled 0.0115/h for slimy sculpin and 0.0147/h for deepwater sculpin, and did not vary between 2.7 °C and 5.1 °C for either species or between prey types (Mysis relicta and fish eggs) for slimy sculpin. Index of fullness varied with fish size, and averaged 1.93% and 1.85% for slimy and deepwater sculpins, respectively. Maximum index of fullness was generally higher (except for the smallest sizes) for both species in 2009–2010 than in 1976 despite reductions in a primary prey, Diporeia spp. Predictive daily ration equations were derived as a function of fish dry weight. Estimates of daily consumption ranged from 0.2 to 0.8% of their body weight, which was within the low range of estimates from other species at comparably low water temperatures. These results provide a tool to estimate the consumptive demand of sculpins which will improve our understanding of benthic offshore food webs and aid in management and restoration of these native species in the Great Lakes.

  7. The isolation, purification and amino-acid sequence of insulin from the teleost fish Cottus scorpius (daddy sculpin).

    Science.gov (United States)

    Cutfield, J F; Cutfield, S M; Carne, A; Emdin, S O; Falkmer, S

    1986-07-01

    Insulin from the principal islets of the teleost fish, Cottus scorpius (daddy sculpin), has been isolated and sequenced. Purification involved acid/alcohol extraction, gel filtration, and reverse-phase high-performance liquid chromatography to yield nearly 1 mg pure insulin/g wet weight islet tissue. Biological potency was estimated as 40% compared to porcine insulin. The sculpin insulin crystallised in the absence of zinc ions although zinc is known to be present in the islets in significant amounts. Two other hormones, glucagon and pancreatic polypeptide, were copurified with the insulin, and an N-terminal sequence for pancreatic polypeptide was determined. The primary structure of sculpin insulin shows a number of sequence changes unique so far amongst teleost fish. These changes occur at A14 (Arg), A15 (Val), and B2 (Asp). The B chain contains 29 amino acids and there is no N-terminal extension as seen with several other fish. Presumably as a result of the amino acid substitutions, sculpin insulin does not readily form crystals containing zinc-insulin hexamers, despite the presence of the coordinating B10 His.

  8. Identification of natural hybrids between Cottus poecilopus, Heckel, 1837, and Cottus gobio, Linnaeus, 1758, at a hybrid zone on the Svratka River (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Vítek, T.; Halačka, Karel; Bartoňová-Marešová, Eva; Vetešník, Lukáš; Spurný, P.

    2014-01-01

    Roč. 30, č. 1 (2014), s. 102-108 ISSN 0175-8659 Institutional support: RVO:68081766 Keywords : Fish communities * sculpins Cottus * bullhead * Pisces * Pleistocene Subject RIV: EG - Zoology Impact factor: 0.867, year: 2014

  9. Mechanosensory based orienting behaviors in fluvial and lacustrine populations of mottled sculpin (Cottus bairdi)

    Science.gov (United States)

    Sheryl Coombs; Gary D. Grossman

    2006-01-01

    We compared prey-orienting and rheotactic behaviors in a fluvial (Coweeta Creek) and lacustrine (Lake Michigan) population of mottled sculpin. Blinded sculpin from both populations exhibited unconditioned, mechanosensory based rheotaxis to low velocity flows. Whereas Lake Michigan sculpin generally showed increasing levels of positive rheotaxis to increasing velocities...

  10. Adaptive genomic divergence under high gene flow between freshwater and brackish-water ecotypes of prickly sculpin (Cottus asper) revealed by Pool-Seq.

    Science.gov (United States)

    Dennenmoser, Stefan; Vamosi, Steven M; Nolte, Arne W; Rogers, Sean M

    2017-01-01

    Understanding the genomic basis of adaptive divergence in the presence of gene flow remains a major challenge in evolutionary biology. In prickly sculpin (Cottus asper), an abundant euryhaline fish in northwestern North America, high genetic connectivity among brackish-water (estuarine) and freshwater (tributary) habitats of coastal rivers does not preclude the build-up of neutral genetic differentiation and emergence of different life history strategies. Because these two habitats present different osmotic niches, we predicted high genetic differentiation at known teleost candidate genes underlying salinity tolerance and osmoregulation. We applied whole-genome sequencing of pooled DNA samples (Pool-Seq) to explore adaptive divergence between two estuarine and two tributary habitats. Paired-end sequence reads were mapped against genomic contigs of European Cottus, and the gene content of candidate regions was explored based on comparisons with the threespine stickleback genome. Genes showing signals of repeated differentiation among brackish-water and freshwater habitats included functions such as ion transport and structural permeability in freshwater gills, which suggests that local adaptation to different osmotic niches might contribute to genomic divergence among habitats. Overall, the presence of both repeated and unique signatures of differentiation across many loci scattered throughout the genome is consistent with polygenic adaptation from standing genetic variation and locally variable selection pressures in the early stages of life history divergence. © 2016 John Wiley & Sons Ltd.

  11. Effects of un-ionized ammonia on histological, endocrine, and whole organism endpoints in slimy sculpin (Cottus cognatus)

    Energy Technology Data Exchange (ETDEWEB)

    Spencer, P. [Toxicology Centre, University of Saskatchewan, 44 Campus Drive, Saskatoon, SK, S7N 5B3 (Canada)], E-mail: paula.spencer@usask.ca; Pollock, R.; Dube, M. [Toxicology Centre, University of Saskatchewan, 44 Campus Drive, Saskatoon, SK, S7N 5B3 (Canada)

    2008-12-11

    Ammonia is known to be an important toxicant in aquatic environments. Although ammonia toxicity has been well studied in many fish species, effects of chronic exposure on slimy sculpin (Cottus cognatus), a critical biomonitoring species for northern aquatic habitats, are not well known. Further, with increasing mining development in Canada's north, this information is critical to better predict potential effects of mine effluent discharges on northern fish species. Slimy sculpin were exposed to six concentrations of un-ionized ammonia (NH{sub 3}) relevant to concentrations found in northern mining effluents: control (0 ppm), 0.278 ppm, 0.556 ppm, 0.834 ppm, 1.112 ppm, and 1.668 ppm. An LC{sub 50} of 1.529 ppm was calculated from mortality data. Histopathological examination of gills indicated significant tissue damage, measured as lamellar fusion and epithelial lifting, at 0.834 ppm, 1.112 ppm, and 1.668 ppm. Using gill endpoints, NOEC and LOEC were calculated as 0.556 ppm and 0.834 ppm, respectively. An EC{sub 50} of 0.775 ppm was determined for lamellar fusion and an EC{sub 50} of 0.842 ppm for epithelial lifting. Hemorrhage of gills was present in mortalities, which occurred at 1.668 ppm of un-ionized ammonia. A significant decrease in liver somatic index (LSI) was seen in both male and female fish at 0.834 ppm and 1.112 ppm, respectively. Gonadosomatic index (GSI) in female fish significantly increased at 1.668 ppm un-ionized ammonia with an associated significant increase in total wholebody testosterone concentrations. GSI in male fish also significantly increased at 1.668 ppm but no differences were seen in testosterone concentrations. No significant differences were seen in gonad histopathological assessments or condition factor. Gill histopathology endpoints may be a more sensitive indicator for detecting effects in slimy sculpin exposed to ammonia than traditional chronic endpoints. Results from this study indicate that ammonia concentrations commonly

  12. Complex postglacial recolonization inferred from population genetic structure of mottled sculpin Cottus bairdii in tributaries of eastern Lake Michigan, U.S.A.

    Science.gov (United States)

    Homola, J J; Ruetz, C R; Kohler, S L; Thum, R A

    2016-11-01

    This study used analyses of the genetic structure of a non-game fish species, the mottled sculpin Cottus bairdii to hypothesize probable recolonization routes used by cottids and possibly other Laurentian Great Lakes fishes following glacial recession. Based on samples from 16 small streams in five major Lake Michigan, U.S.A., tributary basins, significant interpopulation differentiation was documented (overall F ST = 0·235). Differentiation was complex, however, with unexpectedly high genetic similarity among basins as well as occasionally strong differentiation within basins, despite relatively close geographic proximity of populations. Genetic dissimilarities were identified between eastern and western populations within river basins, with similarities existing between eastern and western populations across basins. Given such patterns, recolonization is hypothesized to have occurred on three occasions from more than one glacial refugium, with a secondary vicariant event resulting from reduction in the water level of ancestral Lake Michigan. By studying the phylogeography of a small, non-game fish species, this study provides insight into recolonization dynamics of the region that could be difficult to infer from game species that are often broadly dispersed by humans. © 2016 The Fisheries Society of the British Isles.

  13. Shifts in the diets of slimy sculpin (Cottus cognatus) and lake whitefish (Coregonus clupeaformis) in Lake Ontario following the collapse of the burrowing amphipod Diporeia

    Science.gov (United States)

    Owens, Randall W.; Dittman, Dawn E.

    2003-01-01

    In Lake Ontario, the diets of slimy sculpin Cottus cognatus and lake whitefish Coregonus clupeaformis shifted from a diet dominated by the burrowing amphipod, Diporeia, and to a lesser extent, Mysis, to a more diverse diet, after Diporeia collapsed, to one dominated by Mysis and prey that were formerly less important or uncommon such as Chironomidae, Oligochaeta, and Ostracoda. Additionally, lake whitefish still preyed on native mollusks like Sphaeriidae and Gastropoda, but also preyed on exotic mollusks, Dreissena spp., which are swallowed intact and subsequently crushed in its muscular stomach. Whether Diporeia was abundant (1992) or scarce (1999), selection indices for Diporeia by slimy sculpins was positive, suggesting that Diporeia was a preferred prey. Unlike lake whitefish, slimy sculpins avoided Dreissena; therefore, energy diverted to Dreissena production was a real loss for slimy sculpins. The shifts in the diet of these benthic fishes corresponded with drastic changes in the benthic community between 1992 and 1999. The collapse of Diporeia, formerly the most abundant macroinvertebrate in the benthic community, along with sharp declines in the abundance of Oligochaeta and Sphaeriidae, coincided with the establishment and rapid expansion of Dreissena bugensis, the quagga mussel, and to a lesser degree Dreissena polymorpha, the zebra mussel. It appears that the Diporeia population first collapsed at depths >70 m in southeastern Lake Ontario by autumn 1992, at shallower depths in the eastern Lake Ontario by 1995, and along the entire south shore line at depths 100 m by 1999. In response to the disappearance of Diporeia, populations of two native benthivores, slimy sculpin and lake whitefish, collapsed in eastern Lake Ontario, perhaps due in part to starvation, because Diporeia was their principal prey. Presently, alternative food resources do not appear sufficient to sustain these two benthivores at their former levels of abundance. We do not expect slimy

  14. Complete Mitochondrial Genomes of the Cherskii's Sculpin Cottus czerskii and Siberian Taimen Hucho taimen Reveal GenBank Entry Errors: Incorrect Species Identification and Recombinant Mitochondrial Genome.

    Science.gov (United States)

    Balakirev, Evgeniy S; Saveliev, Pavel A; Ayala, Francisco J

    2017-01-01

    The complete mitochondrial (mt) genome is sequenced in 2 individuals of the Cherskii's sculpin Cottus czerskii . A surprisingly high level of sequence divergence (10.3%) has been detected between the 2 genomes of C czerskii studied here and the GenBank mt genome of C czerskii (KJ956027). At the same time, a surprisingly low level of divergence (1.4%) has been detected between the GenBank C czerskii (KJ956027) and the Amur sculpin Cottus szanaga (KX762049, KX762050). We argue that the observed discrepancies are due to incorrect taxonomic identification so that the GenBank accession number KJ956027 represents actually the mt genome of C szanaga erroneously identified as C czerskii . Our results are of consequence concerning the GenBank database quality, highlighting the potential negative consequences of entry errors, which once they are introduced tend to be propagated among databases and subsequent publications. We illustrate the premise with the data on recombinant mt genome of the Siberian taimen Hucho taimen (NCBI Reference Sequence Database NC_016426.1; GenBank accession number HQ897271.1), bearing 2 introgressed fragments (≈0.9 kb [kilobase]) from 2 lenok subspecies, Brachymystax lenok and Brachymystax lenok tsinlingensis , submitted to GenBank on June 12, 2011. Since the time of submission, the H taimen recombinant mt genome leading to incorrect phylogenetic inferences was propagated in multiple subsequent publications despite the fact that nonrecombinant H taimen genomes were also available (submitted to GenBank on August 2, 2014; KJ711549, KJ711550). Other examples of recombinant sequences persisting in GenBank are also considered. A GenBank Entry Error Depositary is urgently needed to monitor and avoid a progressive accumulation of wrong biological information.

  15. Using molecular biomarkers and traditional morphometric measurements to assess the health of slimy sculpin (Cottus cognatus) from streams with elevated selenium in North-Eastern British Columbia.

    Science.gov (United States)

    Miller, Lana L; Isaacs, Meghan A; Martyniuk, Christopher J; Munkittrick, Kelly R

    2015-10-01

    Canadian fish-based environmental effects monitoring programs use individual and population-level endpoints to assess aquatic health. Impacts of coal mining and selenium (Se) exposure were assessed in slimy sculpin (Cottus cognatus) from reference streams located both inside and outside of a coal zone, and from 1 stream with a history of coal mining, using traditional environmental effects monitoring endpoints. In addition, physical characteristics of the streams and benthic macro-invertebrate communities were assessed. To determine whether the assessment of effects could be improved by including molecular markers, real-time polymerase chain reaction assays were optimized for genes associated with reproduction (vtg, esr1, star, cyp19a1, and gys2), and oxidative and cellular stress (sod1, gpx, gsr, cat, and hsp 90). Water Se levels exceeded guidelines in the stream with historical mining (4 μg/L), but benthic macroinvertebrates did not exceed dietary thresholds (2-3 μg/g dry wt). Whole-body Se levels were above British Columbia's tissue guideline in fish from all streams, but only above the draft US Environmental Protection Agency (USEPA) criterion (7.91 μg/g dry wt) at the reference stream inside the coal zone. Some markers of cellular and oxidative stress were elevated in fish liver at the exposed site (sod1, gpx), but some were lower (cat, sod1, gpx, gsr, hsp90) in the gonads of fish inside the coal zone. Some of the differences in gene expression levels between the reference and impacted sites were sex dependent. Based on benthic macroinvertebrate assessments, the authors hypothesize that traditional and molecular differences in slimy sculpin at impacted sites may be driven by food availability rather than Se exposure. The present study is the first to adapt molecular endpoints in the slimy sculpin for aquatic health assessments. © 2015 SETAC.

  16. Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).

    Science.gov (United States)

    Conlon, J M; Falkmer, S; Thim, L

    1987-04-01

    Three peptides isolated from the Brockmann bodies of the daddy sculpin, a teleostean fish, have been identified as fragments of one or more proglucagons. The peptide L Q D A E D S S R F D A D D T L A G E A R E L S T P K represents the NH2 terminus of proglucagon (residues 1-27), H S E G T F S N D Y S K Y L E T R R A Q D F V Q W L K N S represents glucagon and H A D G T F T S D V S S Y L N D Q A I K D F V A K L K S G K V represents the glucagon-like peptide at the COOH terminus of the precursor. The fast-atom bombardment mass spectra of the three peptides were consistent with the proposed structures and demonstrated that further posttranslational modifications of the peptides had not taken place. Sculpin glucagon is identical to anglerfish glucagon II but sculpin proglucagon(1-27) and glucagon-like peptide show stronger homology to the corresponding regions of anglerfish proglucagon I than to proglucagon II. The structures of the peptides are suggestive of the action of trypsin-like and carboxypeptidase-B-like enzymes at the site of pairs of basic amino acid residues in proglucagon. The presence of a COOH-terminal lysyl group in proglucagon(1-27) may indicate, however, that the penultimate prolyl residue partially inhibits the action of the carboxypeptidase-B-like activity.

  17. Complete Mitochondrial Genomes of the Cherskii’s Sculpin Cottus czerskii and Siberian Taimen Hucho taimen Reveal GenBank Entry Errors: Incorrect Species Identification and Recombinant Mitochondrial Genome

    Science.gov (United States)

    Balakirev, Evgeniy S; Saveliev, Pavel A; Ayala, Francisco J

    2017-01-01

    The complete mitochondrial (mt) genome is sequenced in 2 individuals of the Cherskii’s sculpin Cottus czerskii. A surprisingly high level of sequence divergence (10.3%) has been detected between the 2 genomes of C czerskii studied here and the GenBank mt genome of C czerskii (KJ956027). At the same time, a surprisingly low level of divergence (1.4%) has been detected between the GenBank C czerskii (KJ956027) and the Amur sculpin Cottus szanaga (KX762049, KX762050). We argue that the observed discrepancies are due to incorrect taxonomic identification so that the GenBank accession number KJ956027 represents actually the mt genome of C szanaga erroneously identified as C czerskii. Our results are of consequence concerning the GenBank database quality, highlighting the potential negative consequences of entry errors, which once they are introduced tend to be propagated among databases and subsequent publications. We illustrate the premise with the data on recombinant mt genome of the Siberian taimen Hucho taimen (NCBI Reference Sequence Database NC_016426.1; GenBank accession number HQ897271.1), bearing 2 introgressed fragments (≈0.9 kb [kilobase]) from 2 lenok subspecies, Brachymystax lenok and Brachymystax lenok tsinlingensis, submitted to GenBank on June 12, 2011. Since the time of submission, the H taimen recombinant mt genome leading to incorrect phylogenetic inferences was propagated in multiple subsequent publications despite the fact that nonrecombinant H taimen genomes were also available (submitted to GenBank on August 2, 2014; KJ711549, KJ711550). Other examples of recombinant sequences persisting in GenBank are also considered. A GenBank Entry Error Depositary is urgently needed to monitor and avoid a progressive accumulation of wrong biological information. PMID:28890653

  18. Diet and habitat use by age-0 deepwater sculpins in northern Lake Huron, Michigan and the Detroit River

    Science.gov (United States)

    Roseman, Edward F.

    2014-01-01

    Deepwater sculpins (Myoxocephalus thompsonii) are an important link in deepwater benthic foodwebs of the Great Lakes. Little information exists about deepwater sculpin spawning habits and early life history ecology due to difficulty in sampling deep offshore habitats. Larval and age-0 deepwater sculpins collected in northern Lake Huron and the Detroit River during 2007 were used to improve our understanding of their habitat use, diet, age, and growth. Peak larval density reached 8.4/1000 m3 in the Detroit River during April and was higher than that in Lake Huron. Offshore bottom trawls at DeTour and Hammond Bay first collected benthic age-0 deepwater sculpins in early September when fish were ≥ 25 mm TL. Otolith analysis revealed that hatch dates for pelagic larvae occurred during late March and larvae remained pelagic for 40 to 60 days. Diet of pelagic larvae (10–21 mm TL) was dominated by calanoid copepods at all sample locations. Diets of benthic age-0 fish varied by location and depth: Mysis and chironomids were prevalent in fish from Hammond Bay and the 91 m site at DeTour, but only chironomids were found in fish from the 37 m DeTour site. This work showed that nearshore epilimnetic sites were important for pelagic larvae and an ontogenetic shift from pelagic planktivore to benthivore occurred at about 25 mm TL in late summer. Age analysis showed that larvae remained pelagic long enough to be transported through the St. Clair–Detroit River system, Lake Erie, and the Niagara River, potentially contributing to populations in Lake Ontario.

  19. Epidermis structure and blood parameter differences between sculpin Cottus gobio and Siberian sculpin Cottus poecilopus from the Morava watershed

    Czech Academy of Sciences Publication Activity Database

    Halačka, Karel; Vítek, T.; Vetešník, Lukáš; Spurný, P.

    2012-01-01

    Roč. 61, č. 1 (2012), s. 9-16 ISSN 0139-7893 Institutional support: RVO:68081766 Keywords : goblet cell * sacciform cell * erythrocyte * leucocyte Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

  20. An Ecological Study on the Introduction of the Banded Sculpin Into a Coal Flyash Impacted Stream

    International Nuclear Information System (INIS)

    Carrico, B.A.; Ryon, M.G.

    1996-02-01

    A number of banded sculpins [Cottus carolinae (Gill)] were obtained from a population in a reference stream, marked with subcutaneous acrylic paint injections, and introduced into McCoy Branch, a small second-order stream located on the Oak Ridge Reservation in eastern Tennessee, which was inhabited by only a few banded sculpins prior to the study. McCoy Branch had received deposits of coal ash slurry for a prolonged period, however, there were some indications of recovery in the macroinvertebrate community due to improvements in water quality. Stream habitat characteristics and water chemistry parameters were monitored in McCoy Branch and a reference stream for a three-year period. Feeding patterns and reproductive activities of the banded sculpins were also monitored during the study. Sculpin population parameters including density, condition factor, and young-of-year (YOY) abundance and survival were studied. The results of the study show that the introduced fish have survived and appear to be in good condition. The sculpins have maintained a density of approximately 0.12 fish per square meter of stream, a figure similar to that found in other headwater streams located in the region. Colonization rates and sculpin densities in McCoy Branch were lower than expected, perhaps due to physical habitat degradation and reduced macroinvertebrate abundance. Evidence of sculpin reproduction in McCoy Branch was seen in the presence of gravid female sculpins (1994 and 1995) and YOY fish (1993 through 1995 year classes). This study indicates that McCoy Branch continues to recover from past perturbations to the point where it can now support a viable population of banded sculpins

  1. An Ecological Study on the Introduction of the Banded Sculpin Into a Coal Flyash Impacted Stream

    Energy Technology Data Exchange (ETDEWEB)

    Carrico, B.A.; Ryon, M.G.

    1996-02-01

    A number of banded sculpins [Cottus carolinae (Gill)] were obtained from a population in a reference stream, marked with subcutaneous acrylic paint injections, and introduced into McCoy Branch, a small second-order stream located on the Oak Ridge Reservation in eastern Tennessee, which was inhabited by only a few banded sculpins prior to the study. McCoy Branch had received deposits of coal ash slurry for a prolonged period, however, there were some indications of recovery in the macroinvertebrate community due to improvements in water quality. Stream habitat characteristics and water chemistry parameters were monitored in McCoy Branch and a reference stream for a three-year period. Feeding patterns and reproductive activities of the banded sculpins were also monitored during the study. Sculpin population parameters including density, condition factor, and young-of-year (YOY) abundance and survival were studied. The results of the study show that the introduced fish have survived and appear to be in good condition. The sculpins have maintained a density of approximately 0.12 fish per square meter of stream, a figure similar to that found in other headwater streams located in the region. Colonization rates and sculpin densities in McCoy Branch were lower than expected, perhaps due to physical habitat degradation and reduced macroinvertebrate abundance. Evidence of sculpin reproduction in McCoy Branch was seen in the presence of gravid female sculpins (1994 and 1995) and YOY fish (1993 through 1995 year classes). This study indicates that McCoy Branch continues to recover from past perturbations to the point where it can now support a viable population of banded sculpins.

  2. A short-term look at potential changes in Lake Michigan slimy sculpin diets

    Science.gov (United States)

    French, John R. P.; Stickel, Richard G.; Stockdale, Beth A.; Black, M. Glen

    2010-01-01

    Diporeia hoyi and Mysis relicta are the most important prey items of slimy sculpins (Cottus cognatus) in the Great Lakes. Slimy sculpins were collected from dreissenid-infested bottoms off seven Lake Michigan ports at depths of 27–73 m in fall 2003 to study their lake-wide diets. Relatively large dreissenid biomass occurred at depths of 37- and 46-m. Quagga mussels (Dreissena bugnesis) composed at least 50% of dreissenid biomass at Manistique, Saugatuck, and Sturgeon Bay. Mysis accounted for 82% of the sculpin diet by dry weight at eastern Lake Michigan while Diporeia composed 54–69% of the diet at western Lake Michigan and dominated the diets of slimy sculpins at all sites deeper than 46 m. In northern Lake Michigan, this diet study in new sites showed that slimy sculpin consumed more prey with low energy contents, especially chironomids, than Mysis and Diporeia in shallow sites (depth diet studies on sedentary benthic fishes to be conducted along perimeters of the Great Lakes to observe changes in their diets that may be impacted by changing benthic macroinvertebrate communities.

  3. On behavioural responses to smell and sight of alpine bullhead Cottus poecilopus Heckel for an allopatric and a sympatric population of brown trout Salmo trutta L.

    OpenAIRE

    Hauge, Joakim

    2007-01-01

    Freshwater sculpins and salmonids coexist in many streams throughout the Northern hemisphere, and often constitute an important component of stream ecosystems. Alpine bullhead Cottus poecilopus Heckel have been known to predate eggs and fry of brown trout Salmo trutta L., and also to function as a competitor to older brown trout for habitat and prey items. This study was designed to examine possible behavioural differences in activity level and positioning between a sympatric and an allopatri...

  4. Patterns of ancestry and genetic diversity in reintroduced populations of the slimy sculpin: Implications for conservation

    Science.gov (United States)

    Huff, David D.; Miller, Loren M.; Vondracek, Bruce C.

    2010-01-01

    Reintroductions are a common approach for preserving intraspecific biodiversity in fragmented landscapes. However, they may exacerbate the reduction in genetic diversity initially caused by population fragmentation because the effective population size of reintroduced populations is often smaller and reintroduced populations also tend to be more geographically isolated than native populations. Mixing genetically divergent sources for reintroduction purposes is a practice intended to increase genetic diversity. We documented the outcome of reintroductions from three mixed sources on the ancestral composition and genetic variation of a North American fish, the slimy sculpin (Cottus cognatus). We used microsatellite markers to evaluate allelic richness and heterozygosity in the reintroduced populations relative to computer simulated expectations. Sculpins in reintroduced populations exhibited higher levels of heterozygosity and allelic richness than any single source, but only slightly higher than the single most genetically diverse source population. Simulations intended to mimic an ideal scenario for maximizing genetic variation in the reintroduced populations also predicted increases, but they were only moderately greater than the most variable source population. We found that a single source contributed more than the other two sources at most reintroduction sites. We urge caution when choosing whether to mix source populations in reintroduction programs. Genetic characteristics of candidate source populations should be evaluated prior to reintroduction if feasible. When combined with knowledge of the degree of genetic distinction among sources, simulations may allow the genetic diversity benefits of mixing populations to be weighed against the risks of outbreeding depression in reintroduced and nearby populations.

  5. Estimating differential reproductive success from nests of related individuals, with application to a study of the Mottled Sculpin, Cottus bairdi

    Science.gov (United States)

    Beatrix Jones; Gary D. Grossman; Daniel C.I. Walsh; Brady A. Porter; John C. Avise; Anthony C. Flumera

    2007-01-01

    Understanding how variation in reproductive success is related to demography is a critical component in understanding the life history of an organism. Parentage analysis using molecular markers can be used to estimate the reproductive success of different groups of individuals in natural populations. Previous models have been developed for cases where offspring are...

  6. Hybridization between Cottus gobio and Cottus poecilopus in the Odra River drainage basin (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Marešová, Eva; Lusková, Věra; Lojkásek, B.

    2012-01-01

    Roč. 67, č. 4 (2012), s. 788-795 ISSN 0006-3088 R&D Projects: GA MŽP(CZ) SPII2D1/9/07 Institutional support: RVO:68081766 Keywords : bullheads * hybrid zones * microsatellites * S7 nuclear gene Subject RIV: EG - Zoology Impact factor: 0.506, year: 2012

  7. Reproduction of the shorthorn sculpin Myoxocephalus scorpius in northern Norway

    NARCIS (Netherlands)

    Luksenburg, JA; Pedersen, T; Falk-Petersen, IB

    The reproduction and life history events of the shorthorn sculpin Myoxocephalus scorpius were studied in an unexploited high latitude population in Tromso, northern Norway. Shorthorn sculpins were sampled from November 1998 to March 1999 to determine sex ratio, spawning period, oogenesis, fecundity,

  8. Complete Mitochondrial Genomes of the Cherskii’s Sculpin and Siberian Taimen Reveal GenBank Entry Errors: Incorrect Species Identification and Recombinant Mitochondrial Genome

    Directory of Open Access Journals (Sweden)

    Evgeniy S Balakirev

    2017-08-01

    Full Text Available The complete mitochondrial (mt genome is sequenced in 2 individuals of the Cherskii’s sculpin Cottus czerskii . A surprisingly high level of sequence divergence (10.3% has been detected between the 2 genomes of C czerskii studied here and the GenBank mt genome of C czerskii (KJ956027. At the same time, a surprisingly low level of divergence (1.4% has been detected between the GenBank C czerskii (KJ956027 and the Amur sculpin Cottus szanaga (KX762049, KX762050. We argue that the observed discrepancies are due to incorrect taxonomic identification so that the GenBank accession number KJ956027 represents actually the mt genome of C szanaga erroneously identified as C czerskii . Our results are of consequence concerning the GenBank database quality, highlighting the potential negative consequences of entry errors, which once they are introduced tend to be propagated among databases and subsequent publications. We illustrate the premise with the data on recombinant mt genome of the Siberian taimen Hucho taimen (NCBI Reference Sequence Database NC_016426.1; GenBank accession number HQ897271.1, bearing 2 introgressed fragments (≈0.9 kb [kilobase] from 2 lenok subspecies, Brachymystax lenok and Brachymystax lenok tsinlingensis , submitted to GenBank on June 12, 2011. Since the time of submission, the H taimen recombinant mt genome leading to incorrect phylogenetic inferences was propagated in multiple subsequent publications despite the fact that nonrecombinant H taimen genomes were also available (submitted to GenBank on August 2, 2014; KJ711549, KJ711550. Other examples of recombinant sequences persisting in GenBank are also considered. A GenBank Entry Error Depositary is urgently needed to monitor and avoid a progressive accumulation of wrong biological information.

  9. Structural characterization of peptides derived from prosomatostatins I and II isolated from the pancreatic islets of two species of teleostean fish: the daddy sculpin and the flounder.

    Science.gov (United States)

    Conlon, J M; Davis, M S; Falkmer, S; Thim, L

    1987-11-02

    The primary structures of three peptides from extracts from the pancreatic islets of the daddy sculpin (Cottus scorpius) and three analogous peptides from the islets of the flounder (Platichthys flesus), two species of teleostean fish, have been determined by automated Edman degradation. The structures of the flounder peptides were confirmed by fast-atom bombardment mass spectrometry. The peptides show strong homology to residues (49-60), (63-96) and (98-125) of the predicted sequence of preprosomatostatin II from the anglerfish (Lophius americanus). The amino acid sequences of the peptides suggest that, in the sculpin, prosomatostatin II is cleaved at a dibasic amino acid residue processing site (corresponding to Lys61-Arg62 in anglerfish preprosomatostatin II). The resulting fragments are further cleaved at monobasic residue processing sites (corresponding to Arg48 and Arg97 in anglerfish preprosomatostatin II). In the flounder the same dibasic residue processing site is utilised but cleavage at different monobasic sites takes place (corresponding to Arg50 and Arg97 in anglerfish preprosomatostatin II). A peptide identical to mammalian somatostatin-14 was also isolated from the islets of both species and is presumed to represent a cleavage product of prosomatostatin I.

  10. Food habits of Arctic staghorn sculpin (Gymnocanthus tricuspis) and shorthorn sculpin (Myoxocephalus scorpius) in the northeastern Chukchi and western Beaufort Seas

    Science.gov (United States)

    Gray, Benjamin P.; Norcross, Brenda L.; Beaudreau, Anne H.; Blanchard, Arny L.; Seitz, Andrew C.

    2017-01-01

    Arctic staghorn sculpin (Gymnocanthus tricuspis) and shorthorn sculpin (Myoxocephalus scorpius) belong to Cottidae, the second most abundant fish family in the western Arctic. Although considered important in food webs, little is known about their food habits throughout this region. To address this knowledge gap, we examined and compared the diets of 515 Arctic staghorn sculpin and 422 shorthorn sculpin using stomachs collected over three summers in the northeastern Chukchi Sea (2010-2012) and one summer in the western Beaufort Sea (2011). We used permutational multivariate analysis of variance (PERMANOVA) and non-metric multidimensional scaling (nMDS) to compare sculpin diets between regions and selected size classes. Differences in mouth morphologies and predator size versus prey size relationships were examined using regression techniques. Arctic staghorn sculpin and shorthorn sculpin diet compositions differed greatly throughout the Chukchi and Beaufort Seas. Regardless of body size, the smaller-mouthed Arctic staghorn sculpin consumed mostly benthic amphipods and polychaetes, whereas the larger-mouthed shorthorn sculpin shifted from a diet composed of benthic and pelagic macroinvertebrates as smaller individuals to shrimps and fish prey as larger individuals. Within shared habitats, the sculpins appear to partition prey, either by taxa or size, in a manner that suggests no substantial overlap occurs between species. This study increases knowledge of sculpin feeding ecology in the western Arctic and offers regional, quantitative diet information that could support current and future food web modeling efforts.

  11. Experimental Gravel Bar Habitat Creation in the Tombigbee River, Mississippi

    National Research Council Canada - National Science Library

    Miller, Andrew C

    2006-01-01

    Prior to development of the Tennessee Tombigbee Waterway (TTW), the Tombigbee River was well-known for supporting a dense and diverse fauna, including sculpins, minnows, mussels, snails, worms, and immature insects...

  12. Population demographics and life history of the round hickorynut (Obovaria subrotunda) in the Duck River, Tennessee

    Science.gov (United States)

    Ehlo, Chase A.; Layzer, James B.

    2014-01-01

    Population characteristics and life history aspects of healthy mussel populations are poorly understood. The reproductive cycle, age and growth, and population structure of Obovaria subrotunda were examined at four sites in the middle Duck River, Tennessee. Obovaria subrotunda was confirmed to be a bradytictic species, spawning in the late summer and holding glochidia in the gills for 11 mo until the following summer. Fecundity was positively related to mussel length (R2  =  0.75) and ranged from 7122 to 76,584 glochidia. Fourteen species of fish found in the Duck River, in the families Percidae, Cyprinidae, and Cottidae, were infested with glochidia in the laboratory to examine potential hosts. Juveniles transformed onEtheostoma blennioides (greenside darter), E. obama (spangled darter), E. flabellare (fantail darter), and Cottus carolinae (banded sculpin). Analyses of shell thin-sections indicated that males grew faster and obtained a larger size than females. Individuals live to at least 14 y old. Females became sexually mature at age one. Four sites were quantitatively sampled using a systematic design with three random starts. The observed ratio of adult males to females (0.9∶1) did not differ significantly from 1∶1. Results of the quantitative sampling showed an increase in density compared to earlier studies and a high proportion of 1 to 5 y old O. subrotunda.

  13. New species of Freitascapillaria (Nematoda: Capillariidae) from the intestine of Cottus caeruleomentum (Teleostei: Cottidae) in Maryland

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Muzzall, P.

    2009-01-01

    Roč. 95, č. 4 (2009), s. 987-990 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Freitascapillaria * Cottus * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009

  14. Environmental Baseline Studies of St. Marys River Near Neebish Island, Michigan, Prior to Proposed Extension of Navigation Season, 1981. Great Lakes- St. Lawrence Seaway, Navigation Season Extension Program

    Science.gov (United States)

    1983-06-01

    developmental stage were usually measured. All fish larvae were identified to the lowest taxonomic unit. Complete descriptions of the early life history ...14 04 e44 14 C4 04 %1 On 14 U.0 ’. 1 (T% N Nq N4 C14 Ř 00 IkeA .4 IA C4 - * eq N C- * en .4 .4 U in * . n . aD cc Cn -4 0o en % z ; 0 c 0O 0: oc 0 i...Dissertation. Mich. State Univ. In preparation. Bailey, J. E. 1952. Life history and ecology of the sculpin Cottus bairdi punctulatus in southwestern

  15. Comparison of heavy metals, parasites and histopathology in sculpins (Myoxocephalus spp.) from two sites at a lead-zinc mine in North East Greenland

    DEFF Research Database (Denmark)

    Nørregaard, Rasmus Dyrmose; Dang, Mai; Bach, Lis

    2018-01-01

    light on the present contamination and its potential effects on local fish we investigated gill and liver histology of sculpins (Myoxocephalus spp.) around the former mining area. Two species of sculpins were caught; shorthorn sculpins (M. scorpius; n = 16) and fourhorn sculpins (M. quadricornis; n = 17...... a significantly higher prevalence of chondroplastic tissue and intensity of neutral, mixed and total mucus cells in the gills compared to the shorthorn sculpins. The data indicate that both sculpin species could be useful indicator species for environmental monitoring of metal pollution in Arctic areas. However...

  16. Prevalence of the parasitic copepod Haemobaphes intermedius on juvenile buffalo sculpins from Washington State

    Science.gov (United States)

    Halpenny, C.M.; Kocan, R.M.; Hershberger, P.K.

    2004-01-01

    The parasitic copepod, Haemobaphes intermedius, was detected in 62% of juvenile buffalo sculpins Enophrys bison, a previously unreported host, from the San Juan Islands archipelago in Washington State. Most infestations were characterized by the presence of a single female copepod infestations with multiple H. intermedius occurred either unilaterally or bilaterally in 29% of parasitized individuals. Impaired condition of parasitized hosts was indicated by significantly lower total lengths and weights (34.9 mm; 1.6 g) than in unparasitized cohorts (38.9 mm; 2.1 g). Host specificity was indicated by the failure to detect H. intermedius in 43 sympatric great sculpins Myoxocephalus polyacanthocephalus from the same location.

  17. Metal residues, histopathology and presence of parasites in the liver and gills of fourhorn sculpin (Myoxocephalus quadricornis) and shorthorn sculpin (Myoxocephalus scorpius) near a former lead-zinc mine in East Greenland

    Energy Technology Data Exchange (ETDEWEB)

    Dang, Mai [Institute of Marine and Antarctic Studies University of Tasmania, Launceston, Tasmania 7250 (Australia); Nørregaard, Rasmus; Bach, Lis; Sonne, Christian; Søndergaard, Jens; Gustavson, Kim; Aastrup, Peter [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, PO Box 358, DK-4000 Roskilde (Denmark); Nowak, Barbara, E-mail: B.Nowak@utas.edu.au [Institute of Marine and Antarctic Studies University of Tasmania, Launceston, Tasmania 7250 (Australia)

    2017-02-15

    Fourhorn sculpins (Myoxocephalus quadricornis) and shorthorn sculpins (Myoxocephalus scorpius) have been considered suitable local bioindicators for environmental monitoring studies in the Arctic. Because these species share many characteristics, data from the two species have previously been pooled when assessing marine metal contamination. A chemical and histological study was conducted on fourhorn and shorthorn sculpins collected around a contaminated lead-zinc mine at East Greenland to investigate whether there were any differences in the residues of metals, histopathology and parasites in liver and gills between the two sculpin species. The results demonstrated that concentrations of copper (Cu), zinc (Zn), mercury (Hg) and lead (Pb) were significantly higher in the fourhorn sculpins (p<0.001) while there were no significant differences for arsenic (As) or cadmium (Cd). Furthermore, density of blood vessel fibrosis (p=0.028), prevalence and density of chondroplasia (p=0.002 and p=0.005, respectively), number of mucin-containing mucous cells (p<0.001) and chloride cells (p<0.001) and mean intensity of colonial Peritricha (p<0.001) were significantly higher in fourhorn sculpin. Based on these results we suggest that pooling the two species when conducting environmental assessments is not recommended as it can lead to incorrect conclusions. We propose that a larger study investigating the biological effects of zinc-lead mining in Greenland is needed. - Highlights: • Fourhorn sculpins (Myoxocephalus quadricornis) more sensitive to pollution than shorthorn sculpins (Myoxocephalus scorpius). • Metal residues, histological changes and presence of parasites were species-specific. • Different sculpin species should not be pooled together as pollution biomarkers.

  18. Sexual and geographical variation in life history parameters of the shorthorn sculpin

    NARCIS (Netherlands)

    Luksenburg, JA; Pedersen, T

    2002-01-01

    A total of 293 shorthorn sculpins Myoxocephalus scorpius from Tromso, northern Norway, were sampled between November 1998 and April 1999 to determine sex, total length, age, growth, maturity and mortality. Females grew to larger sizes (L-infinity=26.9 v. 18.5 cm), matured later (2 v. 1 year of age)

  19. Redescription of Rhabdochona cotti (Nematoda, Rhabdochonidae) from Cottus caeruleomentum (Teleostei, Cottidae) in Maryland, USA, with remarks on the taxonomy of North American Rhabdochona spp

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Muzzall, P.

    2007-01-01

    Roč. 52, č. 1 (2007), s. 51-57 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Rhabdochona * Cottus * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.814, year: 2007

  20. 76 FR 3044 - Fisheries of the Exclusive Economic Zone Off Alaska; Sculpins, Sharks, Squid, and Octopus in the...

    Science.gov (United States)

    2011-01-19

    ..., Squid, and Octopus in the Gulf of Alaska AGENCY: National Marine Fisheries Service (NMFS), National... prohibiting directed fishing for sculpins, sharks, squid, and octopus in the Gulf of Alaska (GOA). This action..., and octopus in the GOA. DATES: Effective 1200 hrs, Alaska local time (A.l.t.), January 13, 2011...

  1. Biochemical indicators of pollution exposure in shorthorn sculpin (Myoxocephalus scorpius), caught in four harbours on the southwest coast of Iceland.

    Science.gov (United States)

    Stephensen; Svavarsson; Sturve; Ericson; Adolfsson-Erici; Förlin

    2000-04-01

    Shorthorn sculpins (Myoxocephalus scorpius) were caught in four Icelandic harbours, differing in size, use and traffic. Biochemical responses in liver were measured and chemicals analysed in bile. Eyrarbakki harbour, which has not been in use for many years was chosen as a control site. Njar partial differentialvík harbour is a small fishing harbour and a marina, Sandger partial differentiali harbour is a large fishing harbour, and Reykjavík harbour is a large fishing harbour and an international transport harbour. Higher levels of DNA-adducts and cytochrome P4501A (CYP1A) in the fish from the harbours in Sandger partial differentiali, Njar partial differentialvík and Reykjavík, compared to Eyrarbakki harbour, indicate PAH exposure. This was confirmed by PAH analysis in bile. The higher activities of the antioxidant enzymes catalase (CAT), glutathione peroxidase (GPx) and glutathione reductase (GR) in fish caught in Sandger partial differentiali, than in fish caught in the other harbours, indicate exposure of sculpin to prooxidative compounds in Sandger partial differentiali harbour. Shorthorn sculpin seems to be a convenient species for monitoring pollution in northern coastal areas.

  2. Metal levels in flathead sole (Hippoglossoides elassodon) and great sculpin (Myoxocephalus polyacanthocephalus) from Adak Island, Alaska: Potential risk to predators and fishermen

    International Nuclear Information System (INIS)

    Burger, Joanna; Gochfeld, Michael; Jeitner, Christian; Burke, Sean; Stamm, Timothy

    2007-01-01

    Increasingly there is a need to assess the contaminant levels in fish as indicators of the health and well-being of both the fish and their consumers, including humans. This paper examines the levels of arsenic, cadmium, chromium, lead, manganese, mercury, and selenium in the kidney, liver, and muscle of great sculpin and flathead sole from Adak Island in the Aleutian Islands, Alaska. Both species are consumed by the local Aleuts and others. There were significant differences in the levels of heavy metals as a function of tissue for both fish species; the liver of sculpin and sole generally had the highest levels of most metals, except for arsenic, lead, and selenium. Sole had significantly higher mean levels of arsenic in kidney (32,384 vs. 531 ppb, wet weight), liver (18,954 vs. 2532 ppb), and muscle (19,452 vs. 1343 ppb) than did sculpin. Sole also had higher mean levels of cadmium (230 vs. 63 ppb), lead (1236 vs. 48 ppb), mercury (150 vs. 107 ppb), and selenium (5215 vs. 1861 ppb) in kidney than did sculpin. There were significant correlations among weight and length measurements for both species. However, except for mercury, there were few significant correlations among tissue types for most metals. Only mercury and manganese levels were significantly correlated with size for sculpin (but not for sole). Levels of arsenic, lead, and mercury may pose a risk to predators that consume them, and arsenic and mercury may pose a risk to human consumers

  3. Applications in environmental risk assessment of leucocyte apoptosis, necrosis and respiratory burst analysis on the European bullhead, Cottus sp

    International Nuclear Information System (INIS)

    Bado-Nilles, Anne; Jolly, Sabrina; Porcher, Jean-Marc; Palluel, Olivier; Geffard, Alain

    2014-01-01

    The use of a biochemical multi-biomarker approach proved insufficient to obtain clear information about ecosystem health. The fish immune system is considered as an attractive non-specific marker for environmental biomonitoring which has direct implications in individual fitness and population growth. Thus, the present work proposes the use of fish immunomarkers together with more common biochemical biomarkers in sampling conditions optimized to reduce biomarker variability and increase parameter robustness. European bullheads (Cottus sp.) from 11 stations in the Artois-Picardie watershed (France) were sampled. In the multiple discriminant analysis, the sites were highly correlated with apoptosis, respiratory burst, GST and EROD activities. Moreover, the use together of biochemical and immune markers increased the percentage of fish correctly classed at each site and enhanced site separation. This study argues in favor of the utilization of apoptosis, necrosis and respiratory burst for the determination of environmental risk assessment in addition to the set of biochemical biomarkers commonly used in fish. -- Highlights: • Optimization of biomarker variability and parameters robustness for biomonitoring. • Adding of fish immunomarkers together with more current biochemical biomarkers. • Use of immune system allows a better evaluation of fish health. • We argue for the deployment of immunomarkers in freshwater monitoring programs. -- Attractive use of freshwater fish leucocyte non-specific immune function in environmental risk assessment according to international recommendations

  4. Impact of ocean acidification on the hypoxia tolerance of the woolly sculpin, Clinocottus analis.

    Science.gov (United States)

    Hancock, Joshua R; Place, Sean P

    2016-01-01

    As we move into the Anthropocene, organisms inhabiting marine environments will continue to face growing challenges associated with changes in ocean pH (ocean acidification), dissolved oxygen (dead zones) and temperature. These factors, in combination with naturally variable environments such as the rocky intertidal zone, may create extreme physiological challenges for organisms that are already performing near their biological limits. Although numerous studies have examined the impacts of climate-related stressors on intertidal animals, little is known about the underlying physiological mechanisms driving adaptation to ocean acidification and how this may alter organism interactions, particularly in marine vertebrates. Therefore, we have investigated the effects of decreased ocean pH on the hypoxia response of an intertidal sculpin, Clinocottus analis . We used both whole-animal and biochemistry-based analyses to examine how the energetic demands associated with acclimation to low-pH environments may impact the fish's reliance on facultative air breathing in low-oxygen environments. Our study demonstrated that acclimation to ocean acidification resulted in elevated routine metabolic rates and acid-base regulatory capacity (Na + ,K + -ATPase activity). These, in turn, had downstream effects that resulted in decreased hypoxia tolerance (i.e. elevated critical oxygen tension). Furthermore, we present evidence that these fish may be living near their physiological capacity when challenged by ocean acidification. This serves as a reminder that the susceptibility of teleost fish to changes in ocean pH may be underestimated, particularly when considering the multiple stressors that many experience in their natural environments.

  5. Evaluation of the use of common sculpin (Myoxocephalus scorpius) organ histology as bioindicator for element exposure in the fjord of the mining area Maarmorilik, West Greenland

    Energy Technology Data Exchange (ETDEWEB)

    Sonne, Christian, E-mail: csh@dmu.dk [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, P.O. Box 358, DK-4000 Roskilde (Denmark); Bach, Lis; Søndergaard, Jens; Rigét, Frank F.; Dietz, Rune; Mosbech, Anders [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, P.O. Box 358, DK-4000 Roskilde (Denmark); Leifsson, Pall S. [University of Copenhagen, Faculty of Health and Medical Sciences, Department of Veterinary Disease Biology, Bülowsvej 17, DK-1870 Frederiksberg (Denmark); Gustavson, Kim [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, P.O. Box 358, DK-4000 Roskilde (Denmark)

    2014-08-15

    The former Black Angel lead–zinc mine in Maarmorilik, West Greenland, is a historic example of how mining activity may result in a significant impact on the surrounding fjord system in terms of elevated concentrations of especially lead (Pb) and zinc (Zn) in seawater, sediments and surrounding biota. In order to shed light on the present contamination and possible effects in the fjord we initiated a range of studies including a pilot study on gill and liver morphology of common sculpins (Myoxocephalus scorpius) around Maarmorilik. Sculpins were caught and sampled at five different stations known to represent a gradient of Pb concentrations. Fish livers from all specimens were analyzed for relevant elements in the area: Fe, Zn, As, Cu, Se, Cd, Pb, Ag, Hg, Co and Ni. Lead, As and Hg showed significant differences among the five stations. For 20% of the sculpins, Hg concentrations were in the range of lowest observed effect dose (LOED) of 0.1–0.5 μg/g ww for toxic threshold on reproduction and subclinical endpoints. Likewise LOEDs for tissue lesions, LOEDs for biochemistry, growth, survival and reproduction were exceeded for Cd (0.42–1.8 μg/g ww) and for As (11.6 μg/g ww) in 28% and 85% of the sculpins, respectively. Similar to this, the no observed effect dose (NOED) for biochemistry was exceeded for Pb (0.32 μg/g ww) and for growth, mortality and reproduction for Zn (60–68 μg/g ww) in 33% and 24% of the sculpins, respectively. For all sculpins, females were significantly larger than males and for five of the elements (Fe, Co, Ni, Cu, Se) females had higher concentrations. The chronic lesions observed in liver (mononuclear cell infiltrates, necrosis, vacuolar hepatocytes, portal fibrosis, bile duct hyperplasia, active melanomacrophage centers) and gills (fusion and edema of secondary lamellae, laminar telangiectasis, mononuclear cell infiltrates, blebs) were similar to those in the literature studies for both wild and laboratory exposed sculpins and

  6. Evaluation of the use of common sculpin (Myoxocephalus scorpius) organ histology as bioindicator for element exposure in the fjord of the mining area Maarmorilik, West Greenland

    International Nuclear Information System (INIS)

    Sonne, Christian; Bach, Lis; Søndergaard, Jens; Rigét, Frank F.; Dietz, Rune; Mosbech, Anders; Leifsson, Pall S.; Gustavson, Kim

    2014-01-01

    The former Black Angel lead–zinc mine in Maarmorilik, West Greenland, is a historic example of how mining activity may result in a significant impact on the surrounding fjord system in terms of elevated concentrations of especially lead (Pb) and zinc (Zn) in seawater, sediments and surrounding biota. In order to shed light on the present contamination and possible effects in the fjord we initiated a range of studies including a pilot study on gill and liver morphology of common sculpins (Myoxocephalus scorpius) around Maarmorilik. Sculpins were caught and sampled at five different stations known to represent a gradient of Pb concentrations. Fish livers from all specimens were analyzed for relevant elements in the area: Fe, Zn, As, Cu, Se, Cd, Pb, Ag, Hg, Co and Ni. Lead, As and Hg showed significant differences among the five stations. For 20% of the sculpins, Hg concentrations were in the range of lowest observed effect dose (LOED) of 0.1–0.5 μg/g ww for toxic threshold on reproduction and subclinical endpoints. Likewise LOEDs for tissue lesions, LOEDs for biochemistry, growth, survival and reproduction were exceeded for Cd (0.42–1.8 μg/g ww) and for As (11.6 μg/g ww) in 28% and 85% of the sculpins, respectively. Similar to this, the no observed effect dose (NOED) for biochemistry was exceeded for Pb (0.32 μg/g ww) and for growth, mortality and reproduction for Zn (60–68 μg/g ww) in 33% and 24% of the sculpins, respectively. For all sculpins, females were significantly larger than males and for five of the elements (Fe, Co, Ni, Cu, Se) females had higher concentrations. The chronic lesions observed in liver (mononuclear cell infiltrates, necrosis, vacuolar hepatocytes, portal fibrosis, bile duct hyperplasia, active melanomacrophage centers) and gills (fusion and edema of secondary lamellae, laminar telangiectasis, mononuclear cell infiltrates, blebs) were similar to those in the literature studies for both wild and laboratory exposed sculpins and

  7. Effects of cadmium exposure on the gill proteome of Cottus gobio: Modulatory effects of prior thermal acclimation

    Energy Technology Data Exchange (ETDEWEB)

    Dorts, Jennifer, E-mail: jennifer.dorts@unamur.be [Research Unit in Environmental and Evolutionary Biology (URBE), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium); Kestemont, Patrick [Research Unit in Environmental and Evolutionary Biology (URBE), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium); Thézenas, Marie-Laetitia; Raes, Martine [Research Unit in Cell Biology (URBC) (NARILIS), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium); Silvestre, Frédéric [Research Unit in Environmental and Evolutionary Biology (URBE), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium)

    2014-09-15

    Highlights: • Fish acclimated to elevated temperature were subsequently exposed to cadmium. • Interaction of both stressors on LDH activity and protein expression was complex. • Both stressors have opposite effects at branchial protein expression level. • Proteins belonging to the same functional class exhibited differing responses. • Prior acclimation to elevated temperature modulated the effects of cadmium exposure. - Abstract: Temperature and trace metals are common environmental stressors, and their importance is increasing due to global climate change and anthropogenic pollution. The aim of the present study was to investigate whether acclimation to elevated temperature affects the response of the European bullhead (Cottus gobio) to subsequent cadmium (Cd) exposure by using enzymatic and proteomic approaches. Fish acclimated to 15 (standard temperature), 18 or 21 °C for 28 days were exposed to 1 mg Cd/L for 4 days at the respective acclimation temperature. First, exposure to Cd significantly decreased the activity of the lactate dehydrogenase (LDH) in gills of fish acclimated to 15 or 18 °C. However, an acclimation to 21 °C suppressed the inhibitory effect of Cd. Second, using a proteomic analysis by 2D-DIGE, we observed that thermal acclimation was the first parameter affecting the protein expression profile in gills of C. gobio, while subsequent Cd exposure seemed to attenuate this temperature effect. Moreover, our results showed opposite effects of these two environmental stressors at protein expression level. From the 52 protein spots displaying significant interaction effects of temperature and Cd exposure, a total of 28 different proteins were identified using nano LC–MS/MS and the Peptide and Protein Prophet algorithms of Scaffold software. The identified differentially expressed proteins can be categorized into diverse functional classes, related to protein turnover, folding and chaperoning, metabolic process, ion transport, cell

  8. Effects of cadmium exposure on the gill proteome of Cottus gobio: Modulatory effects of prior thermal acclimation

    International Nuclear Information System (INIS)

    Dorts, Jennifer; Kestemont, Patrick; Thézenas, Marie-Laetitia; Raes, Martine; Silvestre, Frédéric

    2014-01-01

    Highlights: • Fish acclimated to elevated temperature were subsequently exposed to cadmium. • Interaction of both stressors on LDH activity and protein expression was complex. • Both stressors have opposite effects at branchial protein expression level. • Proteins belonging to the same functional class exhibited differing responses. • Prior acclimation to elevated temperature modulated the effects of cadmium exposure. - Abstract: Temperature and trace metals are common environmental stressors, and their importance is increasing due to global climate change and anthropogenic pollution. The aim of the present study was to investigate whether acclimation to elevated temperature affects the response of the European bullhead (Cottus gobio) to subsequent cadmium (Cd) exposure by using enzymatic and proteomic approaches. Fish acclimated to 15 (standard temperature), 18 or 21 °C for 28 days were exposed to 1 mg Cd/L for 4 days at the respective acclimation temperature. First, exposure to Cd significantly decreased the activity of the lactate dehydrogenase (LDH) in gills of fish acclimated to 15 or 18 °C. However, an acclimation to 21 °C suppressed the inhibitory effect of Cd. Second, using a proteomic analysis by 2D-DIGE, we observed that thermal acclimation was the first parameter affecting the protein expression profile in gills of C. gobio, while subsequent Cd exposure seemed to attenuate this temperature effect. Moreover, our results showed opposite effects of these two environmental stressors at protein expression level. From the 52 protein spots displaying significant interaction effects of temperature and Cd exposure, a total of 28 different proteins were identified using nano LC–MS/MS and the Peptide and Protein Prophet algorithms of Scaffold software. The identified differentially expressed proteins can be categorized into diverse functional classes, related to protein turnover, folding and chaperoning, metabolic process, ion transport, cell

  9. Fish assemblage structure and relations with environmental conditions in a Rocky Mountain watershed

    Science.gov (United States)

    Quist, M.C.; Hubert, W.A.; Isaak, D.J.

    2004-01-01

    Fish and habitat were sampled from 110 reaches in the Salt River basin (Idaho and Wyoming) during 1996 and 1997 to assess patterns in fish assemblage structure across a Rocky Mountain watershed. We identified four distinct fish assemblages using cluster analysis: (1) allopatric cutthroat trout (Oncorhynchus clarki (Richardson, 1836)); (2) cutthroat trout - brook trout (Salvelinus fontinalis (Mitchell, 1814)) - Paiute sculpin (Cottus beldingi Eigenmann and Eigenmann, 1891); (3) cutthroat trout - brown trout (Salmo trutta L., 1758) - mottled sculpin (Cottus bairdi Girard, 1850); and (4) Cyprinidae-Catostomidae. The distribution of fish assemblages was explained by thermal characteristics, stream geomorphology, and local habitat features. Reaches with allopatric cutthroat trout and the cutthroat trout - brook trout - Paiute sculpin assemblage were located in high-elevation, high-gradient streams. The other two fish assemblages were generally located in low-elevation streams. Associations between habitat gradients, locations of reaches in the watershed, and occurrence of species were further examined using canonical correspondence analysis. The results suggest that stream geomorphology, thermal conditions, and local habitat characteristics influence fish assemblage structure across a Rocky Mountain watershed, and they provide information on the ecology of individual species that can guide conservation activities. ?? 2004 NRC Canada.

  10. The effect of bloom of filamentous green algae on the reproduction of yellowfin sculpin Cottocomephorus grewingkii (Dybowski, 1874) (Cottoidae) during ecological crisis in Lake Baikal.

    Science.gov (United States)

    Khanaev, I V; Dzyuba, E V; Kravtsova, L S; Grachev, M A

    2016-03-01

    In shallow water areas of open Lake Baikal, filamentous green alga of the genus Spirogyra grows abundantly. Together with alga of the genus Ulothrix, it forms algal mats. According to our observations from 2010 to 2013, the spawning habitat conditions for the yellowfin sculpin Cottocomephorus grewingkii (Dybowski, 1874) (Cottidae) proved to be significantly disturbed in the littoral zone of Listvennichnyi Bay (southern Baikal), which, in turn, reduced the number of egg layings. With a 100% projective cover of the floor and a high density of green filamentous algae, the shallow-water stony substrate becomes completely inaccessible for spawning of the August population.

  11. Glochidial infestation by the endangered mollusc Unio crassus in rivers of north-eastern France: Phoxinus phoxinus and Cottus gobio as primary fish hosts

    Czech Academy of Sciences Publication Activity Database

    Lamand, F.; Roche, Kevin Francis; Beisel, J.-N.

    2016-01-01

    Roč. 26, č. 3 (2016), s. 445-455 ISSN 1052-7613 Institutional support: RVO:68081766 Keywords : unionid conservation * glochidia * threatened species * Eurasian minnow * bullhead * parasitic host Subject RIV: EG - Zoology Impact factor: 3.130, year: 2016

  12. Columbia River System Operation Review final environmental impact statement. Appendix K: Resident fish

    International Nuclear Information System (INIS)

    1995-11-01

    The System Operation Review (SOR) is a study and environmental compliance process being used by the three Federal agencies to analyze future operations of the system and river use issues. The goal of the SOR is to achieve a coordinated system operation strategy for the river that better meets the needs of all river users. This technical appendix addresses only the effects of alternative system operating strategies for managing the Columbia River system. In this appendix the Resident Fish Work Group (RFWG) has attempted to characterize and evaluate impacts of dam operation on an extremely complex and diverse integrated resource. Not only is this required under the National Environmental Policy Act (NEPA) for SOR, there are resident fish populations that have status under the Federal Endangered Species Act (ESA) or equivalent state regulations (Kootenai River white sturgeon, Snake River white sturgeon, sandroller, shorthead and torrent sculpins, bull trout, westslope cutthroat trout, redband trout, and burbot). The RFWG has also attempted to develop operating alternatives that benefit not only resident fish, but anadromous fish, wildlife, and other human interests as well. The authors have recognized the co-evolution of resident fish, anadromous fish, and other integrated resources in the basin

  13. System-Wide Significance of Predation on Juvenile Salmonids in Columbia and Snake River Reservoirs : Annual Report 1992.

    Energy Technology Data Exchange (ETDEWEB)

    Petersen, James H.; Poe, Thomas P.

    1993-12-01

    Northern squawfish (Ptychocheilus oregonensis) predation on juvenile salmonids was characterized during 1992 at ten locations in the Columbia River below Bonneville Dam and at three locations in John Day Reservoir. During the spring and summer, 1,487 northern squawfish were collected in the lower Columbia River and 202 squawfish were sampled in John Day Reservoir. Gut content data, predator weight, and water temperature were used to compute a consumption index (CI) for northern squawfish, and overall diet was also described. In the Columbia River below Bonneville Dam, northern squawfish diet was primarily fish (spring 69%; summer 53%), most of which were salmonids. Salmonids were also the primary diet component in the Bonneville Dam tailrace, John Day Dam forebay, and the McNary Dam tailrace. Crustaceans were the dominant diet item at the John Day mid-reservoir location, although sample sizes were small. About half of the non-salmonid preyfish were sculpins. The consumption index (CI) of northern squawfish was generally higher during summer than during spring. The highest CI`s were observed during summer in the tailrace boat restricted zones of Bonneville Dam (CI = 7.8) and McNary Dam (CI = 4.6). At locations below Bonneville Dam, CI`s were relatively low near Covert`s Landing and Rooster Rock, higher at four locations between Blue Lake and St. Helens, and low again at three downriver sites (Kalama, Ranier, and Jones Beach). Northern squawfish catches and CI`s were noticeably higher throughout the lower Columbia compared to mid-reservoir sites further upriver sampled during 1990--92. Predation may be especially intense in the free-flowing section of the Columbia River below Bonneville Dam. Smallmouth bass (Micropterus dolomieui; N = 198) ate mostly fish -- 25% salmonids, 29% sculpins, and 46% other fish. Highest catches of smallmouth bass were in the John Day Dam forebay.

  14. Ichthyofauna of the Kubo, Tochikura, and Ichinono river systems (Kitakami River drainage, northern Japan), with a comparison of predicted and surveyed species richness

    Science.gov (United States)

    Nakae, Masanori; Senou, Hiroshi

    2014-01-01

    Abstract The potential fish species pool of the Kubo, Tochikura, and Ichinono river systems (tributaries of the Iwai River, Kitakami River drainage), Iwate Prefecture, northern Japan, was compared with the observed ichthyofauna by using historical records and new field surveys. Based on the literature survey, the potential species pool comprised 24 species/subspecies but only 20, including 7 non-native taxa, were recorded during the fieldwork. The absence during the survey of 11 species/subspecies from the potential species pool suggested either that sampling effort was insufficient, or that accurate determination of the potential species pool was hindered by lack of biogeographic data and ecological data related to the habitat use of the species. With respect to freshwater fish conservation in the area, Lethenteron reissneri, Carassius auratus buergeri, Pseudorasbora pumila, Tachysurus tokiensis, Oryzias latipes, and Cottus nozawae are regarded as priority species, and Cyprinus rubrofuscus, Pseudorasbora parva, and Micropterus salmoides as targets for removal. PMID:25425932

  15. Geographic variation in host fish use and larval metamorphosis for the endangered dwarf wedgemussel

    Science.gov (United States)

    White, Barbara (St. John); Ferreri, C. Paola; Lellis, William A.; Wicklow, Barry J.; Cole, Jeffrey C.

    2017-01-01

    Host fishes play a crucial role in survival and dispersal of freshwater mussels (Unionoida), particularly rare unionids at conservation risk. Intraspecific variation in host use is not well understood for many mussels, including the endangered dwarf wedgemussel (Alasmidonta heterodon) in the USA.Host suitability of 33 fish species for dwarf wedgemussel glochidia (larvae) from the Delaware and Connecticut river basins was tested in laboratory experiments over 9 years. Relative suitability of three different populations of a single host fish, the tessellated darter (Etheostoma olmstedi), from locations in the Connecticut, Delaware, and Susquehanna river basins, was also tested.Connecticut River basin A. heterodon metamorphosed into juvenile mussels on tessellated darter, slimy sculpin (Cottus cognatus), and Atlantic salmon (Salmo salar) parr. Delaware River basin mussels metamorphosed using these three species, as well as brown trout (Salmo trutta), banded killifish (Fundulus diaphanus), mottled sculpin (Cottus bairdii), striped bass (Morone saxatilis), and shield darter (Percina peltata). Atlantic salmon, striped bass, and sculpins were highly effective hosts, frequently generating 5+ juveniles per fish (JPF) and metamorphosis success (MS; proportion of attaching larvae that successfully metamorphose) ≥ 0.4, and producing juveniles in repeated trials.In experiments on tessellated darters, mean JPF and MS values decreased as isolation between the mussel source (Connecticut River) and each fish source increased; mean JPF = 10.45, 6.85, 4.14, and mean MS = 0.50, 0.41, and 0.34 in Connecticut, Delaware, and Susquehanna river darters, respectively. Host suitability of individual darters was highly variable (JPF = 2–11; MS = 0.20–1.0).The results show that mussel–host fish compatibility in A. heterodon differs among Atlantic coastal rivers, and suggest that hosts including anadromous Atlantic salmon and striped bass may help sustain A. heterodon in parts of

  16. Factors affecting the recovery of fish populations in an industrial river. [Brown trout

    Energy Technology Data Exchange (ETDEWEB)

    Turnpenny, A W.M.; Williams, R

    1981-01-01

    The river Ebbw Fawr, an industrial river of South-East Wales, was investigated over a three-year period to follow the re-establishment of fish populations as a result of pollution control measures at coal washeries and a steelworks on the river. These measures were effective in reducing levels of toxic materials and restoring dissolved oxygen levels and pH values acceptable for fish. Five freshwater fish species became established in parts of the river during the study period (1974-77). The brown trout Salmo trutta l. was the first to enter, followed by eel Anguilla anguilla l., stoneloach Noemacheilus barbatulus l., stickleback Gasterosteus aculeatus l. and bullhead Cottus gobio l., respectively. The flounder Platicthys flesus l., a euryhaline species, penetrated the river beyond the upper tidal limit. The minnow Phoxinus phoxinus l., a resident of other parts of the Ebbw system, did not recolonise during the study. Calculated toxicities and the results of fish caging tests indicated that water quality was satisfactory for fish populations throughout the river with the possible exception of a short reach immediately below the steelworks. The absence of fish from some upstream reaches with good water quality was due to the limited numbers of fish available for recolonisation and their restricted movements. Good growth and condition factors among the recolonising brown trout stock suggest that a sport fishery could be developed on the river, though constraints on spawning due to residual silt pollution indicate that stocking with hatchery reared fish will be necessary to maintain trout numbers.

  17. River engineering

    NARCIS (Netherlands)

    De Vries, M.

    1993-01-01

    One dimension models - basic eauations, analytical models, numberical models. One dimensional models -suspended load, roughness and resistance of river beds. Solving river problems - tools, flood mitigation, bank protection.

  18. NATIVE AND INTRODUCED LARVAL FISHES IN SUISAN MARSH, CALIFORNIA,: THE EFFECTS OF FRESHWATER FLOW

    Science.gov (United States)

    We sampled ichthyoplankton weekly in Suisun Marsh in the San Francisco Estuary from February to June each year from 1994 to 1999. We collected approximately 227,900 fish, predominantly shimofuri goby Tridentiger bifasciatus (60%) and prickly sculpin Cottus asper (33%). Principal ...

  19. Charles River

    Science.gov (United States)

    Information on the efforts of the US EPA, the Commonwealth of Massachusetts, the municipalities within the Charles River Watershed and nongovernmental organizations to improve the water quality of the Charles River.

  20. Abundance of Cottus poecilopus is influenced by O2 saturation, food density and Salmo trutta in three tributaries of the Rožnovská Bečva River, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Baran, Roman; Kubečka, Jan; Kubín, M.; Lojkásek, B.; Mrkvička, T.; Ricard, Daniel; Rulík, M.

    2015-01-01

    Roč. 86, č. 2 (2015), s. 805-811 ISSN 0022-1112. [Česká ichtyologická konference /13./. Červená nad Vltavou, 24.10.2012-26.10.2012] Institutional support: RVO:60077344 Keywords : alpine bullhead * brown trout * macroinvertebrates * organic carbon * shading * water temperature Subject RIV: EH - Ecology, Behaviour Impact factor: 1.246, year: 2015

  1. River nomads

    DEFF Research Database (Denmark)

    2016-01-01

    sail on the Niger River between Nigeria and Mali. Crossing villages, borders and cultures, they stop only to rest by setting up camp on riverbanks or host villages. In River Nomads, we join the nomadic Kebbawa fishermen on one of their yearly crossing, experiencing their relatively adventurous...

  2. River Piracy

    Indian Academy of Sciences (India)

    There was this highly venerated river Saraswati flowing through. Haryana, Marwar and Bahawalpur in Uttarapath and emptying itself in the Gulf ofKachchh, which has been described in glowing terms by the Rigveda. "Breaking through the mountain barrier", this "swift-flowing tempestuous river surpasses in majesty and.

  3. Invasion strategy and abiotic activity triggers for non-native gobiids of the River Rhine.

    Directory of Open Access Journals (Sweden)

    Jan Baer

    Full Text Available The 24 hour activity patterns of three non-native gobiids (round goby Neogobius melanostomus, Western tubenose goby Proterorhinus semilunaris and bighead goby Ponticola kessleri were assessed over 46 consecutive months between 2011 and 2014 from their occurrence in the cooling water intake of a nuclear power plant on the River Rhine, Germany. In total, 117717 gobiids were identified and classified. The occurrence of all three species varied strongly between sampling years, and species-specific activity triggers were identified. The activity of juveniles of all three gobiids species was positively temperature dependent while adult tubenose goby activity appeared to be negatively temperature dependent. Increasing fluvial discharge in the adjoining main river stimulated the activity of juvenile round goby but inhibited activity of adult tubenose goby. Except for adult bighead goby, activity was also structured by time of day, but with no uniform mean. Meteorological factors such as precipitation, air pressure and duration of sunshine hours had little or no influence on gobiid activity. On selected rare occasions, mainly at night, all three species exhibited pulsed swarming behaviour, with thousands of individuals recorded in the intake water. Round goby swarms exhibited both the highest intensity and the largest swarming individuals, suggesting a potential competitive advantage over tubenose and bighead goby. Electric fishing surveys in natural river stretches corroborated this observation. Negative effects on the native fish fauna were apparent only for the bullhead, Cottus gobio. The activity triggers identified offer a unique insight into the invasion mechanisms of these ecosystem-changing non-native gobiids.

  4. Mercury and selenium concentrations in biofilm, macroinvertebrates, and fish collected in the Yankee Fork of the Salmon River, Idaho, USA, and their potential effects on fish health

    Science.gov (United States)

    Rhea, Darren T.; Farag, Aïda M.; Harper, David D.; McConnell, Elizabeth; Brumbaugh, William G.

    2013-01-01

    The Yankee Fork is a large tributary of the Salmon River located in central Idaho, USA, with an extensive history of placer and dredge-mining activities. Concentrations of selenium (Se) and mercury (Hg) in various aquatic trophic levels were measured in the Yankee Fork during 2001 and 2002. Various measurements of fish health were also performed. Sites included four on the mainstem of the Yankee Fork and two off-channel sites in partially reclaimed dredge pools used as rearing habitat for cultured salmonid eggs and fry. Hg concentrations in whole mountain whitefish and shorthead sculpin ranged from 0.28 to 0.56 μg/g dry weight (dw), concentrations that are generally less than those reported to have significant impacts on fish. Biofilm and invertebrates ranged from 0.05 to 0.43 μg Hg/g dw. Se concentrations measured in biota samples from the Yankee Fork were greater than many representative samples collected in the Snake and Columbia watersheds and often exceeded literature-based toxic thresholds. Biofilm and invertebrates ranged from 0.58 to 4.66 μg Se/g dw. Whole fish ranged from 3.92 to 7.10 μg Se/g dw, and gonads ranged from 6.91 to 31.84 μg Se/g dw. Whole-body Se concentrations exceeded reported toxicological thresholds at three of four sites and concentrations in liver samples were mostly greater than concentrations shown to have negative impacts on fish health. Histological examinations performed during this study noted liver abnormalities, especially in shorthead sculpin, a bottom-dwelling species.

  5. Antecedent Rivers

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 8. Antecedent Rivers - Ganga Is Older Than Himalaya. K S Valdiya. General Article Volume 1 Issue 8 August 1996 pp 55-63. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/08/0055-0063 ...

  6. RIVER STATE

    African Journals Online (AJOL)

    principals randomly selected from one hundred secondary schools in Cross River State. The data collected ... There was no siyriificant influerlce of gender on principals' leadership styles effectiveness. ... result of the cultural stereotyping of males and females by .... schools were single sex boys, another 10 were single sex ...

  7. Antecedent Rivers

    Indian Academy of Sciences (India)

    far north of the high NandaDevi (7,817 m) - Api Nampa. (7,132 m) range of the Himadri. The Sindhu flows northwestwards, the Satluj goes west, the Karnali takes the southerly course and the Tsangpo flows east. These rivers flow through their pristine channels, carved out at the very outset about 50 to 55 m.y (million years) ...

  8. Brown trout and food web interactions in a Minnesota stream

    Science.gov (United States)

    Zimmerman, J.K.H.; Vondracek, B.

    2007-01-01

    1. We examined indirect, community-level interactions in a stream that contained non-native brown trout (Salmo trutta Linnaeus), native brook trout (Salvelinus fontinalis Mitchill) and native slimy sculpin (Cottus cognatus Richardson). Our objectives were to examine benthic invertebrate composition and prey selection of fishes (measured by total invertebrate dry mass, dry mass of individual invertebrate taxa and relative proportion of invertebrate taxa in the benthos and diet) among treatments (no fish, juvenile brook trout alone, juvenile brown trout alone, sculpin with brook trout and sculpin with brown trout). 2. We assigned treatments to 1 m2 enclosures/exclosures placed in riffles in Valley Creek, Minnesota, and conducted six experimental trials. We used three designs of fish densities (addition of trout to a constant number of sculpin with unequal numbers of trout and sculpin; addition of trout to a constant number of sculpin with equal numbers of trout and sculpin; and replacement of half the sculpin with an equal number of trout) to investigate the relative strength of interspecific versus intraspecific interactions. 3. Presence of fish (all three species, alone or in combined-species treatments) was not associated with changes in total dry mass of benthic invertebrates or shifts in relative abundance of benthic invertebrate taxa, regardless of fish density design. 4. Brook trout and sculpin diets did not change when each species was alone compared with treatments of both species together. Likewise, we did not find evidence for shifts in brown trout or sculpin diets when each species was alone or together. 5. We suggest that native brook trout and non-native brown trout fill similar niches in Valley Creek. We did not find evidence that either species had an effect on stream communities, potentially due to high invertebrate productivity in Valley Creek. ?? 2007 Blackwell Publishing Ltd.

  9. River Corridor Easements

    Data.gov (United States)

    Vermont Center for Geographic Information — A River Corridor Easement (RCE) is an area of conserved land adjacent to a river or stream that was conserved to permanently protect the lateral area the river needs...

  10. River Diversions and Shoaling

    National Research Council Canada - National Science Library

    Letter, Jr., Joseph V; Pinkard, Jr., C. F; Raphelt, Nolan K

    2008-01-01

    This Coastal and Hydraulics Engineering Technical Note describes the current knowledge of the potential impacts of river diversions on channel morphology, especially induced sedimentation in the river channel...

  11. Acute toxicity of zinc to several aquatic species native to the Rocky Mountains.

    Science.gov (United States)

    Brinkman, Stephen F; Johnston, Walter D

    2012-02-01

    National water-quality criteria for the protection of aquatic life are based on toxicity tests, often using organisms that are easy to culture in the laboratory. Species native to the Rocky Mountains are poorly represented in data sets used to derive national water-quality criteria. To provide additional data on the toxicity of zinc, several laboratory acute-toxicity tests were conducted with a diverse assortment of fish, benthic invertebrates, and an amphibian native to the Rocky Mountains. Tests with fish were conducted using three subspecies of cutthroat trout (Colorado River cutthroat trout Oncorhynchus clarkii pleuriticus, greenback cutthroat trout O. clarkii stomias, and Rio Grande cutthroat trout O. clarkii virginalis), mountain whitefish (Prosopium williamsoni), mottled sculpin (Cottus bairdi), longnose dace (Rhinichthys cataractae), and flathead chub (Platygobio gracilis). Aquatic invertebrate tests were conducted with mayflies (Baetis tricaudatus, Drunella doddsi, Cinygmula sp. and Ephemerella sp.), a stonefly (Chloroperlidae), and a caddis fly (Lepidostoma sp.). The amphibian test was conducted with tadpoles of the boreal toad (Bufo boreas). Median lethal concentrations (LC(50)s) ranged more than three orders of magnitude from 166 μg/L for Rio Grande cutthroat trout to >67,000 μg/L for several benthic invertebrates. Of the organisms tested, vertebrates were the most sensitive, and benthic invertebrates were the most tolerant.

  12. Allegheny County Major Rivers

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — This dataset contains locations of major rivers that flow through Allegheny County. These shapes have been taken from the Hydrology dataset. The Ohio River,...

  13. Flowing with Rivers

    Science.gov (United States)

    Anderson, Heather

    2004-01-01

    This article describes a lesson in which students compare how artists have depicted rivers in paintings, using different styles, compositions, subject matter, colors, and techniques. They create a watercolor landscape that includes a river. Students can learn about rivers by studying them on site, through environmental study, and through works of…

  14. River basin administration

    Science.gov (United States)

    Management of international rivers and their basins is the focus of the Centre for Comparative Studies on (International) River Basin Administration, recently established at Delft University of Technology in the Netherlands. Water pollution, sludge, and conflicting interests in the use of water in upstream and downstream parts of a river basin will be addressed by studying groundwater and consumption of water in the whole catchment area of a river.Important aspects of river management are administrative and policy aspects. The Centre will focus on policy, law, planning, and organization, including transboundary cooperation, posing standards, integrated environmental planning on regional scale and environmental impact assessments.

  15. Operation of river systems. The Otra river

    International Nuclear Information System (INIS)

    Harby, A.; Vaskinn, K.A.; Wathne, M.; Heggenes, J.; Saltveit, S.J.

    1993-12-01

    The purpose of the project described in this report was to prepare an operative tool for making decisions about the operation of the power system on the river Otra (Norway) with regard to how this operation might affect the various users of the river system. Above all this affects fish, outdoor life and esthetic values. The connection between water quality and volume of discharge has been examined in a sub project. How suitable parts of the river are as habitats for trout has been simulated on a computer. From field investigation it is concluded that near the Steinfoss power station the physical conditions for trout depend on the operation of the river system. Outdoor life is not much affected downstream Vikeland. 11 refs., 22 figs., 2 tabs

  16. 76 FR 51887 - Safety Zone; Patuxent River, Patuxent River, MD

    Science.gov (United States)

    2011-08-19

    ...-AA00 Safety Zone; Patuxent River, Patuxent River, MD AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone during the ``NAS Patuxent River... held over certain waters of the Patuxent River adjacent to Patuxent River, Maryland from September 1...

  17. Introduced northern pike predation on salmonids in southcentral Alaska

    Science.gov (United States)

    Sepulveda, Adam J.; Rutz, David S.; Ivey, Sam S.; Dunker, Kristine J.; Gross, Jackson A.

    2013-01-01

    Northern pike (Esox lucius) are opportunistic predators that can switch to alternative prey species after preferred prey have declined. This trophic adaptability allows invasive pike to have negative effects on aquatic food webs. In Southcentral Alaska, invasive pike are a substantial concern because they have spread to important spawning and rearing habitat for salmonids and are hypothesised to be responsible for recent salmonid declines. We described the relative importance of salmonids and other prey species to pike diets in the Deshka River and Alexander Creek in Southcentral Alaska. Salmonids were once abundant in both rivers, but they are now rare in Alexander Creek. In the Deshka River, we found that juvenile Chinook salmon (Oncorhynchus tshawytscha) and coho salmon (O. kisutch) dominated pike diets and that small pike consumed more of these salmonids than large pike. In Alexander Creek, pike diets reflected the distribution of spawning salmonids, which decrease with distance upstream. Although salmonids dominated pike diets in the lowest reach of the stream, Arctic lamprey (Lampetra camtschatica) and slimy sculpin (Cottus cognatus) dominated pike diets in the middle and upper reaches. In both rivers, pike density did not influence diet and pike consumed smaller prey items than predicted by their gape-width. Our data suggest that (1) juvenile salmonids are a dominant prey item for pike, (2) small pike are the primary consumers of juvenile salmonids and (3) pike consume other native fish species when juvenile salmonids are less abundant. Implications of this trophic adaptability are that invasive pike can continue to increase while driving multiple species to low abundance.

  18. Down to the River

    DEFF Research Database (Denmark)

    Wessels, Josepha Ivanka

    2015-01-01

    Currently there is no coherent or sustainable water cooperation among the five states—Israel, Jordan, Lebanon, Palestinian territories and Syria—that share the Jordan River. Why do people not cooperate on sustainable river basin management, even if it seems the most rational course from the persp......Currently there is no coherent or sustainable water cooperation among the five states—Israel, Jordan, Lebanon, Palestinian territories and Syria—that share the Jordan River. Why do people not cooperate on sustainable river basin management, even if it seems the most rational course from...

  19. Investing in river health.

    Science.gov (United States)

    Bennett, J

    2002-01-01

    Rivers provide society with numerous returns. These relate to both the passive and extractive uses of the resources embodied in river environments. Some returns are manifest in the form of financial gains whilst others are non-monetary. For instance, rivers are a source of monetary income for those who harvest their fish. The water flowing in rivers is extracted for drinking and to water crops and livestock that in turn yield monetary profits. However, rivers are also the source of non-monetary values arising from biological diversity. People who use them for recreation (picnicking, swimming, boating) also receive non-monetary returns. The use of rivers to yield these returns has had negative consequences. With extraction for financial return has come diminished water quantity and quality. The result has been a diminished capacity of rivers to yield (non-extractive) environmental returns and to continue to provide extractive values. A river is like any other asset. With use, the value of an asset depreciates because its productivity declines. In order to maintain the productive capacity of their assets, managers put aside from their profits depreciation reserves that can be invested in the repair or replacement of those assets. Society now faces a situation in which its river assets have depreciated in terms of their capacity to provide monetary and non-monetary returns. An investment in river "repair" is required. But, investment means that society gives up something now in order to achieve some benefit in the future. Society thus has to grapple wih the choice between investing in river health and other investments--such as in hospitals, schools, defence etc. - as well as between investing in river health and current consumption--such as on clothes, food, cars etc. A commonly used aid for investment decision making in the public sector is benefit cost analysis. However, its usefulness in tackling the river investment problem is restricted because it requires all

  20. River Corridors (Jan 2, 2015)

    Data.gov (United States)

    Vermont Center for Geographic Information — River corridors are delineated to provide for the least erosive meandering and floodplain geometry toward which a river will evolve over time. River corridor maps...

  1. Preserving the Dnipro River

    International Development Research Centre (IDRC) Digital Library (Canada)

    Humanity inherited the true sense of proportion, synergy, and harmony from the natural environment. ..... In Ukraine, the middle and lower sections of the Dnipro have a drainage ... The following large cities are located in the Dnipro basin: in Russia, .... In Kherson Oblast and in river basins of some small rivers it is as high as ...

  2. Numerical modelling of river processes: flow and river bed deformation

    NARCIS (Netherlands)

    Tassi, P.A.

    2007-01-01

    The morphology of alluvial river channels is a consequence of complex interaction among a number of constituent physical processes, such as flow, sediment transport and river bed deformation. This is, an alluvial river channel is formed from its own sediment. From time to time, alluvial river

  3. Changes in stream chemistry and biology in response to reduced levels of acid deposition during 1987-2003 in the Neversink River Basin, Catskill Mountains

    Science.gov (United States)

    Burns, Douglas A.; Riva-Murray, K.; Bode, R.W.; Passy, S.

    2008-01-01

    Atmospheric acid deposition has decreased in the northeastern United States since the 1970s, resulting in modest increases in pH, acid-neutralizing capacity (ANC), and decreases in inorganic monomeric aluminum (AlIM) concentrations since stream chemistry monitoring began in the 1980s in the acid-sensitive upper Neversink River basin in the Catskill Mountains of New York. Stream pH has increased by 0.01 units/year during 1987-2003 at three sites in the Neversink basin as determined by Seasonal Kendall trend analysis. In light of this observed decrease in stream acidity, we sampled 12 stream sites within the Neversink River watershed for water chemistry, macroinvertebrates, fish, and periphytic diatoms in 2003 to compare with a similar data set collected in 1987. Metrics and indices that reflect sensitivity to stream acidity were developed with these biological data to determine whether changes in stream biota over the intervening 16 years parallel those of stream chemistry. Statistical comparisons of data on stream chemistry and an acid biological assessment profile (Acid BAP) derived from invertebrate data showed no significant differences between the two years. For pH and ANC, however, values in 2003 were generally lower than those in 1987; this difference likely resulted from higher streamflow in summer 2003. Despite these likely flow-induced changes in summer 2003, an ordination and cluster analysis of macroinvertebrate taxa based on the Acid BAP indicated that the most acidic sites in the upstream half of the East Branch Neversink River form a statistically significant separate cluster consistent with less acidic stream conditions. This analysis is consistent with limited recovery of invertebrate species in the most acidic reaches of the river, but will require additional improvement in stream chemistry before a stronger conclusion can be drawn. Data on the fish and periphytic diatom communities in 2003 indicate that slimy sculpin had not extended their habitat

  4. Uranium in river water

    International Nuclear Information System (INIS)

    Palmer, M.R.; Edmond, J.M.

    1993-01-01

    The concentration of dissolved uranium has been determined in over 250 river waters from the Orinoco, Amazon, and Ganges basins. Uranium concentrations are largely determined by dissolution of limestones, although weathering of black shales represents an important additional source in some basins. In shield terrains the level of dissolved U is transport limited. Data from the Amazon indicate that floodplains do not represent a significant source of U in river waters. In addition, the authors have determined dissolved U levels in forty rivers from around the world and coupled these data with previous measurements to obtain an estimate for the global flux of dissolved U to the oceans. The average concentration of U in river waters is 1.3 nmol/kg, but this value is biased by very high levels observed in the Ganges-Brahmaputra and Yellow rivers. When these river systems are excluded from the budget, the global average falls to 0.78 nmol/kg. The global riverine U flux lies in the range of 3-6 x 10 7 mol/yr. The major uncertainty that restricts the accuracy of this estimate (and that of all other dissolved riverine fluxes) is the difficulty in obtaining representative samples from rivers which show large seasonal and annual variations in runoff and dissolved load

  5. Savannah River Plant environment

    International Nuclear Information System (INIS)

    Dukes, E.K.

    1984-03-01

    On June 20, 1972, the Atomic Energy Commission designated 192,323 acres of land near Aiken, SC, as the nation's first National Environmental Research Park. The designated land surrounds the Department of Energy's Savannah River Plant production complex. The site, which borders the Savannah River for 17 miles, includes swampland, pine forests, abandoned town sites, a large man-made lake for cooling water impoundment, fields, streams, and watersheds. This report is a description of the geological, hydrological, meteorological, and biological characteristics of the Savannah River Plant site and is intended as a source of information for those interested in environmental research at the site. 165 references, 68 figures, 52 tables

  6. Hunting camp. River Murray

    OpenAIRE

    ? Bayliss, Charles, 1850-1897, photographer

    2003-01-01

    200 x 149 mm. A good photograph showing a group of aborigines (in European clothes) with two hunting dogs, holding spears and standing in front of rough wooden cabins; with the river in the background. Photograph unknown, possible Charles Bayliss.

  7. Wild and Scenic Rivers

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — This map layer portrays the linear federally-owned land features (i.e., national parkways, wild and scenic rivers, etc.) of the United States, Puerto Rico, and the...

  8. [Health assessment of river ecosystem in Haihe River Basin, China].

    Science.gov (United States)

    Hao, Li-Xia; Sun, Ran-Hao; Chen, Li-Ding

    2014-10-01

    With the development of economy, the health of river ecosystem is severely threatened because of the increasing effects of human activities on river ecosystem. In this paper, the authors assessed the river ecosystem health in aspects of chemical integrity and biological integrity, using the criterion in water quality, nutrient, and benthic macroinvertebrates of 73 samples in Haihe River Basin. The research showed that the health condition of river ecosystem in Haihe River Basin was bad overall since the health situation of 72. 6% of the samples was "extremely bad". At the same time, the health situation in Haihe River Basin exhibited obvious regional gathering effect. We also found that the river water quality was closely related to human activities, and the eutrophication trend of water body was evident in Haihe River Basin. The biodiversity of the benthic animal was low and lack of clean species in the basin. The indicators such as ammonia nitrogen, total nitrogen and total phosphorus were the key factors that affected the river ecosystem health in Haihe River Basin, so the government should start to curb the deterioration of river ecosystem health by controlling these nutrients indicators. For river ecosystem health assessment, the multi-factors comprehensive evaluation method was superior to single-factor method.

  9. 33 CFR 117.734 - Navesink River (Swimming River).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Navesink River (Swimming River). 117.734 Section 117.734 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... (Swimming River). The Oceanic Bridge, mile 4.5, shall open on signal; except that, from December 1 through...

  10. Skjern River Restoration Counterfactual

    DEFF Research Database (Denmark)

    Clemmensen, Thomas Juel

    2014-01-01

    In 2003 the Skjern River Restoration Project in Denmark was awarded the prestigious Europa Nostra Prize for ‘conserving the European cultural heritage’ (Danish Nature Agency 2005). In this case, however, it seems that the conservation of one cultural heritage came at the expense of another cultural...... this massive reconstruction work, which involved moving more than 2,7 million cubic meters of earth, cause a lot of ‘dissonance’ among the local population, the resulting ‘nature’ and its dynamic processes are also constantly compromising the preferred image of the restored landscape (Clemmensen 2014......). The presentation offers insight into an on-going research and development project - Skjern River Restoration Counterfactual, which question existing trends and logics within nature restoration. The project explores how the Skjern River Delta could have been ‘restored’ with a greater sensibility for its cultural...

  11. Missouri River 1943 Compact Line

    Data.gov (United States)

    Iowa State University GIS Support and Research Facility — Flood Control, Bank Stabilization and development of a navigational channel on the Missouri River had a great impact on the river and adjacent lands. The new...

  12. Haw River PFCs Data Set

    Data.gov (United States)

    U.S. Environmental Protection Agency — PFAS concentrations in river and drinking water in and around the Haw River in North Carolina. This dataset is associated with the following publication: Sun, M., E....

  13. Susceptibility of various Japanese freshwater fish species to an isolate of viral haemorrhagic septicaemia virus (VHSV) genotype IVb

    DEFF Research Database (Denmark)

    Ito, Takafumi; Olesen, Niels Jørgen

    2013-01-01

    Genotype IVb of viral haemorrhagic septicaemia virus (VHSV) was isolated for the first time in the Great Lakes basin in 2003, where it spread and caused mass mortalities in several wild fish species throughout the basin. In order to prevent further spreading of the disease and to assess risks...... mortalities in bluegill Lepomis macrochirus used as positive controls, Japanese fluvial sculpin Cottus pollux, and iwana Salvelinus leucomaenis pluvius were 50, 80 and 0%, respectively. In Expt 2, cumulative mortalities of 100, 100 and 10% were observed in Japanese fluvial sculpin C. pollux, Japanese rice......-isolation by cell culture was successful from all dead fish. We detected the virus in the brain from a few surviving bluegill 50 d post exposure by both cell culture and RT-PCR. These results revealed that VHSV IVb could become a serious threat to wild freshwater fish species in Japan, and that some surviving fish...

  14. Stochastic Modelling of River Geometry

    DEFF Research Database (Denmark)

    Sørensen, John Dalsgaard; Schaarup-Jensen, K.

    1996-01-01

    Numerical hydrodynamic river models are used in a large number of applications to estimate critical events for rivers. These estimates are subject to a number of uncertainties. In this paper, the problem to evaluate these estimates using probabilistic methods is considered. Stochastic models for ...... for river geometries are formulated and a coupling between hydraulic computational methods and numerical reliability methods is presented....

  15. The Gediz River fluvial archive

    NARCIS (Netherlands)

    Maddy, D.; Veldkamp, A.; Demir, T.; Gorp, van W.; Wijbrans, J.R.; Hinsbergen, van D.J.J.; Dekkers, M.J.; Schreve, D.; Schoorl, J.M.; Scaife, R.

    2017-01-01

    The Gediz River, one of the principal rivers of Western Anatolia, has an extensive Pleistocene fluvial archive that potentially offers a unique window into fluvial system behaviour on the western margins of Asia during the Quaternary. In this paper we review our work on the Quaternary Gediz River

  16. Geomorphic classification of rivers

    Science.gov (United States)

    J. M. Buffington; D. R. Montgomery

    2013-01-01

    Over the last several decades, environmental legislation and a growing awareness of historical human disturbance to rivers worldwide (Schumm, 1977; Collins et al., 2003; Surian and Rinaldi, 2003; Nilsson et al., 2005; Chin, 2006; Walter and Merritts, 2008) have fostered unprecedented collaboration among scientists, land managers, and stakeholders to better understand,...

  17. Savannah River Technology Center

    International Nuclear Information System (INIS)

    1993-01-01

    This is a monthly progress report from the Savannah River Laboratory for the month of January 1993. It has sections with work in the areas of reactor safety, tritium processes and absorption, separations programs and wastes, environmental concerns and responses, waste management practices, and general concerns

  18. Alligator Rivers Region

    International Nuclear Information System (INIS)

    1992-01-01

    An introduction to the Alligator Rivers Region is presented. It contains general information regarding the physiography, climate, hydrology and mining of the region. The Alligator Rivers Region is within an ancient basin, the Pine Creek Geosyncline, which has an area of approximately 66000 km 2 . The Geosyncline has a history of mineral exploitation dating back to 1865, during which time 16 metals have been extracted (silver, arsenic, gold, bismuth, cadmium, cobalt, copper, iron, manganese, molybdenum, lead, tin, tantalum, uranium, tungsten, zinc). Uranium exploration in the Pine Creek Geosyncline was stimulated by the discovery in 1949 of secondary uranium mineralisation near Rum June, 70 km south-east of Darwin. This was followed by a decade of intense exploration activity resulting in the discoveries of economic uranium ore bodies at Rum Jungle and in the upper reaches of the South Alligator River Valley. All the known major uranium deposits of the East Alligator River uranium field have been discovered since 1969. The present known resources of the Geosyncline are approximately 360 000 tonnes of contained U 3 O 8 . 2 refs., 2 figs., 1 tab

  19. Discover the Nile River

    Science.gov (United States)

    Project WET Foundation, 2009

    2009-01-01

    Bordering on the Fantastic. As the longest river on earth, the Nile passes through 10 countries. Presented through a wide range of activities and a winning array of games, it's also unsurpassed at taking young minds into exploring the world of water, as well as natural and man made wonders.

  20. Two Pontic rivers

    DEFF Research Database (Denmark)

    Bekker-Nielsen, Tønnes; Jensen, Marit

    2015-01-01

    The accounts of the landscape around the Iris (Yeşilirmak) and the Thermodon (Terme) given by ancient authors are diverse and often contradictory. The Periegesis of the World by Dionysius of Alexandria, a didactic poem written in the early IInd c. A.D., established an image of the two rivers that...

  1. River water pollution condition in upper part of Brantas River and Bengawan Solo River

    Science.gov (United States)

    Roosmini, D.; Septiono, M. A.; Putri, N. E.; Shabrina, H. M.; Salami, I. R. S.; Ariesyady, H. D.

    2018-01-01

    Wastewater and solid waste from both domestic and industry have been known to give burden on river water quality. Most of river water quality problem in Indonesia has start in the upper part of river due to anthropogenic activities, due to inappropriate land use management including the poor wastewater infrastructure. Base on Upper Citarum River Water pollution problem, it is interesting to study the other main river in Java Island. Bengawan Solo River and Brantas River were chosen as the sample in this study. Parameters assessed in this study are as follows: TSS, TDS, pH, DO, and hexavalent chromium. The status of river water quality are assess using STORET method. Based on (five) parameters, STORET value showed that in Brantas River, Pagerluyung monitoring point had the worst quality relatively compared to other monitoring point in Brantas River with exceeding copper, lead and tin compared to the stream standard in East Java Provincial Regulation No. 2 in 2008. Brantas River was categorized as lightly polluted river based on monitoring period 2011-2015 in 5 monitoring points, namely Pendem, Sengguruh, Kademangan, Meritjan and Kertosono.

  2. River-corridor habitat dynamics, Lower Missouri River

    Science.gov (United States)

    Jacobson, Robert B.

    2010-01-01

    Intensive management of the Missouri River for navigation, flood control, and power generation has resulted in substantial physical changes to the river corridor. Historically, the Missouri River was characterized by a shifting, multithread channel and abundant unvegetated sandbars. The shifting channel provided a wide variety of hydraulic environments and large areas of connected and unconnected off-channel water bodies.Beginning in the early 1800s and continuing to the present, the channel of the Lower Missouri River (downstream from Sioux City, Iowa) has been trained into a fast, deep, single-thread channel to stabilize banks and maintain commercial navigation. Wing dikes now concentrate the flow, and revetments and levees keep the channel in place and disconnect it from the flood plain. In addition, reservoir regulation of the Missouri River upstream of Yankton, South Dakota, has substantially changed the annual hydrograph, sediment loads, temperature regime, and nutrient budgets.While changes to the Missouri River have resulted in broad social and economic benefits, they have also been associated with loss of river-corridor habitats and diminished populations of native fish and wildlife species. Today, Missouri River stakeholders are seeking ways to restore some natural ecosystem benefits of the Lower Missouri River without compromising traditional economic uses of the river and flood plain.

  3. Sapucai River Project

    International Nuclear Information System (INIS)

    Duarte, A.L.; Rosa, M.J.

    1988-01-01

    The Sapucai River Project is a gold, ilmenite, monazite and zircon alluvial deposit. It is located on Sapucai River valley in the south of Minas Gerais State. The reserves are 28.000.000 m 3 of pay bed. The production will be 1.400.000 m 3 /year and the mine's life 20 years. A cutterhead suction dredge will do the overburden removal. The pay bed will be mined with an underwater bucket-wheel dredge. The ROM will be concentrated in a washing plant. The gold will be recovered by leaching method. The other heavy minerals will be recovered by electrostatic, magnetic and gravitic methods. SAMITRI believes that it's possible to implant and operate the Project without ecological damage. (author) [pt

  4. Geomorphology and River Management

    Directory of Open Access Journals (Sweden)

    GARY BRIERLEY

    2008-01-01

    Full Text Available Engineering-dominated practices, visible in a "command and control" outlook on natural systems, have induced enormous damage to the environment. Biodiversity losses and declining provision of ecosystem services are testimony to the non-sustainable outcomes brought about by such practices. More environmentally friendly approaches that promote a harmonious relationship between human activities and nature are required. Moves towards an "ecosystem approach" to environmental management require coherent (integrative scientific guidance. Geomorphology, the study of the form of the earth, provides a landscape template with which to ground this process. This way of thinking respects the inherent diversity and complexity of natural systems. Examples of the transition toward such views in environmental practice are demonstrated by the use of science to guide river management, emphasising applications of the River Styles framework.

  5. Heat dispersion in rivers

    International Nuclear Information System (INIS)

    Shaw, T.L.

    1974-01-01

    One of the tasks of the Sonderforschungsbereich 80 is to study the dispersion of heat discharged into rivers and other bodies of water and to develop methods which permit prediction of detrimental effects caused by the heated discharges. In order to help the SFB 80 to specify this task, Dr. Shaw, lecturer of Civil Engineering at the Bristol University, conducted a literature survey on heat-dispersion studies during the two months which he spent as a visiting research fellow with the SFB 80 at the University of Karlsruhe in the summer of 1973. The following report is the outcome of this survey. It gives Dr. Shaw's assessment of the present state of knowledge - based almost exclusively on literature in the English language - and compares this with the knowledge required by river planners. The apparent discrepancy leads to suggestions for future research. Selected references as well as a representative bibliography can be found at the end of the report. (orig.) [de

  6. 50 CFR 226.205 - Critical habitat for Snake River sockeye salmon, Snake River fall chinook salmon, and Snake River...

    Science.gov (United States)

    2010-10-01

    ... salmon, Snake River fall chinook salmon, and Snake River spring/summer chinook salmon. 226.205 Section... Snake River sockeye salmon, Snake River fall chinook salmon, and Snake River spring/summer chinook salmon. The following areas consisting of the water, waterway bottom, and adjacent riparian zone of...

  7. Ecology of Siberian Taimen Hucho taimen in the Lake Baikal Basin

    Science.gov (United States)

    Matveyev, Arcadi N.; Pronin, Nikolai M.; Samusenok, Vitali P.; Bronte, Charles R.

    1998-01-01

    Taimen Hucho taimen historically inhabited most tributaries and littoral areas of Lake Baikal, in south central Siberia, where they supported subsistence and commercial fisheries. Logging, pollution, and overfishing have caused dramatic population declines or local extinction of most stocks. Most of what is known about this species has been published in eastern journals and therefore is not readily available to western scientists. New data collected during the 1980s and 1990s have been combined with other reports to provide an overview of the biology and life history of this species. Taimen are long-lived fish and can reach ages of 29 years and sizes up to 60 kg. Populations can either be strictly riverine or anadromous. Adults from both life histories ascend rivers in spring to spawn and feed, and less extensive migrations occur in fall to prey on spawning omul (Coregonus autumnalis migratorius). Principal food items for age 1 and 2 taimen are macroinvertebrates, but young taimen quickly become piscivorous at age 2 when they consume mainly black Baikal grayling (Thymallus arcticus baicalensis), and sculpins (Taracottus kneri, Cottus kesslerij). Males reach sexual maturity at ages 7 to 8 and later for females at ages 8 to 9. Average egg production per female was about 22,000 eggs. Parasite burdens are heavy but composed of few species and mediated by prey items consumed. This fish is a highly-specialized predator and plays an indispensable role in the structure of fish communities in mountains and foothills. Taimen conservation in the Baikal region is impossible without adoption and implementation of a dedicated rehabilitation program that includes the protection of remaining populations and habitat, and possibly introduction of hatchery-reared fish in selected areas where habitat remains, but parental stocks are low.

  8. Recovery of a mining-damaged stream ecosystem

    Directory of Open Access Journals (Sweden)

    Christopher A. Mebane

    2015-03-01

    Full Text Available Abstract This paper presents a 30+ year record of changes in benthic macroinvertebrate communities and fish populations associated with improving water quality in mining-influenced streams. Panther Creek, a tributary to the Salmon River in central Idaho, USA suffered intensive damage from mining and milling operations at the Blackbird Mine that released copper (Cu, arsenic (As, and cobalt (Co into tributaries. From the 1960s through the 1980s, no fish and few aquatic invertebrates could be found in 40 km of mine-affected reaches of Panther Creek downstream of the metals contaminated tributaries, Blackbird and Big Deer Creeks. Efforts to restore water quality began in 1995, and by 2002 Cu levels had been reduced by about 90%, with incremental declines since. Rainbow Trout (Oncorhynchus mykiss were early colonizers, quickly expanding their range as areas became habitable when Cu concentrations dropped below about 3X the U.S. Environmental Protection Agency’s biotic ligand model (BLM based chronic aquatic life criterion. Anadromous Chinook Salmon (O. tshawytscha and steelhead (O. mykiss have also reoccupied Panther Creek. Full recovery of salmonid populations occurred within about 12-years after the onset of restoration efforts and about 4-years after the Cu chronic criteria had mostly been met, with recovery interpreted as similarity in densities, biomass, year class strength, and condition factors between reference sites and mining-influenced sites. Shorthead Sculpin (Cottus confusus were slower than salmonids to disperse and colonize. While benthic macroinvertebrate biomass has increased, species richness has plateaued at about 70 to 90% of reference despite the Cu criterion having been met for several years. Different invertebrate taxa had distinctly different recovery trajectories. Among the slowest taxa to recover were Ephemerella, Cinygmula and Rhithrogena mayflies, Enchytraeidae oligochaetes, and Heterlimnius aquatic beetles. Potential

  9. Bull trout life history, genetics, habitat needs, and limiting factors in central and northeast Oregon, Annual Report 1995

    International Nuclear Information System (INIS)

    Hemmingsen, A.R.; Buchanan, D.V.; Howell, P.J.

    1996-03-01

    To fulfill one objective of the present study, genetic characteristics of Oregon bull trout will be determined by analysis of mitochondrial and nuclear DNA. During 1995, the authors collected and sampled a total of 1,217 bull trout from 46 streams in the Columbia River Basin. DNA analysis of those samples will be conducted at University of Montana. They primarily sampled juvenile fish near natal areas to increase the likelihood of identifying discrete populations while minimizing risk of injury to large spawners. Fork lengths of all fish sampled ranged from 2.6 to 60.5 cm with a median of 12 cm. Eighty-four percent of all bull trout sampled were less than 19 cm while two percent were larger than 27 cm. Bull trout were collected by several methods, mostly by electrofishing. Eighty-six percent of all bull trout sampled were collected by electrofishing with a programmable waveform electrofisher. They observed injuries caused by electrofishing to 8% of that proportion. Based on preliminary analysis, no waveform combination used appeared less injurious than others. Highest voltages appeared less injurious than some that were lower. Frequency of electrofishing injury was significantly correlated to fork length over the range-from 4 to 26 cm. There were indications for substantial risk for such injury to bull trout larger than 26 cm. Other species found in association with bull trout included chinook salmon Oncorhynchus tshawytscha, mountain whitefish Prosopium williamsoni, rainbow trout Oncorhynchus mykiss, sculpins Cottus spp., cutthroat trout Oncorhynchus clarki, non-native brook trout Salvelinus fontinalis, and tailed frogs Ascaphus truei. Rainbow trout was the species most frequently associated with bull trout. No injury or mortality was observed for any of the associated species captured

  10. Onilahy River, Madagascar

    Science.gov (United States)

    1982-01-01

    Near the southern tip of Madagascar, the Onilahy River (23.5S, 44E) drains a near barren landscape, the result of rapid deforestation for quick profits from the lumber industry with no regard to the environmental impact. At the turn of the century, the island was a lush tropical paradise with about 90 percent of the surface forested. Now, at the close of the century, only about 10 percent of the forests remain in inaccessible rugged terrain.

  11. Charles River Crossing

    Science.gov (United States)

    2012-04-06

    duration, deck sections will be prefabricated off-site and delivered just-in-time for assembly and installation. The schedule assumes that the parts of...on one side (the side which abuts the existing bridges) there will be the appearance that the new bridges cantilever off the existing bridges. (See...many events that takes place on the Charles River such as crew racings and the “Head of the Charles”. Prefabricated off 19  ANCHORAGE GROUP, LTD

  12. AHP 45: Review: River

    Directory of Open Access Journals (Sweden)

    Phun tshogs dbang rgyal ཕུན་ཚོགས་དབང་རྒྱལ།

    2017-03-01

    Full Text Available Zon thar rgyal says that inspiration for River came with the arrival of his second child (a son, which made his daughter very uncomfortable. "At first, I just wanted to make a simple movie for children as a gift for my daughter,"6 he said during an interview in Lha sa. Later, however, the film became more elaborate with the addition of a grandfather, creating a story that embraces three generations.

  13. Columbia River pathway report

    International Nuclear Information System (INIS)

    1991-07-01

    This report summarizes the river-pathway portion of the first phase of the Hanford Environmental Dose Reconstruction (HEDR) Project. The HEDR Project is estimating radiation doses that could have been received by the public from the Department of Energy's Hanford Site, in southeastern Washington State. Phase 1 of the river-pathway dose reconstruction effort sought to determine whether dose estimates could be calculated for populations in the area from above the Hanford Site at Priest Rapids Dam to below the site at McNary Dam from January 1964 to December 1966. Of the potential sources of radionuclides from the river, fish consumption was the most important. Doses from drinking water were lower at Pasco than at Richland and lower at Kennewick than at Pasco. The median values of preliminary dose estimates calculated by HEDR are similar to independent, previously published estimates of average doses to Richland residents. Later phases of the HEDR Project will address dose estimates for periods other than 1964--1966 and for populations downstream of McNary Dam. 17 refs., 19 figs., 1 tab

  14. The river ecosystem

    International Nuclear Information System (INIS)

    Descy, J.P.; Lambinon, J.

    1984-01-01

    From the standpoint of the ecologist, a river is an ecosystem characterized by its biocoenosis, in dynamic equilibrium with the abiotic environment. This ecosystem can be envisaged at the structural level by examining its physical, chemical and biological properties, together with the relationships existing between these compartments. The biocoenotic structure of a river is relatively complex: it manifests, among other specific features, the presence of plankton communities which show marked space-time variations. The function of the river ecosystem can be approximated by a study of the relationships between the biotic and abiotic components: primary production, secondary production, recycling of organic matter, etc. Lotic environments are subject to frequent disturbance from various forms of man-made pollution: organic pollution, eutrophization, thermal pollution, mineral pollution, contamination by organic and mineral micropollutants, as well as by radionuclides, mechanical pollution and physical degradation. The biocoenotic effects of these forms of pollution may be evaluated, in particular, using biological indicators (bioindicators): these are either able to show the overall impact of the pollution on the biocoenosis or else they permit the detection and evaluation of certain pollutant forms. (author)

  15. 78 FR 28492 - Special Local Regulation; Low Country Splash, Wando River, Cooper River, and Charleston Harbor...

    Science.gov (United States)

    2013-05-15

    ...-AA08 Special Local Regulation; Low Country Splash, Wando River, Cooper River, and Charleston Harbor... establishing a special local regulation on the waters of the Wando River, Cooper River, and Charleston Harbor... rulemaking (NPRM) entitled, ``Special Local Regulation; Low Country Splash, Wando River, Cooper River, and...

  16. 78 FR 18277 - Special Local Regulation; Low Country Splash, Wando River, Cooper River, and Charleston Harbor...

    Science.gov (United States)

    2013-03-26

    ...-AA08 Special Local Regulation; Low Country Splash, Wando River, Cooper River, and Charleston Harbor... proposes to issue a special local regulation on the waters of the Wando River, Cooper River, and Charleston... Country Splash is scheduled to take place on the waters of the Wando River, Cooper River, and Charleston...

  17. River Restoration and Meanders

    Directory of Open Access Journals (Sweden)

    G. Mathias Kondolf

    2006-12-01

    Full Text Available Among the most visually striking river restoration projects are those that involve the creation of a new channel, often in a new alignment and generally with a form and dimensions that are different from those of the preproject channel. These channel reconstruction projects often have the objective of creating a stable, single-thread, meandering channel, even on rivers that were not historically meandering, on rivers whose sediment load and flow regime would not be consistent with such stable channels, or on already sinuous channels whose bends are not symmetrical. Such meandering channels are often specified by the Rosgen classification system, a popular restoration design approach. Although most projects of this type have not been subject to objective evaluation, completed postproject appraisals show that many of these projects failed within months or years of construction. Despite its, at best, mixed results, this classification and form-based approach continues to be popular because it is easy to apply, because it is accessible to those without formal training in fluvial geomorphology, and probably because it satisfies a deep-seated, although unrecognized, cultural preference for single-thread meandering channels. This preference is consistent with 18th-century English landscape theories, which held the serpentine form to be ideal and led to widespread construction of meandering channels on the country estates of the era. The preference for stability in restored channels seems to be widely accepted by practitioners and funders despite the fact that it is antithetical to research showing that dynamically migrating channels have the greatest ecological richness.

  18. Saga of Clinch River

    International Nuclear Information System (INIS)

    Young, W.H.

    1984-01-01

    An epic struggle in the US Congress between what the author calls the forces of transcendence and the forces of experience over development of a breeder reactor for electric power generation is described in this article. The project was started by President Nixon, survived repeated attacks under President Carter, and ironically succumbed under a strong supporter, President Reagan, as a result of an unlikely coalition of conservative organizations and Republican politicians. The broader meanings of the demise of the Clinch River project are examined on several levels, examining the significance for the nation's energy future and for the nation's political future

  19. Lowland river systems - processes, form and function

    DEFF Research Database (Denmark)

    Pedersen, M. L.; Kronvang, B.; Sand-Jensen, K.

    2006-01-01

    Present day river valleys and rivers are not as dynamic and variable as they used to be. We will here describe the development and characteristics of rivers and their valleys and explain the background to the physical changes in river networks and channel forms from spring to the sea. We seek...... to answer two fundamental questions: How has anthropogenic disturbance of rivers changed the fundamental form and physical processes in river valleys? Can we use our understanding of fl uvial patterns to restore the dynamic nature of channelised rivers and drained fl oodplains in river valleys?...

  20. Elevated temperature exacerbates Ichthyophonus infections in buffalo sculpin

    Science.gov (United States)

    Halpenny, C.M.; Kocan, R.M.; Winton, J.R.; Perry, J.A.; Hershberger, P.K.

    2002-01-01

    High incidences of Ichthyophonus hoferi, a parasite primarily of marine and estuarine fishes, have recently been reported in rockfishes and Pacific herring from the eastern North Pacific (Kent et al 2001, Hershberger et al 2002). Taxonomic position of I. hoferi remains unresolved, but recent phylogenetic studies have grouped the organism with Dermocystidium, Psorospermium, the rosette agent of salmonids, and Rhinosporidium in the Mesomycetozoa, a novel clade of protists near the animal-fungal divergence (Herr et al 1999). Genetic differences among isolates from the east coast of North America indicate that more than one species of Ichthyophonus exist (Rand et al 2000), and different species have likely been assigned the same name based on morphological characteristics. Therefore, hereafter in this manuscript, the organism will be referred to as Ichthyophonus .

  1. Energy from rivers and oceans

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    This chapter discusses the role energy from rivers and oceans may have in the energy future of the US. The topics discussed in the chapter include historical aspects of using energy from rivers and oceans, hydropower assessment including resources, technology and costs, and environmental and regulatory issues, ocean thermal energy conversion including technology and costs and environmental issues, tidal power, and wave power

  2. Hood River Passive House

    Energy Technology Data Exchange (ETDEWEB)

    Hales, David [BA-PIRC, Spokane, WA (United States)

    2014-01-01

    The Hood River Passive Project was developed by Root Design Build of Hood River Oregon using the Passive House Planning Package (PHPP) to meet all of the requirements for certification under the European Passive House standards. The Passive House design approach has been gaining momentum among residential designers for custom homes and BEopt modeling indicates that these designs may actually exceed the goal of the U.S. Department of Energy's (DOE) Building America program to "reduce home energy use by 30%-50% (compared to 2009 energy codes for new homes). This report documents the short term test results of the Shift House and compares the results of PHPP and BEopt modeling of the project. The design includes high R-Value assemblies, extremely tight construction, high performance doors and windows, solar thermal DHW, heat recovery ventilation, moveable external shutters and a high performance ductless mini-split heat pump. Cost analysis indicates that many of the measures implemented in this project did not meet the BA standard for cost neutrality. The ductless mini-split heat pump, lighting and advanced air leakage control were the most cost effective measures. The future challenge will be to value engineer the performance levels indicated here in modeling using production based practices at a significantly lower cost.

  3. Geomorphology and river dynamics of the lower Copper River, Alaska

    Science.gov (United States)

    Brabets, Timothy P.; Conaway, Jeffrey S.

    2009-01-01

    Located in south-central Alaska, the Copper River drains an area of more than 24,000 square miles. The average annual flow of the river near its mouth is 63,600 cubic feet per second, but is highly variable between winter and summer. In the winter, flow averages approximately 11,700 cubic feet per second, and in the summer, due to snowmelt, rainfall, and glacial melt, flow averages approximately 113,000 cubic feet per second, an order of magnitude higher. About 15 miles upstream of its mouth, the Copper River flows past the face of Childs Glacier and enters a large, broad, delta. The Copper River Highway traverses this flood plain, and in 2008, 11 bridges were located along this section of the highway. The bridges cross several parts of the Copper River and in recent years, the changing course of the river has seriously damaged some of the bridges.Analysis of aerial photography from 1991, 1996, 2002, 2006, and 2007 indicates the eastward migration of a channel of the Copper River that has resulted in damage to the Copper River Highway near Mile 43.5. Migration of another channel in the flood plain has resulted in damage to the approach of Bridge 339. As a verification of channel change, flow measurements were made at bridges along the Copper River Highway in 2005–07. Analysis of the flow measurements indicate that the total flow of the Copper River has shifted from approximately 50 percent passing through the bridges at Mile 27, near the western edge of the flood plain, and 50 percent passing through the bridges at Mile 36–37 to approximately 5 percent passing through the bridges at Mile 27 and 95 percent through the bridges at Mile 36–37 during average flow periods.The U.S. Geological Survey’s Multi-Dimensional Surface-Water Modeling System was used to simulate water-surface elevation and velocity, and to compute bed shear stress at two areas where the Copper River is affecting the Copper River Highway. After calibration, the model was used to examine the

  4. Columbia River water quality monitoring

    International Nuclear Information System (INIS)

    Anon.

    1983-01-01

    Waste water from Hanford activities is discharged at eight points along the Hanford reach of the Columbia River. These discharges consist of backwash water from water intake screens, cooling water, river bank springs, water storage tank overflow, and fish laboratory waste water. Each discharge point is identified in an existing National Pollutant Discharge Elimination System (NPDES) permit issued by the EPA. Effluents from each of these outfalls are routinely monitored and reported by the operating contractors as required by their NPDES permits. Measurements of several Columbia River water quality parameters were conducted routinely during 1982 both upstream and downstream of the Hanford Site to monitor any effects on the river that may be attributable to Hanford discharges and to determine compliance with the Class A designation requirements. The measurements indicated that Hanford operations had a minimal, if any, impact on the quality of the Columbia River water

  5. Global relationships in river hydromorphology

    Science.gov (United States)

    Pavelsky, T.; Lion, C.; Allen, G. H.; Durand, M. T.; Schumann, G.; Beighley, E.; Yang, X.

    2017-12-01

    Since the widespread adoption of digital elevation models (DEMs) in the 1980s, most global and continental-scale analysis of river flow characteristics has been focused on measurements derived from DEMs such as drainage area, elevation, and slope. These variables (especially drainage area) have been related to other quantities of interest such as river width, depth, and velocity via empirical relationships that often take the form of power laws. More recently, a number of groups have developed more direct measurements of river location and some aspects of planform geometry from optical satellite imagery on regional, continental, and global scales. However, these satellite-derived datasets often lack many of the qualities that make DEM=derived datasets attractive, including robust network topology. Here, we present analysis of a dataset that combines the Global River Widths from Landsat (GRWL) database of river location, width, and braiding index with a river database extracted from the Shuttle Radar Topography Mission DEM and the HydroSHEDS dataset. Using these combined tools, we present a dataset that includes measurements of river width, slope, braiding index, upstream drainage area, and other variables. The dataset is available everywhere that both datasets are available, which includes all continental areas south of 60N with rivers sufficiently large to be observed with Landsat imagery. We use the dataset to examine patterns and frequencies of river form across continental and global scales as well as global relationships among variables including width, slope, and drainage area. The results demonstrate the complex relationships among different dimensions of river hydromorphology at the global scale.

  6. Life history and biogeographic diversification of an endemic western North American freshwater fish clade using a comparative species tree approach.

    Science.gov (United States)

    Baumsteiger, Jason; Kinziger, Andrew P; Aguilar, Andres

    2012-12-01

    The west coast of North America contains a number of biogeographic freshwater provinces which reflect an ever-changing aquatic landscape. Clues to understanding this complex structure are often encapsulated genetically in the ichthyofauna, though frequently as unresolved evolutionary relationships and putative cryptic species. Advances in molecular phylogenetics through species tree analyses now allow for improved exploration of these relationships. Using a comprehensive approach, we analyzed two mitochondrial and nine nuclear loci for a group of endemic freshwater fish (sculpin-Cottus) known for a wide ranging distribution and complex species structure in this region. Species delimitation techniques identified three novel cryptic lineages, all well supported by phylogenetic analyses. Comparative phylogenetic analyses consistently found five distinct clades reflecting a number of unique biogeographic provinces. Some internal node relationships varied by species tree reconstruction method, and were associated with either Bayesian or maximum likelihood statistical approaches or between mitochondrial, nuclear, and combined datasets. Limited cases of mitochondrial capture were also evident, suggestive of putative ancestral hybridization between species. Biogeographic diversification was associated with four major regions and revealed historical faunal exchanges across regions. Mapping of an important life-history character (amphidromy) revealed two separate instances of trait evolution, a transition that has occurred repeatedly in Cottus. This study demonstrates the power of current phylogenetic methods, the need for a comprehensive phylogenetic approach, and the potential for sculpin to serve as an indicator of biogeographic history for native ichthyofauna in the region. Copyright © 2012 Elsevier Inc. All rights reserved.

  7. River-Based Experiential Learning: the Bear River Fellows Program

    Science.gov (United States)

    Rosenberg, D. E.; Shirley, B.; Roark, M. F.

    2012-12-01

    The Department of Civil and Environmental Engineering, Outdoor Recreation, and Parks and Recreation programs at Utah State University (USU) have partnered to offer a new, unique river-based experiential learning opportunity for undergraduates called the Bear River Fellows Program. The program allows incoming freshmen Fellows to experience a river first hand during a 5-day/4-night river trip on the nearby Bear River two weeks before the start of their first Fall semester. As part of the program, Fellows will navigate the Bear River in canoes, camp along the banks, interact with local water and environmental managers, collect channel cross section, stream flow, vegetation cover, and topological complexity data, meet other incoming freshmen, interact with faculty and graduate students, develop boating and leadership skills, problem solve, and participate as full members of the trip team. Subsequently, Fellows will get paid as undergraduate researchers during their Fall and Spring Freshman semesters to analyze, synthesize, and present the field data they collect. The program is a collaborative effort between two USU academic units and the (non-academic) division of Student Services and supports a larger National Science Foundation funded environmental modelling and management project for the lower Bear River, Utah watershed. We have advertised the program via Facebook and emails to incoming USU freshmen, received 35 applications (60% women), and accepted 5 Fellows into the program (3 female and 2 male). The river trip departs August 14, 2012. The poster will overview the Bear River Fellows Program and present qualitative and preliminary outcomes emerging from the trip and Fellows' work through the Fall semester with the field data they collect. We will also undertake more rigorous and longer longitudinal quantitative evaluation of Program outcomes (for example, in problem-solving and leadership) both in Spring 2013 and in subsequent 2013 and 2014 offerings of the

  8. Alligator Rivers analogue project

    International Nuclear Information System (INIS)

    Duerden, P.

    1990-01-01

    Australian Nuclear Science and Technology Organization has extensively evaluated uranium ore bodies in the Alligator Rivers Uranium Province in Australia as analogues of radioactive waste repositories. The work was extended for a three-year program as an international project based on the Koongarra uranium deposit and sponsored by the OECD Nuclear Energy Agency. The technical program comprises six major sub-projects involving modelling and experimental work: modelling of radionuclide migration; hydrogeology of the Koongarra uranium deposit; uranium/thorium series disequilibria studies; groundwater and colloid studies; fission product studies; transuranic nuclide studies; an outline of the technical programs and a summary of progress in the technical sub-projects is given. This is followed by a series of technical reports which briefly describe current research tasks, and which have been separately indexed

  9. River history and tectonics.

    Science.gov (United States)

    Vita-Finzi, C

    2012-05-13

    The analysis of crustal deformation by tectonic processes has gained much from the clues offered by drainage geometry and river behaviour, while the interpretation of channel patterns and sequences benefits from information on Earth movements before or during their development. The interplay between the two strands operates at many scales: themes which have already benefited from it include the possible role of mantle plumes in the breakup of Gondwana, the Cenozoic development of drainage systems in Africa and Australia, Himalayan uplift in response to erosion, alternating episodes of uplift and subsidence in the Mississippi delta, buckling of the Indian lithospheric plate, and changes in stream pattern and sinuosity along individual alluvial channels subject to localized deformation. Developments in remote sensing, isotopic dating and numerical modelling are starting to yield quantitative analyses of such effects, to the benefit of geodymamics as well as fluvial hydrology. This journal is © 2012 The Royal Society

  10. Robotics at Savannah River

    International Nuclear Information System (INIS)

    Byrd, J.S.

    1983-01-01

    A Robotics Technology Group was organized at the Savannah River Laboratory in August 1982. Many potential applications have been identified that will improve personnel safety, reduce operating costs, and increase productivity using modern robotics and automation. Several active projects are under way to procure robots, to develop unique techniques and systems for the site's processes, and to install the systems in the actual work environments. The projects and development programs are involved in the following general application areas: (1) glove boxes and shielded cell facilities, (2) laboratory chemical processes, (3) fabrication processes for reactor fuel assemblies, (4) sampling processes for separation areas, (5) emergency response in reactor areas, (6) fuel handling in reactor areas, and (7) remote radiation monitoring systems. A Robotics Development Laboratory has been set up for experimental and development work and for demonstration of robotic systems

  11. HYDROLOGICAL ASSESSMENTS OF SOME RIVERS IN EDO ...

    African Journals Online (AJOL)

    Highest monthly hydropower yields were recorded in September for Ovia, Ikpoba and Edion Rivers and in August for Orlie River. On annual basis, Ovia River, recorded the highest power yield of 61.619MW (suggesting that Ovia river may be suitable for a Medium hydropower scheme, 10MW-100MW) with the highest ...

  12. Assessment of river plan changes in Terengganu River using RS ...

    African Journals Online (AJOL)

    Journal of Fundamental and Applied Sciences ... The database can help in the appropriate understanding of river plan change and know ... The data collected from Geographic Information System (GIS) and Remote Sensing (RS) database.

  13. 78 FR 17087 - Special Local Regulation; New River Raft Race, New River; Fort Lauderdale, FL

    Science.gov (United States)

    2013-03-20

    ...-AA08 Special Local Regulation; New River Raft Race, New River; Fort Lauderdale, FL AGENCY: Coast Guard... on the New River in Fort Lauderdale, Florida during the Rotary Club of Fort Lauderdale New River Raft... States during the Rotary Club of Fort Lauderdale New River Raft Race. On March 23, 2013, Fort Lauderdale...

  14. 76 FR 71342 - Proposed CERCLA Administrative Cost Recovery Settlement; River Forest Dry Cleaners Site, River...

    Science.gov (United States)

    2011-11-17

    ... Settlement; River Forest Dry Cleaners Site, River Forest, Cook County, IL AGENCY: Environmental Protection... response costs concerning the River Forest Dry Cleaners site in River Forest, Cook County, Illinois with... code: C-14J, Chicago, Illinois 60604. Comments should reference the River Forest Dry Cleaners Site...

  15. Hydrological River Drought Analysis (Case Study: Lake Urmia Basin Rivers

    Directory of Open Access Journals (Sweden)

    Mohammad Nazeri Tahrudi

    2017-02-01

    Full Text Available Introduction: Drought from the hydrological viewpoint is a continuation of the meteorological drought that cause of the lack of surface water such as rivers, lakes, reservoirs and groundwater resources. This analysis, which is generally on the surface streams, reservoirs, lakes and groundwater, takes place as hydrological drought considered and studied. So the data on the quantity of flow of the rivers in this study is of fundamental importance. This data are included, level, flow, river flow is no term (5. Overall the hydrological drought studies are focused on annual discharges, maximum annual discharge or minimum discharge period. The most importance of this analysis is periodically during the course of the analysis remains a certain threshold and subthresholdrunoff volume fraction has created. In situations where water for irrigation or water of a river without any reservoir, is not adequate, the minimum flow analysis, the most important factor to be considered (4. The aim of this study is evaluatingthe statistical distributions of drought volume rivers data from the Urmia Lake’s rivers and its return period. Materials and Methods: Urmia Lake is a biggest and saltiest continued lake in Iran. The Lake Urmia basin is one of the most important basins in Iran region which is located in the North West of Iran. With an extent of 52700 square kilometers and an area equivalent to 3.21% of the total area of the country, This basin is located between the circuit of 35 degrees 40 minutes to 38 degrees 29 minutes north latitude and the meridian of 44 degrees 13 minutes to 47 degrees 53 minutes east longitude. In this study used the daily discharge data (m3s-1 of Urmia Lake Rivers. Extraction of river drought volume The drought durations were extracted from the daily discharge of 13 studied stations. The first mean year was calculated for each 365 days using the Eq 1 (14. (1 (For i=1,2,3,…,365 That Ki is aith mean year, Yijis ith day discharge in jth

  16. Riparian Habitat - San Joaquin River

    Data.gov (United States)

    California Natural Resource Agency — The immediate focus of this study is to identify, describe and map the extent and diversity of riparian habitats found along the main stem of the San Joaquin River,...

  17. 33 CFR 162.90 - White River, Arkansas Post Canal, Arkansas River, and Verdigris River between Mississippi River...

    Science.gov (United States)

    2010-07-01

    ... go adrift. Immediately after completion of the emergency mooring, the lockmaster of the first lock... of approach to unattended, normally open automatic, movable span bridges, the factor of river flow...

  18. Anastomosing Rivers are Disequilibrium Patterns

    NARCIS (Netherlands)

    Lavooi, E.; Haas, de T.; Kleinhans, M.G.; Makaske, B.; Smith, D.G.

    2010-01-01

    Anastomosing rivers have multiple interconnected channels that enclose floodbasins. Various theories have been proposed to explain this pattern, including an increased discharge conveyance and sediment transport capacity of multiple channels, or, alternatively, a tendency to avulse due to upstream

  19. Missouri River, Natural Resources Bibliography.

    Science.gov (United States)

    1997-07-01

    1971. Thermal study of the 366. CUNDAY TW, BROOKS KN. 1981. Calibrating Missouri River in North Dakota using infrared and verifying the SSARR model...in North and South 1612. SCHUELER RL, SULLIVAN JK. 1967. Quantifying Dakota using NOAA-5 infrared data. In: current and potential commercial fishery...use survey, 1984. South Dakota River. Journal of the Waterways Department of Game, Fish and Parks. Pierre, 101( WW2 ):119-33. SD. Interim report. South

  20. Continuum Model for River Networks

    Science.gov (United States)

    Giacometti, Achille; Maritan, Amos; Banavar, Jayanth R.

    1995-07-01

    The effects of erosion, avalanching, and random precipitation are captured in a simple stochastic partial differential equation for modeling the evolution of river networks. Our model leads to a self-organized structured landscape and to abstraction and piracy of the smaller tributaries as the evolution proceeds. An algebraic distribution of the average basin areas and a power law relationship between the drainage basin area and the river length are found.

  1. Sensitivity of Coastal Environments and Wildlife to Spilled Oil: Hudson River: RVRMILES (River Mile Marker Lines)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains human-use resource data for river miles along the Hudson River. Vector lines in this data set represent river mile markers. This data set...

  2. Hierarchically nested river landform sequences

    Science.gov (United States)

    Pasternack, G. B.; Weber, M. D.; Brown, R. A.; Baig, D.

    2017-12-01

    River corridors exhibit landforms nested within landforms repeatedly down spatial scales. In this study we developed, tested, and implemented a new way to create river classifications by mapping domains of fluvial processes with respect to the hierarchical organization of topographic complexity that drives fluvial dynamism. We tested this approach on flow convergence routing, a morphodynamic mechanism with different states depending on the structure of nondimensional topographic variability. Five nondimensional landform types with unique functionality (nozzle, wide bar, normal channel, constricted pool, and oversized) represent this process at any flow. When this typology is nested at base flow, bankfull, and floodprone scales it creates a system with up to 125 functional types. This shows how a single mechanism produces complex dynamism via nesting. Given the classification, we answered nine specific scientific questions to investigate the abundance, sequencing, and hierarchical nesting of these new landform types using a 35-km gravel/cobble river segment of the Yuba River in California. The nested structure of flow convergence routing landforms found in this study revealed that bankfull landforms are nested within specific floodprone valley landform types, and these types control bankfull morphodynamics during moderate to large floods. As a result, this study calls into question the prevailing theory that the bankfull channel of a gravel/cobble river is controlled by in-channel, bankfull, and/or small flood flows. Such flows are too small to initiate widespread sediment transport in a gravel/cobble river with topographic complexity.

  3. A Rejang River rash

    Directory of Open Access Journals (Sweden)

    Jean-Li Lim

    2014-04-01

    Full Text Available A 30-year-old Iban woman presented to a rural primary healthcare clinic located along the Batang Rejang in Sarawak. She had a 2-day history of rash, which started over her trunk and later spread to her face and limbs. What started out as individual erythematous maculopapular spots later coalesced to form larger raised blotches. The rash was extremely pruritic and affected her sleep, and hence her visit. The rash was preceded by high grade, persistent fever that was temporarily relieved by paracetamol. She also complained of malaise, arthralgia and myalgia. Her appetite had been poor since the onset of the fever. She lived in a long house at the edge of the jungle. Although she did not have a history of going into the jungle to forage, she went regularly to the river to wash clothes. Clinically, she appeared lethargic and had bilateral conjunctival injection. Her left anterior cervical lymph nodes were palpable. There were erythematous macules measuring 5 to 15 mm distributed over her whole body but predominantly over the chest and abdominal region (Figure 1. An unusual skin lesion was discovered at the right hypochondriac region. This lesion resembled a cigarette burn with a necrotic centre (Figure 2. There was no evidence of hepato-splenomegaly. Examination of the other systems was unremarkable. On further questioning, the patient admitted being bitten by a ‘kutu babi’ or mite 3 days before the onset of her fever.

  4. Upper Illinois River basin

    Science.gov (United States)

    Friedel, Michael J.

    1998-01-01

    During the past 25 years, industry and government made large financial investments that resulted in better water quality across the Nation; however, many water-quality concerns remain. Following a 1986 pilot project, the U.S. Geological Survey began implementation of the National Water-Quality Assessment (NAWQA) Program in 1991. This program differs from other national water-quality assessment studies in that the NAWQA integrates monitoring of surface- and ground-water quality with the study of aquatic ecosystems. The goals of the NAWQA Program are to (1) describe current water-quality conditions for a large part of the Nation's freshwater streams and aquifers (water-bearing sediments and rocks), (2) describe how water quality is changing over time, and (3) improve our understanding of the primary natural and human factors affecting water quality.The Upper Illinois River Basin National Water- Quality Assessment (NAWQA) study will increase the scientific understanding of surface- and ground-water quality and the factors that affect water quality in the basin. The study also will provide information needed by water-resource managers to implement effective water-quality management actions and evaluate long-term changes in water quality.

  5. Connectivity in river deltas

    Science.gov (United States)

    Passalacqua, P.; Hiatt, M. R.; Sendrowski, A.

    2016-12-01

    Deltas host approximately half a billion people and are rich in ecosystem diversity and economic resources. However, human-induced activities and climatic shifts are significantly impacting deltas around the world; anthropogenic disturbance, natural subsidence, and eustatic sea-level rise are major causes of threat to deltas and in many cases have compromised their safety and sustainability, putting at risk the people that live on them. In this presentation, I will introduce a framework called Delta Connectome for studying connectivity in river deltas based on different representations of a delta as a network. Here connectivity indicates both physical connectivity (how different portions of the system interact with each other) as well as conceptual (pathways of process coupling). I will explore several network representations and show how quantifying connectivity can advance our understanding of system functioning and can be used to inform coastal management and restoration. From connectivity considerations, the delta emerges as a leaky network that evolves over time and is characterized by continuous exchanges of fluxes of matter, energy, and information. I will discuss the implications of connectivity on delta functioning, land growth, and potential for nutrient removal.

  6. River rating complexity

    Science.gov (United States)

    Holmes, Robert R.

    2016-01-01

    Accuracy of streamflow data depends on the veracity of the rating model used to derive a continuous time series of discharge from the surrogate variables that can readily be collected autonomously at a streamgage. Ratings are typically represented as a simple monotonic increasing function (simple rating), meaning the discharge is a function of stage alone, however this is never truly the case unless the flow is completely uniform at all stages and in transitions from one stage to the next. For example, at some streamflow-monitoring sites the discharge on the rising limb of the hydrograph is discernably larger than the discharge at the same stage on the falling limb of the hydrograph. This is the so-called “loop rating curve” (loop rating). In many cases, these loops are quite small and variation between rising- and falling-limb discharge measurements made at the same stage are well within the accuracy of the measurements. However, certain hydraulic conditions can produce a loop that is large enough to preclude use of a monotonic rating. A detailed data campaign for the Mississippi River at St. Louis, Missouri during a multi-peaked flood over a 56-day period in 2015 demonstrates the rating complexity at this location. The shifting-control method used to deal with complexity at this site matched all measurements within 8%.

  7. Turbulent forces within river plumes affect spread

    Science.gov (United States)

    Bhattacharya, Atreyee

    2012-08-01

    When rivers drain into oceans through narrow mouths, hydraulic forces squeeze the river water into buoyant plumes that are clearly visible in satellite images. Worldwide, river plumes not only disperse freshwater, sediments, and nutrients but also spread pollutants and organisms from estuaries into the open ocean. In the United States, the Columbia River—the largest river by volume draining into the Pacific Ocean from North America—generates a plume at its mouth that transports juvenile salmon and other fish into the ocean. Clearly, the behavior and spread of river plumes, such as the Columbia River plume, affect the nation's fishing industry as well as the global economy.

  8. Evaluating the negative effect of benthic egg predators on bloater recruitment in northern Lake Michigan

    Science.gov (United States)

    Bunnell, David B.; Mychek-Londer, Justin G.; Diana, James S.; Stott, Wendylee; Madenjian, Charles P.

    2012-01-01

    As the only extant deepwater cisco in Lake Michigan, bloater is currently at record low levels of abundance.  Several mechanisms to regulate their recruitment have been proposed, including skewed sex ratios, predation on their larvae by adult alewife, and climatic factors during early life history stages, but none has unequivocal support.  In this research, we evaluated an alternative mechanism of egg predation that was supported by an inverse relationship between bloater recruitment and biomass of slimy sculpin, which are known to be effective egg predators.  To that end, we used a combination of field sampling, laboratory experiments, and modeling to estimate the proportion of bloater eggs consumed by sculpins each year between 1973 and 2008.  Monthly field sampling between January through May 2009-2010 (when bloater eggs were incubating) offshore of Frankfort (Michigan), Sturgeon Bay (Wisconsin), Two Rivers (Wisconsin), and Muskegon (Michigan) provided benthivore diets for subsequent laboratory processing.  Identification and enumeration of stomach contents and subsequent genetic analyses of eggs revealed that the mean proportion of bloater eggs in slimy sculpin diets (N = 1016) equaled 0.04.  Bloater eggs also were consumed by deepwater sculpins (N = 699) at a slightly lower mean proportion (0.02), and only one round goby diet among 552 enumerated revealed a bloater egg.  Based on the diet results, we developed daily ration models to estimate consumption for both deepwater and slimy sculpins.  We conducted feeding experiments to estimate gastric evacuation (GEVAC) for water temperatures ranging 2-5 °C, similar to those observed during egg incubation.  GEVAC rates equaled 0.0115/ h for slimy sculpin and 0.0147/h for deepwater sculpin, and did not vary between 2.7 and 5.1 °C for either species or between prey types (Mysis relicta and fish eggs) for slimy sculpin.  Index of fullness [(g prey/g fish weight)100%] was estimated from sculpins sampled in

  9. Intermittent ephemeral river-breaching

    Science.gov (United States)

    Reniers, A. J.; MacMahan, J. H.; Gallagher, E. L.; Shanks, A.; Morgan, S.; Jarvis, M.; Thornton, E. B.; Brown, J.; Fujimura, A.

    2012-12-01

    In the summer of 2011 we performed a field experiment in Carmel River State Beach, CA, at a time when the intermittent natural breaching of the ephemeral Carmel River occurred due to an unusually rainy period prior to the experiment associated with El Nino. At this time the river would fill the lagoon over the period of a number of days after which a breach would occur. This allowed us to document a number of breaches with unique pre- and post-breach topographic surveys, accompanying ocean and lagoon water elevations as well as extremely high flow (4m/s) velocities in the river mouth during the breaching event. The topographic surveys were obtained with a GPS-equipped backpack mounted on a walking human and show the evolution of the river breaching with a gradually widening and deepening river channel that cuts through the pre-existing beach and berm. The beach face is qualified as a steep with an average beach slope of 1:10 with significant reflection of the incident waves (MacMahan et al., 2012). The wave directions are generally shore normal as the waves refract over the deep canyon that is located offshore of the beach. The tide is mixed semi-diurnal with a range on the order of one meter. Breaching typically occurred during the low-low tide. Grain size is highly variable along the beach with layers of alternating fine and coarse material that could clearly be observed as the river exit channel was cutting through the beach. Large rocky outcroppings buried under the beach sand are also present along certain stretches of the beach controlling the depth of the breaching channel. The changes in the water level measured within the lagoon and the ocean side allows for an estimate of the volume flux associated with the breach as function of morphology, tidal elevation and wave conditions as well as an assessment of the conditions and mechanisms of breach closure, which occurred on the time scale of O(0.5 days). Exploratory model simulations will be presented at the

  10. The River Danube: An Examination of Navigation on the River

    Science.gov (United States)

    Cooper, R. W.

    One of the definitions of Navigation that gets little attention in this Institute is (Oxford English Dictionary), and which our French friends call La Navigation. I have always found this subject fascinating, and have previously navigated the Rivers Mekong, Irrawaddy, Hooghly, Indus, Shatt-al-Arab, Savannah and RhMainKanal (RMDK) and the River Danube, a distance of approximately 4000 km. This voyage has only recently become possible with the opening of the connecting RMDK at the end of 1992, but has been made little use of because of the civil war in the former Yugoslavia.

  11. Lake Ontario benthic prey fish assessment, 2015

    Science.gov (United States)

    Weidel, Brian C.; Walsh, Maureen; Holden, Jeremy P.; Connerton, Michael J.

    2016-01-01

    Benthic prey fishes are a critical component of the Lake Ontario food web, serving as energy vectors from benthic invertebrates to native and introduced piscivores. Since the late 1970’s, Lake Ontario benthic prey fish status was primarily assessed using bottom trawl observations confined to the lake’s south shore, in waters from 8 – 150 m (26 – 492 ft). In 2015, the Benthic Prey Fish Survey was cooperatively adjusted and expanded to address resource management information needs including lake-wide benthic prey fish population dynamics. Effort increased from 55 bottom trawl sites to 135 trawl sites collected in depths from 8 - 225m (26 – 738 ft). The spatial coverage of sampling was also expanded and occurred in all major lake basins. The resulting distribution of tow depths more closely matched the available lake depth distribution. The additional effort illustrated how previous surveys were underestimating lake-wide Deepwater Sculpin, Myoxocephalus thompsonii, abundance by not sampling in areas of highest density. We also found species richness was greater in the new sampling sites relative to the historic sites with 11 new fish species caught in the new sites including juvenile Round Whitefish, Prosopium cylindraceum, and Mottled sculpin, Cottus bairdii. Species-specific assessments found Slimy Sculpin, Cottus cognatus abundance increased slightly in 2015 relative to 2014, while Deepwater Sculpin and Round Goby, Neogobius melanostomus, dramatically increased in 2015, relative to 2014. The cooperative, lake-wide Benthic Prey Fish Survey expanded our understanding of benthic fish population dynamics and habitat use in Lake Ontario. This survey’s data and interpretations influence international resource management decision making, such as informing the Deepwater Sculpin conservation status and assessing the balance between sport fish consumption and prey fish populations. Additionally a significant Lake Ontario event occurred in May 2015 when a single

  12. Nelson River and Hudson Bay

    Science.gov (United States)

    2002-01-01

    Rivers that empty into large bodies of water can have a significant impact on the thawing of nearshore winter ice. This true-color Moderate Resolution Imaging Spectroradiometer (MODIS) image from May 18, 2001, shows the Nelson River emptying spring runoff from the Manitoba province to the south into the southwestern corner of Canada's Hudson Bay. The warmer waters from more southern latitudes hasten melting of ice near the shore, though some still remained, perhaps because in shallow coastal waters, the ice could have been anchored to the bottom. High volumes of sediment in the runoff turned the inflow brown, and the rim of the retreating ice has taken on a dirty appearance even far to the east of the river's entrance into the Bay. The sediment would have further hastened the melting of the ice because its darker color would have absorbed more solar radiation than cleaner, whiter ice. Image courtesy Jacques Descloitres, MODIS Land Rapid Response Team at NASA GSFC

  13. Grays River Watershed Geomorphic Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Geist, David R

    2005-04-30

    This investigation, completed for the Pacific Northwest National Laboratory (PNNL), is part of the Grays River Watershed and Biological Assessment commissioned by Bonneville Power Administration under project number 2003-013-00 to assess impacts on salmon habitat in the upper Grays River watershed and present recommendations for habitat improvement. This report presents the findings of the geomorphic assessment and is intended to support the overall PNNL project by evaluating the following: The effects of historical and current land use practices on erosion and sedimentation within the channel network The ways in which these effects have influenced the sediment budget of the upper watershed The resulting responses in the main stem Grays River upstream of State Highway 4 The past and future implications for salmon habitat.

  14. 2010 Hudson River Shallow Water Sediment Cores

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Hudson River Shallow Water Mapping project characterizes the bottom of the Hudson River Estuary in shallow water (<3 m). The characterization includes...

  15. Habitat Analysis - Trinity River Restoration Potential

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The goal of the Trinity River project is to identify the potential positive effects of large-scale restoration actions in a 63 kilometer reach of the Trinity River...

  16. Physical - Elwha River Dam Removal Study

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This study examines the ecosystem response of the Elwha River to the removal of the Elwha River dams. We will measure the following attributes of ecosystem response:...

  17. Russian River Ice Thickness and Duration

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set consists of river ice thickness measurements, and beginning and ending dates for river freeze-up events from fifty stations in northern Russia. The...

  18. Geomorphic Analysis - Trinity River Restoration Potential

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The goal of the Trinity River project is to identify the potential positive effects of large-scale restoration actions in a 63 kilometer reach of the Trinity River...

  19. Global Lake and River Ice Phenology Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Global Lake and River Ice Phenology Database contains freeze and thaw/breakup dates as well as other descriptive ice cover data for 865 lakes and rivers in the...

  20. Charles River Fish Contaminant Survey, April 2001

    Science.gov (United States)

    Report summarizing a biological monitoring component of the Clean Charles River 2005 initiative through the monitoring & analysis of fish within the lower Charles River basin, implemented by the EPA New England Regional Laboratory in the late fall of 1999.

  1. Biological - Elwha River Dam Removal Study

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This study examines the ecosystem response of the Elwha River to the removal of the Elwha River dams. We will measure the following attributes of ecosystem response:...

  2. River restoration - Malaysian/DID perspective

    International Nuclear Information System (INIS)

    Ahmad Darus

    2006-01-01

    Initially the river improvement works in Malaysia was weighted on flood control to convey a certain design flood with the lined and channelized rivers. But in late 2003 did has makes the approaches that conservation and improvement of natural function of river, i.e. river environment and eco-system should be incorporated inside the planning and design process. Generally, river restoration will focus on four approaches that will improve water quality, which is improving the quality of stormwater entering the river, maximizing the quantity of the urban river riparian corridor, stabilizing the riverbank, and improving the habitat within the river. This paper outlined the appropriate method of enhancing impairment of water quality from human activities effluent and others effluent. (Author)

  3. Savannah River Site Environmental Implentation Plan

    International Nuclear Information System (INIS)

    1989-01-01

    This report describes the organizational responsibilities for the Savannah River Site Environmental program. Operations, Engineering and projects, Environment, safety, and health, Quality assurance, and the Savannah River Laboratory are described

  4. 76 FR 25545 - Safety Zone; Blue Crab Festival Fireworks Display, Little River, Little River, SC

    Science.gov (United States)

    2011-05-05

    ...-AA00 Safety Zone; Blue Crab Festival Fireworks Display, Little River, Little River, SC AGENCY: Coast... zone on the waters of Little River in Little River, South Carolina during the Blue Crab Festival... this rule because the Coast Guard did not receive notice of the Blue Crab Festival Fireworks Display...

  5. 78 FR 41689 - Safety Zone; Skagit River Bridge, Skagit River, Mount Vernon, WA

    Science.gov (United States)

    2013-07-11

    ... submerged automobiles and floating bridge debris in the Skagit River. Following the initial response and...-AA00 Safety Zone; Skagit River Bridge, Skagit River, Mount Vernon, WA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a safety zone around the Skagit River Bridge...

  6. Many rivers to cross. Cross border co-operation in river management

    NARCIS (Netherlands)

    Verwijmeren, J.A.; Wiering, M.A.

    2007-01-01

    River basin management is a key concept in contemporary water policy. Since the management of rivers is best designed and implemented at the scale of the river basin, it seems obvious that we should not confine ourselves to administrative or geographical borders. In other words, river basin

  7. 75 FR 51945 - Safety Zone; Potomac River, St. Mary's River, St. Inigoes, MD

    Science.gov (United States)

    2010-08-24

    ...-AA00 Safety Zone; Potomac River, St. Mary's River, St. Inigoes, MD AGENCY: Coast Guard, DHS. ACTION... of the St. Mary's River, a tributary of the Potomac River. This action is necessary to provide for.... Navy helicopter located near St. Inigoes, Maryland. This safety zone is intended to protect the...

  8. Geochemistry of some Brazilian rivers

    International Nuclear Information System (INIS)

    Moreira-Nordemann, L.M.

    1981-01-01

    Concentrations of the totality of the dissolved salts and sodium, calcium, potassium, magnesium, and uranium were measured in ten rivers belonging to three hydrografic basins located in Northeastern Brazil. Activity ratios U 234 /U 238 were also measured. A correlation was done between the results obtained and the geological and climatic context of these regions. Sodium is the most abundant element in the waters, except for rivers flowing in callcareous regions for which calcium is predominant. The concentrations of the major cations are function of the regional lithology whereas water salinity depends on climatic factors. (Author) [pt

  9. Columbia River Component Data Evaluation Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    C.S. Cearlock

    2006-08-02

    The purpose of the Columbia River Component Data Compilation and Evaluation task was to compile, review, and evaluate existing information for constituents that may have been released to the Columbia River due to Hanford Site operations. Through this effort an extensive compilation of information pertaining to Hanford Site-related contaminants released to the Columbia River has been completed for almost 965 km of the river.

  10. RiverCare: towards self-sustaining multifunctional rivers

    Science.gov (United States)

    Augustijn, Denie; Schielen, Ralph; Hulscher, Suzanne

    2014-05-01

    Rivers are inherently dynamic water systems involving complex interactions among hydrodynamics, morphology and ecology. In many deltas around the world lowland rivers are intensively managed to meet objectives like safety, navigation, hydropower and water supply. With the increasing pressure of growing population and climate change it will become even more challenging to reach or maintain these objectives and probably also more demanding from a management point of view. In the meantime there is a growing awareness that rivers are natural systems and that, rather than further regulation works, the dynamic natural processes should be better utilized (or restored) to reach the multifunctional objectives. Currently many integrated river management projects are initiated all over the world, in large rivers as well as streams. Examples of large scale projects in the Netherlands are 'Room for the River' (Rhine), the 'Maaswerken' (Meuse), the Deltaprogramme and projects originating from the European Water Framework Directive (WFD). These projects include innovative measures executed never before on this scale and include for example longitudinal training dams, side channels, removal of bank protection, remeandering of streams, dredging/nourishment and floodplain rehabilitation. Although estimates have been made on the effects of these measures for many of the individual projects, the overall effects on the various management objectives remains uncertain, especially if all projects are considered in connection. For all stakeholders with vested interests in the river system it is important to know how that system evolves at intermediate and longer time scales (10 to 100 years) and what the consequences will be for the various river functions. If the total, integrated response of the system can be predicted, the system may be managed in a more effective way, making optimum use of natural processes. In this way, maintenance costs may be reduced, the system remains more natural

  11. The radionuclide migration model in river system

    International Nuclear Information System (INIS)

    Zhukova, O.M.; Shiryaeva, N.M.; Myshkina, M.K.; Shagalova, Eh.D.; Denisova, V.V.; Skurat, V.V.

    2001-01-01

    It was propose the model of radionuclide migration in river system based on principle of the compartmental model at hydraulically stationary and chemically equilibrium conditions of interaction of radionuclides in system water-dredge, water-sediments. Different conditions of radioactive contamination entry in river system were considered. The model was verified on the data of radiation monitoring of Iput' river

  12. The science and practice of river restoration

    Science.gov (United States)

    Wohl, Ellen; Lane, Stuart N.; Wilcox, Andrew C.

    2015-08-01

    River restoration is one of the most prominent areas of applied water-resources science. From an initial focus on enhancing fish habitat or river appearance, primarily through structural modification of channel form, restoration has expanded to incorporate a wide variety of management activities designed to enhance river process and form. Restoration is conducted on headwater streams, large lowland rivers, and entire river networks in urban, agricultural, and less intensively human-altered environments. We critically examine how contemporary practitioners approach river restoration and challenges for implementing restoration, which include clearly identified objectives, holistic understanding of rivers as ecosystems, and the role of restoration as a social process. We also examine challenges for scientific understanding in river restoration. These include: how physical complexity supports biogeochemical function, stream metabolism, and stream ecosystem productivity; characterizing response curves of different river components; understanding sediment dynamics; and increasing appreciation of the importance of incorporating climate change considerations and resiliency into restoration planning. Finally, we examine changes in river restoration within the past decade, such as increasing use of stream mitigation banking; development of new tools and technologies; different types of process-based restoration; growing recognition of the importance of biological-physical feedbacks in rivers; increasing expectations of water quality improvements from restoration; and more effective communication between practitioners and river scientists.

  13. 33 CFR 117.1058 - Snake River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake River. 117.1058 Section 117... OPERATION REGULATIONS Specific Requirements Washington § 117.1058 Snake River. (a) The draw of the Burlington Northern Santa Fe railroad bridge across the Snake River at mile 1.5 between Pasco and Burbank is...

  14. River as a part of ground battlefield

    Science.gov (United States)

    Vračar, Miodrag S.; Pokrajac, Ivan; Okiljević, Predrag

    2013-05-01

    The rivers are in some circumstances part of the ground battlefield. Microseisms induced at the riverbed or ground at the river surrounding might be consequence of military activities (military ground transports, explosions, troop's activities, etc). Vibrations of those fluid-solid structures are modeled in terms of solid displacement and change of fluid pressure. This time varying fluid pressure in river, which originates from ground microseisms, is possible to detect with hydrophones. Therefore, hydroacoustic measurements in rivers enables detecting, identification and localization various types of military noisy activities at the ground as and those, which origin is in the river water (hydrodynamics of water flow, wind, waves, river vessels, etc). In this paper are presented river ambient noise measurements of the three great rivers: the Danube, the Sava and the Tisa, which flows in north part of Serbia in purpose to establish limits in detection of the ground vibrations in relatively wide frequency range from zero to 20 kHz. To confirm statement that the river is a part of ground battlefield, and that hydroacoustic noise is possible to use in detecting and analyzing ground microseisms induced by civil or military activities, some previous collected data of hydroacoustic noise measurement in the rivers are used. The data of the river ambient noise include noise induced by civil engineering activities, that ordinary take place in large cities, noise that produced ships and ambient noise of the river when human activities are significantly reduced. The poly spectral method was used in analysis such events.

  15. Role of vegetation on river bank accretion

    NARCIS (Netherlands)

    Vargas Luna, A.

    2016-01-01

    There is rising awareness of the need to include the effects of vegetation in studies dealing with the morphological response of rivers. Vegetation growth on river banks and floodplains alters the river bed topography, reduces the bank erosion rates and enhances the development of new floodplains

  16. Hydraulic characteristics of the New River in the New River Gorge National River, West Virginia

    Science.gov (United States)

    Wiley, J.B.; Appel, David H.

    1989-01-01

    Traveltime, dispersion, water-surface and streambed profiles, and cross-section data were collected for use in application of flow and solute-transport models to the New River in the New River Gorge National River, West Virginia. Dye clouds subjected to increasing and decreasing flow rates (unsteady flow) showed that increasing flows shorten the cloud and decreasing flows lengthen the cloud. After the flow rate was changed and the flow was again steady, traveltime and dispersion characteristics were determined by the new rate of flow. Seven stage/streamflow relations identified the general changes of stream geometry throughout the study reach. Channel cross sections were estimated for model input. Low water and streambed profiles were developed from surveyed water surface elevations and water depths. (USGS)

  17. 33 CFR 165.150 - New Haven Harbor, Quinnipiac River, Mill River.

    Science.gov (United States)

    2010-07-01

    ... River, Mill River. 165.150 Section 165.150 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... New Haven Harbor, Quinnipiac River, Mill River. (a) The following is a regulated navigation area: The... 303°T to point D at the west bank of the mouth of the Mill River 41°18′05″ N, 72°54′23″ W thence south...

  18. 77 FR 47331 - Regulated Navigation Area-New Haven Harbor, Quinnipiac River, Mill River, New Haven, CT; Pearl...

    Science.gov (United States)

    2012-08-08

    ...-AA11 Regulated Navigation Area--New Haven Harbor, Quinnipiac River, Mill River, New Haven, CT; Pearl... navigable waters of New Haven Harbor, Quinnipiac River and Mill River. The current RNA pertains only to the..., Quinnipiac River, and Mill River RNA. The proposed amendment would give the Captain of the Port Sector Long...

  19. 77 FR 67563 - Regulated Navigation Area-New Haven Harbor, Quinnipiac River, Mill River, New Haven, CT; Pearl...

    Science.gov (United States)

    2012-11-13

    ... 1625-AA11 Regulated Navigation Area--New Haven Harbor, Quinnipiac River, Mill River, New Haven, CT... Haven Harbor, Quinnipiac River and Mill River. The current RNA pertains only to the operation of tugs...) entitled Regulated Navigation Area--New Haven Harbor, Quinnipiac River, Mill River, New Haven, CT; Pearl...

  20. 77 FR 23120 - Special Local Regulations; Lowcountry Splash Open Water Swim, Wando River and Cooper River, Mount...

    Science.gov (United States)

    2012-04-18

    ...-AA08 Special Local Regulations; Lowcountry Splash Open Water Swim, Wando River and Cooper River, Mount... establishing special local regulations on the waters of the Wando River and Cooper River in Mount Pleasant... River and Cooper River along the shoreline of Mount Pleasant, South Carolina. The Lowcountry Splash...

  1. Conservation of South African Rivers

    CSIR Research Space (South Africa)

    O'Keeffe, JH

    1986-01-01

    Full Text Available The report presents the proceedings of a three-day workshop at Midmar Dam designed to establish a consensus view of river conservation and to provide professional conservationists, managers and planners with a set of guidelines. These indicate what...

  2. Stochastic modelling of river morphodynamics

    NARCIS (Netherlands)

    Van Vuren, B.G.

    2005-01-01

    Modern river management has to reconcile a number of functions, such as protection against floods and provision of safe and efficient navigation, floodplain agriculture, ecology and recreation. Knowledge on uncertainty in fluvial processes is important to make this possible, to design effective

  3. Rebirth of the Cheat River

    Science.gov (United States)

    The Cheat River in West Virginia is again a haven for whitewater rafting and smallmouth bass fishing after years of Clean Water Act funding and the efforts of a local non-profit group and others to control pollution from old abandoned mines.

  4. Sorting out river channel patterns

    NARCIS (Netherlands)

    Kleinhans, M.G.

    2010-01-01

    Rivers self-organize their pattern/planform through feedbacks between bars, channels, floodplain and vegetation, which emerge as a result of the basic spatial sorting process of wash load sediment and bed sediment. The balance between floodplain formation and destruction determines the width and

  5. Hydrological balance of Cauca River

    International Nuclear Information System (INIS)

    Corzo G, J.; Garcia, M.

    1992-11-01

    This thesis understand the superficial and underground hydrology of the C.c. River Basin; the purpose of this study is to obtain information related to the quantity and behavior of the water resource, in order to make the necessary recommendations for the adequate managing, the aquifer protection and thus be able to have valuable liquid

  6. River habitat assessment for ecological restoration of Wei River Basin, China.

    Science.gov (United States)

    Yang, Tao; Wang, Shuo; Li, Xiaoping; Wu, Ting; Li, Li; Chen, Jia

    2018-04-11

    As an important composition component of river ecosystems, river habitats must undergo quality assessment to potentially provide scientific basis for river ecological restoration. Substrate composition, habitat complexity, bank erosion degree, river meandering degree, human activity intensity, vegetation buffer width, water quality, and water condition were determined as indicators for river habitat assessment. The comprehensive habitat quality index (CHQI) was established for the Wei River Basin. In addition, the indicator values were determined on the basis of a field investigation at 12 national hydrological stations distributed across the Wei, Jing, and Beiluo Rivers. The analytic hierarchy process was used to determine the indicator weights and thus distinguish the relative importance of the assessment indicator system. Results indicated that the average CHQIs for the Wei, Jing, and Beiluo Rivers were 0.417, 0.508, and 0.304, respectively. The river habitat quality for the three rivers was well. As for the whole river basin, the river habitat quality for 25% of the cross section was very well, the other 25% was well, and the 50% remaining was in critical state. The river habitat quality of the Jing River was better than that of the Wei and Beiluo Rivers.

  7. Interlinking of Rivers in India: Issues & Challenges

    OpenAIRE

    MEHTA, Dharmendra; MEHTA, Naveen K.

    2013-01-01

    Abstract. The rivers in India are truly speaking not only life-line of masses but also for wild-life. The rivers play a vital role in the lives of the Indian people. The river systems help us in irrigation, potable water, cheap transportation, electricity as well as a source of livelihood for our ever increasing population. Some of the major cities of India are situated at the banks of holy rivers. Proper management of river water is the need of the hour. Indian agriculture largely d...

  8. The Amazon, measuring a mighty river

    Science.gov (United States)

    ,

    1967-01-01

    The Amazon, the world's largest river, discharges enough water into the sea each day to provide fresh water to the City of New York for over 9 years. Its flow accounts for about 15 percent of all the fresh water discharged into the oceans by all the rivers of the world. By comparison, the Amazon's flow is over 4 times that of the Congo River, the world's second largest river. And it is 10 times that of the Mississippi, the largest river on the North American Continent.

  9. HANFORD SITE RIVER CORRIDOR CLEANUP

    International Nuclear Information System (INIS)

    BAZZELL, K.D.

    2006-01-01

    In 2005, the US Department of Energy (DOE) launched the third generation of closure contracts, including the River Corridor Closure (RCC) Contract at Hanford. Over the past decade, significant progress has been made on cleaning up the river shore that bordes Hanford. However, the most important cleanup challenges lie ahead. In March 2005, DOE awarded the Hanford River Corridor Closure Contract to Washington Closure Hanford (WCH), a limited liability company owned by Washington Group International, Bechtel National and CH2M HILL. It is a single-purpose company whose goal is to safely and efficiently accelerate cleanup in the 544 km 2 Hanford river corridor and reduce or eliminate future obligations to DOE for maintaining long-term stewardship over the site. The RCC Contract is a cost-plus-incentive-fee closure contract, which incentivizes the contractor to reduce cost and accelerate the schedule. At $1.9 billion and seven years, WCH has accelerated cleaning up Hanford's river corridor significantly compared to the $3.2 billion and 10 years originally estimated by the US Army Corps of Engineers. Predictable funding is one of the key features of the new contract, with funding set by contract at $183 million in fiscal year (FY) 2006 and peaking at $387 million in FY2012. Another feature of the contract allows for Washington Closure to perform up to 40% of the value of the contract and subcontract the balance. One of the major challenges in the next few years will be to identify and qualify sufficient subcontractors to meet the goal

  10. The impact of industries on surface water quality of River Ona and ...

    African Journals Online (AJOL)

    Samples of water from two rivers (River Ona and River Alaro) in Oluyole ... were higher in the industrial zones than those found in the upstream of both rivers. ... Key words: River Ona, River Alaro, industrial discharges, surface water quality.

  11. Savannah River Plant/Savannah River Laboratory radiation exposure report

    International Nuclear Information System (INIS)

    Rogers, C.D.; Hyman, S.D.; Keisler, L.L.; Reeder, D.F.; Jolly, L.; Spoerner, M.T.; Schramm, G.R.

    1989-01-01

    The protection of worker health and safety is of paramount concern at the Savannah River Site. Since the site is one of the largest nuclear sites in the nation, radiation safety is a key element in the protection program. This report is a compendium of the results in 1988 of the programs at the Savannah River Plant and the Savannah River Laboratory to protect the radiological health of employees. By any measure, the radiation protection performance at this site in 1988 was the best since the beginning of operations. This accomplishment was made possible by the commitment and support at all levels of the organizations to reduce radiation exposures to ALARA (As Low As Reasonably Achievable). The report provides detailed information about the radiation doses received by departments and work groups within these organizations. It also includes exposure data for recent years to allow Plant and Laboratory units to track the effectiveness of their ALARA efforts. Many of the successful practices and methods that reduced radiation exposure are described. A new goal for personnel contamination cases has been established for 1989. Only through continual and innovative efforts to minimize exposures can the goals be met. The radiation protection goals for 1989 and previous years are included in the report. 27 figs., 58 tabs

  12. Potential relationships between the river discharge and the precipitation in the Jinsha River basin, China

    Science.gov (United States)

    Wang, Gaoxu; Zeng, Xiaofan; Zhao, Na; He, Qifang; Bai, Yiran; Zhang, Ruoyu

    2018-02-01

    The relationships between the river discharge and the precipitation in the Jinsha River basin are discussed in this study. In addition, the future precipitation trend from 2011-2050 and its potential influence on the river discharge are analysed by applying the CCLM-modelled precipitation. According to the observed river discharge and precipitation, the annual river discharge at the two main hydrological stations displays good correlations with the annual precipitation in the Jinsha River basin. The predicted future precipitation tends to change similarly as the change that occurred during the observation period, whereas the monthly distributions over a year could be more uneven, which is unfavourable for water resources management.

  13. Incineration demonstration at Savannah River

    International Nuclear Information System (INIS)

    Lewandowski, K.E.; Becker, G.W.; Mersman, K.E.; Roberson, W.A.

    1983-01-01

    A full-scale incineration process for Savannah River Plant (SRP) low level beta-gamma combustible waste was demonstrated at the Savannah River Laboratory (SRL) using nonradioactive wastes. From October 1981 through September 1982, 15,700 kilograms of solid waste and 5.7 m 3 of solvent were incinerated. Emissions of off-gas components (NO/sub x/, SO 2 , CO, and particulates) were well below South Carolina state standards. Volume reductions of 20:1 for solid waste and 7:1 for Purex solvent/lime slurry were achieved. Presently, the process is being upgraded by SRP to accept radioactive wastes. During a two-year SRP demonstration, the facility will be used to incinerate slightly radioactive ( 3 ) solvent and suspect level (<1 mR/hr at 0.0254 meter) solid wastes

  14. Large-scale river regulation

    International Nuclear Information System (INIS)

    Petts, G.

    1994-01-01

    Recent concern over human impacts on the environment has tended to focus on climatic change, desertification, destruction of tropical rain forests, and pollution. Yet large-scale water projects such as dams, reservoirs, and inter-basin transfers are among the most dramatic and extensive ways in which our environment has been, and continues to be, transformed by human action. Water running to the sea is perceived as a lost resource, floods are viewed as major hazards, and wetlands are seen as wastelands. River regulation, involving the redistribution of water in time and space, is a key concept in socio-economic development. To achieve water and food security, to develop drylands, and to prevent desertification and drought are primary aims for many countries. A second key concept is ecological sustainability. Yet the ecology of rivers and their floodplains is dependent on the natural hydrological regime, and its related biochemical and geomorphological dynamics. (Author)

  15. Savannah River Plant incinerator demonstration

    International Nuclear Information System (INIS)

    Lewandowski, K.E.

    1983-01-01

    A full-scale incineration process was demonstrated at the Savannah River Laboratory (SRL) using nonradioactive waste. From October 1981 through September 1982, 15,700 kilograms of solid waste and 5.7 m 3 of solvent were incinerated. Emissions of off-gas components (NO/sub x/, SO 2 , CO, and particulates) were well below South Carolina state standards. Volume reductions of 20:1 for solid waste and 7:1 for Purex solvent/lime slurry were achieved. The process has been relocated and upgraded by the Savannah River Plant to accept low-level beta-gamma combustibles. During a two-year demonstration, the facility will incinerate slightly radioactive ( 3 ) solvent and suspect level (< 1 mR/h at 0.0254 meter) solid wastes. This demonstration will begin in early 1984

  16. Naturalness and Place in River Rehabilitation

    Directory of Open Access Journals (Sweden)

    Kirstie Fryirs

    2009-06-01

    Full Text Available An authentic approach to river rehabilitation emphasizes concerns for the natural values of a given place. As landscape considerations fashion the physical template upon which biotic associations take place, various geomorphic issues must be addressed in framing rehabilitation activities that strive to improve river health. An open-ended approach to river classification promotes applications that appreciate the values of a given river, rather than pigeonholing reality. As the geomorphic structure of some rivers is naturally simple, promoting heterogeneity as a basis for management may not always be appropriate. Efforts to protect unique attributes of river systems must be balanced with procedures that look after common features. Concerns for ecosystem functionality must relate to the behavioral regime of a given river, remembering that some rivers are inherently sensitive to disturbance. Responses to human disturbance must be viewed in relation to natural variability, recognizing how spatial relationships in a catchment, and responses to past disturbances, fashion the operation of contemporary fluxes. These fluxes, in turn, influence what is achievable in the rehabilitation of a given reach. Given the inherently adjusting and evolutionary nature of river systems, notional endpoints do not provide an appropriate basis upon which to promote concepts of naturalness and place in the rehabilitation process. These themes are drawn together to promote rehabilitation practices that relate to the natural values of each river system, in preference to applications of "cookbook" measures that build upon textbook geomorphology.

  17. Radiocesium dynamics in the Hirose River basin

    Science.gov (United States)

    Kuramoto, T.; Taniguchi, K.; Arai, H.; Onuma, S.; Onishi, Y.

    2017-12-01

    A significant amount of radiocesium was deposited in Fukushima Prefecture during the accident of Fukushima Daiichi Nuclear Power Plant. In river systems, radiocesium is transported to downstream in rivers. For the safe use of river and its water, it is needed to clarify the dynamics of radiocesium in river systems. We started the monitoring of the Hirose River from December 2015. The Hirose River is a tributary of the Abukuma River flowing into the Pacific Ocean, and its catchment is close to areas where a large amount of radiocesium was deposited. We set up nine monitoring points in the Hirose River watershed. The Water level and turbidity data are continuously observed at each monitoring point. We regularly collected about 100 liters of water at each monitoring point. Radiocesium in water samples was separated into two forms; the one is the dissolved form, and the other is the suspended particulate form. Radionuclide concentrations of radiocesium in both forms were measured by a germanium semiconductor detector. Furthermore, we applied the TODAM (Time-dependent One-dimensional Degradation And Migration) code to the Hirose River basin using the monitoring data. The objectives of the modeling are to understand a redistribution pattern of radiocesium adsorbed by sediments during flooding events and to determine the amount of radiocesium flux into the Abukuma River.

  18. Clinical cytogenetics in river buffalo

    Directory of Open Access Journals (Sweden)

    L. Zicarelli

    2011-03-01

    Full Text Available While autosomal numeric chromosome abnormalities are phenotipically visible (abnormal body conformation and easily eliminated during the normal breeding selection, sex numeric abnormalities (including the cases of free-martinism, as well as the structural chromosome aberrations, especially the balanced ones, are more tolerate by the animals (normal body conformation but are often responsible of low fertility (structural abnormalities or sterility (sex chromosome aberrations, especially in the females. Although river buffalo (Bubalus bubalis, 2n=50 chromosomes have been characterized......

  19. Chester River Study. Volume I,

    Science.gov (United States)

    1972-11-01

    of the effects of agri- i6 IA -46 cultural activities on the aquatic system. This initial feet (24 meters). The soils of the basin area are suit...to the stocks themselves. The shell crystal struc- ture modification in oysters recalls to mind the eggshell thinning in birds mentioned earlier...with figures provided by Chestertown to the mouth of the River at Love the U.S. Soil Conservation Service as of 1967 (last Point (Table VII). year of

  20. Flambeau River Biofuels Demonstration Plant

    Energy Technology Data Exchange (ETDEWEB)

    Byrne, Robert J. [Flambeau River Biofuels, Inc., Park Falls, WI (United States)

    2012-07-30

    Flambeau River BioFuels, Inc. (FRB) proposed to construct a demonstration biomass-to-liquids (BTL) biorefinery in Park Falls, Wisconsin. The biorefinery was to be co-located at the existing pulp and paper mill, Flambeau River Papers, and when in full operation would both generate renewable energy – making Flambeau River Papers the first pulp and paper mill in North America to be nearly fossil fuel free – and produce liquid fuels from abundant and renewable lignocellulosic biomass. The biorefinery would serve to validate the thermochemical pathway and economic models for BTL production using forest residuals and wood waste, providing a basis for proliferating BTL conversion technologies throughout the United States. It was a project goal to create a compelling new business model for the pulp and paper industry, and support the nation’s goal for increasing renewable fuels production and reducing its dependence on foreign oil. FRB planned to replicate this facility at other paper mills after this first demonstration scale plant was operational and had proven technical and economic feasibility.

  1. Buck Creek River Flow Analysis

    Science.gov (United States)

    Dhanapala, Yasas; George, Elizabeth; Ritter, John

    2009-04-01

    Buck Creek flowing through Springfield Ohio has a number of low-head dams currently in place that cause safety issues and sometimes make it impossible for recreational boaters to pass through. The safety issues include the back eddies created by the dams that are known as drowning machines and the hydraulic jumps. In this study we are modeling the flow of Buck Creek using topographical and flow data provided by the Geology Department of Wittenberg University. The flow is analyzed using Hydraulic Engineering Center - River Analysis System software (HEC-RAS). As the first step a model of the river near Snyder Park has been created with the current structure in place for validation purposes. Afterwards the low-head dam is replaced with four drop structures with V-notch overflow gates. The river bed is altered to reflect plunge pools after each drop structure. This analysis will provide insight to how the flow is going to behave after the changes are made. In addition a sediment transport analysis is also being conducted to provide information about the stability of these structures.

  2. Misrepresenting the Jordan River Basin

    Directory of Open Access Journals (Sweden)

    Clemens Messerschmid

    2015-06-01

    Full Text Available This article advances a critique of the UN Economic and Social Commission for West Asia’s (ESCWA’s representation of the Jordan River Basin, as contained in its recently published Inventory of Shared Water Resources in Western Asia. We argue that ESCWA’s representation of the Jordan Basin is marked by serious technical errors and a systematic bias in favour of one riparian, Israel, and against the Jordan River’s four Arab riparians. We demonstrate this in relation to ESCWA’s account of the political geography of the Jordan River Basin, which foregrounds Israel and its perspectives and narratives; in relation to hydrology, where Israel’s contribution to the basin is overstated, whilst that of Arab riparians is understated; and in relation to development and abstraction, where Israel’s transformation and use of the basin are underplayed, while Arab impacts are exaggerated. Taken together, this bundle of misrepresentations conveys the impression that it is Israel which is the main contributor to the Jordan River Basin, Arab riparians its chief exploiters. This impression is, we argue, not just false but also surprising, given that the Inventory is in the name of an organisation of Arab states. The evidence discussed here provides a striking illustration of how hegemonic hydro-political narratives are reproduced, including by actors other than basin hegemons themselves.

  3. Synchronisation and stability in river metapopulation networks.

    Science.gov (United States)

    Yeakel, J D; Moore, J W; Guimarães, P R; de Aguiar, M A M

    2014-03-01

    Spatial structure in landscapes impacts population stability. Two linked components of stability have large consequences for persistence: first, statistical stability as the lack of temporal fluctuations; second, synchronisation as an aspect of dynamic stability, which erodes metapopulation rescue effects. Here, we determine the influence of river network structure on the stability of riverine metapopulations. We introduce an approach that converts river networks to metapopulation networks, and analytically show how fluctuation magnitude is influenced by interaction structure. We show that river metapopulation complexity (in terms of branching prevalence) has nonlinear dampening effects on population fluctuations, and can also buffer against synchronisation. We conclude by showing that river transects generally increase synchronisation, while the spatial scale of interaction has nonlinear effects on synchronised dynamics. Our results indicate that this dual stability - conferred by fluctuation and synchronisation dampening - emerges from interaction structure in rivers, and this may strongly influence the persistence of river metapopulations. © 2013 John Wiley & Sons Ltd/CNRS.

  4. Priority River Metrics for Urban Residents of the Santa Cruz River Watershed

    Science.gov (United States)

    Indicator selection is a persistent question in river and stream assessment and management. We employ qualitative research techniques to identify features of rivers and streams important to urban residents recruited from the general public in the Santa Cruz watershed. Interviews ...

  5. New River Dam Foundation Report. Gila River Basin: Phoenix, Arizona and Vicinity (Including New River).

    Science.gov (United States)

    1985-10-01

    further downstream before merging with the Agua Fria River. 6 Site Geology 2.08 The geological formations present within the project area consist...sampling and in- situ density testing using the sand displacement 11 or large-scale water displacement method. Dozer trenches TT82-1 and TT82-6 were excavated...underlying the valley or may, due to its pervasiveness, represent an in situ weathering product of the buried bedrock. 4.18 Because of the magnitude

  6. Flood characteristics for the New River in the New River Gorge National River, West Virginia

    Science.gov (United States)

    Wiley, J.B.; Cunningham, M.K.

    1994-01-01

    The frequency and magnitude of flooding of the New River in the New River Gorge National River was studied. A steady-state, one-dimensional flow model was applied to the study reach. Rating curves, cross sections, and Manning's roughness coefficients that were used are presented in this report. Manning's roughness coefficients were evaluated by comparing computed elevations (from application of the steady-state, one-dimensional flow model) to rated elevations at U.S. Geological Survey (USGS) streamflow-gaging stations and miscellaneous-rating sites. Manning's roughness coefficients ranged from 0.030 to 0.075 and varied with hydraulic depth. The 2-, 25-, and 100-year flood discharges were esti- mated on the basis of information from flood- insurance studies of Summers County, Fayette County, and the city of Hinton, and flood-frequency analysis of discharge records for the USGS streamflow-gaging stations at Hinton and Thurmond. The 100-year discharge ranged from 107,000 cubic feet per second at Hinton to 150,000 cubic feet per second at Fayette.

  7. Classification of Tropical River Using Chemometrics Technique: Case Study in Pahang River, Malaysia

    International Nuclear Information System (INIS)

    Mohd Khairul Amri Kamarudin; Mohd Ekhwan Toriman; Nur Hishaam Sulaiman

    2015-01-01

    River classification is very important to know the river characteristic in study areas, where this database can help to understand the behaviour of the river. This article discusses about river classification using Chemometrics techniques in mainstream of Pahang River. Based on river survey, GIS and Remote Sensing database, the chemometric analysis techniques have been used to identify the cluster on the Pahang River using Hierarchical Agglomerative Cluster Analysis (HACA). Calibration and validation process using Discriminant Analysis (DA) has been used to confirm the HACA result. Principal Component Analysis (PCA) study to see the strong coefficient where the Pahang River has been classed. The results indicated the main of Pahang River has been classed to three main clusters as upstream, middle stream and downstream. Base on DA analysis, the calibration and validation model shows 100 % convinced. While the PCA indicates there are three variables that have a significant correlation, domination slope with R"2 0.796, L/D ratio with R"2 -0868 and sinuosity with R"2 0.557. Map of the river classification with moving class also was produced. Where the green colour considered in valley erosion zone, yellow in a low terrace of land near the channels and red colour class in flood plain and valley deposition zone. From this result, the basic information can be produced to understand the characteristics of the main Pahang River. This result is important to local authorities to make decisions according to the cluster or guidelines for future study in Pahang River, Malaysia specifically and for Tropical River generally. The research findings are important to local authorities by providing basic data as a guidelines to the integrated river management at Pahang River, and Tropical River in general. (author)

  8. Urban river design and aesthetics: A river restoration case study from the UK

    OpenAIRE

    Prior, Jonathan

    2016-01-01

    This paper analyses the restoration of an urbanized section of the River Skerne where it flows through a suburb of Darlington, England; a project which was one of the first comprehensive urban river restorations undertaken in the UK. It is shown how aesthetic values were central to the identification of the River Skerne as a site for restoration, the production of restoration objectives, and a design vision of urban river renewal via restoration. Secondly, the means by which these aesthetic v...

  9. River flow controls on tides an tide-mean water level profiles in a tidel freshwater river

    NARCIS (Netherlands)

    Sassi, M.G.; Hoitink, A.J.F.

    2013-01-01

    [1] Tidal rivers feature oscillatory and steady gradients in the water surface, controlled by interactions between river flow and tides. The river discharge attenuates the tidal motion, and tidal motion increases tidal-mean friction in the river, which may act as a barrier to the river discharge.

  10. Savannah River Laboratory monthly report, November 1991

    Energy Technology Data Exchange (ETDEWEB)

    Ferrell, J.M. (comp.)

    1991-01-01

    This document details monthly activities at the Savannah River Laboratory. Topics addressed are reactor operation; tritium facilities and production; separation operations; environmental concerns; and waste management. (FI)

  11. Savannah River Laboratory monthly report, November 1991

    Energy Technology Data Exchange (ETDEWEB)

    Ferrell, J.M. [comp.

    1991-12-31

    This document details monthly activities at the Savannah River Laboratory. Topics addressed are reactor operation; tritium facilities and production; separation operations; environmental concerns; and waste management. (FI)

  12. Savannah River Laboratory monthly report, October 1991

    Energy Technology Data Exchange (ETDEWEB)

    Ferrell, J.M. (comp.)

    1991-01-01

    This document details monthly activities at the Savannah River Laboratory. Topics addressed are reactor operation, tritium facilities and production; separations operations; environmental concerns; and waste management. (FI)

  13. Savannah River Laboratory monthly report, October 1991

    Energy Technology Data Exchange (ETDEWEB)

    Ferrell, J.M. [comp.

    1991-12-31

    This document details monthly activities at the Savannah River Laboratory. Topics addressed are reactor operation, tritium facilities and production; separations operations; environmental concerns; and waste management. (FI)

  14. VT River Restoration Data in Lamoille County

    Data.gov (United States)

    Vermont Center for Geographic Information — (Link to Metadata) Documented river and riparian buffer restoration projects in Lamoille County, Vermont. Restoration includes buffer plantings (trees and shrubs),...

  15. The Columbia River System Inside Story

    Energy Technology Data Exchange (ETDEWEB)

    None

    2001-04-01

    The Columbia River is one of the greatest natural resources in the western United States. The river and its tributaries touch the lives of nearly every resident of the Pacific Northwest—from fostering world-famous Pacific salmon to supplying clean natural fuel for 50 to 65 percent of the region’s electrical generation. Since early in the 20th century, public and private agencies have labored to capture the benefits of this dynamic river. Today, dozens of major water resource projects throughout the region are fed by the waters of the Columbia Basin river system.

  16. Savannah River Laboratory monthly report, September 1991

    Energy Technology Data Exchange (ETDEWEB)

    Ferrell, J.M. (comp.)

    1991-01-01

    This document details monthly activities at the Savannah River Laboratory. Topics addressed are reactor operation, tritium facilities and production; separation operations; environmental concerns; and waste management. (FI)

  17. Savannah River Laboratory monthly report, September 1991

    Energy Technology Data Exchange (ETDEWEB)

    Ferrell, J.M. [comp.

    1991-12-31

    This document details monthly activities at the Savannah River Laboratory. Topics addressed are reactor operation, tritium facilities and production; separation operations; environmental concerns; and waste management. (FI)

  18. Bathymetric surveys of the Neosho River, Spring River, and Elk River, northeastern Oklahoma and southwestern Missouri, 2016–17

    Science.gov (United States)

    Hunter, Shelby L.; Ashworth, Chad E.; Smith, S. Jerrod

    2017-09-26

    In February 2017, the Grand River Dam Authority filed to relicense the Pensacola Hydroelectric Project with the Federal Energy Regulatory Commission. The predominant feature of the Pensacola Hydroelectric Project is Pensacola Dam, which impounds Grand Lake O’ the Cherokees (locally called Grand Lake) in northeastern Oklahoma. Identification of information gaps and assessment of project effects on stakeholders are central aspects of the Federal Energy Regulatory Commission relicensing process. Some upstream stakeholders have expressed concerns about the dynamics of sedimentation and flood flows in the transition zone between major rivers and Grand Lake O’ the Cherokees. To relicense the Pensacola Hydroelectric Project with the Federal Energy Regulatory Commission, the hydraulic models for these rivers require high-resolution bathymetric data along the river channels. In support of the Federal Energy Regulatory Commission relicensing process, the U.S. Geological Survey, in cooperation with the Grand River Dam Authority, performed bathymetric surveys of (1) the Neosho River from the Oklahoma border to the U.S. Highway 60 bridge at Twin Bridges State Park, (2) the Spring River from the Oklahoma border to the U.S. Highway 60 bridge at Twin Bridges State Park, and (3) the Elk River from Noel, Missouri, to the Oklahoma State Highway 10 bridge near Grove, Oklahoma. The Neosho River and Spring River bathymetric surveys were performed from October 26 to December 14, 2016; the Elk River bathymetric survey was performed from February 27 to March 21, 2017. Only areas inundated during those periods were surveyed.The bathymetric surveys covered a total distance of about 76 river miles and a total area of about 5 square miles. Greater than 1.4 million bathymetric-survey data points were used in the computation and interpolation of bathymetric-survey digital elevation models and derived contours at 1-foot (ft) intervals. The minimum bathymetric-survey elevation of the Neosho

  19. Comparative Research on River Basin Management in the Sagami River Basin (Japan and the Muda River Basin (Malaysia

    Directory of Open Access Journals (Sweden)

    Lay Mei Sim

    2018-05-01

    Full Text Available In the world, river basins often interwoven into two or more states or prefectures and because of that, disputes over water are common. Nevertheless, not all shared river basins are associated with water conflicts. Rivers in Japan and Malaysia play a significant role in regional economic development. They also play a significant role as water sources for industrial, domestic, agricultural, aquaculture, hydroelectric power generation, and the environment. The research aim is to determine the similarities and differences between the Sagami and Muda River Basins in order to have a better understanding of the governance needed for effectively implementing the lessons drawn from the Sagami River Basin for improving the management of the Muda River Basin in Malaysia. This research adopts qualitative and quantitative approaches. Semi-structured interviews were held with the key stakeholders from both basins and show that Japan has endeavored to present policy efforts to accommodate the innovative approaches in the management of their water resources, including the establishment of a river basin council. In Malaysia, there is little or no stakeholder involvement in the Muda River Basin, and the water resource management is not holistic and is not integrated as it should be. Besides that, there is little or no Integrated Resources Water Management, a pre-requisite for sustainable water resources. The results from this comparative study concluded that full support and participation from public stakeholders (meaning the non-government and non-private sector stakeholders is vital for achieving sustainable water use in the Muda River Basin. Integrated Water Resources Management (IWRM approaches such as the introduction of payments for ecosystems services and the development of river basin organization in the Muda River Basin should take place in the spirit of political willingness.

  20. 78 FR 36658 - Safety Zone; Delaware River Waterfront Corp. Fireworks Display, Delaware River; Camden, NJ

    Science.gov (United States)

    2013-06-19

    ... portion of the Delaware River from operating while a fireworks event is taking place. This temporary...-AA00 Safety Zone; Delaware River Waterfront Corp. Fireworks Display, Delaware River; Camden, NJ AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary...

  1. 78 FR 22423 - Drawbridge Operation Regulations; Taunton River, Fall River and Somerset, MA

    Science.gov (United States)

    2013-04-16

    ... Operation Regulations; Taunton River, Fall River and Somerset, MA AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation from regulation. SUMMARY: The Coast Guard is issuing a temporary deviation from the regulation governing the operation of the Brightman Street Bridge across the Taunton River...

  2. River-tide dynamics : Exploration of nonstationary and nonlinear tidal behavior in the Yangtze River estuary

    NARCIS (Netherlands)

    Guo, L.; Van der Wegen, M.; Jay, D.A.; Matte, P.; Wang, Z.B.; Roelvink, J.A.; He, Q.

    2015-01-01

    River-tide dynamics remain poorly understood, in part because conventional harmonic analysis (HA) does not cope effectively with nonstationary signals. To explore nonstationary behavior of river tides and the modulation effects of river discharge, this work analyzes tidal signals in the Yangtze

  3. Rivers running deep : complex flow and morphology in the Mahakam River, Indonesia

    NARCIS (Netherlands)

    Vermeulen, B.

    2014-01-01

    Rivers in tropical regions often challenge our geomorphological understanding of fluvial systems. Hairpin bends, natural scours, bifurcate meander bends, tie channels and embayments in the river bank are a few examples of features ubiquitous in tropical rivers. Existing observation techniques

  4. 76 FR 24914 - Digital River Education Services, Inc., a Division of Digital River, Inc., Including Workers...

    Science.gov (United States)

    2011-05-03

    ... Digital River Education Services acquired Journey Education Marketing (JEM) in August 2010. Some workers... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-74,975] Digital River Education Services, Inc., a Division of Digital River, Inc., Including Workers Whose Unemployment Insurance (UI...

  5. Return to the river: strategies for salmon restoration in the Columbia River Basin.

    Science.gov (United States)

    Richard N. Williams; Jack A. Standford; James A. Lichatowich; William J. Liss; Charles C. Coutant; Willis E. McConnaha; Richard R. Whitney; Phillip R. Mundy; Peter A. Bisson; Madison S. Powell

    2006-01-01

    The Columbia River today is a great "organic machine" (White 1995) that dominates the economy of the Pacific Northwest. Even though natural attributes remain—for example, salmon production in Washington State's Hanford Reach, the only unimpounded reach of the mainstem Columbia River—the Columbia and Snake River mainstems are dominated...

  6. 33 CFR 207.10 - Charles River, Mass.; dam of Charles River Basin Commission.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Charles River, Mass.; dam of Charles River Basin Commission. 207.10 Section 207.10 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.10 Charles River, Mass.; dam of...

  7. 75 FR 33690 - Safety Zone, Lights on the River Fireworks Display, Delaware River, New Hope, PA

    Science.gov (United States)

    2010-06-15

    ... scenario with potential for loss of life and property. Basis and Purpose The New Hope Chamber of Commerce... to protect life and property operating on the navigable waterways of the Delaware River in New Hope...-AA00 Safety Zone, Lights on the River Fireworks Display, Delaware River, New Hope, PA AGENCY: Coast...

  8. The Influence of Water Conservancy Projects on River Network Connectivity, A Case of Luanhe River Basin

    Science.gov (United States)

    Li, Z.; Li, C.

    2017-12-01

    Connectivity is one of the most important characteristics of a river, which is derived from the natural water cycle and determine the renewability of river water. The water conservancy project can change the connectivity of natural river networks, and directly threaten the health and stability of the river ecosystem. Based on the method of Dendritic Connectivity Index (DCI), the impacts from sluices and dams on the connectivity of river network are deeply discussed herein. DCI quantitatively evaluate the connectivity of river networks based on the number of water conservancy facilities, the connectivity of fish and geographical location. The results show that the number of water conservancy facilities and their location in the river basin have a great influence on the connectivity of the river network. With the increase of the number of sluices and dams, DCI is decreasing gradually, but its decreasing range is becoming smaller and smaller. The dam located in the middle of the river network cuts the upper and lower parts of the whole river network, and destroys the connectivity of the river network more seriously. Therefore, this method can be widely applied to the comparison of different alternatives during planning of river basins and then provide a reference for the site selection and design of the water conservancy project and facility concerned.

  9. 77 FR 23658 - Six Rivers National Forest, Gasquet Ranger District, California, The Smith River National...

    Science.gov (United States)

    2012-04-20

    ... National Forest, Gasquet Ranger District, California, The Smith River National Recreation Area [email protected] . Please insure that ``Smith River NRA Restoration and Motorized Travel Management'' occurs... UARs totaling 80 miles. The project encompasses the Smith River NRA and Gasquet Ranger District...

  10. Effects of urbanization on river morphology of the Talar River, Mazandarn Province, Iran

    NARCIS (Netherlands)

    Yousefi, Saleh; Moradi, Hamid Reza; Keesstra, Saskia; Pourghasemi, Hamid Reza; Navratil, Oldrich; Hooke, Janet

    2017-01-01

    In the present study, we investigate the effects of urbanization growth on river morphology in the downstream part of Talar River, east of Mazandaran Province, Iran. Morphological and morphometric parameters in 10 equal sub-reaches were defined along a 11.5 km reach of the Talar River after land

  11. Sediment Size Distribution at Three Rivers with Different Types of ...

    African Journals Online (AJOL)

    ADOWIE PERE

    sediment size distribution based on land use is very crucial in river maintenance. ... a basis for river catchment management study and can be used by river management .... small. In this case, the difference between upstream and downstream ...

  12. Sewage discharges and nutrient levels in Marimba River, Zimbabwe ...

    African Journals Online (AJOL)

    Sewage discharges and nutrient levels in Marimba River, Zimbabwe. ... Population distribution, land-use, industrial activity, urban agricultural ... River, one of the major inflow rivers into the Lake Chivero, Harare city\\'s main water supply source.

  13. River classification is important for reporting ecological status and ...

    African Journals Online (AJOL)

    River classification is important for reporting ecological status and for the general ecological management of river systems by partitioning natural variability. A priori river classification by abiotic variables and validation of classifications obtained.

  14. Inputs from Indian rivers to the ocean: A synthesis

    Digital Repository Service at National Institute of Oceanography (India)

    DileepKumar, M.; George, M.D.; SenGupta, R.

    ). Fluxes of chemical substances to the Indian Ocean from these rivers are computed to a first approximation. The major ion contents are inversely proportional to the river runoff especially for the rivers entering the Arabian Sea. On an average Indian...

  15. Elk River Watershed - Flood Study

    Science.gov (United States)

    Barnes, C. C.; Byrne, J. M.; MacDonald, R. J.; Lewis, D.

    2014-12-01

    Flooding has the potential to cause significant impacts to economic activities as well as to disrupt or displace populations. Changing climate regimes such as extreme precipitation events increase flood vulnerability and put additional stresses on infrastructure. Potential flooding from just under 100 (2009 NPRI Reviewed Facility Data Release, Environment Canada) toxic tailings ponds located in Canada increase risk to human safety and the environment. One such geotechnical failure spilt billions of litres of toxic tailings into the Fraser River watershed, British Columbia, when a tailings pond dam breach occurred in August 2014. Damaged and washed out roadways cut access to essential services as seen by the extensive floods that occurred in Saskatchewan and Manitoba in July 2014, and in Southern Alberta in 2013. Recovery efforts from events such as these can be lengthy, and have substantial social and economic impacts both in loss of revenue and cost of repair. The objective of this study is to investigate existing conditions in the Elk River watershed and model potential future hydrological changes that can increase flood risk hazards. By analyzing existing hydrology, meteorology, land cover, land use, economic, and settlement patterns a baseline is established for existing conditions in the Elk River watershed. Coupling the Generate Earth Systems Science (GENESYS) high-resolution spatial hydrometeorological model with flood hazard analysis methodology, high-resolution flood vulnerability base line maps are created using historical climate conditions. Further work in 2015 will examine possible impacts for a range of climate change and land use change scenarios to define changes to future flood risk and vulnerability.

  16. Flood of August 24–25, 2016, Upper Iowa River and Turkey River, northeastern Iowa

    Science.gov (United States)

    Linhart, S. Mike; O'Shea, Padraic S.

    2018-02-05

    Major flooding occurred August 24–25, 2016, in the Upper Iowa River Basin and Turkey River Basin in northeastern Iowa following severe thunderstorm activity over the region. About 8 inches of rain were recorded for the 24-hour period ending at 4 p.m., August 24, at Decorah, Iowa, and about 6 inches of rain were recorded for the 24-hour period ending at 7 a.m., August 24, at Cresco, Iowa, about 14 miles northwest of Spillville, Iowa. A maximum peak-of-record discharge of 38,000 cubic feet per second in the Upper Iowa River at streamgage 05388250 Upper Iowa River near Dorchester, Iowa, occurred on August 24, 2016, with an annual exceedance-probability range of 0.2–1 percent. High-water marks were measured at six locations along the Upper Iowa River between State Highway 26 near the mouth at the Mississippi River and State Highway 76 about 3.5 miles south of Dorchester, Iowa, a distance of 15 river miles. Along the profiled reach of the Turkey River, a maximum peak-of-record discharge of 15,300 cubic feet per second at streamgage 05411600 Turkey River at Spillville, Iowa, occurred on August 24, 2016, with an annual exceedance-probability range of 1–2 percent. A maximum peak discharge of 35,700 cubic feet per second occurred on August 25, 2016, along the profiled reach of the Turkey River at streamgage 05411850 Turkey River near Eldorado, Iowa, with an annual exceedance-probability range of 0.2–1 percent. High-water marks were measured at 11 locations along the Turkey River between County Road B64 in Elgin and 220th Street, located about 4.5 miles northwest of Spillville, Iowa, a distance of 58 river miles. The high-water marks were used to develop flood profiles for the Upper Iowa River and Turkey River.

  17. Nitrogen and phosphorus in the Upper Mississippi River: Transport, processing, and effects on the river ecosystem

    Science.gov (United States)

    Houser, J.N.; Richardson, W.B.

    2010-01-01

    Existing research on nutrients (nitrogen and phosphorus) in the Upper Mississippi River (UMR) can be organized into the following categories: (1) Long-term changes in nutrient concentrations and export, and their causes; (2) Nutrient cycling within the river; (3) Spatial and temporal patterns of river nutrient concentrations; (4) Effects of elevated nutrient concentrations on the river; and (5) Actions to reduce river nutrient concentrations and flux. Nutrient concentration and flux in the Mississippi River have increased substantially over the last century because of changes in land use, climate, hydrology, and river management and engineering. As in other large floodplain rivers, rates of processes that cycle nitrogen and phosphorus in the UMR exhibit pronounced spatial and temporal heterogeneity because of the complex morphology of the river. This spatial variability in nutrient processing creates clear spatial patterns in nutrient concentrations. For example, nitrate concentrations generally are much lower in off-channel areas than in the main channel. The specifics of in-river nutrient cycling and the effects of high rates of nutrient input on UMR have been less studied than the factors affecting nutrient input to the river and transport to the Gulf of Mexico, and important questions concerning nutrient cycling in the UMR remain. Eutrophication and resulting changes in river productivity have only recently been investigated the UMR. These recent studies indicate that the high nutrient concentrations in the river may affect community composition of aquatic vegetation (e. g., the abundance of filamentous algae and duckweeds), dissolved oxygen concentrations in off-channel areas, and the abundance of cyanobacteria. Actions to reduce nutrient input to the river include changes in land-use practices, wetland restoration, and hydrological modifications to the river. Evidence suggests that most of the above methods can contribute to reducing nutrient concentration in

  18. Radio cobalt in French rivers

    International Nuclear Information System (INIS)

    Lambrechts, A.; Baudin-Jaulent, Y.

    1996-01-01

    The isotopes 58 and 60 of cobalt present in liquid wastes from nuclear plants or from fuel reprocessing plant of Marcoule are fixed in the different compartments of French rivers. The activity levels of radio-cobalt vary according to the sampled compartments nature (bryophyta > immersed plants > sediment > fish). Elsewhere, laboratory experimentations show that the contamination of fish occurs essentially from the water way rather than from food. Cobalt is mainly fixed by kidneys; muscles is no more than 30 % of the total fish activity. (author)

  19. Savannah River Site dose control

    International Nuclear Information System (INIS)

    Smith, L.S.

    1992-01-01

    Health physicists from the Brookhaven National Laboratory (BNL) visited the Savannah River Site (SRS) as one of 12 facilities operated by the Department of Energy (DOE) contractors with annual collective dose equivalents greater than 100 person-rem (100 person-cSv). Their charter was to review, evaluate and summarize as low as reasonably achievable (ALARA) techniques, methods and practices as implemented. This presentation gives an overview of the two selected ALARA practices implemented at the SRS: Administrative Exposure Limits and Goal Setting. These dose control methods are used to assure that individual and collective occupational doses are ALARA and within regulatory limits

  20. Inundation risk for embanked rivers

    Directory of Open Access Journals (Sweden)

    W. G. Strupczewski

    2013-08-01

    Full Text Available The Flood Frequency Analysis (FFA concentrates on probability distribution of peak flows of flood hydrographs. However, examination of floods that haunted and devastated the large parts of Poland lead us to revision of the views on the assessment of flood risk of Polish rivers. It turned out that flooding is caused not only by the overflow of the levee crest but also due to the prolonged exposure to high water on levees structure causing dangerous leaks and breaches that threaten their total destruction. This is because the levees are weakened by long-lasting water pressure and as a matter of fact their damage usually occurs after the culmination has passed the affected location. The probability of inundation is the total of probabilities of exceeding embankment crest by flood peak and the probability of washout of levees. Therefore, in addition to the maximum flow one should also consider the duration of high waters in a river channel. In the paper the new two-component model of flood dynamics: "Duration of high waters–Discharge Threshold–Probability of non-exceedance" (DqF, with the methodology of its parameter estimation was proposed as a completion to the classical FFA methods. Such a model can estimate the duration of stages (flows of an assumed magnitude with a given probability of exceedance. The model combined with the technical evaluation of the probability of levee breaches due to the duration (d of flow above alarm stage gives the annual probability of inundation caused by the embankment breaking. The results of theoretical investigation were illustrated by a practical example of the model implementation to the series of daily flow of the Vistula River at Szczucin. Regardless of promising results, the method of risk assessment due to prolonged exposure of levees to high water is still in its infancy despite its great cognitive potential and practical importance. Therefore, we would like to point out the need for and usefulness of

  1. The travail of River Bend

    International Nuclear Information System (INIS)

    Studness, C.M.

    1990-01-01

    This article looks at the attempts by Gulf States Utilities to get the River Bend Nuclear Plant into its rate base. The review begins with the initial filing of rate cases in Texas and Louisiana in 1986 and continues through many court cases and appeals all the way to the Texas Supreme Court. The preferred and preference shareholders now nominally control the company through election of 10 of 15 members of the company's board of directors. This case is used as an argument for deregulation in favor of competition

  2. Human impacts on river water quality- comparative research in the catchment areas of the Tone River and the Mur River-

    Science.gov (United States)

    Kogure, K.

    2013-12-01

    Human activities in river basin affect river water quality as water discharges into river with pollutant after we use it. By detecting pollutants source, pathway, and influential factor of human activities, it will be possible to consider proper river basin management. In this study, material flow analysis was done first and then nutrient emission modeling by MONERIS was conducted. So as to clarify land use contribution and climate condition, comparison of Japanese and European river basin area has been made. The model MONERIS (MOdelling Nutrient Emissions in RIver Systems; Behrendt et al., 2000) was applied to estimate the nutrient emissions in the Danube river basin by point sources and various diffuse pathways. Work for the Mur River Basin in Austria was already carried out by the Institute of Water Quality, Resources and Waste Management at the Vienna University of Technology. This study treats data collection, modelling for the Tone River in Japan, and comparative analysis for these two river basins. The estimation of the nutrient emissions was carried out for 11 different sub catchment areas covering the Tone River Basin for the time period 2000 to 2006. TN emissions into the Tone river basin were 51 kt/y. 67% was via ground water and dominant for all sub catchments. Urban area was also important emission pathway. Human effect is observed in urban structure and agricultural activity. Water supply and sewer system make urban water cycle with pipeline structure. Excess evapotranspiration in arable land is also influential in water cycle. As share of arable land is 37% and there provides agricultural products, it is thought that N emission from agricultural activity is main pollution source. Assumption case of 10% N surplus was simulated and the result was 99% identical to the actual. Even though N surplus reduction does not show drastic impact on N emission, it is of importance to reduce excess of fertilization and to encourage effective agricultural activity

  3. Hydrogeological investigations of river bed clogging at a river bank filtration site along the River Warta, Poland

    Directory of Open Access Journals (Sweden)

    Przybyłek Jan

    2017-12-01

    Full Text Available River bank filtration (RBF is a system that enriches groundwater resources by induced infiltration of river water to an aquifer. Problematic during operation of RBF systems is the deterioration of infiltration effectiveness caused by river bed clogging. This situation was observed in the Krajkowo well field which supplies fresh water to the city of Poznań (Poland during and after the long hydrological drought between the years 1989 and 1992. The present note discusses results of specific hydrogeological research which included drilling of a net of boreholes to a depth of 10 m below river bottom (for sediment sampling as well as for hydrogeological measurements, analyses of grain size distribution and relative density studies. The results obtained have allowed the recognition of the origin of the clogging processes, as well as the documentation of the clogged parts of the river bottom designated for unclogging activities.

  4. Balancing hydropower production and river bed incision in operating a run-of-river hydropower scheme along the River Po

    Science.gov (United States)

    Denaro, Simona; Dinh, Quang; Bizzi, Simone; Bernardi, Dario; Pavan, Sara; Castelletti, Andrea; Schippa, Leonardo; Soncini-Sessa, Rodolfo

    2013-04-01

    Water management through dams and reservoirs is worldwide necessary to support key human-related activities ranging from hydropower production to water allocation, and flood risk mitigation. Reservoir operations are commonly planned in order to maximize these objectives. However reservoirs strongly influence river geomorphic processes causing sediment deficit downstream, altering the flow regime, leading, often, to process of river bed incision: for instance the variations of river cross sections over few years can notably affect hydropower production, flood mitigation, water supply strategies and eco-hydrological processes of the freshwater ecosystem. The river Po (a major Italian river) has experienced severe bed incision in the last decades. For this reason infrastructure stability has been negatively affected, and capacity to derive water decreased, navigation, fishing and tourism are suffering economic damages, not to mention the impact on the environment. Our case study analyzes the management of Isola Serafini hydropower plant located on the main Po river course. The plant has a major impact to the geomorphic river processes downstream, affecting sediment supply, connectivity (stopping sediment upstream the dam) and transport capacity (altering the flow regime). Current operation policy aims at maximizing hydropower production neglecting the effects in term of geomorphic processes. A new improved policy should also consider controlling downstream river bed incision. The aim of this research is to find suitable modeling framework to identify an operating policy for Isola Serafini reservoir able to provide an optimal trade-off between these two conflicting objectives: hydropower production and river bed incision downstream. A multi-objective simulation-based optimization framework is adopted. The operating policy is parameterized as a piecewise linear function and the parameters optimized using an interactive response surface approach. Global and local

  5. Compromised Rivers: Understanding Historical Human Impacts on Rivers in the Context of Restoration

    Directory of Open Access Journals (Sweden)

    Ellen Wohl

    2005-12-01

    Full Text Available A river that preserves a simplified and attractive form may nevertheless have lost function. Loss of function in these rivers can occur because hydrologic and geomorphic processes no longer create and maintain the habitat and natural disturbance regimes necessary for ecosystem integrity. Recognition of compromised river function is particularly important in the context of river restoration, in which the public perception of a river's condition often drives the decision to undertake restoration as well as the decision about what type of restoration should be attempted. Determining the degree to which a river has been altered from its reference condition requires a knowledge of historical land use and the associated effects on rivers. Rivers of the Front Range of the Colorado Rocky Mountains in the United States are used to illustrate how historical land uses such as beaver trapping, placer mining, tie drives, flow regulation, and the construction of transportation corridors continue to affect contemporary river characteristics. Ignorance of regional land use and river history can lead to restoration that sets unrealistic goals because it is based on incorrect assumptions about a river's reference condition or about the influence of persistent land-use effects.

  6. Exploring Controls on Sinuousity, Terraces and River Capture in the Upper Dajia River, Taiwan

    Science.gov (United States)

    Belliveau, L. C.; Ouimet, W. B.; Chan, Y. C.; Byrne, T. B.

    2015-12-01

    Taiwan is one of the most tectonically active regions in the world and is prone to landslides due to steep topography, large earthquakes and frequent typhoons. Landslides often affect and alter the river valleys beneath them, producing knickpoints on longitudinal river profiles, segmenting valleys into mixed bedrock-alluvial rivers and affecting river incision for tens to thousands of years. This study investigates the origin and evolution of complex channel morphologies, terraces and river capture along a 20km stretch of the Upper Da-Jia River in the Heping area of Taiwan. Through GIS analysis and field studies, we explore controls on river channel sinuousity, terrace development and river capture in relation to tectonic and climatic forcing, rock erodibility and landslides. High channel sinuousity is proposed as the result of a coupling between bank erosion and landslides. We discuss three types of landslide-induced meanders and increased sinuousity: (a) depositional-push meanders, (b) failure-zone erosional meanders, and (c) complex-erosional meanders. We also investigate spatial variation in channel morphology (slope, width) and the distribution and heights of river terraces within the Upper Da-Jia watershed associated with periods of widespread valley filling from landslide activity. Examples of river capture provide further evidence of the dynamic interactions between river incision, landslides and associated changes in channel morphology and terrace development within steep rapidly uplift, eroding and evolving mountain belts.

  7. South Fork Holston River basin 1988 biomonitoring

    Energy Technology Data Exchange (ETDEWEB)

    Saylor, C.F.; Ahlstedt, S.A.

    1990-06-01

    There is concern over the effects of shifts in land use use practices on the aquatic fauna of streams in the South Fork Holston River basin in northwestern North Carolina and southwestern Virginia. Trout reproduction has noticeably declined in the Watauga River subbasin. The Watauga River and Elk River subbasins have been subjected to commercial and resort development. The Middle fork Holston River and the upper South Fork Holston River subbasins have been affected by agricultural and mining activities, respectively (Cox, 1986). To aid reclamation and management of the South Fork Holston basin, Tennessee Valley Authority (TVA) biologists conducted biomonitoring--including index of biotic integrity and macroinvertebrate sampling--on the Middle Fork Holston, South Fork Holston, Watauga, and Elk Rivers to assess cumulative impairment related to changes in habitat and pollutant loading in these subbasins. Biomonitoring can detect environmental degradation, help document problem areas, and assist in development of strategies for managing water quality. This report discusses the methods and materials and results of the biomonitoring of South Fork Holston River Basin. 13 refs., 5 figs., 12 tabs.

  8. Limnology of the Touw River floodplain

    CSIR Research Space (South Africa)

    Allanson, BR

    1983-12-01

    Full Text Available stream_source_info THE LIMNOLOGY OF THE TOUW RIVER FLOODPLAIN.pdf.txt stream_content_type text/plain stream_size 41 Content-Encoding ISO-8859-1 stream_name THE LIMNOLOGY OF THE TOUW RIVER FLOODPLAIN.pdf.txt Content-Type text.../plain; charset=ISO-8859-1 ...

  9. 33 CFR 117.1087 - Fox River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Fox River. 117.1087 Section 117.1087 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1087 Fox River. (a) The draws of the Canadian...

  10. Determination of characteristics maximal runoff Mountain Rivers

    African Journals Online (AJOL)

    Ovcharuk V and Todorova O

    Odessa State Environmental University, Ukraine. Received: 03 December 2015 / Accepted: 23 April 2016 / Published online: 01 May 2016. ABSTRACT. This article has been examined maximum runoff of the rivers of the Crimean Mountains. The rivers flow through the western and eastern part of the northern slope Crimean ...

  11. Vocal behaviour of Orange River Francolin Scleroptila ...

    African Journals Online (AJOL)

    Fieldwork to study the vocal behaviour of Orange River Francolin Scleroptilia levaillantoides was conducted on a farm in the Heidelberg district, Gauteng province, South Africa, during August 2009 to March 2011. Orange River Francolins possess a basic repertoire of seven calls and one mechanical sound. From 83 ...

  12. 33 CFR 117.385 - Snake River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake River. 117.385 Section 117.385 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Idaho § 117.385 Snake River. The drawspan of the U.S. 12 bridge...

  13. Advances in understanding river-groundwater interactions

    Science.gov (United States)

    Brunner, Philip; Therrien, René; Renard, Philippe; Simmons, Craig T.; Franssen, Harrie-Jan Hendricks

    2017-09-01

    River-groundwater interactions are at the core of a wide range of major contemporary challenges, including the provision of high-quality drinking water in sufficient quantities, the loss of biodiversity in river ecosystems, or the management of environmental flow regimes. This paper reviews state of the art approaches in characterizing and modeling river and groundwater interactions. Our review covers a wide range of approaches, including remote sensing to characterize the streambed, emerging methods to measure exchange fluxes between rivers and groundwater, and developments in several disciplines relevant to the river-groundwater interface. We discuss approaches for automated calibration, and real-time modeling, which improve the simulation and understanding of river-groundwater interactions. Although the integration of these various approaches and disciplines is advancing, major research gaps remain to be filled to allow more complete and quantitative integration across disciplines. New possibilities for generating realistic distributions of streambed properties, in combination with more data and novel data types, have great potential to improve our understanding and predictive capabilities for river-groundwater systems, especially in combination with the integrated simulation of the river and groundwater flow as well as calibration methods. Understanding the implications of different data types and resolution, the development of highly instrumented field sites, ongoing model development, and the ultimate integration of models and data are important future research areas. These developments are required to expand our current understanding to do justice to the complexity of natural systems.

  14. Savannah River Site Environmental Report for 1998

    Energy Technology Data Exchange (ETDEWEB)

    Arnett, M

    1999-06-09

    The mission at the Savannah River Site (SRS) is focused primarily on support of the national defense, nonproliferation, and environmental cleanup. SRS-through its prime operating contractor, Westinghouse Savannah River Company-continues to maintain a comprehensive environmental monitoring program.

  15. Climate influences on Vaal River flow

    African Journals Online (AJOL)

    2016-04-02

    Apr 2, 2016 ... enriched NW-cloud bands over the Vaal River catchment, during the flood case study of January 2010. Comparison of. (Pacific) Southern Oscillation and east Atlantic influence on Vaal River discharge reveals the former drives evaporative losses while the latter provides an advance warning of flow ...

  16. Thinking big: linking rivers to landscapes

    Science.gov (United States)

    Joan O’Callaghan; Ashley E. Steel; Kelly M. Burnett

    2012-01-01

    Exploring relationships between landscape characteristics and rivers is an emerging field, enabled by the proliferation of satellite date, advances in statistical analysis, and increased emphasis on large-scale monitoring. Landscapes features such as road networks, underlying geology, and human developments, determine the characteristics of the rivers flowing through...

  17. Environmental protection in the Alligator Rivers Region

    International Nuclear Information System (INIS)

    Riley, G.

    1989-01-01

    One of a series of articles on the work of the Office of the Supervising Scientist for the Alligator Rivers Region (OSS) and its Alligator Rivers Region Research Institute (ARRRI), this discusses the environmental protection function of the OSS and the role of the ARRRI in achieving this

  18. Analysis of Cruise Tourism on Croatian Rivers

    Directory of Open Access Journals (Sweden)

    Astrid Zekić

    2017-03-01

    Full Text Available Cruise trips have been rising in popularity since the 1970sand are currently a trend in the tourism market. This is particularly true of river cruises, which record a constant growth in the number of ship calls. The general upward trend in the number of river cruise passengers and dockings is also present in Croatia. Prerequisites for the development of cruising on Croatian rivers include, in addition to other geographical features, also the length of navigable water ways, but a systematic approach to this issue is needed for further development. The authors investigate the level of development of infrastructure on Croatian rivers and analyse the passenger and ship traffic on them. Special attention is given to the importance of cruises for tourism on European rivers and worldwide. In accordance with the Croatian Tourism Development Strategy until 2020, the authors explore geographical and other conditions necessary for the development of river cruise tourism. The aim of the paper is to point to the importance of building infrastructure for accommodation of vessels sailing on Croatian rivers, and in particular to the need to improve tourism offer in river destinations.

  19. 33 CFR 117.263 - Banana River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Banana River. 117.263 Section 117.263 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.263 Banana River. (a) The draw of the Mathers (SR...

  20. Policy and Practice – River Basins

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ms Suruchi Bhadwal

    nature of rivers in the northern belt- inextricably linked. Exacerbated water stress in some areas. Increasing demands – food and drinking water needs. Socioeconomics. CC Impacts. Glacier-fed basins in the. North. Glacier melt and river flooding,. GLOFs, landslides. Unique socio-cultural settings and political differences.

  1. Implementing Integrated River Basin Management in China

    NARCIS (Netherlands)

    Boekhorst, D.G.J. te; Smits, A.J.M.; Yu, X.; Lifeng, L.; Lei, G.; Zhang, C.

    2010-01-01

    This paper examines the role of the World Wildlife Fund for Nature China as policy entrepreneur in China. It illustrates the ways in which the World Wildlife Fund for Nature is active in promoting integrated river basin management in the Yangtze River basin and how the efforts at basin level are

  2. 33 CFR 117.457 - Houston River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Houston River. 117.457 Section 117.457 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.457 Houston River. The draw of the...

  3. Restoring Oaks in the Missouri River Floodplain

    Science.gov (United States)

    Dan Dey; John Kabrick; Jennifer Grabner; Mike Gold

    2001-01-01

    Restoration of native vegetation and hydrologic regimes in the Mississippi and Missouri River floodplains is problematic because they are among the most altered ecosystems in North America (Noss et al. 1995), and because of the competing demands placed on these river ecosystems by commercial, private and social interests. Since the 1780s, more than half (53 percent) of...

  4. Experiments on sediment pulses in mountain rivers

    Science.gov (United States)

    Y. Cui; T. E. Lisle; J. E. Pizzuto; G. Parker

    1998-01-01

    Pulses of sediment can be introduced into mountain rivers from such mechanisms as debris flows, landslides and fans at tributary confluences. These processes can be natural or associated with the activities of humans, as in the case of a pulse created by sediment derived from timber harvest or the removal of a dam. How does the river digest these pulses?

  5. Savannah River Site Environmental Report for 1998

    International Nuclear Information System (INIS)

    Arnett, M.

    1999-01-01

    The mission at the Savannah River Site (SRS) is focused primarily on support of the national defense, nonproliferation, and environmental cleanup. SRS-through its prime operating contractor, Westinghouse Savannah River Company-continues to maintain a comprehensive environmental monitoring program

  6. Water quality of the river Damanganga (Gujarat)

    Digital Repository Service at National Institute of Oceanography (India)

    Zingde, M.D.; Narvekar, P.V.; Sarma, R.V.; Desai, B.N.

    Water quality (pH, suspended solids, chlorides, DO, BOD, reactive and total phosphorus, nitrates and boron) of River Damanganga which receives 0.2 mld of industrial waste into its fresh water zone through Pimparia River and 3.7 mld in its tidal zone...

  7. Yukon River King Salmon - Ichthyophonus Pilot Study

    Science.gov (United States)

    Kocan, R.M.; Hershberger, P.K.

    2001-01-01

    When king salmon enter the Yukon River on their spawning migration in mid June, over 25% of the population are infected with Ichthyophonus. The percent of infected fish remains relatively constant until the fish pass river mile 1,319 at Dawson, Y.T., then it drops to 13% when they reach river mile 1,745 at Whitehorse, Y.T. When the sexes are examined separately, slightly more females are infected than males (29% vs 22%). The percent of fish exhibiting clinical signs (diseased) is 2-3% when they enter the river, but increases to over 20% at river mile 715 near Tanana, AK. Disease prevalence within the population remains constant at >20% until fish pass Dawson, then the percent of diseased fish drops to <9% at Whitehorse. When the sexes are examined separately, male disease prevalence is highest at Tanana (22.6%) then gradually drops to just 12.9% at Whitehorse. Females however, continue to show an increase in disease prevalence peaking at river mile 1,081 near Circle, AK, at 36.4%, then dropping to just 5.3% at Whitehorse. Data on infection and disease collected from kings at Nenana on the Tanana River more closely resembles that seen at Whitehorse than the lower and middle Yukon River.

  8. Multielement analysis of water in Yodo River

    International Nuclear Information System (INIS)

    Mamuro, Tetsuo; Mizohata, Akira; Matsunami, Tadao; Matsuda, Yatsuka

    1980-01-01

    Yodo River is a major source of water supplies in the Osaka district. Three tributaries including Katsura River flow into this river at close positions. It is known that the Katsura River is considerably polluted due to the sewage treatment in Kyoto City. Following the previous survey in September, 1970, a similar survey by neutron activation has been carried out on the pollution of the Yodo River in October, 1977, by increasing the number of sampling points. Because it is reported that the pollution of the Katsura River has been largely lowered from that in the previous survey, the purpose was to grasp the present situation of the water pollution of the Yodo River due to metal elemens and others, and further to examine in relation of material balance. The procedures used were, first, the evaporation and solidification of sample water, and then neutron activation analysis. The correlation among the concentrations of elements, the pattern of the concentrations of elements, the material balance along the Yodo River, etc. are described in this paper. (J.P.N.)

  9. 33 CFR 117.925 - Cooper River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cooper River. 117.925 Section 117.925 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements South Carolina § 117.925 Cooper River. The draw of the Seaboard...

  10. 33 CFR 117.713 - Cooper River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cooper River. 117.713 Section 117.713 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.713 Cooper River. (a) The drawspans for the...

  11. 33 CFR 117.1095 - Root River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Root River. 117.1095 Section 117.1095 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1095 Root River. (a) The draw of the Main Street...

  12. River meander modeling of the Wabash River near the Interstate 64 Bridge near Grayville, Illinois

    Science.gov (United States)

    Lant, Jeremiah G.; Boldt, Justin A.

    2018-01-16

    Natural river channels continually evolve and change shape over time. As a result, channel evolution or migration can cause problems for bridge structures that are fixed in the flood plain. A once-stable bridge structure that was uninfluenced by a river’s shape could be encroached upon by a migrating river channel. The potential effect of the actively meandering Wabash River on the Interstate 64 Bridge at the border with Indiana near Grayville, Illinois, was studied using a river migration model called RVR Meander. RVR Meander is a toolbox that can be used to model river channel meander migration with physically based bank erosion methods. This study assesses the Wabash River meandering processes through predictive modeling of natural meandering over the next 100 years, climate change effects through increased river flows, and bank protection measures near the Interstate 64 Bridge.

  13. Industrial pollution and the management of river water quality: a model of Kelani River, Sri Lanka.

    Science.gov (United States)

    Gunawardena, Asha; Wijeratne, E M S; White, Ben; Hailu, Atakelty; Pandit, Ram

    2017-08-19

    Water quality of the Kelani River has become a critical issue in Sri Lanka due to the high cost of maintaining drinking water standards and the market and non-market costs of deteriorating river ecosystem services. By integrating a catchment model with a river model of water quality, we developed a method to estimate the effect of pollution sources on ambient water quality. Using integrated model simulations, we estimate (1) the relative contribution from point (industrial and domestic) and non-point sources (river catchment) to river water quality and (2) pollutant transfer coefficients for zones along the lower section of the river. Transfer coefficients provide the basis for policy analyses in relation to the location of new industries and the setting of priorities for industrial pollution control. They also offer valuable information to design socially optimal economic policy to manage industrialized river catchments.

  14. Radioactivity in Orontes river environment

    International Nuclear Information System (INIS)

    Othman, I.; Al-Masri, M. S.; Al-Oudat, M.; Abba, A.; Al-Hishari, M.; Berakdar, I.

    1998-09-01

    Syrian phosphate industry is considered to be one of the main sources of pollutants at the most important water resources of the middle region viz. Orontes river and Quttina lake. The main environmental concern associated with this industry in connection to radioactive contamination is the presence of naturally occurring radionuclides such as 238 U, 226 Ra and their daughters. The impact of this industry on Orontes environment has been investigated. Water, particulates, sediments and plants from seven locations along the Orontes River have been collected and analyzed for radioactivity. The results have shown a clear signal enhancement of natural radionuclides such as 226 Ra, 238 U and 210 Po in those samples collected from sites close to the factory. This enhancement was found to be due to phosphate factory discharges viz. Dust, liquid influents and phosphogypsum piles situated in the area. In addition, an increase in the concentrations of these radionuclides was also observed in other samples where the applications of phosphate fertilizers which contain relatively higher levels of 226 Ra (225 Bq/kg), 238 U (444 Bq/kg) and 210 (220 Bq/kg) being the main source of enhancement. However, the obtained levels of radioactivity are still lower than those reported in other areas in the world where similar source of contamination is presented. (author)

  15. The social connectivity of urban rivers

    Science.gov (United States)

    Kondolf, G. Mathias; Pinto, Pedro J.

    2017-01-01

    By social connectivity we refer to the communication and movement of people, goods, ideas, and culture along and across rivers, recognizing longitudinal, lateral, and vertical connectivity, much as has been described for other rivers for hydrology and ecology. We focus on rivers as they pass through cities, and the relationships between these rivers and city dwellers. Historically, the most important longitudinal connectivity function of rivers was their role as major transport routes and the simplification of formerly complex, irregular banks and beds, into straight, uniform shipping channels has resulted in a loss of lateral and vertical connectivity, notably the quotidian uses such as fishing, washing clothes, water supply, swimming and other recreation. The scale of the river itself, and its scale in comparison to the scale of the city, largely determine the river's social function and the degree to which it influences city form. River width affects the perception of 'closeness' of the other bank, ease of bridging the river, influence of the river on the city's street pattern, and type of waterfront uses that occur. Up to 15 m wide, people can converse, whereas across rivers 50 to 200 m wide, people are not recognizable but still clearly visible, instilling the banks with a 'lively' atmosphere. At widths over 200 m, people blur, yet moving vehicles and trees branches shaking in wind may still provide some dynamic elements to an otherwise static landscape composed of building facades. In exceptionally wide rivers, the city on the opposite bank is little more than a skyline, which often becomes a signature and symbol of regional identity. In contemplating how people use rivers, we can define a range of human activities in relation to height above the water (i.e., instream to banktop), a vertical dimension of human connectivity with rivers. Many uses occur on the top of the bank, such as quiet contemplation, walking, or cycling along a riverside trail, while

  16. Studies of Columbia River water quality

    International Nuclear Information System (INIS)

    Onishi, Y.; Johanson, P.A.; Baca, R.G.; Hilty, E.L.

    1976-01-01

    The program to study the water quality of the Columbia River consists of two separate segments: sediment and radionuclide transport and temperature analysis. Quasi-two dimensional (longitudinal and vertical directions) mathematical simulation models were developed for determining radionuclide inventories, their variations with time, and movements of sediments and individual radionuclides in the freshwater region of the Columbia River below Priest Rapids Dam. These codes are presently being applied to the river reach between Priest Rapids and McNary Dams for the initial sensitivity analysis. In addition, true two-dimensional (longitudinal and lateral directions) models were formulated and are presently being programmed to provide more detailed information on sediment and radionuclide behavior in the river. For the temperature analysis program, river water temperature data supplied by the U. S. Geological Survey for six ERDA-sponsored temperature recording stations have been analyzed and cataloged on storage devices associated with ERDA's CDC 6600 located at Richland, Washington

  17. Preface to the volume Large Rivers

    Science.gov (United States)

    Latrubesse, Edgardo M.; Abad, Jorge D.

    2018-02-01

    The study and knowledge of the geomorphology of large rivers increased significantly during the last years and the factors that triggered these advances are multiple. On one hand, modern technologies became more accessible and their disseminated usage allowed the collection of data from large rivers as never seen before. The generalized use of high tech data collection with geophysics equipment such as acoustic Doppler current profilers-ADCPs, multibeam echosounders, plus the availability of geospatial and computational tools for morphodynamics, hydrological and hydrosedimentological modeling, have accelerated the scientific production on the geomorphology of large rivers at a global scale. Despite the advances, there is yet a lot of work ahead. Good parts of the large rivers are in the tropics and many are still unexplored. The tropics also hold crucial fluvial basins that concentrate good part of the gross domestic product of large countries like the Parana River in Argentina and Brazil, the Ganges-Brahmaputra in India, the Indus River in Pakistan, and the Mekong River in several countries of South East Asia. The environmental importance of tropical rivers is also outstanding. They hold the highest biodiversity of fluvial fauna and alluvial vegetation and many of them, particularly those in Southeast Asia, are among the most hazardous systems for floods in the entire world. Tropical rivers draining mountain chains such as the Himalaya, the Andes and insular Southeast Asia are also among the most heavily sediment loaded rivers and play a key role in both the storage of sediment at continental scale and the transference of sediments from the continent to the Ocean at planetary scale (Andermann et al., 2012; Latrubesse and Restrepo, 2014; Milliman and Syvitski, 1992; Milliman and Farsnworth, 2011; Sinha and Friend, 1994).

  18. Sediment transport in two mediterranean regulated rivers.

    Science.gov (United States)

    Lobera, G; Batalla, R J; Vericat, D; López-Tarazón, J A; Tena, A

    2016-01-01

    Mediterranean climate is characterized by highly irregular rainfall patterns with marked differences between wet and dry seasons which lead to highly variable hydrological fluvial regimes. As a result, and in order to ensure water availability and reduce its temporal variability, a high number of large dams were built during the 20th century (more than 3500 located in Mediterranean rivers). Dams modify the flow regime but also interrupt the continuity of sediment transfer along the river network, thereby changing its functioning as an ecosystem. Within this context, the present paper aims to assess the suspended sediment loads and dynamics of two climatically contrasting Mediterranean regulated rivers (i.e. the Ésera and Siurana) during a 2-yr period. Key findings indicate that floods were responsible for 92% of the total suspended sediment load in the River Siurana, while this percentage falls to 70% for the Ésera, indicating the importance of baseflows on sediment transport in this river. This fact is related to the high sediment availability, with the Ésera acting as a non-supply-limited catchment due to the high productivity of the sources (i.e. badlands). In contrast, the Siurana can be considered a supply-limited system due to its low geomorphic activity and reduced sediment availability, with suspended sediment concentration remaining low even for high magnitude flood events. Reservoirs in both rivers reduce sediment load up to 90%, although total runoff is only reduced in the case of the River Ésera. A remarkable fact is the change of the hydrological character of the River Ésera downstream for the dam, shifting from a humid mountainous river regime to a quasi-invariable pattern, whereas the Siurana experiences the opposite effect, changing from a flashy Mediterranean river to a more constant flow regime below the dam. Copyright © 2015 Elsevier B.V. All rights reserved.

  19. Trends in the occurrence of human and veterinary antibiotics in the sediments of the Yellow River, Hai River and Liao River in northern China

    Energy Technology Data Exchange (ETDEWEB)

    Lijun, Zhou [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Ying Guangguo, E-mail: guang-guo.ying@gig.ac.cn [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Jianliang, Zhao [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Jifeng, Yang [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Chemistry and Chemical Engineering Department, Hunan University of Arts and Science, Changde 415000 (China); Li, Wang; Bin, Yang; Shan, Liu [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China)

    2011-07-15

    The occurrence of four classes of 17 commonly used antibiotics (including fluoroquinolones, tetracycline, sulfonamides, and macrolides) was investigated in the sediments of the Yellow River, Hai River and Liao River in northern China by using rapid resolution liquid chromatography-tandem mass spectrometry. Higher concentrations were detected for most antibiotics in the sediments of the Hai River than in the sediments of the other rivers. Norfloxacin, ofloxacin, ciprofloxacin and oxytetracycline in the three rivers were most frequently detected with concentrations up to 5770, 1290, 653 and 652 ng/g, respectively. High frequencies and concentrations of the detected antibiotics were often found in the downstream of large cities and areas influenced by feedlot and fish ponds. Good fitted linear regression equations between antibiotic concentration and sediment physicochemical properties (TOC, texture and pH) were also found, indicating that sediment properties are important factors influencing the distribution of antibiotics in the sediment of rivers. - Highlights: > Presence of four classes of commonly used antibiotics in the river sediments. > Higher concentrations in the Hai River than in the Liao River and Yellow River. > Norfloxacin, ofloxacin, ciprofloxacin and oxytetracycline most frequently detected. > High antibiotic concentrations often found in the downstream of large cities. > River sediments are an important reservoir of antibiotics. - Higher concentrations of selected antibiotics were determined in the sediments of the Hai River than in the Liao River and Yellow River.

  20. Trends in the occurrence of human and veterinary antibiotics in the sediments of the Yellow River, Hai River and Liao River in northern China

    International Nuclear Information System (INIS)

    Zhou Lijun; Ying Guangguo; Zhao Jianliang; Yang Jifeng; Wang Li; Yang Bin; Liu Shan

    2011-01-01

    The occurrence of four classes of 17 commonly used antibiotics (including fluoroquinolones, tetracycline, sulfonamides, and macrolides) was investigated in the sediments of the Yellow River, Hai River and Liao River in northern China by using rapid resolution liquid chromatography-tandem mass spectrometry. Higher concentrations were detected for most antibiotics in the sediments of the Hai River than in the sediments of the other rivers. Norfloxacin, ofloxacin, ciprofloxacin and oxytetracycline in the three rivers were most frequently detected with concentrations up to 5770, 1290, 653 and 652 ng/g, respectively. High frequencies and concentrations of the detected antibiotics were often found in the downstream of large cities and areas influenced by feedlot and fish ponds. Good fitted linear regression equations between antibiotic concentration and sediment physicochemical properties (TOC, texture and pH) were also found, indicating that sediment properties are important factors influencing the distribution of antibiotics in the sediment of rivers. - Highlights: → Presence of four classes of commonly used antibiotics in the river sediments. → Higher concentrations in the Hai River than in the Liao River and Yellow River. → Norfloxacin, ofloxacin, ciprofloxacin and oxytetracycline most frequently detected. → High antibiotic concentrations often found in the downstream of large cities. → River sediments are an important reservoir of antibiotics. - Higher concentrations of selected antibiotics were determined in the sediments of the Hai River than in the Liao River and Yellow River.

  1. Hotspots within the Transboundary Selenga River Basin

    Science.gov (United States)

    Kasimov, Nikolay; Lychagin, Mikhail; Chalov, Sergey

    2013-04-01

    Gathering the efficient information on water pollution of transboundary river systems remains the crucial task in international water management, environmental pollution control and prevention health problems. Countries, located in the low parts of the river basins, depend on the water strategy and water use in the adjacent countries, located upstream. Surface water pollution is considered to be the most serious problem, facing the above-mentioned countries. Large efforts in terms of field measurement campaigns and (numerical) transport modeling are then typically needed for relevant pollution prediction and prevention. Russian rivers take inflow from 8 neighboring countries. Among them there are 2 developing economies - People Republic of China and Mongolia, which are located in water-scarce areas and thus solve their water-related problems through the consumption of international water. Negative change of water runoff and water quality in the foreign part of transboundary river is appeared inside Russian territory with more or less delay. The transboundary river system of Selenga is particularly challenging, being the biggest tributary of Lake Baikal which is the largest freshwater reservoir in the world. Selenga River contributes about 50 % of the total inflow into Baikal. It originates in the mountainous part of Mongolia and then drains into Russia. There are numerous industries and agricultural activities within the Selenga drainage basin that affect the water quality of the river system. Absence of the single monitoring system and predictive tools for pollutants transport in river system requires large efforts in understanding sources of water pollution and implemented data on the relevant numerical systems for the pollution prediction and prevention. Special investigations in the Selenga river basin (Mongolia and Russia) were done to assess hot spots and understand state-of-the art in sediment load, water chemistry and hydrobiology of transboundary systems

  2. Ichthyoplankton entrainment study at the SRS Savannah River water intakes for Westinghouse Savannah River Company

    International Nuclear Information System (INIS)

    Paller, M.

    1992-01-01

    Cooling water for L and K Reactors and makeup water for Par Pond is pumped from the Savannah River at the 1G, 3G, and 5G pump houses. Ichthyoplankton (drifting fish larvae and eggs) from the river are entrained into the reactor cooling systems with the river water and passed through the reactor's heat exchangers where temperatures may reach 70 degrees C during full power operation. Ichthyoplankton mortality under such conditions is assumed to be 100 percent. The number of ichthyoplankton entrained into the cooling system depends on a variety of variables, including time of year, density and distribution of ichthyoplankton in the river, discharge levels in the river, and the volume of water withdrawn by the pumps. Entrainment at the 1 G pump house, which is immediately downstream from the confluence of Upper Three Runs Creek and the Savannah River, is also influenced by discharge rates and ichthyoplankton densities in Upper Three Runs Creek. Because of the anticipated restart of several SRS reactors and the growing concern surrounding striped bass and American shad stocks in the Savannah River, the Department of Energy requested that the Environmental Sciences Section (ESS) of the Savannah River Laboratory sample ichthyoplankton at the SRS Savannah River intakes. Dams ampersand Moore, Inc., under a contract with Westinghouse Savannah River Company performed the sampling and data analysis for the ESS

  3. Magpie River Development: Environmental considerations

    International Nuclear Information System (INIS)

    Smythe, L.A.; Ashwood, K.R.

    1990-01-01

    The Magpie River development is located near Wawa, Ontario, 250 km north of Sault St. Marie. The unmanned and remotely controlled development consists of three power plants each with reservoir and associated control structures. The plants are equipped with identical single Kaplan units for a total installed capacity of 43 MW. Operation of the plants is automatic, and is governed by a set of Crown conditions, established by the government during project approval stage. The environmental assessment/approval process undertaken for the development is described. Concerns with the project included tourism impact at Magpie Falls, effects of drawdown at Esnagi Lake on recreational fisheries, water quality degradation, protection of riverine fisheries, and native rights. Mitigative measures to address these concerns are described. 7 tabs

  4. River Basin Standards Interoperability Pilot

    Science.gov (United States)

    Pesquer, Lluís; Masó, Joan; Stasch, Christoph

    2016-04-01

    There is a lot of water information and tools in Europe to be applied in the river basin management but fragmentation and a lack of coordination between countries still exists. The European Commission and the member states have financed several research and innovation projects in support of the Water Framework Directive. Only a few of them are using the recently emerging hydrological standards, such as the OGC WaterML 2.0. WaterInnEU is a Horizon 2020 project focused on creating a marketplace to enhance the exploitation of EU funded ICT models, tools, protocols and policy briefs related to water and to establish suitable conditions for new market opportunities based on these offerings. One of WaterInnEU's main goals is to assess the level of standardization and interoperability of these outcomes as a mechanism to integrate ICT-based tools, incorporate open data platforms and generate a palette of interchangeable components that are able to use the water data emerging from the recently proposed open data sharing processes and data models stimulated by initiatives such as the INSPIRE directive. As part of the standardization and interoperability activities in the project, the authors are designing an experiment (RIBASE, the present work) to demonstrate how current ICT-based tools and water data can work in combination with geospatial web services in the Scheldt river basin. The main structure of this experiment, that is the core of the present work, is composed by the following steps: - Extraction of information from river gauges data in OGC WaterML 2.0 format using SOS services (preferably compliant to the OGC SOS 2.0 Hydrology Profile Best Practice). - Model floods using a WPS 2.0, WaterML 2.0 data and weather forecast models as input. - Evaluation of the applicability of Sensor Notification Services in water emergencies. - Open distribution of the input and output data as OGC web services WaterML, / WCS / WFS and with visualization utilities: WMS. The architecture

  5. Reactor loops at Chalk River

    International Nuclear Information System (INIS)

    Sochaski, R.O.

    1962-07-01

    This report describes broadly the nine in-reactor loops, and their components, located in and around the NRX and NRU reactors at Chalk River. First an introduction and general description is given of the loops and their function, supplemented with a table outlining some loop specifications and nine simplified flow sheets, one for each individual loop. The report then proceeds to classify each loop into two categories, the 'main loop circuit' and the 'auxiliary circuit', and descriptions are given of each circuit's components in turn. These components, in part, are comprised of the main loop pumps, the test section, loop heaters, loop coolers, delayed-neutron monitors, surge tank, Dowtherm coolers, loop piping. Here again photographs, drawings and tables are included to provide a clearer understanding of the descriptive literature and to include, in tables, some specifications of the more important components in each loop. (author)

  6. Studies on Lyari river effluents

    International Nuclear Information System (INIS)

    Khan, M.A.; Hashmi, I.; Rashid, A.; Niaz, G.R.; Khan, F.

    1999-01-01

    The study was aimed to determining the physical (TS, TSS, TDS, TVS) and chemical (Cl, SO/sub 4/, NH/sub 3/, BOD/sub 5/ COD, DO) characteristics as well as heavy present in the Lyari river effluents so as to identify the extent of pollution. The average results of each parameter of twelve different sites were compared with that of National Environmental Quality Standards (NEQS), BOD/sub 5/ and COD levels were above the NEQS while the NH/sub 3/-N concentration was low. Concentrations of Cd and Zn were within the range while that of Pb, Cr, Ni and Cu were higher than the NEQS at times. This indicates that heavy pollution load is entering into the Arabian Sea creating tremendous harm especially to marine life. (author)

  7. River water quality modelling: II

    DEFF Research Database (Denmark)

    Shanahan, P.; Henze, Mogens; Koncsos, L.

    1998-01-01

    The U.S. EPA QUAL2E model is currently the standard for river water quality modelling. While QUAL2E is adequate for the regulatory situation for which it was developed (the U.S. wasteload allocation process), there is a need for a more comprehensive framework for research and teaching. Moreover......, QUAL2E and similar models do not address a number of practical problems such as stormwater-flow events, nonpoint source pollution, and transient streamflow. Limitations in model formulation affect the ability to close mass balances, to represent sessile bacteria and other benthic processes......, and to achieve robust model calibration. Mass balance problems arise from failure to account for mass in the sediment as well as in the water column and due to the fundamental imprecision of BOD as a state variable. (C) 1998 IAWQ Published by Elsevier Science Ltd. All rights reserved....

  8. Clinch River Environmental Restoration Program

    International Nuclear Information System (INIS)

    Cook, R.B.

    1992-01-01

    This report consists of tables and listings from the results of the Phase I data gathering activities of the Clinch River Environmental Restoration Program (CR-ERP). The table of contents outlines the presentation of the material and has been annotated to indicate the key fields used to order the printing of each data table. Definitions of selected column headings are provided. Sample collection information is shown first and then more specific information for each matrix type is presented. The analytical results have been reviewed by independent validators and the qualifiers shown are the results of their efforts. No data that were rejected by the validation process are included in this listing. Only results of routine samples are listed; quality control sample results were excluded. All data, both detected and nondetected values, were used to calculated the summary table values. However, only Detected values are given on the analyte specific listings

  9. Visualization of Flow Alternatives, Lower Missouri River

    Science.gov (United States)

    Jacobson, Robert B.; Heuser, Jeanne

    2002-01-01

    Background The U.S. Army Corps of Engineers (COE) 'Missouri River Master Water Control Manual' (Master Manual) review has resulted in consideration of many flow alternatives for managing the water in the river (COE, 2001; 1998a). The purpose of this report is to present flow-management alternative model results in a way that can be easily visualized and understood. This report was updated in October 2001 to focus on the specific flow-management alternatives presented by the COE in the 'Master Manual Revised Draft Environmental Impact Statement' (RDEIS; COE, 2001). The original version (February 2000) is available by clicking here. The COE, U.S. Fish and Wildlife Service (FWS), Missouri River states, and Missouri River basin tribes have been participating in discussions concerning water management of the Missouri River mainstem reservoir system (MRMRS), the Missouri River Bank Stabilization and Navigation Project, and the Kansas River reservoir system since 1986. These discussions include general input to the revision of the Master Manual as well as formal consultation under Section 7 of the Endangered Species Act. In 2000, the FWS issued a Biological Opinion that prescribed changes to reservoir management on the Missouri River that were believed to be necessary to preclude jeopardy to three endangered species, the pallid sturgeon, piping plover, and interior least tern (USFWS, 2000). The combined Missouri River system is large and complex, including many reservoirs, control structures, and free-flowing reaches extending over a broad region. The ability to assess future impacts of altered management scenarios necessarily involves complex, computational models that attempt to integrate physical, chemical, biological, and economic effects. Graphical visualization of the model output is intended to improve understanding of the differences among flow-management alternatives.

  10. Are calanco landforms similar to river basins?

    Science.gov (United States)

    Caraballo-Arias, N A; Ferro, V

    2017-12-15

    In the past badlands have been often considered as ideal field laboratories for studying landscape evolution because of their geometrical similarity to larger fluvial systems. For a given hydrological process, no scientific proof exists that badlands can be considered a model of river basin prototypes. In this paper the measurements carried out on 45 Sicilian calanchi, a type of badlands that appears as a small-scale hydrographic unit, are used to establish their morphological similarity with river systems whose data are available in the literature. At first the geomorphological similarity is studied by identifying the dimensionless groups, which can assume the same value or a scaled one in a fixed ratio, representing drainage basin shape, stream network and relief properties. Then, for each property, the dimensionless groups are calculated for the investigated calanchi and the river basins and their corresponding scale ratio is evaluated. The applicability of Hack's, Horton's and Melton's laws for establishing similarity criteria is also tested. The developed analysis allows to conclude that a quantitative morphological similarity between calanco landforms and river basins can be established using commonly applied dimensionless groups. In particular, the analysis showed that i) calanchi and river basins have a geometrically similar shape respect to the parameters Rf and Re with a scale factor close to 1, ii) calanchi and river basins are similar respect to the bifurcation and length ratios (λ=1), iii) for the investigated calanchi the Melton number assumes values less than that (0.694) corresponding to the river case and a scale ratio ranging from 0.52 and 0.78 can be used, iv) calanchi and river basins have similar mean relief ratio values (λ=1.13) and v) calanchi present active geomorphic processes and therefore fall in a more juvenile stage with respect to river basins. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. 76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-05

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  12. 76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-26

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  13. Conservation genetics of the vulnerable Treur River barb, Barbus ...

    African Journals Online (AJOL)

    At present there are only two populations of the vulnerable Treur River barb, Barbus treurensis, in existence; a founder population in the upper Blyde River and a translocated population in the Treur River where the species became extinct. The translocated population was derived from individuals from the upper Blyde River ...

  14. Projected future runoff of the Breede River under climate change ...

    African Journals Online (AJOL)

    The Breede River is the largest river in the Western Cape Province of South Africa, and as such, is a key resource for a variety of activities within the region. It is this significance of the river that prompted a study into the impact of climate change on future runoff in the river and hence, the potential impacts a projected change ...

  15. 27 CFR 9.208 - Snake River Valley.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Snake River Valley. 9.208... Snake River Valley. (a) Name. The name of the viticultural area described in this section is “Snake River Valley”. For purposes of part 4 of this chapter, “Snake River Valley” is a term of viticultural...

  16. Quantifying flooding regime in floodplain forests to guide river restoration

    Science.gov (United States)

    Christian O. Marks; Keith H. Nislow; Francis J. Magilligan

    2014-01-01

    Determining the flooding regime needed to support distinctive floodplain forests is essential for effective river conservation under the ubiquitous human alteration of river flows characteristic of the Anthropocene Era. At over 100 sites throughout the Connecticut River basin, the largest river system in New England, we characterized species composition, valley and...

  17. An assessment of water quality of Angaw River in Southeastern ...

    African Journals Online (AJOL)

    Physico-chemical and bacteriological water quality of the Angaw river were investigated at three different locations on the river. A range of water quality variables were measured in the river over a period of 12 months. The river was characterized by high ionic content. Relatively higher levels of ionic constituents occurred at ...

  18. 27 CFR 9.47 - Hudson River Region.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Hudson River Region. 9.47... Hudson River Region. (a) Name. The name of the viticultural area described in this section is “Hudson River Region.” (b) Approved maps. The approved maps for determining the boundaries of Hudson River...

  19. Rapid River Hatchery - Spring Chinook, Final Report

    International Nuclear Information System (INIS)

    Watson, M.

    1996-05-01

    This report presents the findings of the independent audit of the Rapid River Hatchery (Spring Chinook). The hatchery is located in the lower Snake River basin near Riggins Idaho. The hatchery is used for adult collection, egg incubation, and rearing of spring chinook. The audit was conducted in April 1996 as part of a two-year effort that will include 67 hatcheries and satellite facilities located on the Columbia and Snake River system in Idaho, Oregon, and Washington. The hatchery operating agencies include the US Fish and Wildlife Service, Idaho Department of Fish and Game, Oregon Department of Fish and Wildlife, and Washington Department of Fish and Wildlife

  20. Raft River Geothermal Aquaculture Experiment. Phase II

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, D.K.; Rose, F.L.; Kent, J.C.; Watson, L.R.; Sullivan, J.F.

    1979-08-01

    Channel catfish, tilapia and Malaysian prawns were cultured directly in geothermal water for approximately seven months at the Department of Energy, Raft River Geothermal Site, to evaluate the organisms throughout a grow-out cycle. Parameters evaluated included survival, growth, bioaccumulation of metals and fluoride, collagen synthesis, and bone calcium levels. Growth at Raft River was slightly lower than at a companion commercial facility at Buhl, Idaho, but was attributed to facility differences rather than an adverse impact of geothermal water. No significant differences were recorded between Raft River and Buhl fish for bone calcium or collagen concentrations. No significant accumulation of heavy metals by fish or prawns was recorded.

  1. Savannah River waste management program plan

    International Nuclear Information System (INIS)

    1980-04-01

    This document provides the program plan as requested by the Savannah River Operations Office of the Department of Energy. The plan was developed to provide a working knowledge of the nature and extent of the waste management programs being undertaken by Savannah River contractors for the Fiscal Year 1980. In addition, the document projects activities for several years beyond 1980 to adequately plan for safe handling and storage of radioactive wastes generated at Savannah River, for developing technology to immobilize high-level radioactive wastes generated and stored at SR, and for developing technology for improved management of low-level solid wastes

  2. Aquatic macroinvertebrates of the Jablanica river, Serbia

    Directory of Open Access Journals (Sweden)

    Stefanović Katarina S.

    2009-01-01

    Full Text Available Research on the community of aquatic macroinvertebrates was carried out during 2005 and 2006 at four sampling sites along the Jablanica River, a right-hand tributary of the Kolubara River. Fifty-seven taxa were recorded in the course of the investigation. The most diverse group was Ephemeroptera, followed by Trichoptera and Plecoptera. Members of the Rhitrogena semicolorata group were the most abundant. Our results could be the basis for evaluation of the influence of damming of the Jablanica River on the status of its water and can serve as a model for studying the influ­ence of hydromorphological degradation of aquatic ecosystems.

  3. Thermal effects on the Savannah River

    International Nuclear Information System (INIS)

    Patrick, R.

    1981-01-01

    The effects of thermal effluents from the Savannah River Plant (SRP), particularly during periods when the L Reactor was operative, on the structure and health of the aquatic communities of organisms in the Savannah River have been determined. Portions of the data base collected by the Academy of Natural Sciences since 1951 on the Savannah River were used. The organisms belonging to various groups of aquatic life were identified to species if possible. The relative abundance of the species was estimated for the more common species. The bacteriological, chemical and physical characteristics of the water were determined

  4. Lindane residues in fish inhabiting Nigerian rivers

    International Nuclear Information System (INIS)

    Okereke, G.U.; Dje, Y.

    1997-01-01

    Analysis for residues of lindane in fish collected from various rivers close to rice agroecosystems showed that the concentrations of lindane ranged from none detectable to 3.4 mg kg -1 . Fish from rivers where strict regulations prohibits its use had no detectable lindane residues while appreciable amounts of lindane were found in fish were such restriction was not enforced with the variation attributed to the extent of use of lindane in the area of contamination. The investigation confirms that the use of lindane in rice production in Nigeria can cause the contamination of fish in nearby rivers. (author). 16 refs, 2 tab

  5. Transit time measurement of Juqueri river waters

    International Nuclear Information System (INIS)

    Plata Bedmar, E.; Garcia A, E.; Albuquerque, A.M. de; Sanchez, W.

    1975-01-01

    The time of travel of the Juqueri River water through the east branch of the Pirapora Reservoir was measured using radioactive tracers (6 Ci 131 I in Kl Solution). The changes in Juqueri River flow rate were also measured during the run. The center of mass of the radioactive cloud was used for the time of travel calculations. Six measurements of the Juqueri River flow rate were perfomed in different days, using the total count method. Fifty, millicuries of 131 I were used in each run. The results of time travel obtained under non-steady conditions, and their correction for steady state are also discussed

  6. Geodetic monitoring of suspended particles in rivers

    Science.gov (United States)

    Kamnik, Rok; Maksimova, Daria; Kovačič, Boštjan

    2017-10-01

    There is a trend in modern approach to the management of space of collecting the spatial data, in order to obtain useful information. In this paper a research of suspended particles in the river Drava and Mura will be introduced. The goal is to connect different fields of water management in countries where the rivers Drava and Mura flows in purpose of water management sustainability. The methods such as GNSS for mapping cross sections of the river, the use of ADCP (Acoustic Doppler Current Profiler) measurement system and water sampling to monitor sediment in the water will be presented.

  7. Landuse Types within Channel Corridor and River Channel Morphology of River Ona, Ibadan, Nigeria

    Directory of Open Access Journals (Sweden)

    Olutoyin Fashae

    2017-12-01

    Full Text Available The importance of river a corridor warrants a well thought out and balanced management approach because it helps in improving or maintaining water quality, protecting wetlands, etc. Hence, this study seeks to identify major landuse types within the River Ona Corridor; examine the impact of these landuse types within the River Ona corridor on its channel morphology and understand the risk being posed by these landuse types. The study is designed by selecting two reaches of six times the average width from each of the four major landuse types that exist along the river corridor. This study revealed that along the downstream section of Eleyele Dam of River Ona, natural forest stabilizes river channel banks, thereby presenting a narrow and shallow width and depth respectively but the widest of all is found at the agricultural zones.

  8. Tritium in the Savannah River Estuary and adjacent marine waters

    International Nuclear Information System (INIS)

    Hayes, D.W.

    1978-01-01

    The tritium distribution in the Savannah River estuary and adjacent marine waters was measured to provide information on the dilution, mixing, and movement of Savannah River water in this region. The Savannah River marine region was chosen because the average tritium concentration in this river is 5 pCi/ml, whereas other rivers in the southeastern United States average less than 0.5 pCi/ml. The increased tritium concentration in the Savannah River is due to releases from the Savannah River Plant of the Department of Energy. Tritium measurements have proved particularly effective in estimating the flushing time of the Savannah River estuary (2.4 days) and in delineating the relative contribution to the water masses in Ossabaw and Port Royal Sounds from the River and from sea water. Ossabaw and Port Royal Sounds are located approximately 20 km south and north of the Savannah River estuary, respectively

  9. Tritium in the Savannah River estuary and adjacent marine waters

    International Nuclear Information System (INIS)

    Hayes, D.W.

    1979-01-01

    The tritium distribution in the Savannah River estuary and adjacent marine waters was measured to provide information on the dilution, mixing and movement of Savannah River water in this region. The Savannah River marine region was chosen because the average tritium concentration in this river is approximately 5 pCi/ml, whereas other rivers in the southeastern United States of America average less than 0.5 pCi/ml. The increased tritium concentration in the Savannah River is due to releases from the Savannah River Plant of the Department of Energy. Tritium measurements have proved particularly effective in estimating the flushing time of the Savannah River estuary (2.4 days) and in delineating the relative contribution to the water masses in Ossabaw and Port Royal Sounds from the river and from sea-water. Ossabaw and Port Royal Sounds are located approximately 20 km south and north of the Savannah River estuary respectively. (author)

  10. Phenomena and characteristics of barrier river reaches in the middle and lower Yangtze River, China

    Science.gov (United States)

    You, Xingying; Tang, Jinwu

    2017-06-01

    Alluvial river self-adjustment describes the mechanism whereby a river that was originally in an equilibrium state of sediment transport encounters some disturbance that destroys the balance and results in responses such as riverbed deformation. A systematic study of historical and recent aerial photographs and topographic maps in the Middle and Lower Reaches of the Yangtze River (MLYR) shows that river self-adjustment has the distinguishing feature of transferring from upstream to downstream, which may affect flood safety, waterway morphology, bank stability, and aquatic environmental safety over relatively long reaches downstream. As a result, it is necessary to take measures to control or block this transfer. Using the relationship of the occurrence time of channel adjustments between the upstream and downstream, 34 single-thread river reaches in the MLYR were classified into four types: corresponding, basically corresponding, basically not corresponding, not corresponding. The latter two types, because of their ability to prevent upstream channel adjustment from transferring downstream, are called barrier river reaches in this study. Statistics indicate that barrier river reaches are generally single thread and slightly curved, with a narrow and deep cross-sectional morphology, and without flow deflecting nodes in the upper and middle parts of reaches. Moreover, in the MLYR, barrier river reaches have a hydrogeometric coefficient of {}1.2‱, a silty clay content of the concave bank {>}{9.5}%, and a median diameter of the bed sediment {>}{0.158} mm. The barrier river reach mechanism lies in that can effectively centralise the planimetric position of the main stream from different upstream directions, meaning that no matter how the upper channel adjusts, the main stream shows little change, providing relatively stable inflow conditions for the lower reaches. Regarding river regulation, it is necessary to optimise the benefits of barrier river reaches; long river

  11. 50 CFR Table 3 to Part 226 - Hydrologic Units Containing Critical Habitat for Snake River Sockeye Salmon and Snake River...

    Science.gov (United States)

    2010-10-01

    ... Habitat for Snake River Sockeye Salmon and Snake River Spring/Summer and Fall Chinook Salmon 3 Table 3 to... Part 226—Hydrologic Units Containing Critical Habitat for Snake River Sockeye Salmon and Snake River... Snake—Asotin 17060103 17060103 17060103 Upper Grande Ronde 17060104 Wallowa 17060105 Lower Grande Ronde...

  12. Combining integrated river modelling and agent based social simulation for river management; The case study of the Grensmaas project

    NARCIS (Netherlands)

    Valkering, P.; Krywkow, Jorg; Rotmans, J.; van der Veen, A.; Douben, N.; van Os, A.G.

    2003-01-01

    In this paper we present a coupled Integrated River Model – Agent Based Social Simulation model (IRM-ABSS) for river management. The models represent the case of the ongoing river engineering project “Grensmaas”. In the ABSS model stakeholders are represented as computer agents negotiating a river

  13. Trace elements and radionuclides in the Connecticut River and Amazon River estuary

    International Nuclear Information System (INIS)

    Dion, E.P.

    1983-01-01

    The Connecticut River, its estuary, and the Amazon River estuary were studied to elucidate some of the processes which control river water chemistry and the flux of elements to the sea. The approach taken was to identify inputs to the Connecticut River and to investigate geochemical processes which modify the dissolved load. The form and quantity of nuclides which are in turn supplied to the estuary are altered by processes unique to that transition zone to the ocean. The Connecticut River estuary was sampled on a seasonal basis to investigate the role of the estuary in controlling the flux of elements to the sea. The knowledge gained from the Connecticut River study was applied to the quantitatively more significant Amazon River estuary. There a variety of samples were analyzed to understand the processes controlling the single greatest flux of elements to the Atlantic Ocean. The results indicate that estimates of the total flux of nuclides to the oceans can best be calculated based on groundwater inputs. Unless significant repositories for nuclides exist in the river-estuarine system, the groundwater flux of dissolved nuclides is that which will eventually be delivered to the ocean despite the reactions which were shown to occur in both rivers and estuaries. 153 references, 63 figures, 28 tables

  14. Contribution of River Mouth Reach to Sediment Load of the Yangtze River

    Directory of Open Access Journals (Sweden)

    C. Wang

    2015-01-01

    Full Text Available This paper examined the sediment gain and loss in the river mouth reach of the Yangtze River by considering sediment load from the local tributaries, erosion/accretion of the river course, impacts of sand mining, and water extraction. A quantitative estimation of the contribution of the river mouth reach to the sediment load of the Yangtze River was conducted before and after impoundment of the Three Gorges Dam (TGD in 2003. The results showed that a net sediment load loss of 1.78 million ton/yr (Mt/yr occurred from 1965 to 2002 in the study area. The contribution of this reach to the sediment discharge into the sea is not as high as what was expected before the TGD. With impoundment of the TGD, channel deposition (29.90 Mt/yr and a net sediment loss of 30.89 Mt/yr occurred in the river mouth reach from 2003 to 2012. The river mouth reach has acted as a sink but not a source of sediment since impoundment of the TGD, which has exacerbated the decrease in sediment load. Technologies should be advanced to measure changes in river channel morphology, as well as in water and sediment discharges at the river mouth reach.

  15. River Data Package for the 2004 Composite Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Rakowski, Cynthia L.; Guensch, Gregory R.; Patton, Gregory W.

    2004-08-01

    Beginning in fiscal year 2003, the DOE Richland Operations Office initiated activities, including the development of data packages, to support the 2004 Composite Analysis. The river data package provides calculations of flow and transport in the Columbia River system. This document presents the data assembled to run the river module components for the section of the Columbia River from Vernita Bridge to the confluence with the Yakima River.

  16. Emergency response capability for pollutant releases to streams and rivers

    International Nuclear Information System (INIS)

    Buckner, M.R.; Hayes, D.W.; Watts, J.R.

    1975-01-01

    Stream-river models have been developed which provide an accurate prediction of normal and accidental pollutant releases to streams and rivers. Stream parameters are being developed for the Savannah River Plant streams and the Savannah River to allow quick response in case of an accidental release of radioactive material. These data are stored on permanent disk storage for quick access via the JOSHUA operating system. This system provides an efficient and flexible emergency response capability for pollutant releases to streams and rivers

  17. Delaware River and Upper Bay Sediment Data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The area of coverage consists of 192 square miles of benthic habitat mapped from 2005 to 2007 in the Delaware River and Upper Delaware Bay. The bottom sediment map...

  18. Columbia River ESI: INVERT (Invertebrate Polygons)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains sensitive biological resource data for clams, oysters, crabs, and other invertebrate species in Columbia River. Vector polygons in this data...

  19. Climate influences on upper Limpopo River flow

    African Journals Online (AJOL)

    2016-01-01

    Jan 1, 2016 ... Keywords: Limpopo Valley, hydro-meteorology, surface water deficit. * To whom all ... millenia and there is a history of drought impacts on vegetation. (Ekblom et ... water budget of the upper Limpopo River valley using direct.

  20. the left bank of the Rimac river

    International Development Research Centre (IDRC) Digital Library (Canada)

    The Focus City Research Initiative (FCRI) is a series of eight action research ... Reducing physical vulnerability of residents ... physically (along the edge of the Rimac river, on the .... the topic of disaster risk management and vulnerability.

  1. DNR 100K Lakes and Rivers

    Data.gov (United States)

    Minnesota Department of Natural Resources — Polygons representing hydrographic features (lakes, ponds, some rivers, and open water areas) originating from the USGS 1:100,000 (100K)DLG (Digital Line Graph)...

  2. Hydro energetic inventory study from Chapecozinho river

    International Nuclear Information System (INIS)

    Pimenta, S.C.; Sureck, M.A.A.; Nascimento, P.R.; Kawasaki, M.; Silva Felipe, R. da.

    1990-01-01

    The Hydro energetic Inventory Study in Chapecozinho River Basin, Brazil is described, comparing the proposed results in 1979 with the actual review in 1989. An analysis for solution the socio-economic and environment problems is also presented. (author)

  3. 2015 OLC FEMA Lidar: Snake River, ID

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Quantum Spatial has collected Light Detection and Ranging (LiDAR) data for the Oregon LiDAR Consortium (OLC) Snake River FEMA study area. This study area is located...

  4. Diatom algae of the Guni river (Pamir)

    International Nuclear Information System (INIS)

    Kurbonova, P.A.; Hisoriev, H.H.

    2006-01-01

    There are presented the dates of the results of diatom algae (Bacillariophyta) of the Gunt river. There was found 107 species and 9 subspecies which belong to 3 classics, 12 ordos, 13 families and 28 genus

  5. Columbia River ESI: NESTS (Nest Points)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains sensitive biological resource data for bird nesting sites in the Columbia River area. Vector points in this data set represent locations of...

  6. Ecological flow requirements for South African rivers

    CSIR Research Space (South Africa)

    Ferrar, AA

    1989-01-01

    Full Text Available This document contains the proceedings of a workshop which was convened to debate the ecological flow requirements of South African rivers. Topics which are discussed include the influence of weirs and impoundments, the quantity requirements...

  7. sample data Red River_2011-2013

    Data.gov (United States)

    U.S. Environmental Protection Agency — OK Fish Kill data from Red River 2011-2013. This dataset is associated with the following publication: Jones-Lepp, T., V. Taguchi, W. Sovocool, D. Betowski, P....

  8. Columbia River ESI: FISHL (Fish Lines)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains sensitive biological resource data for anadromous fish species in Columbia River. Vector lines in this data set represent locations of...

  9. Columbia River ESI: FISH (Fish Polygons)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains sensitive biological resource data for marine, estuarine, anadromous, and freshwater fish species in Columbia River. Vector polygons in this...

  10. Heavy metals in Mindhola river estuary, India

    Digital Repository Service at National Institute of Oceanography (India)

    Zingde, M.D.; Rokade, M.A; Mandalia, A

    The heavy metal concentrations are studied along the Mindhola river estuary. Surface and bottom water samples were collected using Niskin Sampler. The sediment samples were collected using a Van Veen grab. The heavy metal concentration is estimated...

  11. Onset in-river conductivity sonde data

    Data.gov (United States)

    U.S. Environmental Protection Agency — Onset HOBO Model U24-01 in-river sondes were deployed to measure water temperature and electrical conductivity at each of the ISCO sampling sites at 5 min intervals....

  12. Channel Restoration Design for Meandering Rivers

    National Research Council Canada - National Science Library

    Soar, Philip

    2001-01-01

    .... A geomorphic engineering approach is presented, which recognizes that the river is ultimately the best restorer of its natural morphology and should be allowed to participate in its own recovery...

  13. Charles River Residual Designation: Executive Summary

    Science.gov (United States)

    Read an executive summary of the Record of Decision's preliminary decision by the Regional Administrator of EPA Region 1 that storm water permits are needed to address serious water quality problems in the Charles River.

  14. Using river locks to teach hydrodynamic concepts

    Science.gov (United States)

    Carvalho-Santos, Vagson L.; Mendes, Thales C.; Silva, Enisvaldo C.; Rios, Márcio L.; Silva, Anderson A. P.

    2013-11-01

    In this work, the use of a river lock as a non-formal setting for teaching hydrodynamical concepts is proposed. In particular, we describe the operation of a river lock situated at the Sobradinho dam, on the São Francisco River (Brazil). A model to represent and to analyse the dynamics of river lock operation is presented and we derive the dynamical equations for the rising of the water column as an example to understand the Euler equation. Furthermore, with this activity, we enable the integration of content initially introduced in the classroom with practical applications, thereby allowing the association of physical themes to content relevant in disciplines such as history and geography. In addition, experiences of this kind enable teachers to talk about the environmental and social impacts caused by the construction of a dam and, consequently, a crossover of concepts has been made possible, leading to more meaningful learning for the students.

  15. Anthropogenic impacts on global organic river pollution

    NARCIS (Netherlands)

    Wen, Y.

    2017-01-01

    Organic pollution of rivers by wastewater discharge from human activities negatively impacts people and ecosystems. Without treatment, pollution control relies on a combination of natural degradation and dilution by natural runoff to reduce downstream effects. To implement integrated water

  16. Implementing Integrated River Basin Management in China

    Directory of Open Access Journals (Sweden)

    Dorri G. J. te Boekhorst

    2010-06-01

    Full Text Available This paper examines the role of the World Wildlife Fund for Nature China as policy entrepreneur in China. It illustrates the ways in which the World Wildlife Fund for Nature is active in promoting integrated river basin management in the Yangtze River basin and how the efforts at basin level are matched with the advice of the China Council for International Cooperation on Environment and Development task force on integrated river basin management to the national government of China. This article demonstrates that the World Wildlife Fund for Nature uses various strategies of different types to support a transition process towards integrated river basin management. Successful deployment of these strategies for change in environmental policy requires special skills, actions, and attitudes on the part of the policy entrepreneur, especially in China, where the government has a dominant role regarding water management and the position of policy entrepeneurs is delicate.

  17. Studies of mineralization in South African rivers

    CSIR Research Space (South Africa)

    Hall, GC

    1978-03-01

    Full Text Available Several South African rivers are polluted by mineral salts of diffuse source. This pollution can be related to geological phenomena and to irrigation practices. Mineralization is problematic in that it can render surface waters unsuitable...

  18. Using river locks to teach hydrodynamic concepts

    International Nuclear Information System (INIS)

    Carvalho-Santos, Vagson L; Mendes, Thales C; Silva, Enisvaldo C; Rios, Márcio L; Silva, Anderson A P

    2013-01-01

    In this work, the use of a river lock as a non-formal setting for teaching hydrodynamical concepts is proposed. In particular, we describe the operation of a river lock situated at the Sobradinho dam, on the São Francisco River (Brazil). A model to represent and to analyse the dynamics of river lock operation is presented and we derive the dynamical equations for the rising of the water column as an example to understand the Euler equation. Furthermore, with this activity, we enable the integration of content initially introduced in the classroom with practical applications, thereby allowing the association of physical themes to content relevant in disciplines such as history and geography. In addition, experiences of this kind enable teachers to talk about the environmental and social impacts caused by the construction of a dam and, consequently, a crossover of concepts has been made possible, leading to more meaningful learning for the students. (paper)

  19. Greater nitrogen load in rivers and fjords

    International Nuclear Information System (INIS)

    Kaste, Oeyvind; Engen-Skaugen, Torill

    2005-01-01

    The article presents results from river and fjord climate simulations. Climatic changes may be amplified by hydrologic, water chemical and biologic systems. Connecting model systems, interpreting results and uncertainties are discussed

  20. Savannah River Site Environmental Report for 1997

    Energy Technology Data Exchange (ETDEWEB)

    Arnett, M.W.; Mamatey, A.R. [eds.

    1998-08-01

    The mission at the Savannah River Site has changed from the production of nuclear weapons materials for national defense to the management of waste, restoration of the environment, and the development of industry in and around the site.

  1. Advanced separations at Savannah River Site

    International Nuclear Information System (INIS)

    Thompson, M.; McCabe, D.

    1996-01-01

    The Savannah River Site (SRS) has many waste streams that are contaminated with radionuclides and/or hazardous materials that must be treated to remove the radioactivity (cesium, strontium, tritium, actinides) and hazardous components (polychlorinated biphenyls (PCBs), cyanide, metal ions)

  2. Savannah River Site Environmental Report for 1997

    International Nuclear Information System (INIS)

    Arnett, M.W.; Mamatey, A.R.

    1998-01-01

    The mission at the Savannah River Site has changed from the production of nuclear weapons materials for national defense to the management of waste, restoration of the environment, and the development of industry in and around the site

  3. Hudson River Sub-Bottom Profile Points

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Hudson River Estuary Shallow Water Surveys. Subbottom Profile Points. Subbottom data was collected November 5 to December 15, 2009, in the estuary north from...

  4. Cover Art: River's Edge: Downward, Outward, Upward

    Directory of Open Access Journals (Sweden)

    Jonee Kulman Brigham

    2017-10-01

    Full Text Available Artist's Statement for the cover art of IJPS volume 4, issue 3: River's Edge: Downward, Outward, Upward, 2015. Mixed Media: photograph, inkjet printed on presentation matte of colored pencil over photograph.

  5. Columbia River ESI: MGT (Management Area Polygons)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains sensitive human-use data for Wildlife Refuges, National Forests, and State Parks for the Columbia River area. Vector polygons in this data set...

  6. Assessing river health in Europe and Switzerland

    Science.gov (United States)

    Milano, Marianne; Chèvre, Nathalie; Reynard, Emmanuel

    2017-04-01

    River conditions and welfare of aquatic ecosystems are threatened by anthropogenic and climatic changes. The release of personal-care products, pharmaceuticals and crop protection products is increasing and climate change is likely to cause significant changes in hydrological regimes affecting water resources' capacity to dissolve pollutants. Assessing river health, i.e. the ability of a river to support and maintain a balanced ecosystem close to the natural habitat, is thus of major concern to ensure the development of ecosystems and to provide enough clean useable water to users. Such studies involve physical, chemical and biological processes and characteristics. In Europe and Switzerland, standardized procedures have been developed to assess the hydromorphological, ecological and toxicological status of rivers. The European Water Framework Directive sets ecological requirements and chemical guidelines while the Swiss Modular Stepwise Procedure suggests methods to apprehend ecological deficits and promote water management plans. In this study, both procedures were applied and compared in order (i) to address their capacity to follow-up the spatial and temporal variability of the river's water quality and (ii) to identify challenges that still need to be addressed to assess river's health. Applied on the Boiron River (canton of Vaud, Switzerland) for a 11-year period (2005-2015), both frameworks highlight that no section of the river currently meets a good environmental state. This river flows through a diversified agricultural area causing a progressive deterioration of its chemical and biological quality. The two methods also identify two periods of time with significant changes of the river's water quality. The 2009-2011 period is characterized by a significant deterioration of the river's ecological and toxicological state due to severe low flows and an increased use of pesticides. However, since 2013, an improvement in water quality is identified in

  7. Groundwater controls on river channel pattern

    Science.gov (United States)

    Bätz, Nico; Colombini, Pauline; Cherubini, Paolo; Lane, Stuart N.

    2017-04-01

    Braided rivers are characterized by high rates of morphological change. However, despite the potential for frequent disturbance, vegetated patches may develop within this system and influence long-term channel dynamics and channel patterns through the "engineering effects" of vegetation. The stabilizing effect of developing vegetation on morphological change has been widely shown by flume experiments and (historic) aerial pictures analysis. Thus, there is a balance between disturbance and stabilization, mediated through vegetation, that may determine the long-term geomorphic and biogeomorphic evolution of the river. It follows that with a change in disturbance frequency relative to the rate of vegetation establishment, a systematic geomorphological shift could occur. Research has addressed how changes in disturbance frequency affect river channel pattern, but has rarely addressed the way in which the stabilizing effects of biogeomorphic succession interact with disturbance frequency to maintain a river in a more dynamic or a less dynamic state. Here, we quantify how the interplay between groundwater access, disturbance frequency and vegetation succession, drive changes in channel pattern. We studied this complex interplay on a transitional gravel-bed river system (braided, wandering, meandering) close to Geneva (Switzerland) - the Allondon River. Dendroecological analysis demonstrate that vegetation growth is driven by groundwater access. Groundwater access conditions the rate of vegetation stabilization at the sub-reach scale and, due to a reduction in flood-related disturbance frequency over the last 50 years, drives a change in channel pattern. Where groundwater is shallower, vegetation encroachment rates were high and as flood-related disturbance decreased, the river has shifted towards a meandering state. Where groundwater was deeper, vegetation growth was limited by water-access and thus vegetation encroachment rates were low. Even though there was a

  8. Susquehanna River Basin Flood Control Review Study

    Science.gov (United States)

    1980-08-01

    and made recommendations for an intergrated water plan for the Basin and included a specific Early Action Plan. Concerning flood damage reduction, the...transportation and by agriculture as a source of income and occupation. The river served as a source of transportation for trade and commerce and also as a... trade patterns, and labor market areas. The Susquehanna River Basin is largely comprised of BEA economic areas 011, 012, 013, and 016. Figure II shows the

  9. Recent solvent extraction experience at Savannah River

    International Nuclear Information System (INIS)

    Gray, L.W.; Burney, G.A.; Gray, J.H.; Hodges, M.E.; Holt, D.L.; Macafee, I.M.; Reif, D.J.; Shook, H.E.

    1986-01-01

    Tributyl phosphate-based solvent extraction processes have been used at Savannah River for more than 30 years to separate and purify thorium, uranium, neptunium, plutonium, americium, and curium isotopes. This report summarizes the advancement of solvent extraction technology at Savannah River during the 1980's. Topics that are discussed include equipment improvements, solvent treatment, waste reduction, and an improved understanding of the various chemistries in the process streams entering, within, and leaving the solvent extraction processes

  10. The fusion blanket program at Chalk River

    International Nuclear Information System (INIS)

    Hastings, I.J.

    1986-03-01

    Work on the Fusion Blanket Program commenced at Chalk River in 1984 June. Co-funded by Canadian Fusion Fuels Technology Project and Atomic Energy of Canada Limited, the Program utilizes Chalk River expertise in instrumented irradiation testing, ceramics, tritium technology, materials testing and compound chemistry. This paper gives highlights of studies to date on lithium-based ceramics, leading contenders for the fusion blanket

  11. Morphology of Tigris River within Baghdad City

    Directory of Open Access Journals (Sweden)

    A. A. Ali

    2012-10-01

    Full Text Available In recent years, substantial changes have occurred in the morphology of the River Tigris within Baghdad City. Although huge volumes of sediment are being trapped in recently constructed headwater reservoirs, the number of islands in the Tigris at Baghdad is increasing. The debris of bridges destroyed in the wars of 1991 and 2003 and their subsequent reconstruction have enhanced the development of these islands. As a consequence the ability of the river to carry the peaks of flood waters has been reduced. This has led to potential increase of flooding in parts of the city.

    The bed of the River Tigris has been surveyed on three occasions (1976, 1991, and 2008. The most recent survey was conducted by the Ministry of Water Resources, extended 49 km from the Al-Muthana Bridge north Baghdad to the confluence with the Diyala River south Baghdad. It yielded cross-section profiles at 250 m intervals. The data are used to predict the maximum flood capacity for the river using the one-dimensional hydraulic model for steady flow "HEC-RAS" modeling. Calibration of the model was carried out using field measurements for water levels along the last 15 km of the reach and the last 10 yr of observation at the Sarai Baghdad gauging station.

    The model showed a significant predicted reduction in the current river capacity below that which the river had carried during the floods of 1971 and 1988. The three surveys conducted on the same reach of the Tigris indicated that the ability of the river to transport water has decreased.

  12. Salmon River Habitat Enhancement. 1990 Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    Rowe, Mike

    1991-12-01

    The annual report contains three individual subproject sections detailing tribal fisheries work completed during the summer and fall of 1990. Subproject I contains summaries of evaluation/monitoring efforts associated with the Bear Valley Creek, Idaho enhancement project. Subproject II contains an evaluation of the Yankee Fork of the Salmon River habitat enhancement project. Subproject III concerns the East Fork of the Salmon River, Idaho.

  13. Transport on river networks: A dynamical approach

    OpenAIRE

    Zaliapin, I; Foufoula-Georgiou, E; Ghil, M

    2017-01-01

    This study is motivated by problems related to environmental transport on river networks. We establish statistical properties of a flow along a directed branching network and suggest its compact parameterization. The downstream network transport is treated as a particular case of nearest-neighbor hierarchical aggregation with respect to the metric induced by the branching structure of the river network. We describe the static geometric structure of a drainage network by a tree, referred to as...

  14. Columbia River Component Data Gap Analysis

    Energy Technology Data Exchange (ETDEWEB)

    L. C. Hulstrom

    2007-10-23

    This Data Gap Analysis report documents the results of a study conducted by Washington Closure Hanford (WCH) to compile and reivew the currently available surface water and sediment data for the Columbia River near and downstream of the Hanford Site. This Data Gap Analysis study was conducted to review the adequacy of the existing surface water and sediment data set from the Columbia River, with specific reference to the use of the data in future site characterization and screening level risk assessments.

  15. Climate change characteristics of Amur River

    Directory of Open Access Journals (Sweden)

    Lan-lan YU

    2013-04-01

    Full Text Available Unusually severe weather is occurring more frequently due to global climate change. Heat waves, rainstorms, snowstorms, and droughts are becoming increasingly common all over the world, threatening human lives and property. Both temperature and precipitation are representative variables usually used to directly reflect and forecast the influences of climate change. In this study, daily data (from 1953 to 1995 and monthly data (from 1950 to 2010 of temperature and precipitation in five regions of the Amur River were examined. The significance of changes in temperature and precipitation was tested using the Mann-Kendall test method. The amplitudes were computed using the linear least-squares regression model, and the extreme temperature and precipitation were analyzed using hydrological statistical methods. The results show the following: the mean annual temperature increased significantly from 1950 to 2010 in the five regions, mainly due to the warming in spring and winter; the annual precipitation changed significantly from 1950 to 2010 only in the lower mainstream of the Amur River; the frequency of extremely low temperature events decreased from 1953 to 1995 in the mainstream of the Amur River; the frequency of high temperature events increased from 1953 to 1995 in the mainstream of the Amur River; and the frequency of extreme precipitation events did not change significantly from 1953 to 1995 in the mainstream of the Amur River. This study provides a valuable theoretical basis for settling disputes between China and Russia on sustainable development and utilization of water resources of the Amur River.

  16. Migration of radionuclides through a river system

    Energy Technology Data Exchange (ETDEWEB)

    Matsunaga, Takeshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1999-03-01

    Migration behavior of several atmospherically-derived radionuclides in a river watershed was studied. A main interest was in their relocation from the ground soil of the watershed to a downstream region through a river. Studied radionuclides are: {sup 137}Cs generated by weapon tests in the atmosphere; {sup 210}Pb and {sup 7}Be of naturally occurring radionuclides; {sup 137}Cs, {sup 90}Sr, {sup 239,240}Pu and {sup 241}Am released by the Chernobyl nuclear power plant accident. Dominance of the form in suspended solid in river water (particulate form) was qualified for the radionuclides in the Kuji river watershed. An importance of discharge in flooding was also confirmed. A historical budget analysis for weapon test derived {sup 137}Cs was presented for the Hi-i river watershed and its accompanied lake sediment (Lake Shinji). The work afforded a scheme of a fate of {sup 137}Cs after falling on the ground soil and on the lake surface. Several controlling factors, which can influence on the chemical form of radionuclides discharged to a river, were also investigated in the vicinity of the Chernobyl nuclear power plant. A special attention was paid on the association of the radionuclides with dissolved species in water. Preferential association of Pu and Am isotopes to a large molecular size of dissolved matrices, probably of humic substances, was suggested. (author)

  17. In Brief: Improving Mississippi River water quality

    Science.gov (United States)

    Showstack, Randy

    2007-10-01

    If water quality in the Mississippi River and the northern Gulf of Mexico is to improve, the U.S. Environmental Protection Agency (EPA) needs to take a stronger leadership role in implementing the federal Clean Water Act, according to a 16 October report from the U.S. National Research Council. The report notes that EPA has failed to use its authority to coordinate and oversee activities along the river. In addition, river states need to be more proactive and cooperative in efforts to monitor and improve water quality, and the river should be monitored and evaluated as a single system, the report indicates. Currently, the 10 states along the river conduct separate and widely varying water quality monitoring programs. ``The limited attention being given to monitoring and managing the Mississippi's water quality does not match the river's significant economic, ecological, and cultural importance,'' said committee chair David A. Dzombak, director of the Steinbrenner Institute for Environmental Education and Research at Carnegie Mellon University, Pittsburgh, Pa. The report notes that while measures taken under the Clean Water Act have successfully reduced much point source pollution, nutrient and sediment loads from nonpoint sources continue to be significant problems. For more information, visit the Web site: http://books.nap.edu/catalog.php?record_id=12051.

  18. The Columbia River System : the Inside Story.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration.

    1991-09-01

    The Columbia Ricer is one of the greatest natural resources in the western United States. The river and its tributaries touch the lives of nearly every resident of the Northwest-from providing the world-famous Pacific salmon to supplying the clean natural fuel for over 75 percent of the region's electrical generation. Since early in the century, public and private agencies have labored to capture the benefits of this dynamic river. Today, dozens of major water resource projects throughout the region are fed by the waters of the Columbia Basin river system. And through cooperative efforts, the floods that periodically threaten developments near the river can be controlled. This publication presents a detailed explanation of the planning and operation of the multiple-use dams and reservoirs of the Columbia River system. It describes the river system, those who operate and use it, the agreements and policies that guide system operation, and annual planning for multiple-use operation.

  19. Hydrogeochemical characteristics of the River Idrijca (Slovenia

    Directory of Open Access Journals (Sweden)

    Tjaša Kanduč

    2008-06-01

    Full Text Available The hydrogeochemical and isotope characteristics of the River Idrijca, Slovenia, where the world’s second largest mercury (Hg mine is located, were investigated. The River Idrijca, a typical steep mountain river has an HCO3- - Ca2+ - Mg2+ chemical composition. Its Ca2+/Mg2+ molar ratio indicates that dolomite weathering prevails in the watershed. The River Idrijca and its tributaries are over saturated with respect to calcite and dolomite. The pCO2 pressure is up to 13 times over atmospheric pressure and represents a source of CO2 to the atmosphere. δ18O values in river water indicate primary control from precipitation and enrichment of the heavy oxygen isotope of infiltrating water recharging the River Idrijca from its slopes.The δ13 CDIC values range from −10.8 to −6.6 ‰ and are controlled by biogeochemical processes in terrestrial environments and in the stream: 1 exchange with atmospheric CO2, 2 degradation of organic matter, 3 dissolution of carbonates, and 4 tributaries. The contributions of these inputs were calculated according to steady state equations and are estimated to be -11 %: 19 %: 31 %: 61 % in the autumn and 0 %: 6 %: 9 %: 35 % in the spring sampling seasons.

  20. Bank storage buffers rivers from saline regional groundwater: an example from the Avon River Australia

    Science.gov (United States)

    Gilfedder, Benjamin; Hofmann, Harald; Cartwrighta, Ian

    2014-05-01

    Groundwater-surface water interactions are often conceptually and numerically modeled as a two component system: a groundwater system connected to a stream, river or lake. However, transient storage zones such as hyporheic exchange, bank storage, parafluvial flow and flood plain storage complicate the two component model by delaying the release of flood water from the catchment. Bank storage occurs when high river levels associated with flood water reverses the hydraulic gradient between surface water and groundwater. River water flows into the riparian zone, where it is stored until the flood water recede. The water held in the banks then drains back into the river over time scales ranging from days to months as the hydraulic gradient returns to pre-flood levels. If the frequency and amplitude of flood events is high enough, water held in bank storage can potentially perpetually remain between the regional groundwater system and the river. In this work we focus on the role of bank storage in buffering river salinity levels against saline regional groundwater on lowland sections of the Avon River, Victoria, Australia. We hypothesize that the frequency and magnitude of floods will strongly influence the salinity of the stream water as banks fill and drain. A bore transect (5 bores) was installed perpendicular to the river and were instrumented with head and electrical conductivity loggers measuring for two years. We also installed a continuous 222Rn system in one bore. This data was augmented with long-term monthly EC from the river. During high rainfall events very fresh flood waters from the headwaters infiltrated into the gravel river banks leading to a dilution in EC and 222Rn in the bores. Following the events the fresh water drained back into the river as head gradients reversed. However the bank water salinities remained ~10x lower than regional groundwater levels during most of the time series, and only slightly above river water. During 2012 SE Australia

  1. Fractionation of rare earth elements in the Mississippi River estuary and river sediments

    Science.gov (United States)

    Adebayo, S. B.; Johannesson, K. H.

    2017-12-01

    This study presents the first set of data on the fractionation of rare earth elements (REE) in the mixing zone between the Mississippi River and the Gulf of Mexico, as well as the fractionation of REE in the operationally defined fractions of Mississippi River sediments. This subject is particularly important because the Mississippi river is one of the world's major rivers, and contributes a substantial amount of water and sediment to the ocean. Hence, it is a major source of trace elements to the oceans. The geochemistry of the REE in natural systems is principally important because of their unique chemical properties, which prompt their application as tracers of mass transportation in modern and paleo-ocean environments. Another important consideration is the growth in the demand and utilization of REE in the green energy and technology industries, which has the potential to bring about a change in the background levels of these trace elements in the environment. The results of this study show a heavy REE enrichment of both the Mississippi River water and the more saline waters of the mixing zone. Our data demonstrate that coagulation and removal of REE in the low salinity region of the estuary is more pronounced among the Light REE ( 35% for Nd) compared to the Heavy REE. Remarkably, our data also indicate that REE removal in the Mississippi River estuary is significantly less than that observed in other estuaries, including the Amazon River system. We propose that the high pH/alkalinity of the Mississippi River is responsible for the greater stability of REE in the Mississippi River estuary. The results of sequential extraction of river sediments reveal different Sm/Nd ratios for the various fractions, which we submit implies different 143Nd/144Nd ratios of the labile fractions of the sediments. The possible impact of such hypothesized different Nd isotope signatures of labile fractions of the river sediments on Gulf of Mexico seawater is under investigation.

  2. Measuring river from the cloud - River width algorithm development on Google Earth Engine

    Science.gov (United States)

    Yang, X.; Pavelsky, T.; Allen, G. H.; Donchyts, G.

    2017-12-01

    Rivers are some of the most dynamic features of the terrestrial land surface. They help distribute freshwater, nutrients, sediment, and they are also responsible for some of the greatest natural hazards. Despite their importance, our understanding of river behavior is limited at the global scale, in part because we do not have a river observational dataset that spans both time and space. Remote sensing data represent a rich, largely untapped resource for observing river dynamics. In particular, publicly accessible archives of satellite optical imagery, which date back to the 1970s, can be used to study the planview morphodynamics of rivers at the global scale. Here we present an image processing algorithm developed using the Google Earth Engine cloud-based platform, that can automatically extracts river centerlines and widths from Landsat 5, 7, and 8 scenes at 30 m resolution. Our algorithm makes use of the latest monthly global surface water history dataset and an existing Global River Width from Landsat (GRWL) dataset to efficiently extract river masks from each Landsat scene. Then a combination of distance transform and skeletonization techniques are used to extract river centerlines. Finally, our algorithm calculates wetted river width at each centerline pixel perpendicular to its local centerline direction. We validated this algorithm using in situ data estimated from 16 USGS gauge stations (N=1781). We find that 92% of the width differences are within 60 m (i.e. the minimum length of 2 Landsat pixels). Leveraging Earth Engine's infrastructure of collocated data and processing power, our goal is to use this algorithm to reconstruct the morphodynamic history of rivers globally by processing over 100,000 Landsat 5 scenes, covering from 1984 to 2013.

  3. Development of river flood model in lower reach of urbanized river basin

    Science.gov (United States)

    Yoshimura, Kouhei; Tajima, Yoshimitsu; Sanuki, Hiroshi; Shibuo, Yoshihiro; Sato, Shinji; Lee, SungAe; Furumai, Hiroaki; Koike, Toshio

    2014-05-01

    Japan, with its natural mountainous landscape, has demographic feature that population is concentrated in lower reach of elevation close to the coast, and therefore flood damage with large socio-economic value tends to occur in low-lying region. Modeling of river flood in such low-lying urbanized river basin is complex due to the following reasons. In upstream it has been experienced urbanization, which changed land covers from natural forest or agricultural fields to residential or industrial area. Hence rate of infiltration and runoff are quite different from natural hydrological settings. In downstream, paved covers and construct of sewerage system in urbanized areas affect direct discharges and it enhances higher and faster flood peak arrival. Also tidal effect from river mouth strongly affects water levels in rivers, which must be taken into account. We develop an integrated river flood model in lower reach of urbanized areas to be able to address above described complex feature, by integrating model components: LSM coupled distributed hydrological model that models anthropogenic influence on river discharges to downstream; urban hydrological model that simulates run off response in urbanized areas; Saint Venant's equation approximated river model that integrates upstream and urban hydrological models with considering tidal effect from downstream. These features are integrated in a common modeling framework so that model interaction can be directly performed. The model is applied to the Tsurumi river basin, urbanized low-lying river basin in Yokohama and model results show that it can simulate water levels in rivers with acceptable model errors. Furthermore the model is able to install miscellaneous water planning constructs, such as runoff reduction pond in urbanized area, flood control field along the river channel, levee, etc. This can be a useful tool to investigate cost performance of hypothetical water management plan against impact of climate change in

  4. Assessment of River Habitat Quality in the Hai River Basin, Northern China

    Directory of Open Access Journals (Sweden)

    Yuekui Ding

    2015-09-01

    Full Text Available We applied a river habitat quality (RHQ assessment method to the Hai River Basin (HRB; an important economic centre in China; to obtain baseline information for water quality improvement; river rehabilitation; and watershed management. The results of the assessment showed that the river habitat in the HRB is seriously degraded. Specifically; 42.41% of the sites; accounting for a river length of 3.31 × 104 km; were designated poor and bad. Habitat in the plain areas is seriously deteriorated; and nearly 50% of the sites; accounting for a river length of 1.65 × 104 km; had either poor or bad habitats. River habitat degradation was attributable to the limited width of the riparian zone (≤5 m; lower coverage of riparian vegetation (≤40%; artificial land use patterns (public and industrial land; frequent occurrence of farming on the river banks and high volumes of solid waste (nearly 10 m3; single flow channels; and rare aquatic plants (≤1 category. At the regional scale; intensive artificial land use types caused by urbanization had a significant impact on the RHQ in the HRB. RHQ was significantly and negatively correlated with farmland (r = 1.000; p < 0.01 and urban land (r = 0.998; p < 0.05; and was significantly and positively correlated with grassland and woodland (r = 1.000; p < 0.01. Intensive artificial land use; created through urbanization processes; has led to a loss of the riparian zone and its native vegetation; and has disrupted the lateral connectivity of the rivers. The degradation of the already essentially black rivers is exacerbated by poor longitudinal connectivity (index of connectivity is 2.08–16.56; caused by reservoirs and sluices. For river habitat rehabilitation to be successful; land use patterns need to be changed and reservoirs and sluices will have to be regulated.

  5. Savannah River Site computing architecture

    Energy Technology Data Exchange (ETDEWEB)

    1991-03-29

    A computing architecture is a framework for making decisions about the implementation of computer technology and the supporting infrastructure. Because of the size, diversity, and amount of resources dedicated to computing at the Savannah River Site (SRS), there must be an overall strategic plan that can be followed by the thousands of site personnel who make decisions daily that directly affect the SRS computing environment and impact the site's production and business systems. This plan must address the following requirements: There must be SRS-wide standards for procurement or development of computing systems (hardware and software). The site computing organizations must develop systems that end users find easy to use. Systems must be put in place to support the primary function of site information workers. The developers of computer systems must be given tools that automate and speed up the development of information systems and applications based on computer technology. This document describes a proposal for a site-wide computing architecture that addresses the above requirements. In summary, this architecture is standards-based data-driven, and workstation-oriented with larger systems being utilized for the delivery of needed information to users in a client-server relationship.

  6. Savannah River Site computing architecture

    Energy Technology Data Exchange (ETDEWEB)

    1991-03-29

    A computing architecture is a framework for making decisions about the implementation of computer technology and the supporting infrastructure. Because of the size, diversity, and amount of resources dedicated to computing at the Savannah River Site (SRS), there must be an overall strategic plan that can be followed by the thousands of site personnel who make decisions daily that directly affect the SRS computing environment and impact the site`s production and business systems. This plan must address the following requirements: There must be SRS-wide standards for procurement or development of computing systems (hardware and software). The site computing organizations must develop systems that end users find easy to use. Systems must be put in place to support the primary function of site information workers. The developers of computer systems must be given tools that automate and speed up the development of information systems and applications based on computer technology. This document describes a proposal for a site-wide computing architecture that addresses the above requirements. In summary, this architecture is standards-based data-driven, and workstation-oriented with larger systems being utilized for the delivery of needed information to users in a client-server relationship.

  7. Bank retreat study of a meandering river reach case study : River Irwell

    NARCIS (Netherlands)

    Duran, R.; Beevers, L.; Crosato, A.; Wright, N.

    2010-01-01

    Lack of data is often considered a limitation when undertaking morphological studies. This research deals with morphological studies of small rivers experiencing bank erosion processes when only limited data are available. A reach of the meandering gravel-bed river Irwell (United Kingdom) is taken

  8. Bank retreat of a meandering river reach case study : River Irwell

    NARCIS (Netherlands)

    Duran, R.; Beevers, L.; Crosato, A.; Wright, N.G.

    2009-01-01

    Lack of data is often considered a limitation when undertaking morphological studies. This research deals with the morphological study of a small river experiencing bank erosion for which only limited data are available. A reach of the meandering gravel-bed river Irwell (United Kingdom) is taken as

  9. Restoration strategies for river floodplains along large lowland rivers in Europe

    NARCIS (Netherlands)

    Buijse, A.D.; Coops, H.; Staras, M.; Jans, L.H.; Van Geest, G.J.; Grift, R.E.; Ibelings, B.W.; Oosterberg, W.; Roozen, F.C.J.M.

    2002-01-01

    1. Most temperate rivers are heavily regulated and characterised by incised channels, aggradated floodplains and modified hydroperiods. As a consequence, former extensive aquatic /terrestrial transition zones lack most of their basic ecological functions. 2. Along large rivers in Europe and North

  10. Restoration strategies for river floodplains along large lowland rivers in Europe

    NARCIS (Netherlands)

    Buijse, A.D.; Coops, H.; Staras, M.; Jans, L.H.; Geest, van G.; Grift, R.E.; Ibelings, B.W.; Oosterberg, W.; Roozen, F.C.J.M.

    2002-01-01

    1. Most temperate rivers are heavily regulated and characterised by incised channels, aggradated floodplains and modified hydroperiods. As a consequence, former extensive aquatic/terrestrial transition zones lack most of their basic ecological functions. 2. Along large rivers in Europe and North

  11. Handling sediments in Dutch river management: The planning stage of the Maaswerken river widening project

    NARCIS (Netherlands)

    Meulen, M.J. van der; Rijnveld, M.; Gerrits, L.M.; Joziasse, J.; Heijst, M.W.I.M. van; Gruijters, S.H.L.L.

    2006-01-01

    Goals, Scope and Background. Faced with higher peak discharges in the foreseeable future, the Dutch government has decided to increase the discharge capacities of the Dutch Rhine and Meuse rivers. Instead of raising the dikes, river widening measures are to be undertaken, in and along the riverbed.

  12. Assessing impact of urbanization on river water quality in the Pearl River Delta Economic Zone, China.

    Science.gov (United States)

    Ouyang, Tingping; Zhu, Zhaoyu; Kuang, Yaoqiu

    2006-09-01

    The Pearl River Delta Economic Zone is one of the most developed regions in China. It has been undergoing a rapid urbanization since the reformation and opening of China in 1978. This process plays a significant impact on the urban environment, particularly river water quality. The main goal of this present study is to assess the impact of urban activities especially urbanization on river water quality for the study area. Some Landsat TM images from 2000 were used to map the areas for different pollution levels of urban river sections for the study area. In addition, an improved equalized synthetic pollution index method was utilized to assess the field analytical results. The results indicate that there is a positive correlation between the rapidity of urbanization and the pollution levels of urban river water. Compared to the rural river water, urban river water was polluted more seriously. During the urban development process, urbanization and urban activities had a significant negative impact on the river water quality.

  13. An Evaluation of River Health for the Weihe River in Shaanxi Province, China

    Directory of Open Access Journals (Sweden)

    Jinxi Song

    2015-01-01

    Full Text Available Excessive socioeconomic activities in the Weihe River region have caused severe ecosystem degradation, and the call for the recovery and maintenance of the river health has drawn great attention. Based on the connotation of river health, previous research findings, and status quo of the Weihe River ecosystem, in this study, we developed a novel health evaluation index system to quantitatively determine the health of the Weihe River in Shaanxi Province. The river in the study area was divided into five reaches based on the five hydrological gauging stations, and appropriate evaluation indices for each river section were selected according to the ecological environmental functions of that section. A hybrid approach integrating analytic hierarchy process (AHP and a fuzzy synthetic evaluation method was applied to measure the river health. The results show that Linjiancun-Weijiabao reach and Weijiabao-Xianyang reach are in the “moderate” level of health and Lintong-Huaxian reach and downstream of Huaxian reach are in the “poor” health rating, whereas Xianyang-Lintong reach is in the “sick” rating. Moreover, the most sensitive factors were determined, respectively, for each reach from upper stream to lower stream in the study area.

  14. Denitrification in the Mississippi River network controlled by flow through river bedforms

    Science.gov (United States)

    Gomez-Velez, Jesus D.; Harvey, Judson W.; Cardenas, M. Bayani; Kiel, Brian

    2015-01-01

    Increasing nitrogen concentrations in the world’s major rivers have led to over-fertilization of sensitive downstream waters1, 2, 3, 4. Flow through channel bed and bank sediments acts to remove riverine nitrogen through microbe-mediated denitrification reactions5, 6, 7, 8, 9, 10. However, little is understood about where in the channel network this biophysical process is most efficient, why certain channels are more effective nitrogen reactors, and how management practices can enhance the removal of nitrogen in regions where water circulates through sediment and mixes with groundwater - hyporheic zones8, 11, 12. Here we present numerical simulations of hyporheic flow and denitrification throughout the Mississippi River network using a hydrogeomorphic model. We find that vertical exchange with sediments beneath the riverbed in hyporheic zones, driven by submerged bedforms, has denitrification potential that far exceeds lateral hyporheic exchange with sediments alongside river channels, driven by river bars and meandering banks. We propose that geomorphic differences along river corridors can explain why denitrification efficiency varies between basins in the Mississippi River network. Our findings suggest that promoting the development of permeable bedforms at the streambed - and thus vertical hyporheic exchange - would be more effective at enhancing river denitrification in large river basins than promoting lateral exchange through induced channel meandering. 

  15. History of river regulation of the Noce River (NE Italy) and related bio-morphodynamic responses

    Science.gov (United States)

    Serlet, Alyssa; Scorpio, Vittoria; Mastronunzio, Marco; Proto, Matteo; Zen, Simone; Zolezzi, Guido; Bertoldi, Walter; Comiti, Francesco; Prà, Elena Dai; Surian, Nicola; Gurnell, Angela

    2016-04-01

    The Noce River is a hydropower-regulated Alpine stream in Northern-East Italy and a major tributary of the Adige River, the second longest Italian river. The objective of the research is to investigate the response of the lower course of the Noce to two main stages of hydromorphological regulation; channelization/ diversion and, one century later, hydropower regulation. This research uses a historical reconstruction to link the geomorphic response with natural and human-induced factors by identifying morphological and vegetation features from historical maps and airborne photogrammetry and implementing a quantitative analysis of the river response to channelization and flow / sediment supply regulation related to hydropower development. A descriptive overview is presented. The concept of evolutionary trajectory is integrated with predictions from morphodynamic theories for river bars that allow increased insight to investigate the river response to a complex sequence of regulatory events such as development of bars, islands and riparian vegetation. Until the mid-19th century the river had a multi-thread channel pattern. Thereafter (1852) the river was straightened and diverted. Upstream of Mezzolombardo village the river was constrained between embankments of approximately 100 m width while downstream they are of approximately 50 m width. Since channelization some interesting geomorphic changes have appeared in the river e.g. the appearance of alternate bars in the channel. In 1926 there was a breach in the right bank of the downstream part that resulted in a multi-thread river reach which can be viewed as a recovery to the earlier multi-thread pattern. After the 1950's the flow and sediment supply became strongly regulated by hydropower development. The analysis of aerial images reveals that the multi-thread reach became progressively stabilized by vegetation development over the bars, though signs of some dynamics can still be recognizable today, despite the

  16. Molybdenum, vanadium, and uranium weathering in small mountainous rivers and rivers draining high-standing islands

    Science.gov (United States)

    Gardner, Christopher B.; Carey, Anne E.; Lyons, W. Berry; Goldsmith, Steven T.; McAdams, Brandon C.; Trierweiler, Annette M.

    2017-12-01

    Rivers draining high standing islands (HSIs) and small mountainous rivers (SMRs) are known to have extremely high sediment fluxes, and can also have high chemical weathering yields, which makes them potentially important contributors to the global riverine elemental flux to the ocean. This work reports on the riverine concentrations, ocean flux, and weathering yields of Molybdenum (Mo), Vanadium (V), and Uranium (U) in a large number of small but geochemically important rivers using 338 river samples from ten lithologically-diverse regions. These redox-sensitive elements are used extensively to infer paleo-redox conditions in the ocean, and Mo and V are also important rock-derived micronutrients used by microorganisms in nitrogen fixation. Unlike in large river systems, in which dissolved Mo has been attributed predominately to pyrite dissolution, Mo concentrations in these rivers did not correlate with sulfate concentrations. V was found to correlate strongly with Si in terrains dominated by silicate rocks, but this trend was not observed in primarily sedimentary regions. Many rivers exhibited much higher V/Si ratios than larger rivers, and rivers draining young Quaternary volcanic rocks in Nicaragua had much higher dissolved V concentrations (mean = 1306 nM) than previously-studied rivers. U concentrations were generally well below the global average with the exception of rivers draining primarily sedimentary lithologies containing carbonates and shales. Fluxes of U and Mo from igneous terrains of intermediate composition are lower than the global average, while fluxes of V from these regions are higher, and up to two orders of magnitude higher in the Nicaragua rivers. Weathering yields of Mo and V in most regions are above the global mean, despite lower than average concentrations measured in some of those systems, indicating that the chemical weathering of these elements are higher in these SMR watersheds than larger drainages. In regions of active boundaries

  17. Hydrology and morphology of two river mouth regions (temperate Vistula Delta and subtropical Red River Delta

    Directory of Open Access Journals (Sweden)

    Zbigniew Pruszak

    2005-09-01

    Full Text Available The paper presents a comparative analysis of two different river mouths from two different geographical zones (subtropical and temperate climatic regions. One is the multi-branch and multi-spit mouth of the Red River on the Gulf of Tonkin (Vietnam, the other is the smaller delta of the river Vistula on a bay of the Baltic Sea (Poland. The analysis focuses on the similarities and differences in the hydrodynamics between these estuaries and the adjacent coastal zones, the features of sediment transport, and the long-term morphodynamics of the river outlets. Salinity and water level are also discussed, the latter also in the context of the anticipated global effect of accelerated sea level rise. The analysis shows that the climatic and environmental conditions associated with geographical zones give rise to fundamental differences in the generation and dynamic evolution of the river mouths.

  18. River and Reservoir Operations Model, Truckee River basin, California and Nevada, 1998

    Science.gov (United States)

    Berris, Steven N.; Hess, Glen W.; Bohman, Larry R.

    2001-01-01

    The demand for all uses of water in the Truckee River Basin, California and Nevada, commonly is greater than can be supplied. Storage reservoirs in the system have a maximum effective total capacity equivalent to less than two years of average river flows, so longer-term droughts can result in substantial water-supply shortages for irrigation and municipal users and may stress fish and wildlife ecosystems. Title II of Public Law (P.L.) 101-618, the Truckee?Carson?Pyramid Lake Water Rights Settlement Act of 1990, provides a foundation for negotiating and developing operating criteria, known as the Truckee River Operating Agreement (TROA), to balance interstate and interbasin allocation of water rights among the many interests competing for water from the Truckee River. In addition to TROA, the Truckee River Water Quality Settlement Agreement (WQSA), signed in 1996, provides for acquisition of water rights to resolve water-quality problems during low flows along the Truckee River in Nevada. Efficient execution of many of the planning, management, or environmental assessment requirements of TROA and WQSA will require detailed water-resources data coupled with sound analytical tools. Analytical modeling tools constructed and evaluated with such data could help assess effects of alternative operational scenarios related to reservoir and river operations, water-rights transfers, and changes in irrigation practices. The Truckee?Carson Program of the U.S. Geological Survey, to support U.S. Department of the Interior implementation of P.L. 101-618, is developing a modeling system to support efficient water-resources planning, management, and allocation. The daily operations model documented herein is a part of the modeling system that includes a database management program, a graphical user interface program, and a program with modules that simulate river/reservoir operations and a variety of hydrologic processes. The operations module is capable of simulating lake

  19. Field intercomparison of channel master ADCP with RiverSonde Radar for measuring river discharge

    Science.gov (United States)

    Spain, P.; Marsden, R.; Barrick, D.; Teague, C.; Ruhl, C.

    2005-01-01

    The RiverSonde radar makes non-contact measurement of a horizontal swath of surface velocity across a river section. This radar, which has worked successfully at several rivers in the Western USA, has shown encouraging correlation with simultaneous measurements of average currents at one level recorded by an acoustic travel-time system. This work reports a field study intercomparing data sets from a 600 kHz Channel Master ADCP with the RiverSonde radar. The primary goal was to begin to explore the robustness of the radar data as a reliable index of discharge. This site Is at Three Mile Slough in Northern California, USA. The larger intent of the work is to examine variability in space and time of the radar's surface currents compared with subsurface flows across the river section. Here we examine data from a couple of periods with strong winds. ?? 2005 IEEE.

  20. Hydrological and geochemical consequences of river regulation - hyporheic perspective

    Science.gov (United States)

    Siergieiev, Dmytro; Lundberg, Angela; Widerlund, Anders

    2014-05-01

    River-aquifer interfaces, essential for ecosystem functioning in terms of nutrient exchange and biological habitat, appear greatly threatened worldwide. Although river regulation is a vast pressure on river-aquifer interaction, influencing entire watersheds, knowledge about hyporheic exchange in regulated rivers is rather limited. In this study, we combine two decades of research on hydrological and geochemical impacts of hydropower regulation on river water and hyporheic zone in two large boreal rivers, unregulated Kalix River and regulated Lule River. Altered river discharge, with reduced spring peaks, daily summer fluctuations and elevated winter base flow severely modified Lule River water geochemistry and thus the transport of solutes to the Bothnian Bay (Baltic Sea). Further, these river modifications changed the river-aquifer exchange on both daily and seasonal scale, which resulted in deteriorated hyporheic conditions with reduced riverbed hydraulic conductivity (formation of a clogging layer) reflected in a declined hyporheic flux. Altered hydrological regime of the hyporheic zone created quasi-stagnant conditions beneath the river-aquifer interface and promoted the formation of geochemically suboxic environment. Taken that hyporheic water is a mixture of river water and groundwater, mixing models for the regulated site demonstrate a considerable addition of Fe, Mn, Al, NH4 and removal of dissolved oxygen and nitrate, which suggests the hyporheic zone in the Lule River to be a source of solutes. This contradicts the observations from the hyporheic zone in the unregulated river, with opposite behaviour functioning as a barrier. These results suggest that the hyporheic zone function is dependent on the river discharge and the state of the river-aquifer connectivity. Improved knowledge about the latter on a watershed scale will substantially increase our understanding about the status and potential pressures of riverine ecosystems and assist management and

  1. Characterizing seston in the Penobscot River Estuary.

    Science.gov (United States)

    Meseck, Shannon L; Li, Yaqin; Sunila, Inke; Dixon, Mark; Clark, Paul; Lipsky, Christine; Stevens, Justin R; Music, Paul; Wikfors, Gary H

    2017-10-01

    The Penobscot River Estuary is an important system for diadromous fish in the Northeast United States of American (USA), in part because it is home to the largest remnant population of Atlantic salmon, Salmo salar, in the country. Little is known about the chemical and biological characteristics of seston in the Penobscot River Estuary. This study used estuarine transects to characterize the seston during the spring when river discharge is high and diadromous fish migration peaks in the Penobscot River Estuary. To characterize the seston, samples were taken in spring 2015 for phytoplankton identification, total suspended matter (TSM), percent organic TSM, chlorophyll a, particle size (2 μm-180 μm), particulate carbon and nitrogen concentrations, and stable carbon and nitrogen isotopes. The estuarine profiles indicate that TSM behaved non-conservatively with a net gain in the estuary. As phytoplankton constituted only 1/1000 of the particles, the non-conservative behavior of TSM observed in the estuary was most likely not attributable to phytoplankton. Particulate carbon and nitrogen ratios and stable isotope signals indicate a strong terrestrial, allochthonous signal. The seston in the Penobscot River Estuary was dominated by non-detrital particles. During a short, two-week time period, Heterosigma akashiwo, a phytoplankton species toxic to finfish, also was detected in the estuary. A limited number of fish samples, taken after the 2015 Penobscot River Estuary bloom of H. akashiwo, indicated frequent pathological gill damage. The composition of seston, along with ichthyotoxic algae, suggest the need for further research into possible effects upon resident and migratory fish in the Penobscot River Estuary. Published by Elsevier Ltd.

  2. Trend analyses with river sediment rating curves

    Science.gov (United States)

    Warrick, Jonathan A.

    2015-01-01

    Sediment rating curves, which are fitted relationships between river discharge (Q) and suspended-sediment concentration (C), are commonly used to assess patterns and trends in river water quality. In many of these studies it is assumed that rating curves have a power-law form (i.e., C = aQb, where a and b are fitted parameters). Two fundamental questions about the utility of these techniques are assessed in this paper: (i) How well to the parameters, a and b, characterize trends in the data? (ii) Are trends in rating curves diagnostic of changes to river water or sediment discharge? As noted in previous research, the offset parameter, a, is not an independent variable for most rivers, but rather strongly dependent on b and Q. Here it is shown that a is a poor metric for trends in the vertical offset of a rating curve, and a new parameter, â, as determined by the discharge-normalized power function [C = â (Q/QGM)b], where QGM is the geometric mean of the Q values sampled, provides a better characterization of trends. However, these techniques must be applied carefully, because curvature in the relationship between log(Q) and log(C), which exists for many rivers, can produce false trends in â and b. Also, it is shown that trends in â and b are not uniquely diagnostic of river water or sediment supply conditions. For example, an increase in â can be caused by an increase in sediment supply, a decrease in water supply, or a combination of these conditions. Large changes in water and sediment supplies can occur without any change in the parameters, â and b. Thus, trend analyses using sediment rating curves must include additional assessments of the time-dependent rates and trends of river water, sediment concentrations, and sediment discharge.

  3. Morphological, hydrological, biogeochemical and ecological changes and challenges in river restoration - the Thur River case study

    Science.gov (United States)

    Schirmer, M.; Luster, J.; Linde, N.; Perona, P.; Mitchell, E. A. D.; Barry, D. A.; Hollender, J.; Cirpka, O. A.; Schneider, P.; Vogt, T.; Radny, D.; Durisch-Kaiser, E.

    2014-06-01

    River restoration can enhance river dynamics, environmental heterogeneity and biodiversity, but the underlying processes governing the dynamic changes need to be understood to ensure that restoration projects meet their goals, and adverse effects are prevented. In particular, we need to comprehend how hydromorphological variability quantitatively relates to ecosystem functioning and services, biodiversity as well as ground- and surface water quality in restored river corridors. This involves (i) physical processes and structural properties, determining erosion and sedimentation, as well as solute and heat transport behavior in surface water and within the subsurface; (ii) biogeochemical processes and characteristics, including the turnover of nutrients and natural water constituents; and (iii) ecological processes and indicators related to biodiversity and ecological functioning. All these aspects are interlinked, requiring an interdisciplinary investigation approach. Here, we present an overview of the recently completed RECORD (REstored CORridor Dynamics) project in which we combined physical, chemical, and biological observations with modeling at a restored river corridor of the perialpine Thur River in Switzerland. Our results show that river restoration, beyond inducing morphologic changes that reshape the river bed and banks, triggered complex spatial patterns of bank infiltration, and affected habitat type, biotic communities and biogeochemical processes. We adopted an interdisciplinary approach of monitoring the continuing changes due to restoration measures to address the following questions: How stable is the morphological variability established by restoration? Does morphological variability guarantee an improvement in biodiversity? How does morphological variability affect biogeochemical transformations in the river corridor? What are some potential adverse effects of river restoration? How is river restoration influenced by catchment-scale hydraulics

  4. Transport of plutonium by the Mississippi River system and other rivers in the southern United States

    International Nuclear Information System (INIS)

    Scott, M.R.; Salter, P.F.

    1987-01-01

    The distribution of fallout Pu has been studied in the sediments and water of the Mississippi River and eight other rivers. Plutonium content of the sediments is related to grain size and Fe and Mn content. Rivers in human climates show relatively high organic carbon (3 to 4%) and high /sup 239,240)Pu content (36 to 131 dpm/kg) in their suspended sediments. Dissolved Pu is very low in all the rivers; distribution coefficients vary from 10 4 to 10 5 . The 238 Pu//sup 239,240/Pu ratios are low in all the river sediments (∼.06) except the Miami River in Ohio, where ratios as high as 99 were measured. The high ratios originate from the Mound Laboratory Pu processing plant at Miamisburg, Ohio, and can be traced downstream to the junction with the Ohio River. Mississippi River suspended sediment shows a continual decrease of /sup 239,240/Pu content over a 7 year time period. An exponential curve best-fit through the data predicts a half time of decrease equal to 4.3 years. The decrease in Pu content of river sediment results from several factors: cessation of atmospheric weapons testing; transport of Pu to deeper levels of soil profiles; storage of sediment in flood plains and behind dams; and dilution by erosion by older, prebomb soil material. The amount of fallout Pu now removed from the Mississippi River drainage basin to the ocean is 11% as a maximum estimate. Most the fallout Pu in the Mississippi drainage basin will remain on the continent unless there are major changes in erosion and sediment transport patterns in the basin itself. 56 references, 7 figures, 2 tables

  5. Shutdown of the River Water System at the Savannah River Site: Draft environmental impact statement

    International Nuclear Information System (INIS)

    1996-11-01

    This environmental impact statement (EIS) evaluates alternative approaches to and environmental impacts of shutting down the River Water System at the Savannah River Site (SRS). Five production reactors were operated at the site.to support these facilities, the River Water System was constructed to provide cooling water to pass through heat exchangers to absorb heat from the reactor core in each of the five reactor areas (C, K, L, P, and R). The DOE Savannah River Strategic Plan directs the SRS to find ways to reduce operating costs and to determine what site infrastructure it must maintain and what infrastructure is surplus. The River Water System has been identified as a potential surplus facility. Three alternatives to reduce the River Water System operating costs are evaluated in this EIS. In addition to the No-Action Alternative, which consists of continuing to operate the River Water System, this EIS examines one alternative (the Preferred Alternative) to shut down and maintain the River Water System in a standby condition until DOE determines that a standby condition is no longer necessary, and one alternative to shut down and deactivate the River Water System. The document provides background information and introduces the River Water System at the SRS; sets forth the purpose and need for DOE action; describes the alternatives DOE is considering; describes the environment at the SRS and in the surrounding area potentially affected by the alternatives addressed and provides a detailed assessment of the potential environmental impacts of the alternatives; and identifies regulatory requirements and evaluates their applicability to the alternatives considered

  6. Analysis of Hydraulic Flood Control Structure at Putat Boro River

    OpenAIRE

    Ruzziyatno, Ruhban

    2015-01-01

    Putat Boro River is one of the main drainage systems of Surakarta city which drains into Bengawan Solo river. The primary problem when flood occur is the higher water level of Bengawan Solo than Boro River and then backwater occur and inundates Putat Boro River. The objective of the study is to obtain operational method of Putat Boro River floodgate to control both inflows and outflows not only during flood but also normal condition. It also aims to know the Putat Boro rivers floodgate op...

  7. RiverHeath: Neighborhood Loop Geothermal Exchange System

    Energy Technology Data Exchange (ETDEWEB)

    Geall, Mark [RiverHeath LLC, Appleton, WI (United States)

    2016-07-11

    The goal of the RiverHeath project is to develop a geothermal exchange system at lower capital infrastructure cost than current geothermal exchange systems. The RiverHeath system features an innovative design that incorporates use of the adjacent river through river-based heat exchange plates. The flowing water provides a tremendous amount of heat transfer. As a result, the installation cost of this geothermal exchange system is lower than more traditional vertical bore systems. Many urban areas are located along rivers and other waterways. RiverHeath will serve as a template for other projects adjacent to the water.

  8. Columbia River impact evaluation plan

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    As a result of past practices, four areas of the Hanford Site (the 100, 200, 300, and 1100 Areas) have been included on the US Environmental Protection Agency`s (EPA`s) National Priorities List (NPL) under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980. To accomplish the timely cleanup of the past-practice units, the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement), was signed by the Washington State Department of Ecology (Ecology), EPA, and the US Department of Energy (DOE). To support the Tri-Party Agreement, milestones were adopted. These milestones represent the actions needed to ensure acceptable progress toward Hanford Site compliance with CERCLA, RCRA, and the Washington State Hazardous Waste Management Act of 1976. This report was prepared to fulfill the requirement of Tri-Party Agreement Milestone M-30-02, which requires a plan to determine cumulative health and environmental impacts to the Columbia River. This plan supplements the CERCLA remedial investigations/feasibility studies (RI/FS) and RCRA facility investigations/corrective measures studies (RFI/CMSs) that will be undertaken in the 100 Area. To support the plan development process, existing information was reviewed and a preliminary impact evaluation based on this information was performed. The purpose of the preliminary impact evaluation was to assess the adequacy of existing data and proposed data collection activities. Based on the results of the evaluation, a plan is proposed to collect additional data or make changes to existing or proposed data collection activities.

  9. RIVER PROTECTION PROJECT SYSTEM PLAN

    International Nuclear Information System (INIS)

    Certa, P.J.; Kirkbride, R.A.; Hohl, T.M.; Empey, P.A.; Wells, M.N.

    2009-01-01

    The U.S. Department of Energy (DOE), Office of River Protection (ORP) manages the River Protection Project (RPP). The RPP mission is to retrieve and treat Hanford's tank waste and close the tank farms to protect the Columbia River. As a result, ORP is responsible for the retrieval, treatment, and disposal of approximately 57 million gallons 1 of radioactive waste contained in the Hanford Site waste tanks and closure2 of all the tanks and associated facilities. The previous revision of the System Plan was issued in May 2008. ORP has made a number of changes to the tank waste treatment strategy and plans since the last revision of this document, and additional changes are under consideration. ORP has contracts in place to implement the strategy for completion of the mission and establish the capability to complete the overall mission. The current strategl involves a number of interrelated activities. ORP will reduce risk to the environment posed by tank wastes by the following: (1) Retrieving the waste from the single-shell tanks (SST) to double-shell tanks (DST) and delivering the waste to the Waste Treatment and Immobilization Plant (WTP). (2) Constructing and operating the WTP, which will safely treat all of the high-level waste (HLW) fraction contained in the tank farms. About one-third of the low-activity waste (LAW) fraction separated from the HLW fraction in the WTP will be immobilized in the WTP LAW Vitrification Facility. (3) Developing and deploying supplemental treatment capability assumed to be a second LAW vitrification facility that can safely treat about two-thirds of the LAW contained in the tank farms. (4) Developing and deploying supplemental pretreatment capability currently assumed to be an Aluminum Removal Facility (ARF) using a lithium hydrotalcite process to mitigate sodium management issues. (5) Developing and deploying treatment and packaging capability for contact-handled transuranic (CH-TRU) tank waste for possible shipment to and disposal

  10. RIVER PROTECTION PROJECT SYSTEM PLAN

    Energy Technology Data Exchange (ETDEWEB)

    CERTA PJ

    2008-07-10

    The U.S. Department of Energy (DOE), Office of River Protection (ORP) manages the River Protection Project (RPP). The RPP mission is to retrieve and treat Hanford's tank waste and close the tank farms to protect the Columbia River. As a result, the ORP is responsible for the retrieval, treatment, and disposal of the approximately 57 million gallons of radioactive waste contained in the Hanford Site waste tanks and closure of all the tanks and associated facilities. The previous revision of the System Plan was issued in September 2003. ORP has approved a number of changes to the tank waste treatment strategy and plans since the last revision of this document, and additional changes are under consideration. The ORP has established contracts to implement this strategy to establish a basic capability to complete the overall mission. The current strategy for completion of the mission uses a number of interrelated activities. The ORP will reduce risk to the environment posed by tank wastes by: (1) Retrieving the waste from the single-shell tanks (SST) to double-shell tanks (DST) for treatment and disposal; (2) Constructing and operating the WTP, which will safely treat all of the high-level waste (HLW) and about half of the low-activity waste (LAW) contained in the tank farms, and maximizing its capability and capacity; (3) Developing and deploying supplemental treatment capability or a second WTP LAW Facility that can safely treat about half of the LAW contained in the tank farms; (4) Developing and deploying treatment and packaging capability for transuranic (TRU) tank waste for shipment to and disposal at the Waste Isolation Pilot Plant (WIPP); (5) Deploying interim storage capacity for the immobilized HLW and shipping that waste to Yucca Mountain for disposal; (6) Operating the Integrated Disposal Facility for the disposal of immobilized LAW, along with the associated secondary waste, (7) Closing the SST and DST tank farms, ancillary facilities, and al1 waste

  11. RIVER PROTECTION PROJECT SYSTEM PLAN

    International Nuclear Information System (INIS)

    CERTA PJ

    2008-01-01

    The U.S. Department of Energy (DOE), Office of River Protection (ORP) manages the River Protection Project (RPP). The RPP mission is to retrieve and treat Hanford's tank waste and close the tank farms to protect the Columbia River. As a result, the ORP is responsible for the retrieval, treatment, and disposal of the approximately 57 million gallons of radioactive waste contained in the Hanford Site waste tanks and closure of all the tanks and associated facilities. The previous revision of the System Plan was issued in September 2003. ORP has approved a number of changes to the tank waste treatment strategy and plans since the last revision of this document, and additional changes are under consideration. The ORP has established contracts to implement this strategy to establish a basic capability to complete the overall mission. The current strategy for completion of the mission uses a number of interrelated activities. The ORP will reduce risk to the environment posed by tank wastes by: (1) Retrieving the waste from the single-shell tanks (SST) to double-shell tanks (DST) for treatment and disposal; (2) Constructing and operating the WTP, which will safely treat all of the high-level waste (HLW) and about half of the low-activity waste (LAW) contained in the tank farms, and maximizing its capability and capacity; (3) Developing and deploying supplemental treatment capability or a second WTP LAW Facility that can safely treat about half of the LAW contained in the tank farms; (4) Developing and deploying treatment and packaging capability for transuranic (TRU) tank waste for shipment to and disposal at the Waste Isolation Pilot Plant (WIPP); (5) Deploying interim storage capacity for the immobilized HLW and shipping that waste to Yucca Mountain for disposal; (6) Operating the Integrated Disposal Facility for the disposal of immobilized LAW, along with the associated secondary waste, (7) Closing the SST and DST tank farms, ancillary facilities, and al1 waste

  12. RIVER PROTECTION PROJECT SYSTEM PLAN

    Energy Technology Data Exchange (ETDEWEB)

    CERTA PJ; KIRKBRIDE RA; HOHL TM; EMPEY PA; WELLS MN

    2009-09-15

    The U.S. Department of Energy (DOE), Office of River Protection (ORP) manages the River Protection Project (RPP). The RPP mission is to retrieve and treat Hanford's tank waste and close the tank farms to protect the Columbia River. As a result, ORP is responsible for the retrieval, treatment, and disposal of approximately 57 million gallons 1 of radioactive waste contained in the Hanford Site waste tanks and closure2 of all the tanks and associated facilities. The previous revision of the System Plan was issued in May 2008. ORP has made a number of changes to the tank waste treatment strategy and plans since the last revision of this document, and additional changes are under consideration. ORP has contracts in place to implement the strategy for completion of the mission and establish the capability to complete the overall mission. The current strategl involves a number of interrelated activities. ORP will reduce risk to the environment posed by tank wastes by the following: (1) Retrieving the waste from the single-shell tanks (SST) to double-shell tanks (DST) and delivering the waste to the Waste Treatment and Immobilization Plant (WTP). (2) Constructing and operating the WTP, which will safely treat all of the high-level waste (HLW) fraction contained in the tank farms. About one-third of the low-activity waste (LAW) fraction separated from the HLW fraction in the WTP will be immobilized in the WTP LAW Vitrification Facility. (3) Developing and deploying supplemental treatment capability assumed to be a second LAW vitrification facility that can safely treat about two-thirds of the LAW contained in the tank farms. (4) Developing and deploying supplemental pretreatment capability currently assumed to be an Aluminum Removal Facility (ARF) using a lithium hydrotalcite process to mitigate sodium management issues. (5) Developing and deploying treatment and packaging capability for contact-handled transuranic (CH-TRU) tank waste for possible shipment to and

  13. Tidal controls on river delta morphology

    Science.gov (United States)

    Hoitink, A. J. F.; Wang, Z. B.; Vermeulen, B.; Huismans, Y.; Kästner, K.

    2017-09-01

    River delta degradation has been caused by extraction of natural resources, sediment retention by reservoirs, and sea-level rise. Despite global concerns about these issues, human activity in the world’s largest deltas intensifies. Harbour development, construction of flood defences, sand mining and land reclamation emerge as key contemporary factors that exert an impact on delta morphology. Tides interacting with river discharge can play a crucial role in the morphodynamic development of deltas under pressure. Emerging insights into tidal controls on river delta morphology suggest that--despite the active morphodynamics in tidal channels and mouth bar regions--tidal motion acts to stabilize delta morphology at the landscape scale under the condition that sediment import during low flows largely balances sediment export during high flows. Distributary channels subject to tides show lower migration rates and are less easily flooded by the river because of opposing non-linear interactions between river discharge and the tide. These interactions lead to flow changes within channels, and a more uniform distribution of discharge across channels. Sediment depletion and rigorous human interventions in deltas, including storm surge defence works, disrupt the dynamic morphological equilibrium and can lead to erosion and severe scour at the channel bed, even decades after an intervention.

  14. Radioactivity in the River Danube - special investigations

    International Nuclear Information System (INIS)

    Maringer, F.J.; Rank, D.; Terlunen, J.

    1989-01-01

    A sediment trap was installed in the River Danube at Vienna (river km 1933.9) in March, 1987. Since April, 1987 sediment samples have been collected monthly. On these samples systematical investigations such as gamma spectrometric measurements, Sr-90 analysis, grain-size-analysis have been carried out. The maximum of Cs-137-activity was about 300 Bq/kg at the beginning of the operation in April, 1987. Since this date the activity has generally decreased with some slight increases. The ratio of the activities of the <20 μm-fraction to the original sample lies between 2 and 4. The results of the monthly collected sediment samples are shown in regard to radioactivity determinations of water samples and sediment cores in power plant-reservoirs of the River Danube. The Chernobyl accident increases the Cs-137-activity of reservoir sediments in the Austrian part of the Danube from about 20 Bq/kg to 3000 Bq/kg in the <20 μm-fraction. The results of gamma spectrometric measurements of bottom sediments, which were taken in March, 1988 at several points of the River Danube (from river km 16/USSR to 1819/CSSR) are shown. (orig.)

  15. Resilience scales of a dammed tropical river

    Science.gov (United States)

    Calamita, Elisa; Schmid, Martin; Wehrli, Bernhard

    2017-04-01

    Artificial river impoundments disrupt the seasonality and dynamics of thermal, chemical, morphological and ecological regimes in river systems. These alterations affect the aquatic ecosystems in space and time and specifically modify the seasonality and the longitudinal gradients of important biogeochemical processes. Resilience of river systems to anthropogenic stressors enables their recovery along the flow path; however little is known about the longitudinal distance that rivers need to partially restore their physical, chemical and biological integrity. In this study, the concept of a "resilience scale" will be explored for different water quality parameters downstream of Kariba dam, the largest artificial lake in the Zambezi basin (South-East Africa). The goal of this project is to develop a modelling framework to investigate and quantify the impact of large dams on downstream water quality in tropical context. In particular, we aim to assess the degree of reversibility of the main downstream alterations (temperature, oxygen, nutrients) and consequently the quantification of their longitudinal extent. Coupling in-situ measurements with hydraulic and hydrological parameters such as travel times, will allow us to define a physically-based parametrization of the different resilience scales for tropical rivers. The results will be used for improving future dam management at the local scale and assessing the ecological impact of planned dams at the catchment scale.

  16. Heavy metals determination in the Medellin River

    International Nuclear Information System (INIS)

    Casta, S; H, B.

    1998-01-01

    During the last years the Medellin River has been a constant preoccupation for the inhabitants of the Aburra Valley. When the city began to grow took the river as its shaft and all the tailing produced by the domestic action, commercial and industrial were begun to pour of continuous way to its waters, what has caused the degradation that today is observed. Various industries established to what is long of the Medellin River, as are the metal mechanics, those of tanneries, of photographs, paintings and nutritional products, between other. These industries unload its effluents, without no type of treatment, to the river and to its affluent, became these water bodies in receiving of the industrial and domestic liquids effluents of the city. In the present study was sought to determine the presence of some metals in the water bulk and in the sediments of the Medellin River, such as the cadmium, chrome, copper and zinc. The content of these metals plays a role very important in the pollution of the water bodies, upon causing great impact by its toxicity and bio - accumulation. The investigation was accomplished in the section located between the municipalities of Caldas and Copacabana, in four sampling stations during a period of four months, from August until November of 1996

  17. Atmospheric River Characteristics under Decadal Climate Variability

    Science.gov (United States)

    Done, J.; Ge, M.

    2017-12-01

    How does decadal climate variability change the nature and predictability of atmospheric river events? Decadal swings in atmospheric river frequency, or shifts in the proportion of precipitation falling as rain, could challenge current water resource and flood risk management practice. Physical multi-scale processes operating between Pacific sea surface temperatures (SSTs) and atmospheric rivers over the Western U.S. are explored using the global Model for Prediction Across Scales (MPAS). A 45km global mesh is refined over the Western U.S. to 12km to capture the major terrain effects on precipitation. The performance of the MPAS is first evaluated for a case study atmospheric river event over California. Atmospheric river characteristics are then compared in a pair of idealized simulations, each driven by Pacific SST patterns characteristic of opposite phases of the Interdecadal Pacific Oscillation (IPO). Given recent evidence that we have entered a positive phase of the IPO, implications for current reservoir management practice over the next decade will be discussed. This work contributes to the NSF-funded project UDECIDE (Understanding Decision-Climate Interactions on Decadal Scales). UDECIDE brings together practitioners, engineers, statisticians, and climate scientists to understand the role of decadal climate information for water management and decisions.

  18. Savannah River Site (SRS) environmental overview

    International Nuclear Information System (INIS)

    O'Rear, M.G.; Steele, J.L.; Kitchen, B.G.

    1990-01-01

    The environmental surveillance activities at and in the vicinity of the Savannah River Site (SRS) [formerly the Savannah River Plant (SRP)] comprise one of the most comprehensive and extensive environmental monitoring programs in the United States. This overview contains monitoring data from routine and nonroutine radiological and nonradiological environmental surveillance activities, summaries of environmental protection programs in progress, a summary of National Environmental Policy Act (NEPA) activities, and a listing of environmental permits (Appendix A) issued by regulatory agencies. This overview provides information about the impact of SRS operations on the public and the environment. The SRS occupies a large area of approximately 300 square miles along the Savannah River, principally in Aiken and Barnwell counties of South Carolina. SRS's primary function is the production of tritium, plutonium, and other special nuclear materials for national defense, for other governmental uses, and for some civilian purposes. From August 1950 to March 31, 1989, SRS was operated for the Department of Energy (DOE) by E. I. du Pont de Nemours ampersand Co. On April 1, 1989 the Westinghouse Savannah River Company assumed responsibility as the prime contractor for the Savannah River Site

  19. The internal strength of rivers: autogenic processes in control of the sediment load (Tana River, Kenya)

    Science.gov (United States)

    Geeraert, Naomi; Ochieng Omengo, Fred; Tamooh, Fredrick; Paron, Paolo; Bouillon, Steven; Govers, Gerard

    2014-05-01

    The construction of sediment rating curves for monitoring stations is a widely used technique to budget sediment fluxes. Changes in the relationship between discharge and sediment concentrations over time are often attributed to human-induced changes in catchment characteristics, such as land use change, dam construction or soil conservation measures and many models have been developed to quantitatively link catchment characteristics and river sediment load. Conversely, changes in river sediment fluxes are often interpreted as indications of major changes in the catchment. By doing so, autogenic processes, taking place within the river channel, are overlooked despite the increasing awareness of their importance. We assessed the role of autogenic processes on the sediment load of Tana River (Kenya). The Tana river was impacted by major dam construction between 1968 and 1988, effectively blocking at least 80% of the sediment transfer from the highlands to the lower river reaches. However, a comparison of pre-dam sediment fluxes at Garissa (located 250 km downstream of the dams) with recent measurements shows that sediment fluxes have not changed significantly. This suggests that most of the sediment in the post-dam period has to originate from inside the alluvial plain of the river, as tributaries downstream of the dams are scarce and intermittent. Several observations are consistent with this hypothesis. We observed that, during the wet season, sediment concentrations rapidly increased below the dams and are not controlled by inputs from tributaries. Also, sediment concentrations were high at the beginning of the wet season, which can be attributed to channel adjustment to the higher discharges. The river sediment does not contain significant amounts of 137Cs or 210Pbxs, suggesting that sediments are not derived from topsoil erosion. Furthermore, we observed a counter clockwise hysteresis during individual events which can be explained by the fact that sediment

  20. Benchmarking wide swath altimetry-based river discharge estimation algorithms for the Ganges river system

    Science.gov (United States)

    Bonnema, Matthew G.; Sikder, Safat; Hossain, Faisal; Durand, Michael; Gleason, Colin J.; Bjerklie, David M.

    2016-04-01

    The objective of this study is to compare the effectiveness of three algorithms that estimate discharge from remotely sensed observables (river width, water surface height, and water surface slope) in anticipation of the forthcoming NASA/CNES Surface Water and Ocean Topography (SWOT) mission. SWOT promises to provide these measurements simultaneously, and the river discharge algorithms included here are designed to work with these data. Two algorithms were built around Manning's equation, the Metropolis Manning (MetroMan) method, and the Mean Flow and Geomorphology (MFG) method, and one approach uses hydraulic geometry to estimate discharge, the at-many-stations hydraulic geometry (AMHG) method. A well-calibrated and ground-truthed hydrodynamic model of the Ganges river system (HEC-RAS) was used as reference for three rivers from the Ganges River Delta: the main stem of Ganges, the Arial-Khan, and the Mohananda Rivers. The high seasonal variability of these rivers due to the Monsoon presented a unique opportunity to thoroughly assess the discharge algorithms in light of typical monsoon regime rivers. It was found that the MFG method provides the most accurate discharge estimations in most cases, with an average relative root-mean-squared error (RRMSE) across all three reaches of 35.5%. It is followed closely by the Metropolis Manning algorithm, with an average RRMSE of 51.5%. However, the MFG method's reliance on knowledge of prior river discharge limits its application on ungauged rivers. In terms of input data requirement at ungauged regions with no prior records, the Metropolis Manning algorithm provides a more practical alternative over a region that is lacking in historical observations as the algorithm requires less ancillary data. The AMHG algorithm, while requiring the least prior river data, provided the least accurate discharge measurements with an average wet and dry season RRMSE of 79.8% and 119.1%, respectively, across all rivers studied. This poor

  1. Survey of fishes and environmental conditions in Abbotts Lagoon, Point Reyes National Seashore, California

    Science.gov (United States)

    Saiki, M.K.; Martin, B.A.

    2001-01-01

    This study was conducted to gain a better understanding of fishery resources in Abbotts Lagoon, Point Reyes National Seashore. During February/March, May, August, and November 1999, fish were sampled with floating variable-mesh gill nets and small minnow traps from as many as 14 sites in the lagoon. Water temperature, dissolved oxygen, pH, total ammonia(NH3 + NH4+), salinity, turbidity, water depth, and bottom substrate composition were also measured at each site. A total of 2,656 fish represented by eight species was captured during the study. Gill nets captured Sacramento perch, Archoplites interruptus; largemouth bass, Micropterus salmoides; Pacific herring, Clupea pallasi; prickly sculpin, Cottus asper, silver surfperch, Hyperprosopon ellipticum; longfin smelt, Spirinchus thaleichthys; and striped bass, Morone saxatilis; whereas minnow traps captured Sacramento perch; prickly sculpin; and threespine stickleback, Gasterosteus aculeatus. Cluster analysis (Ward's minimum variance method of fish catch statistics identified two major species assemblages-the first dominated by Sacramento perch and, to a lesser extent, by largemouth bass, and the second dominated by Pacific herring and threespine stickleback. Simple discriminant analysis of environmental variables indicated that salinity contributed the most towards separating the two assemblages.

  2. Coherence between coastal and river flooding along the California coast

    Science.gov (United States)

    Odigie, Kingsley O.; Warrick, Jonathan

    2018-01-01

    Water levels around river mouths are intrinsically determined by sea level and river discharge. If storm-associated coastal water-level anomalies coincide with extreme river discharge, landscapes near river mouths will be flooded by the hydrodynamic interactions of these two water masses. Unfortunately, the temporal relationships between ocean and river water masses are not well understood. The coherence between extreme river discharge and coastal water levels at six California river mouths across different climatic and geographic regions was examined. Data from river gauges, wave buoys, and tide gauges from 2007 to 2014 were integrated to investigate the relationships between extreme river discharge and coastal water levels near the mouths of the Eel, Russian, San Lorenzo, Ventura, Arroyo Trabuco, and San Diego rivers. Results indicate that mean and extreme coastal water levels during extreme river discharge are significantly higher compared with background conditions. Elevated coastal water levels result from the combination of nontidal residuals (NTRs) and wave setups. Mean and extreme (>99th percentile of observations) NTRs are 3–20 cm and ∼30 cm higher during extreme river discharge conditions, respectively. Mean and extreme wave setups are up to 40 cm and ∼20–90 cm higher during extreme river discharge than typical conditions, respectively. These water-level anomalies were generally greatest for the northern rivers and least for the southern rivers. Time-series comparisons suggest that increases in NTRs are largely coherent with extreme river discharge, owing to the low atmospheric pressure systems associated with storms. The potential flooding risks of the concurrent timing of these water masses are tempered by the mixed, semidiurnal tides of the region that have amplitudes of 2–2.5 m. In summary, flooding hazard assessments for floodplains near California river mouths for current or future conditions with sea-level rise should include the temporal

  3. Columbia River System Operation Review final environmental impact statement. Appendix A: River Operation Simulation (ROSE)

    International Nuclear Information System (INIS)

    1995-11-01

    The System Operation Review (SOR) is a study and environmental compliance process being used by the three Federal agencies to analyze future operations of the system and river use issues. The goal of the SOR is to achieve a coordinated system operation strategy for the river that better meets the needs of all river users. This technical appendix addresses only the effects of alternative system operating strategies for managing the Columbia River system. The River Operation Simulation Experts (ROSE) work group is comprised of representatives of the Corps, BPA, Reclamation, NMFS, Pacific Northwest Utilities Conference Committee (PNUCC), and Northwest Power Planning Council (NPPC). ROSE was responsible for using computer hydroregulation models to simulate the operation of the river system for all of the alternatives evaluated in screening and full scale analysis in SOR. These models are complex computer programs which sequentially route streamflows through each dam in the system, calculating the streamflows, reservoir elevations, spill, power generation and other information at each project and pertinent locations on the river system. ROSE first reviewed specifications of proposed alternatives to determine whether such alternatives were formulated adequately to be run on hydroregulation models

  4. Floodplain methylmercury biomagnification factor higher than that of the contiguous river (South River, Virginia USA)

    Energy Technology Data Exchange (ETDEWEB)

    Newman, Michael C., E-mail: newman@vims.edu [College of William and Mary - VIMS, P.O. Box 1346, Rt. 1208 Greate Rd., Gloucester Point, VA 23062 (United States); Xu Xiaoyu, E-mail: xiaoyu@vims.edu [College of William and Mary - VIMS, P.O. Box 1346, Rt. 1208 Greate Rd., Gloucester Point, VA 23062 (United States); Condon, Anne, E-mail: anne_condon@fws.gov [U.S. Fish and Wildlife, 6669 Short Lane, Gloucester, VA 23061 (United States); Liang Lian, E-mail: liang@cebam.net [Cebam Analytical, Inc., 18804 North Creek Parkway, Suite 110, Bothell, WA 98011 (United States)

    2011-10-15

    Mercury biomagnification on the South River floodplain (Virginia, USA) was modeled at two locations along a river reach previously modeled for methylmercury movement through the aquatic trophic web. This provided an opportunity to compare biomagnification in adjoining trophic webs. Like the aquatic modeling results, methylmercury-based models provided better prediction than those for total mercury. Total mercury Food Web Magnification Factors (FWMF, fold per trophic level) for the two locations were 4.9 and 9.5. Methylmercury FWMF for the floodplain locations were higher (9.3 and 25.1) than that of the adjacent river (4.6). Previous speculation was not resolved regarding whether the high mercury concentrations observed in floodplain birds was materially influenced by river prey consumption by riparian spiders and subsequent spider movement into the trophic web of the adjacent floodplains. Results were consistent with a gradual methylmercury concentration increase from contaminated floodplain soil, to arthropod prey, and finally, to avian predators. - Highlights: > First comparison of methylmercury biomagnification in adjacent river/land food webs. > Methylmercury increased more rapidly in the terrestrial, than the aquatic, food web. > Methylmercury increased gradually from soil, to prey, and, to avian predators. - Higher methylmercury biomagnification on South River floodplain than the associated river likely explain high mercury in floodplain birds.

  5. Fishes of the White River basin, Indiana

    Science.gov (United States)

    Crawford, Charles G.; Lydy, Michael J.; Frey, Jeffrey W.

    1996-01-01

    Since 1875, researchers have reported 158 species of fish belonging to 25 families in the White River Basin. Of these species, 6 have not been reported since 1900 and 10 have not been reported since 1943. Since the 1820's, fish communities in the White River Basin have been affected by the alteration of stream habitat, overfishing, the introduction of non-native species, agriculture, and urbanization. Erosion resulting from conversion of forest land to cropland in the 1800's led to siltation of streambeds and resulted in the loss of some silt-sensitive species. In the early 1900's, the water quality of the White River was seriously degraded for 100 miles by untreated sewage from the City of Indianapolis. During the last 25 years, water quality in the basin has improved because of efforts to control water pollution. Fish communities in the basin have responded favorably to the improved water quality.

  6. River plastic emissions to the world's oceans

    Science.gov (United States)

    Lebreton, Laurent C. M.; van der Zwet, Joost; Damsteeg, Jan-Willem; Slat, Boyan; Andrady, Anthony; Reisser, Julia

    2017-06-01

    Plastics in the marine environment have become a major concern because of their persistence at sea, and adverse consequences to marine life and potentially human health. Implementing mitigation strategies requires an understanding and quantification of marine plastic sources, taking spatial and temporal variability into account. Here we present a global model of plastic inputs from rivers into oceans based on waste management, population density and hydrological information. Our model is calibrated against measurements available in the literature. We estimate that between 1.15 and 2.41 million tonnes of plastic waste currently enters the ocean every year from rivers, with over 74% of emissions occurring between May and October. The top 20 polluting rivers, mostly located in Asia, account for 67% of the global total. The findings of this study provide baseline data for ocean plastic mass balance exercises, and assist in prioritizing future plastic debris monitoring and mitigation strategies.

  7. Building on the Orange river project

    International Nuclear Information System (INIS)

    Skinner, J.

    1999-01-01

    The life of the World Commission on Dams (WCD) is due to end in mid-2000. In order to achieve its objective of making recommendations on the environmental, social, economic and institutional questions on dams, it will conduct up to ten case studies where the dams and river basins have been selected according to their age, function, regional representation and the lessons to be learned. The Orange River project in South Africa is being used as a pilot study for the other case studies and the reactions to the study are discussed. The case studies will focus on planning, implementation and operation of the dams with respect to their river basins. Six questions are listed and these will need to be answered to form a basis for a structured approach. To date, stakeholder meetings and fieldwork have highlighted four common generic difficulties and these are listed. A form for completion by interested parties was included with the article. (UK)

  8. Smoky River coal flood risk mapping study

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-06-01

    The Canada-Alberta Flood Damage Reduction Program (FDRP) is designed to reduce flood damage by identifying areas susceptible to flooding and by encouraging application of suitable land use planning, zoning, and flood preparedness and proofing. The purpose of this study is to define flood risk and floodway limits along the Smoky River near the former Smoky River Coal (SRC) plant. Alberta Energy has been responsible for the site since the mine and plant closed in 2000. The study describes flooding history, available data, features of the river and valley, calculation of flood levels, and floodway determination, and includes flood risk maps. The HEC-RAS program is used for the calculations. The flood risk area was calculated using the 1:100 year return period flood as the hydrological event. 7 refs., 11 figs., 7 tabs., 3 apps.

  9. Updating river basin models with radar altimetry

    DEFF Research Database (Denmark)

    Michailovsky, Claire Irene B.

    suited for use in data assimilation frameworks which combine the information content from models and current observations to produce improved forecasts and reduce prediction uncertainty. The focus of the second and third papers of this thesis was therefore the use of radar altimetry as update data...... of political unwillingness to share data which is a common problem in particular in transboundary settings. In this context, remote sensing (RS) datasets provide an appealing alternative to traditional in-situ data and much research effort has gone into the use of these datasets for hydrological applications...... response of a catchment to meteorological forcing. While river discharge cannot be directly measured from space, radar altimetry (RA) can measure water level variations in rivers at the locations where the satellite ground track and river network intersect called virtual stations or VS. In this PhD study...

  10. Water security evaluation in Yellow River basin

    Science.gov (United States)

    Jiang, Guiqin; He, Liyuan; Jing, Juan

    2018-03-01

    Water security is an important basis for making water security protection strategy, which concerns regional economic and social sustainable development. In this paper, watershed water security evaluation index system including 3 levels of 5 criterion layers (water resources security, water ecological security and water environment security, water disasters prevention and control security and social economic security) and 24 indicators were constructed. The entropy weight method was used to determine the weights of the indexes in the system. The water security index of 2000, 2005, 2010 and 2015 in Yellow River basin were calculated by linear weighting method based on the relative data. Results show that the water security conditions continue to improve in Yellow River basin but still in a basic security state. There is still a long way to enhance the water security in Yellow River basin, especially the water prevention and control security, the water ecological security and water environment security need to be promoted vigorously.

  11. Lower Red River Meadow Stream Restoration Project

    International Nuclear Information System (INIS)

    1996-05-01

    As part of a continuing effort to restore anadromous fish populations in the South Fork Clearwater River basin of Idaho, Bonneville Power Administration (BPA) proposes to fund the Lower Red River Meadow Restoration Project (Project). The Project is a cooperative effort with the Idaho Soil and Water Conservation District, Nez Perce National Forest, Idaho Department of Fish and Game (IDFG), and the Nez Perce Tribe of Idaho. The proposed action would allow the sponsors to perform stream bank stabilization, aquatic and riparian habitat improvement activities on IDFG's Red River Management Area and to secure long-term conservation contracts or agreements for conducting streambank and habitat improvement activities with participating private landowners located in the Idaho County, Idaho, study area. This preliminary Environmental Assessment (EA) examines the potential environmental effects of stabilizing the stream channel, restoring juvenile fish rearing habitat and reestablishing a riparian shrub community along the stream

  12. Klamath River Basin water-quality data

    Science.gov (United States)

    Smith, Cassandra D.; Rounds, Stewart A.; Orzol, Leonard L.; Sobieszczyk, Steven

    2018-05-29

    The Klamath River Basin stretches from the mountains and inland basins of south-central Oregon and northern California to the Pacific Ocean, spanning multiple climatic regions and encompassing a variety of ecosystems. Water quantity and water quality are important topics in the basin, because water is a critical resource for farming and municipal use, power generation, and for the support of wildlife, aquatic ecosystems, and endangered species. Upper Klamath Lake is the largest freshwater lake in Oregon (112 square miles) and is known for its seasonal algal blooms. The Klamath River has dams for hydropower and the upper basin requires irrigation water to support agriculture and grazing. Multiple species of endangered fish inhabit the rivers and lakes, and the marshes are key stops on the Pacific flyway for migrating birds. For these and other reasons, the water resources in this basin have been studied and monitored to support their management distribution.

  13. Flood Forecasting in River System Using ANFIS

    International Nuclear Information System (INIS)

    Ullah, Nazrin; Choudhury, P.

    2010-01-01

    The aim of the present study is to investigate applicability of artificial intelligence techniques such as ANFIS (Adaptive Neuro-Fuzzy Inference System) in forecasting flood flow in a river system. The proposed technique combines the learning ability of neural network with the transparent linguistic representation of fuzzy system. The technique is applied to forecast discharge at a downstream station using flow information at various upstream stations. A total of three years data has been selected for the implementation of this model. ANFIS models with various input structures and membership functions are constructed, trained and tested to evaluate efficiency of the models. Statistical indices such as Root Mean Square Error (RMSE), Correlation Coefficient (CORR) and Coefficient of Efficiency (CE) are used to evaluate performance of the ANFIS models in forecasting river flood. The values of the indices show that ANFIS model can accurately and reliably be used to forecast flood in a river system.

  14. [Nutrients Input Characteristics of the Yangtze River and Wangyu River During the "Water Transfers on Lake Taihu from the Yangtze River"].

    Science.gov (United States)

    Pan, Xiao-xue; Ma, Ying-qun; Qin, Yan-wen; Zou, Hua

    2015-08-01

    Overall 20 surface water samples were collected from the Yangtze River, the Wangyu River and the Gonghu Bay (Lake Taihu) to clarify the pollution characteristics of nitrogen and phosphorus during 2 sample stages of "Water Transfers on Lake Taihu from the Yangtze River" in August and December of 2013 respectively. The results showed that the mass concentrations of NO2- -N, NO3- -N, NH4+ -N and TN in the Gonghu Bay were lower than those of the Yangtze River and Wangyu River during the 2 water transfer processes. However, there was higher level of DON content in the Gonghu Bay than that of the Yangtze River and Wangyu River. The percentages of various N species showed that NO3- -N was the major N species in the Yangtze River and Wangyu River during the 2 water transfer processes. TP contents in samples collected from the Yangtze River displayed a constant trend compared with the Wangyu River. However, the percentages of various P species were different with each other during the 2 water transfer processes. Mass concentrations of DON and TP in surface water in August were higher than those in December and the contents of NO3- -N and TDP were lower in August than those in December. In general, NO3- -N and TPP were the main N and P species in Wangyu River from the Yangtze River. NO3- -N, PO4(3-) -P and TPP were the main N and P species in Gonghu Bay from Wangyu River during the 2 water transfer processes.

  15. A geomorphological characterisation of river systems in South Africa: A case study of the Sabie River

    Science.gov (United States)

    Eze, Peter N.; Knight, Jasper

    2018-06-01

    Fluvial geomorphology affects river character, behaviour, evolution, trajectory of change and recovery potential, and as such affects biophysical interactions within a catchment. Water bodies in South Africa, in common with many other water-stressed parts of the world, are generally under threat due to increasing natural and anthropogenic influences including aridity, siltation and pollution, as well as climate and environmental change. This study reports on a case study to characterise the geomorphology of different river systems in South Africa, with the aim of better understanding their properties, controls, and implications for biophysical interactions including water quality, biodiversity (aquatic and riparian), and human activity within the catchment. The approach adopted is based on the River Styles® framework (RSF), a geomorphology-based approach developed for rivers in New Zealand and Australia, but applied here for the first time to South Africa. Based on analysis of remote sensing imagery, SRTM-2 digital topographic data and field observations on sites through the entire river system, six geomorphic elements were identified along the Sabie River, northeast South Africa (gorge, bedrock-forced meander, low-moderate sinuosity planform controlled sand bed, meandering sand bed, low sinuosity fine grained sand bed, and floodouts), using the RSF classification scheme and based on the RSF procedural tree of Brierley and Fryirs (2005). Previous geomorphological studies along the Sabie River have shown that different reaches respond differently to episodic floods; we use these data to link river geomorphological character (as defined by the RSF) to the hydrodynamic conditions and processes giving rise to such character. This RSF approach can be used to develop a new management approach for river systems that considers their functional biophysical behaviour within individual reaches, rather than considering them as homogeneous and uniform systems.

  16. Trace elements and radionuclides in the Connecticut River and Amazon River estuary

    International Nuclear Information System (INIS)

    Dion, E.P.

    1983-01-01

    The Connecticut River, its estuary and the Amazon River plume were studied to elucidate processes which control the flux of nuclides to the sea. Major ions (Ca, Mg, Na, Cl, Bicarbonate) and selected trace elements (Ra, Ba, Cu, Si) are introduced to the Connecticut River in proportion to the total dissolved load of various groundwaters. Si, Ra, and Ba are subject to removal from solution by seasonal diatom productivity; whereas the other groundwater-derived elements are found in proportion to TDS both time and space. These nuclides are released in the estuary when a portion of the Ra, Ba, and Si in riverine biogenic detritus is trapped in salt marshes and coves bordering the estuary where it redissolves and is exported to the main river channel at ebb tide. In the Amazon River estuary, the Ra and Ba are released in mid-salinity waters. Ra and Ba together with Si are subsequently removed by diatom productivity as reflected in increased Ra and Ba in the suspended particles and depleted dissolved nuclide concentrations in samples from the high productivity zone. In both the Connecticut River system and the Amazon River plume, Cu behaves conservatively; whereas the fates of Fe and Al are linked to soil-derived humic acids. Trace elements in Amazon plume sediments are found simply in proportion to the percentage of fine-grained size materials, despite low Th-228/Ra-228 mean residence times in the plume and the presence of Cs-137 in the sediment column. Estimates of the total flux of nuclides to the oceans can best be calculated on a mass balance basis using groundwater inputs. Unless significant repositories for nuclides exist in the river-estuarine system, the groundwater flux of dissolved nuclides is net flux to the ocean despite the reactions which occur in both rivers and estuaries

  17. Dating sediment cores from Hudson River marshes

    International Nuclear Information System (INIS)

    Robideau, R.; Bopp, R.F.

    1993-01-01

    There are several methods for determining sediment accumulation rates in the Hudson River estuary. One involves the analysis of the concentration of certain radionuclides in sediment core sections. Radionuclides occur in the Hudson River as a result of: natural sources, fallout from nuclear weapons testing and low level aqueous releases from the Indian Point Nuclear Power Facility. The following radionuclides have been studied in the authors work: Cesium-137, which is derived from global fallout that started in the 1950's and has peaked in 1963. Beryllium-7, a natural radionuclide with a 53 day half-life and found associated with very recently deposited sediments. Another useful natural radionuclide is Lead-210 derived from the decay of Radon-222 in the atmosphere. Lead-210 has a half-life of 22 years and can be used to date sediments up to about 100 years old. In the Hudson River, Cobalt-60 is a marker for Indian Point Nuclear Reactor discharges. The author's research involved taking sediment core samples from four sites in the Hudson River Estuarine Research Reserve areas. These core samples were sectioned, dried, ground and analyzed for the presence of radionuclides by the method of gamma-ray spectroscopy. The strength of each current pulse is proportional to the energy level of the gamma ray absorbed. Since different radionuclides produce gamma rays of different energies, several radionuclides can be analyzed simultaneously in each of the samples. The data obtained from this research will be compared to earlier work to obtain a complete chronology of sediment deposition in these Reserve areas of the river. Core samples may then by analyzed for the presence of PCB's, heavy metals and other pollutants such as pesticides to construct a pollution history of the river

  18. Radiation monitoring of Syr-Darya river

    International Nuclear Information System (INIS)

    Barber, D.S.; Howard, H.D.; Betsill, J.D.; Matthews, R.; Yuldashev, B.S.; Salikhbaev, U.S.; Radyuk, R.I.; Vdovina, E.D.; Solodukhin, V.P.; Poznyak, V.L.; Vasiliev, I.A.; Alekhina, V.M.; Juraev, A.A.

    2003-01-01

    The article contains the results obtained during the radiation monitoring of Syr-Darya River, which was conducted within the frames of international collaboration of Kazakhstan, Kyrgyzstan, Tajikistan, Uzbekistan, and USA. The data on the nature of salinity of water, alfa- and beta-activity of water, bottom, water plants, and soil was obtained. Dependence of the obtained results on the distance form the source is discussed. The major life-providing arteries for the great region of Central Asia are Syr-Darya and Amu Darya rivers. There are many countries next to the pools of these rivers: Tajikistan, Afghanistan, Turkmenistan, Uzbekistan, Kyrgyzstan, and Kazakhstan. There is a great concern caused by the shortage of supply of fresh water, severe epidemiological situation, and radiation conditions along of the pools of these rivers. Such conditions have developed as a result of intensive economic and industrial activities, and also of geological and geochemical features of this region. One of the most serious aspects of this problem is the weak scrutiny level of influence of large deposits of natural uranium and consequences of technological and industrial activities. Since November, 2000 Scientifics of four of the listed countries (Kazakhstan, Kyrgyzstan, Tajikistan, and Uzbekistan) have come to an agreement carrying out the teamwork on studying and monitoring the environment in the pools of Syr-Darya and Amu Darya rivers [1]. Collaborator of these works is Cooperative Monitoring Center at Sandia National Laboratories, USA. During three expeditions each country in 15 control sites on their territory has conducted field researches and has obtained the samples of elements of the environment. Laboratory researches were carried out in Kazakhstan and Uzbekistan. The first results were obtained in (2,3) and later in [4].Currently, the analysis of the data on salinity of water and alpha- and beta- activities of samples along Syr-Darya River is presented

  19. Automatic River Network Extraction from LIDAR Data

    Science.gov (United States)

    Maderal, E. N.; Valcarcel, N.; Delgado, J.; Sevilla, C.; Ojeda, J. C.

    2016-06-01

    National Geographic Institute of Spain (IGN-ES) has launched a new production system for automatic river network extraction for the Geospatial Reference Information (GRI) within hydrography theme. The goal is to get an accurate and updated river network, automatically extracted as possible. For this, IGN-ES has full LiDAR coverage for the whole Spanish territory with a density of 0.5 points per square meter. To implement this work, it has been validated the technical feasibility, developed a methodology to automate each production phase: hydrological terrain models generation with 2 meter grid size and river network extraction combining hydrographic criteria (topographic network) and hydrological criteria (flow accumulation river network), and finally the production was launched. The key points of this work has been managing a big data environment, more than 160,000 Lidar data files, the infrastructure to store (up to 40 Tb between results and intermediate files), and process; using local virtualization and the Amazon Web Service (AWS), which allowed to obtain this automatic production within 6 months, it also has been important the software stability (TerraScan-TerraSolid, GlobalMapper-Blue Marble , FME-Safe, ArcGIS-Esri) and finally, the human resources managing. The results of this production has been an accurate automatic river network extraction for the whole country with a significant improvement for the altimetric component of the 3D linear vector. This article presents the technical feasibility, the production methodology, the automatic river network extraction production and its advantages over traditional vector extraction systems.

  20. AUTOMATIC RIVER NETWORK EXTRACTION FROM LIDAR DATA

    Directory of Open Access Journals (Sweden)

    E. N. Maderal

    2016-06-01

    Full Text Available National Geographic Institute of Spain (IGN-ES has launched a new production system for automatic river network extraction for the Geospatial Reference Information (GRI within hydrography theme. The goal is to get an accurate and updated river network, automatically extracted as possible. For this, IGN-ES has full LiDAR coverage for the whole Spanish territory with a density of 0.5 points per square meter. To implement this work, it has been validated the technical feasibility, developed a methodology to automate each production phase: hydrological terrain models generation with 2 meter grid size and river network extraction combining hydrographic criteria (topographic network and hydrological criteria (flow accumulation river network, and finally the production was launched. The key points of this work has been managing a big data environment, more than 160,000 Lidar data files, the infrastructure to store (up to 40 Tb between results and intermediate files, and process; using local virtualization and the Amazon Web Service (AWS, which allowed to obtain this automatic production within 6 months, it also has been important the software stability (TerraScan-TerraSolid, GlobalMapper-Blue Marble , FME-Safe, ArcGIS-Esri and finally, the human resources managing. The results of this production has been an accurate automatic river network extraction for the whole country with a significant improvement for the altimetric component of the 3D linear vector. This article presents the technical feasibility, the production methodology, the automatic river network extraction production and its advantages over traditional vector extraction systems.

  1. Holocene environmental changes in Red River Delta, Vietnam as ...

    Indian Academy of Sciences (India)

    63

    2VNU Key Laboratory of Geoenvironment and Climate change Response – 334 ... Keywords: Environmental change; Stable isotopes; C/N ratios; Red River ...... and Meade R H 1983 World-wide delivery of river sediment to the oceans; The.

  2. AFSC/ABL: Movements of Yukon River Chinook salmon

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Upriver movements were determined for Chinook salmon Oncorhynchus tshawytscha returning to the Yukon River, a large, relatively pristine river basin. A total of...

  3. Ecological Research on South African rivers - a preliminary synthesis

    CSIR Research Space (South Africa)

    O'Keeffe, JH

    1986-01-01

    Full Text Available Ecological research on South African rivers has progressed in a number of phases. Until 1950 work was mainly taxonomic and descriptive, an essential prerequisite for more detailed studies. The realisation that South African rivers, a vital national...

  4. ElwhaChemical - Elwha River Dam Removal Study

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This study examines the ecosystem response of the Elwha River to the removal of the Elwha River dams. We will measure the following attributes of ecosystem response:...

  5. Silver Creek Mine Treatment is Golden in Protecting Schuylkill River

    Science.gov (United States)

    The Schuylkill River spans over 130 miles from its headwaters in Schuylkill County through several counties on to New Philadelphia where it joins the Delaware River. It serves a drinking water source for 1.5 million people.

  6. Zooplankton abundance in the River Kars, Northeast Turkey: Impact ...

    African Journals Online (AJOL)

    PRECIOUS

    2009-11-02

    Nov 2, 2009 ... Turkey: Impact of environmental variables. H. Özbay1* and ... in the river. Key words: River Kars, zooplankton, running water, environmental factors. ..... tergestina (Branchiopoda: Onychopoda) in Guanabara Bay, Brazil. Braz.

  7. Evaluating the Effects of Dam Construction on the Morphological Changes of Downstream Meandering Rivers (Case Study: Karkheh River

    Directory of Open Access Journals (Sweden)

    A. Liaghat

    2017-04-01

    Full Text Available The establishment of stability in rivers is dependent on a variety of factors, and yet the established stability can be interrupted at any moment or time. One factor that can strongly disrupt the stability of rivers is the construction of dams. For this study, the identification and evaluation of morphological changes occurring to the Karkheh River, before and after the construction of the Karkheh Dam, along with determining the degree of changes to the width and length of the downstream meanders of the river, have been performed with the assistance of satellite images and by applying the CCHE2D hydrodynamic model. Results show that under natural circumstances the width of the riverbed increases downstream parallel to the decrease in the slope angle of the river. The average width of the river was reduced from 273 meters to 60 meters after dam construction. This 78% decrease in river width has made available 21 hectares of land across the river bank per kilometer length of the river. In the studied area, the average thalweg migration of the river is approximately 340 meters, while the minimum and maximum of river migration measured 53 and 768 meters, respectively. Evaluations reveal that nearly 56% of the migrations pertain to the western side of the river, while over 59% of these migrations take place outside the previous riverbed. By average, each year, the lateral migration rate of the river is 34 meters in the studied area which signifies the relevant instability of the region.

  8. On geo-basis of river regulation——A case study for the middle reaches of the Yangtze River

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    From the point of view that people have to obey the river’s geo-attributes in the river regulation, the definition and the meaning of the geo-attributes of a river are discussed. The geo-basis of the river regulation of the middle reaches of the Yangtze River is expounded in five aspects, including the structural geomorphology environment of flood storage and discharge, the distribution characteristics of subsidence and the sedimentation areas of Dongting Basin, the history evolution of Jianghan Basin, the function of Jianghan Basin and Dongting Basin as the flood water detention areas of Jingjiang River reach in ancient time, and the geological characteristic of Jingjiang River reach. Based on the geo-attributes of the middle reaches of the Yangtze River, some ideas about the middle reach regulation of the Yangtze River are put forward: to process the interchange between the lakes and diked marsh areas in Dongting Basin, to canal the new river route as the flood diversion channel of Jingjiang River reach with the paleo river, to recover the function of Jianghan Basin as flood detention area of the middle reaches. And we should take into consideration the geo-environment of the whole Yangtze River in the river regulation of middle reaches.

  9. Vaal River catchment: problems and research needs

    CSIR Research Space (South Africa)

    Braune, E

    1987-01-01

    Full Text Available , the Pretoria-Witwatersrand-Vereeniging (PWV) complex. Although the catchment only produces eight per cent of the mean annual runoff of the country it has the highest concentration of urban, industrial, mining and power generation development in South Africa... of the Vaal River. The purpose of the workshop and preceding symposium was to examine the ever increasing complexity of the Vaal River system, the much enlarged spectrum of user water quality needs and problems, and those activities in the catchment which...

  10. Biotest method in Rhine river surveillance

    International Nuclear Information System (INIS)

    Nolte, M.

    1994-01-01

    Against the background of the 1986 Sandoz chemical accident the national and international commission for the protection of the Rhine river was prompted to construct, a continuous supra-regional surveillance of the river. Its aim is a biological warning system which encompasses the exising chemical-physical monitoring of the water. The Biotest method was newly developed in a joint plan of eight separate projects. The bio-monitors are continuous or semi-continuous systems which make up for the time delay of chemical analyses. (BWI) [de

  11. Mobile teleoperator research at Savannah River Laboratory

    International Nuclear Information System (INIS)

    Byrd, J.S.

    1985-01-01

    A Robotics Technology Group was organized at Savannah River Laboratory to employ modern automation and robotics for applications at the Savannah River site. Several industrial robots have been installed in plant processes. Other robotics systems are under development in the laboratories, including mobile teleoperators for general remote tasks and emergency response operations. This paper discusses present work on a low-cost wheeled mobile vehicle, a modular light duty manipulator arm, a large gantry telerobot system, and a high technology six-legged walking robot with a teleoperated arm

  12. Radioiodine in the Savannah River Site environment

    Energy Technology Data Exchange (ETDEWEB)

    Kantelo, M.V.; Bauer, L.R.; Marter, W.L.; Murphy, C.E. Jr.; Zeigler, C.C.

    1993-01-15

    Radioiodine, which is the collective term for all radioactive isotopes of the element iodine, is formed at the Savannah River Site (SRS) principally as a by-product of nuclear reactor operations. Part of the radioiodine is released to the environment during reactor and reprocessing operations at the site. The purpose of this report is to provide an introduction to radioiodine production and disposition, its status in the environment, and the radiation dose and health risks as a consequence of its release to the environment around the Savannah River Plant. A rigorous dose reconstruction study is to be completed by thee Center for Disease Control during the 1990s.

  13. Radioiodine in the Savannah River Site environment

    International Nuclear Information System (INIS)

    Kantelo, M.V.; Bauer, L.R.; Marter, W.L.; Murphy, C.E. Jr.; Zeigler, C.C.

    1993-01-01

    Radioiodine, which is the collective term for all radioactive isotopes of the element iodine, is formed at the Savannah River Site (SRS) principally as a by-product of nuclear reactor operations. Part of the radioiodine is released to the environment during reactor and reprocessing operations at the site. The purpose of this report is to provide an introduction to radioiodine production and disposition, its status in the environment, and the radiation dose and health risks as a consequence of its release to the environment around the Savannah River Plant. A rigorous dose reconstruction study is to be completed by thee Center for Disease Control during the 1990s

  14. Partners in Leadership for Pearl River

    Science.gov (United States)

    2007-01-01

    Members of the 2007 class of Partners in Leadership toured NASA Stennis Space Center in Hancock County, Miss., on Jan. 11. They visited the center's B Test Stand, part of the center's rocket engine test complex. The Partners in Leadership training program is designed to teach Pearl River County leaders about their county's government, economic development, health and human services, history and arts, environment and education during a 10-month period. The program, sponsored by the Partners for Pearl River County, helps fulfill the mission of the economic and community development agency.

  15. Flood Disaster Mitigation as Revealed by Cawang-Manggarai River Improvement of Ciliwung River

    Directory of Open Access Journals (Sweden)

    Airlangga Mardjono

    2015-06-01

    The final result of this simulation shows that Scenario 3 gives the lowest water surface elevation profile. Scenario 3 is subjected to river normalization, revetment works along the river, and also flood control structure improvement through the additional sluice gate on Manggarai Barrage. This scenario results 167 cm, 163 cm, 172 cm, 179 cm, 167 cm and 171 cm or 17,60%, 17,16%, 18,09%, 18,76%, 17,38% and 17,72% of maximum water level reduction respectively over cross section number S 20 to S 25, for several simulations with 100 year of design discharge. Keywords: Simulation, river improvement, flood water surface elevation.

  16. Syntectonic Mississippi River Channel Response: Integrating River Morphology and Seismic Imaging to Detect Active Faults

    Science.gov (United States)

    Magnani, M. B.

    2017-12-01

    Alluvial rivers, even great rivers such as the Mississippi, respond to hydrologic and geologic controls. Temporal variations of valley gradient can significantly alter channel morphology, as the river responds syntectonically to attain equilibrium. The river will alter its sinuosity, in an attempt to maintain a constant gradient on a surface that changes slope through time. Therefore, changes of river pattern can be the first clue that active tectonics is affecting an area of pattern change. Here I present geomorphological and seismic imaging evidence of a previously unknown fault crossing the Mississippi river south of the New Madrid seismic zone, between Caruthersville, Missouri and Osceola, Arkansas, and show that both datasets support Holocene fault movement, with the latest slip occurring in the last 200 years. High resolution marine seismic reflection data acquired along the Mississippi river imaged a NW-SE striking north-dipping fault displacing the base of the Quaternary alluvium by 15 m with reverse sense of movement. The fault consistently deforms the Tertiary, Cretaceous and Paleozoic formations. Historical river channel planforms dating back to 1765 reveal that the section of the river channel across the fault has been characterized by high sinuosity and steep projected-channel slope compared to adjacent river reaches. In particular, the reach across the fault experienced a cutoff in 1821, resulting in a temporary lowering of sinuosity followed by an increase between the survey of 1880 and 1915. Under the assumption that the change in sinuosity reflects river response to a valley slope change to maintain constant gradient, I use sinuosity through time to calculate the change in valley slope since 1880 and therefore to estimate the vertical displacement of the imaged fault in the past 200 years. Based on calculations so performed, the vertical offset of the fault is estimated to be 0.4 m, accrued since at least 1880. If the base of the river alluvium

  17. Transuranic waste management at Savannah River - past, present, and future

    International Nuclear Information System (INIS)

    D'Ambrosia, J.

    1985-01-01

    The major objective of the TRU program at Savannah River is to support the TRU National Program, which is dedicated to preparing waste for, and emplacing waste in, the Waste Isolation Pilot Plant, (WIPP). Thus, the Savannah River Program also supports WIPP operations. The Savannah River site specific goals to phase out the indefinite storage of TRU waste, which has been the mode of waste management since 1974, and to dispose of Savannah River's Defense TRU waste

  18. Sediment oxygen demand in the lower Willamette River, Oregon, 1994

    Science.gov (United States)

    Caldwell, James M.; Doyle, Micelis C.

    1995-01-01

    An investigation of sediment oxygen demand (SOD) at the interface of the stream and stream bed was performed in the lower Willamette River (river mile 51 to river mile 3) during August, 1994, as part of a cooperative project with the Oregon Department of Environmental Quality. The primary goals of the investigation were to measure the spatial variability of SOD in the lower Willamette River and to relate SOD to bottom-sediment characteristics.

  19. Capacity of the inflow river channels of the Krpelany and Hricov reservoirs with respect to flood control

    International Nuclear Information System (INIS)

    Capekova, Z.

    2004-01-01

    In this presentation author deals with the capacity of the inflow river channels of the Krpelany and Hricov reservoirs with respect to flood control (Vah River, Orava River, Kysuce River and Rajcianka River, Slovakia)

  20. 77 FR 30589 - SteelRiver Infrastructure Partners LP, SteelRiver Infrastructure Associates LLC, SteelRiver...

    Science.gov (United States)

    2012-05-23

    ... will acquire all of the common stock of Patriot from Patriot Rail Holdings LLC, and thereby indirect... America LP, and Patriot Funding LLC--Control Exemption--Patriot Rail Corp., et al. SteelRiver... notice of exemption to acquire control of Patriot Rail Corp. (Patriot) and its rail carrier subsidiaries...

  1. Development of river sediment monitoring in Croatia

    Science.gov (United States)

    Frančišković-Bilinski, Stanislav; Bilinski, Halka; Mlakar, Marina; Maldini, Krešimir

    2017-04-01

    Establishment of regular river sediment monitoring, in addition to water monitoring, is very important. Unlike water, which represents the current state of a particular watercourse, sediment represents a sort of record of the state of pollution in the long run. Sediment monitoring is crucial to gain a real insight into the status of pollution of particular watercourses and to determine trends over a longer period of time. First scientific investigations of river sediment geochemistry in Croatia started 1989 in the Krka River estuary [1], while first systematic research of a river basin in Croatia was performed 2005 in Kupa River drainage basin [2]. Up to now, several detailed studies of both toxic metals and organic pollutants have been conducted in this drainage basin and some other rivers, also Croatian scientists participated in river sediment research in other countries. In 2008 Croatian water authorities (Hrvatske Vode) started preliminary sediment monitoring program, what was successfully conducted. In the first year of preliminary program only 14 stations existed, while in 2014 number of stations increased to 21. Number of monitored watercourses and of analysed parameters also increased. Current plan is to establish permanent monitoring network of river sediments throughout the state. The goal is to set up about 80 stations, which will cover all most important and most contaminated watercourses in all parts of the country [3]. Until the end of the year 2016, regular monitoring was conducted at 31 stations throughout the country. Currently the second phase of sediment monitoring program is in progress. At the moment parameters being determined on particular stations are not uniform. From inorganic compounds it is aimed to determine Cd, Pb, Ni, Hg, Cu, Cr, Zn and As on all stations. The ratio of natural concentrations of those elements vs. anthropogenic influence is being evaluated on all stations. It was found that worse situation is with Ni, Hg and Cr, who

  2. Lower Snake River Juvenile Salmon Migration Feasibility Report/Environmental Impact Statement. Appendix D: Natural River Drawdown Engineering

    National Research Council Canada - National Science Library

    2002-01-01

    ... (collectively called the Lower Snake River Project) and their effects on four lower Snake River salmon and steelhead stocks listed for protection under the Endangered Species Act (ESA). The U.S...

  3. 77 FR 22216 - Drawbridge Operation Regulation; Sacramento River, Sacramento, CA

    Science.gov (United States)

    2012-04-13

    ... Operation Regulation; Sacramento River, Sacramento, CA AGENCY: Coast Guard, DHS. ACTION: Notice of temporary... schedule that governs the Tower Drawbridge across the Sacramento River, mile 59.0, at Sacramento, CA. The... River, at Sacramento, CA. The Tower Drawbridge navigation span provides a vertical clearance of 30 feet...

  4. 78 FR 15878 - Drawbridge Operation Regulations; Sacramento River, Sacramento, CA

    Science.gov (United States)

    2013-03-13

    ... Operation Regulations; Sacramento River, Sacramento, CA AGENCY: Coast Guard, DHS. ACTION: Notice of... operating schedule that governs the Tower Drawbridge across Sacramento River, mile 59.0, at Sacramento, CA... temporary change to the operation of the Tower Drawbridge, mile 59.0, over Sacramento River, at Sacramento...

  5. 77 FR 52599 - Drawbridge Operation Regulation; Sacramento River, Sacramento, CA

    Science.gov (United States)

    2012-08-30

    ... Operation Regulation; Sacramento River, Sacramento, CA AGENCY: Coast Guard, DHS. ACTION: Notice of temporary... regulation that governs the Tower Drawbridge across Sacramento River, mile 59.0, at Sacramento, CA. The... change to the operation of the Tower Drawbridge, mile 59.0, over Sacramento River, at Sacramento, CA. The...

  6. 78 FR 23489 - Drawbridge Operation Regulation; Sacramento River, Sacramento, CA

    Science.gov (United States)

    2013-04-19

    ... Operation Regulation; Sacramento River, Sacramento, CA AGENCY: Coast Guard, DHS. ACTION: Notice of deviation... operating regulation that governs the Tower Drawbridge across Sacramento River, mile 59.0, at Sacramento, CA... Tower Drawbridge, mile 59.0, over Sacramento River, at Sacramento, CA. The Tower Drawbridge navigation...

  7. 76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-05-23

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

  8. 78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

    Science.gov (United States)

    2013-04-24

    ... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

  9. 76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-06-29

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

  10. Particulate matter characterization of Cauca River water in Colombia

    NARCIS (Netherlands)

    Gutierrez Marin, Juan Pablo; van Halem, D.; Rietveld, L.C.

    2016-01-01

    The particulate matter composition in the Upper Cauca River section was studied, considering the importance of this river for the water supply of Cali, Colombia, and the implications that the turbidity of this water source has had for the city's water treatment. Additionally, the upstream Palo River

  11. Potability Evaluation of Selected River Waters in Ebonyi State, Nigeria

    African Journals Online (AJOL)

    The study focused on the seasonal variation of physiochemical and microbial characteristics of three selected river water in Ebonyi State for human consumption. The three selected rivers studied were Iyioka, Idima and Ubei Rivers. Data were generated using Direct Reading Engineering method (DREM), Gravimetric ...

  12. 77 FR 63725 - Drawbridge Operation Regulations; Old River, Orwood, CA

    Science.gov (United States)

    2012-10-17

    ... BNSF Middle River drawbridge as an alternative path for navigation. DATES: The temporary deviation... Operation Regulation; Old River, Orwood CA'' in the Federal Register (77 FR 58491). The temporary deviation... Operation Regulations; Old River, Orwood, CA AGENCY: Coast Guard, DHS. ACTION: Notice of cancellation of a...

  13. 75 FR 38833 - Walker River Basin Acquisition Program

    Science.gov (United States)

    2010-07-06

    ... DEPARTMENT OF THE INTERIOR Bureau of Reclamation Walker River Basin Acquisition Program AGENCY... (Reclamation) is canceling work on the Environmental Impact Statement (EIS) for the Walker River Basin... Walker River, primarily for irrigated agriculture, have resulted in a steadily declining surface...

  14. 76 FR 13312 - Drawbridge Operation Regulations; Fox River, Oshkosh, WI

    Science.gov (United States)

    2011-03-11

    ...-AA09 Drawbridge Operation Regulations; Fox River, Oshkosh, WI AGENCY: Coast Guard, DHS. ACTION: Notice... National Railway Bridge across the Fox River at Mile 55.72 at Oshkosh, Wisconsin. After careful... On December 8, 2010, we published an NPRM entitled Drawbridge Operation Regulation; Fox River...

  15. 76 FR 60732 - Drawbridge Operation Regulations; Navesink (Swimming) River, NJ

    Science.gov (United States)

    2011-09-30

    ... Operation Regulations; Navesink (Swimming) River, NJ AGENCY: Coast Guard, DHS. ACTION: Notice of temporary... (Swimming) River between Oceanic and Locust Point, New Jersey. The deviation is necessary to facilitate...: The Oceanic Bridge, across the Navesink (Swimming) River, mile 4.5, between Oceanic and Locust Point...

  16. Stonefly (Plecoptera) Feeding Modes: Variation Along a California River Continuum

    Science.gov (United States)

    Richard L. Bottorff; Allen W. Knight

    1989-01-01

    The distribution of Plecoptera along a California river was used to test several predictions of the River Continuum Concept about how functional feeding groups should change along a stream's length. Stoneflies were collected from stream orders 1-6 (123 km) of the Cosumnes River continuum in the central Sierra Nevada. The 69 stonefly species collected were...

  17. Knife River Indian Villages National Historic Site: Teacher's Guide.

    Science.gov (United States)

    National Park Service (Dept. of Interior), Washington, DC. National Register of Historic Places.

    This guide provides history and social studies teachers, at all grade levels, with information and activities about the American Indians of the Northern Plains who lived in the area of the Knife River where it enters the Missouri River. Located in what is now North Dakota, this area is the Knife River Indian Villages National Historic Site. The…

  18. Management of Fishery Resources in Yangtze River Estuary

    OpenAIRE

    Li, Meiling; Huang, Shuolin

    2009-01-01

    We introduce the fish fauna composition and main commercial fishes in Yangtze River estuary. We also analyze the current situation of resources and environment in Yangtze River estuary as well as the influential factors. Finally, related countermeasures are put forward on how to protect and use the fishery resources in Yangtze River.

  19. local government headquarters and spatial interaction within rivers

    African Journals Online (AJOL)

    user

    headquarters and rural hinterland settlements in Rivers South East ... of Rivers State is responsible for over seventy percent (70%) of the total employment in the ... even proportion and balanced development for all could not completely ... Rivers West ... agricultural under development, unemployment, poor quality of life due.

  20. Revisiting the homogenization of dammed rivers in the southeastern US

    Science.gov (United States)

    Ryan A. McManamay; Donald J. Orth; Charles A. Dolloff

    2012-01-01

    For some time, ecologists have attempted to make generalizations concerning how disturbances influence natural ecosystems, especially river systems. The existing literature suggests that dams homogenize the hydrologic variability of rivers. However, this might insinuate that dams affect river systems similarly despite a large gradient in natural hydrologic character....

  1. 76 FR 52563 - Special Local Regulations; Sabine River, Orange, TX

    Science.gov (United States)

    2011-08-23

    ...-AA08 Special Local Regulations; Sabine River, Orange, TX AGENCY: Coast Guard, DHS. ACTION: Temporary... Regulations; Sabine River, Orange, TX in the Federal Register (76 FR 103). We received no comments on the... Regulations for Marine Events; Sabine River, Orange, TX. (a) Definitions. As used in this section...

  2. 75 FR 55968 - Special Local Regulations, Sabine River; Orange, TX

    Science.gov (United States)

    2010-09-15

    ...-AA08 Special Local Regulations, Sabine River; Orange, TX AGENCY: Coast Guard, DHS. ACTION: Temporary... Arthur Captain of the Port Zone on the Sabine River, Orange, Texas. This Special Local Regulation is... River, Orange, TX in the Federal Register (75 FR 41119). We received no comments on the proposed rule...

  3. Downstream hydraulic geometry of a tidally influenced river delta

    NARCIS (Netherlands)

    Sassi, M.G.; Hoitink, A.J.F.; Brye, de B.; Deleersnijder, E.

    2012-01-01

    Channel geometry in tidally influenced river deltas can show a mixed scaling behavior between that of river and tidal channel networks, as the channel forming discharge is both of river and tidal origin. We present a method of analysis to quantify the tidal signature on delta morphology, by

  4. Towards a classification of Tanzanian rivers: a bioassessment and ...

    African Journals Online (AJOL)

    River classification is important for reporting ecological status and for the general ecological management of river systems by partitioning natural variability. A priori river classification by abiotic variables and validation of classifications obtained using aquatic macroinvertebrates from reference sites for selected Tanzanian ...

  5. Effects of Green River Project on Cassava Farmers Production in ...

    African Journals Online (AJOL)

    This paper examined the effects of Green River project on cassava farmers' production in Ogba/Egbema/ Ndoni LGA of Rivers State. Purposive and stratified random sampling techniques were used to select the locations of Green River project, cooperative societies and respondents. Using structured questionnaire, a field ...

  6. Evolution of river management: up to integrated and beyond?

    NARCIS (Netherlands)

    Straatsma, M.W.; Nooij, R.J.W. de

    2010-01-01

    Integrated river management is heralded as the new style of river management, but it has been preceded by a number of previous styles, and is unlikely to be the last. This article presents the first analysis of the evolution of river management using Spiral Dynamics (SD). SD provides a growth

  7. 33 CFR 117.591 - Charles River and its tributaries.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Charles River and its tributaries... BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.591 Charles River and its tributaries. (a) The following requirements apply to all bridges across the Charles River and it's...

  8. 78 FR 35756 - Drawbridge Operation Regulations; Charles River, Boston, MA

    Science.gov (United States)

    2013-06-14

    ... Regulations; Charles River, Boston, MA AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation from...) Bridge across the Charles River, mile 1.0, at Boston, Massachusetts. Under this temporary deviation the... Metropolitan District Commission (Craigie) Bridge, across the Charles River, mile 1.0, at Boston, Massachusetts...

  9. 77 FR 57022 - Drawbridge Operation Regulation; Shark River, Avon, NJ

    Science.gov (United States)

    2012-09-17

    ... Operation Regulation; Shark River, Avon, NJ AGENCY: Coast Guard, DHS. ACTION: Notice of temporary deviation... across the Shark River (South Channel), at Avon Township, NJ. This deviation is necessary to facilitate stringer replacement on the Shark River railroad bridge. This temporary deviation will allow the...

  10. 78 FR 77591 - Drawbridge Operation Regulation; Shark River, NJ

    Science.gov (United States)

    2013-12-24

    ... Operation Regulation; Shark River, NJ AGENCY: Coast Guard, DHS. ACTION: Notice of deviation from drawbridge... governs the bascule span of the Route 71 Bridge across Shark River (South Channel), mile 0.8, at Belmar... motor seals and instrumentation on the bridge. The Route 71 Bridge across Shark River (South Channel...

  11. 78 FR 3836 - Drawbridge Operation Regulation; Shark River, Avon, NJ

    Science.gov (United States)

    2013-01-17

    ... Operation Regulation; Shark River, Avon, NJ AGENCY: Coast Guard, DHS. ACTION: Notice of deviation from... and the railroad bridge, mile 0.9 both of which are across the Shark River (South Channel), at Avon Township, NJ. This deviation is necessary to facilitate machinery replacement on the Shark River railroad...

  12. Mechanisms of carbon storage in mountainous headwater rivers

    Science.gov (United States)

    Ellen Wohl; Kathleen Dwire; Nicholas Sutfin; Lina Polvi; Roberto Bazan

    2012-01-01

    Published research emphasizes rapid downstream export of terrestrial carbon from mountainous headwater rivers, but little work focuses on mechanisms that create carbon storage along these rivers, or on the volume of carbon storage. Here we estimate organic carbon stored in diverse valley types of headwater rivers in Rocky Mountain National Park, CO, USA. We show that...

  13. Evaluation of Pollutant Loads: Organic and Inorganic in River ...

    African Journals Online (AJOL)

    This study was carried out to determine the organic and inorganic pollutant loads in River Ukoghor of the Lower Benue Basin. Grab water samples were collected from the outlet of the River into River Benue, twice a month in three replications for a period of eight months (April November, 2002) using sterilized one-litre ...

  14. Global River Discharge and Water Temperature under Climate Change

    NARCIS (Netherlands)

    Vliet, van M.T.H.; Franssen, W.H.P.; Yearsley, J.R.; Ludwig, F.; Haddeland, I.; Lettenmaier, D.P.; Kabat, P.

    2013-01-01

    Climate change will affect hydrologic and thermal regimes of rivers, having a direct impact on freshwater ecosystems and human water use. Here we assess the impact of climate change on global river flows and river water temperatures, and identify regions that might become more critical for

  15. Variable input parameter influence on river corridor prediction

    NARCIS (Netherlands)

    Zerfu, T.; Beevers, L.; Crosato, A.; Wright, N.

    2015-01-01

    This paper considers the erodible river corridor, which is the area in which the main river channel is free to migrate over a period of time. Due to growing anthropogenic pressure, predicting the corridor width has become increasingly important for the planning of development along rivers. Several

  16. 77 FR 24146 - Drawbridge Operation Regulation; Columbia River, Vancouver, WA

    Science.gov (United States)

    2012-04-23

    ... schedule that governs the Burlington Northern Santa Fe (BNSF) Railway Bridge across the Columbia River... span of the BNSF Railway Bridge across the Columbia River will be disabled and the bridge will not be... allows the swing span of the BNSF Railway Bridge across the Columbia River, mile 105.6, to remain in the...

  17. H-ADCP discharge monitoring of a large tropical river

    NARCIS (Netherlands)

    Hidayat, H.; Sassi, M.G.; Vermeulen, B.

    2012-01-01

    River flow can be continuously monitored through velocity measurements with an acoustic Doppler current profiler, deployed horizontally at a river bank (H-ADCP). This approach was adopted to obtain continuous discharge estimates at two cross-sections in the River Mahakam, i.e. at an upstream station

  18. Investigation of the Hydrological Quality of Ethiope River Watershed ...

    African Journals Online (AJOL)

    The surface and groundwater resources of the Ethiope river watershed have been investigated for its hydrological and quality characteristics. The results indicate that Ethiope River is perennial and fed by groundwater seepages, precipitation and surface run-off from adjacent areas. The lowest discharge rate of the river is ...

  19. 77 FR 22530 - Safety Zone; Fireworks, Hudson River, Rhinecliff, NY

    Science.gov (United States)

    2012-04-16

    ...-AA00 Safety Zone; Fireworks, Hudson River, Rhinecliff, NY AGENCY: Coast Guard, DHS. ACTION: Notice of... navigable waters of the Hudson River in the vicinity of Rhinecliff, NY for a fireworks display. This... fireworks displays. This rule is intended to restrict all vessels from a portion of the Hudson River before...

  20. Congener Patterns of Persistent Organic Pollutants Establish the Extent of Contaminant Biotransport by Pacific Salmon in the Great Lakes.

    Science.gov (United States)

    Gerig, Brandon S; Chaloner, Dominic T; Janetski, David J; Rediske, Richard R; O'Keefe, James P; Moerke, Ashley H; Lamberti, Gary A

    2016-01-19

    In the Great Lakes, introduced Pacific salmon (Oncorhynchus spp.) can transport persistent organic pollutants (POPs), such as polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs), to new environments during their spawning migrations. To explore the nature and extent of POP biotransport by salmon, we compared 58 PCB and 6 PBDE congeners found in spawning salmon directly to those in resident stream fish. We hypothesized that stream fish exposed to salmon spawners would have congener patterns similar to those of salmon, the presumed contaminant source. Using permutational multivariate analysis of variance (PERMANOVA) and nonmetric multidimensional scaling (NMDS), we found that POP congener patterns of Pacific salmon varied among regions in the Great Lakes basin (i.e., Lake Huron, Lake Michigan, or Lake Superior), tissue type (whole fish or eggs), and contaminant type (PCB or PBDE). For stream-resident fish, POP congener pattern was influenced by the presence of salmon, location (i.e., Great Lakes Basin), and species identity (i.e., brook trout [Salvelinus fontinalis] or mottled sculpin [Cottus bairdii]). Similarity in congener patterns indicated that salmon are a source of POPs to brook trout in stream reaches receiving salmon spawners from Lake Michigan and Lake Huron but not from Lake Superior. Congener patterns of mottled sculpin differed from those of brook trout and salmon, suggesting that brook trout and mottled sculpin either use salmon tissue to differing degrees, acquire POPs from different dietary sources, or bioaccumulate or metabolize POPs differently. Overall, our analyses identified the important role of salmon in contaminant biotransport but also demonstrated that the extent of salmon-mediated POP transfer and uptake in Great Lakes tributaries is location- and species-specific.

  1. Modeling of Flood Mitigation Structures for Sarawak River Sub-basin Using Info Works River Simulation (RS)

    OpenAIRE

    Rosmina Bustami; Charles Bong; Darrien Mah; Afnie Hamzah; Marina Patrick

    2009-01-01

    The distressing flood scenarios that occur in recent years at the surrounding areas of Sarawak River have left damages of properties and indirectly caused disruptions of productive activities. This study is meant to reconstruct a 100-year flood event that took place in this river basin. Sarawak River Subbasin was chosen and modeled using the one-dimensional hydrodynamic modeling approach using InfoWorks River Simulation (RS), in combination with Geographical Information S...

  2. 76 FR 75543 - Missisquoi River Technologies; Missisquoi River Hydro LLC; Notice of Transfer of Exemption

    Science.gov (United States)

    2011-12-02

    ..., Missisquoi River Technologies informed the Commission that its exemption from licensing for the North Troy..., located at 453 East Hill Rd., Middlesex, VT 05602, is now the exemptee of the North Troy Hydroelectric...

  3. Forestry practices and aquatic biodiversity: Fish

    Science.gov (United States)

    Gresswell, Robert E.

    2005-01-01

    In the Pacific Northwest, fish communities are found in a diverse array of aquatic habitats ranging from the large coastal rivers of the temperate rainforests, to the fragmented and sometimes ephemeral streams of the xeric interior basins, and high-elevation streams and lakes in the mountainous areas (Rieman et al. 2003). Only high-elevation lakes and streams isolated above barriers to fish passage remained historically devoid of fish because they were never invaded following Pleistocene glaciation (Smith 1981). Despite this widespread distribution and once great population abundances, taxonomic diversity of fishes in these forested systems is naturally lower than in aquatic habitats in the eastern U.S. (Reeves, Bisson, and Dambacher 1998). Interactions among factors that influence species richness in aquatic systems (e.g., basin size, long-term stability of habitat, and barriers to colonization; Smith 1981) continue to influence the occurrence and persistence of fishes in these systems today. Consequently, the larger low-elevation rivers and estuaries support the greatest variety of fish species. In the high-elevation tributary streams, fish communities are less complex because these aquatic systems were less climatically and geologically stable, and fish populations were smaller and more prone to local extirpation. Furthermore, barriers to fish passage inhibited dispersal and colonization (Smith 1981). Streams in forested landscapes generally support salmon and trout, Oncorhynchus spp., whitefish Prosopium spp., sculpins Cottus spp., suckers Catostomus spp., and minnows (Cyprinidae), but in some of the colder streams, chars (e.g., Salvelinus confluentus and Salvelinus malma) and lampreys (Petromyzontidae)may also occur (Rieman et al. 2003).Although biodiversity defined in terms of fish species richness is low in the Pacific Northwest, intraspecific variability is high, and polytypic fish species are common in the diverse aquatic habitats of the region. For

  4. Comparative analysis of the shape of the perch from Techa river and Miass river

    Energy Technology Data Exchange (ETDEWEB)

    Osipov, D.; Pryakhin, E. [Urals Research Center for Radiation Medicine - URCRM (Russian Federation); Rudolfsen, G. [Norwegian Radiation Protection Authority (NRPA) and University of Tromsoe (Norway); Yegoreichenkov, E. [Urals Research Center for Radiation Medicine (Russian Federation)

    2014-07-01

    The adaptation to environmental conditions can be accompanied by morphological changes. Description of morphological differences in animal populations could reveal differences habitat, both abiotic and biotic factors. In our study we examined if fish habituating river with different activity concentration of radionuclides differ in geometric morphometry. Geometric morphometry makes it possible to identify morphological differences between objects on the basis of the form, without influence of the 'size factor'. The approach is based on a multivariate analysis of the coordinates of marks, placed on the surface of the morphological object in accordance with certain rules. We used perch (Perca fluviatilis Linnaeus, 1758) as a study species as it is a common, and widespread species of freshwater fish in moderate and subarctic latitudes of Eurasia and North America. Perch is characterized by high flexibility of morphology in relation to environmental differences. We investigated body shape and its changes with the growth in perch that live in Techa River under chronic radiation exposure and perch in the control river Miass. The alignment of digital image tags that characterize the shape of the fish's body, was implemented in the program TPSdig. Further analysis was performed using the package geomorph for R statistical software. The study showed statistically significant (F{sub 1,95}=12.69, p=0.01) differences in body shape of perch from Techa river and Miass river. Perch living in the Techa River are relatively shorter and higher. Further, perch in Techa is characterized by a smaller size of the eyes. For both populations the contribution of allometric component to shape change was observed: smaller animals have a shape similar to the Miass river perch population. With increase of body size, shape of the perch becomes similar to that of the Techa's perch population. Significant differences were observed only for young animals from the two rivers

  5. Towards Biological Restoration of Tehran Megalopolis River Valleys- Case Study: Farahzad River

    Science.gov (United States)

    Samadi, Nafishe; Oveis Torabi, Seyed; Akhani, Hossein

    2017-04-01

    Towards biological restoration of Tehran megalopolis river-valleys: case study Farahzad river 1Nafiseh Samadi, 2OveisTorabi, 3Hossein Akhani 1Mahsab Shargh Company, Tehran ,Iran, nafiseh19@gmail.com 2 Mahsab Shargh Company, Tehran ,Iran, weg@tna-co.com 3Department of Plant Sciences, Halophytes and C4 Research Laboratory, School of Biology, College of Sciences, University of Tehran, PO Box 14155-6455, Tehran, Iran, akhani@khayam.ut.ac.ir Tehran is located in northcentral parts of Iran on the alluvium of southern Alborz Mountains. Seven rivers originated from the highlands of N Tehran run inside and around the city. Many of these river valleys have been deformed by a variety of urban utilizations such as garden, building, canal, park, autobahn etc. Tehran with more than eight million populations suffered from adverse environmental conditions such as pollution and scarcity of natural habitats for recreational activities. Ecological restoration of altered river valleys of Tehran is one of the priorities of Tehran municipality started as a pilot project in Farahzad river. Intensive disturbance, conversion into various urban utilization, illegal building construction, waste water release into the river, garbage accumulation, artificial park constructions and domination of invasive species have largely altered the river. Parts of the river located in Pardisan Nature Park was studied before its complete deformation into a modern park. The riparian vegetation consisted of Tamarix ramosissima and Salix acmophylla shrubs with large number of aquatic and palustric plants. The norther parts of the river still contain semi-natural vegetation which change into patchy and intensive degraded habitats towards its southern parts. In northern parts of valley there are old gardens of Morus alba and Juglans regia, and planted trees such as Plataneus oreientalis and Acer negundo. Salix acmophylla, Fraxinus excelsior and Celtis caucasica are native species growing on river margin or

  6. Bedload transport in a river confluence

    Science.gov (United States)

    Martín-Vide, J. P.; Plana-Casado, A.; Sambola, A.; Capapé, S.

    2015-12-01

    The confluence of the regulated Toltén River and its tributary the unregulated Allipén (south of Chile) has proved dynamic in the last decade. Daily bedload measurements with a Helley-Smith sampler, bed surveys, and grain-size distributions of the two rivers are obtained from a field campaign that lasts 3 months in high-flow season. The goals are to quantify total bedload and to understand the balance between tributary and main river and the bedload distribution in space and texture. The bedload transport varies 200-fold, with a maximum of 5000 t/day. The discharge varies five-fold, with a maximum of 900 m3/s. Two-thirds of the total bedload volume are transported through the deeper area of the cross section and gravel is predominant (64%). Average bedload volumes in the confluence seem unbalanced in favour of the tributary. Main river bedload transport is predominantly at below-capacity conditions, while the tributary bedload transport is at-capacity conditions. This is deemed the main reason of inaccuracy of the bedload predictors. The roles of entrainment into suspension, helical flow, partial transport, and mobile armour are discussed.

  7. in River Oluwa, Ondo State, Nigeria

    African Journals Online (AJOL)

    Administrator

    The natural foods of Ctenopoma pethereci from River Oluwa in Ondo State, South-west Nigeria, were ... constituted 0.83% of the body weight while food in the intestine formed 1.54%, thus, giving ... South East Asian countries, where the group.

  8. Salvage excavations at the Tokanui River mouth

    International Nuclear Information System (INIS)

    Jacomb, C.

    2011-01-01

    Over the past three years, invstigations have been undertaken at three sites in eastern Foveaux Strait that are particularly severely threatened by coastal erosion. The last of these three sites is at the mouth of the Tokanui River, near Fortrose. (author). 16 refs., 15 figs., 1 tab.

  9. Climatology of the interior Columbia River basin.

    Science.gov (United States)

    Sue A. Ferguson

    1999-01-01

    This work describes climate means and trends in each of three major ecological zones and 13 ecological reporting units in the interior Columbia River basin. Widely differing climates help define each major zone and reporting unit, the pattern of which is controlled by three competing air masses: marine, continental, and arctic. Paleoclimatic evidence and historical...

  10. Climate change adaptation in European river basins

    NARCIS (Netherlands)

    Huntjens, P.; Pahl-Wostl, C.; Grin, J.

    2010-01-01

    This paper contains an assessment and standardized comparative analysis of the current water management regimes in four case-studies in three European river basins: the Hungarian part of the Upper Tisza, the Ukrainian part of the Upper Tisza (also called Zacarpathian Tisza), Alentejo Region

  11. Hydrological study of La Paz river basin

    International Nuclear Information System (INIS)

    Ramos, German F.; Garcia Agudo, Edmundo; Quiroga, F.; Tarquino, W.; Diaz, J.; Suxo, Cl.; Mansilla, A.; Rojas, M.

    1998-01-01

    This work aims to determine the hydrological parameters for the La Paz river, by using tracer techniques and also the determination of the water quality parameters for the study of the behavior along the stream. This study intends the prediction and control of the water contamination by using mathematical modelling

  12. Land Use Baseline Report Savannah River Site

    International Nuclear Information System (INIS)

    Noah, J.C.

    1995-01-01

    This document is to serve as a resource for Savannah River Site managers, planners, and SRS stakeholders by providing a general description of the site and land-use factors important to future use decisions and plans. The intent of this document is to be comprehensive in its review of SRS and the surrounding area

  13. Modelling qualitative knowledge for strategic river management

    NARCIS (Netherlands)

    Janssen, Judith

    2009-01-01

    In decision making processes on strategic river management, use of models is not as great as the research efforts in the field of model application might suggest they could be. Both the fact that the development of many models remains restricted to readily available data and pre-existing models,

  14. LOGISTICS OF ECOLOGICAL SAMPLING ON LARGE RIVERS

    Science.gov (United States)

    The objectives of this document are to provide an overview of the logistical problems associated with the ecological sampling of boatable rivers and to suggest solutions to those problems. It is intended to be used as a resource for individuals preparing to collect biological dat...

  15. The Savannah River Site's groundwater monitoring program

    International Nuclear Information System (INIS)

    1991-01-01

    This report summarizes the Savannah River Site (SRS) groundwater monitoring program conducted by EPD/EMS in the first quarter of 1991. In includes the analytical data, field data, data review, quality control, and other documentation for this program, provides a record of the program's activities and rationale, and serves as an official document of the analytical results

  16. Stock characteristics of Hudson River striped bass

    International Nuclear Information System (INIS)

    Hoff, T.B.; McLaren, J.B.; Cooper, J.C.

    1988-01-01

    Striped bass, because of their tremendous popularity both commercially and recreationally, were a principal focus of the Hudson River power plant case. Between 1976 and 1979, over 23,000 age-II and older striped bass were studied as one facet of an extensive research program on the spring population in the Hudson River. Samples were collected from the overwintering as well as the spawning portion of the striped bass population, and included immature as well as mature fish. At least 12 age-groups contributed to spawning each year. Of these 12, age-groups III, IV, and V usually were most abundant, but the percentage of the population represented by any single age-group varied as the result of fluctuations in year-class strength. Males first became sexually mature at age II and females at age IV. Fast-growing individuals within a year class tended to mature earlier. Fecundity increased with the size of fish, reaching an observed maximum of about 3 million eggs per female. Although significant annual variations in maturity and growth were detected for Hudson River striped bass, there was no evidence of a consistent change in either variable that might be associated with increasing power plant operations and a reduction in striped bass abundance. Age at maturity and age structure are the two life history components that differ the most between the Hudson River population and other striped bass populations. 36 refs., 7 tabs

  17. Microplastics profile along the Rhine River

    Science.gov (United States)

    Mani, Thomas; Hauk, Armin; Walter, Ulrich; Burkhardt-Holm, Patricia

    2015-01-01

    Microplastics result from fragmentation of plastic debris or are released to the environment as pre-production pellets or components of consumer and industrial products. In the oceans, they contribute to the ‘great garbage patches’. They are ingested by many organisms, from protozoa to baleen whales, and pose a threat to the aquatic fauna. Although as much as 80% of marine debris originates from land, little attention was given to the role of rivers as debris pathways to the sea. Worldwide, not a single great river has yet been studied for the surface microplastics load over its length. We report the abundance and composition of microplastics at the surface of the Rhine, one of the largest European rivers. Measurements were made at 11 locations over a stretch of 820 km. Microplastics were found in all samples, with 892,777 particles km −2 on average. In the Rhine-Ruhr metropolitan area, a peak concentration of 3.9 million particles km −2 was measured. Microplastics concentrations were diverse along and across the river, reflecting various sources and sinks such as waste water treatment plants, tributaries and weirs. Measures should be implemented to avoid and reduce the pollution with anthropogenic litter in aquatic ecosystems. PMID:26644346

  18. Three run-of-river power plants

    International Nuclear Information System (INIS)

    1992-01-01

    Three 'run-of-river' hydroelectric power plants in the Montreal area in the province of Quebec were described visually and in sound. A run-of-river generating station is one that has no reservoir behind the generating facilities. Instead of a reservoir, the generating station draws its power from the strong flow of the whole river as it passes through the turbines. The first generating station described was the Beauharnois power plant completed in 1963 which became the most powerful generating station in Canada at that time. Today, it ranks fourth after the La Grande complex. In winter, it supplies electricity primarily to the Quebec power system, but between April and November, 90 per cent of its power is destined for export. The Carillon power station on the Ottawa River, the second to be discussed in this videotape presentation, was completed in 1964 with a total generating capacity of 654 MW. Today, it is the tenth largest of its kind in Quebec. The Rivieres des Prairies generating station, the third and last one described was completed in 1930; today it has a generating capacity of 45 MW. Some of the efforts made by Hydro-Quebec to protect and enhance the natural environment were shown in action, including regular removal and recycling of debris at the gateways to the generating stations, construction of fish spawning ladders, and the control of zebra mussels

  19. Flooding Capability for River-based Scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Curtis L. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Prescott, Steven [Idaho National Lab. (INL), Idaho Falls, ID (United States); Ryan, Emerald [Idaho State Univ., Pocatello, ID (United States); Calhoun, Donna [Boise State Univ., ID (United States); Sampath, Ramprasad [Centroid Labs., Los Angeles, CA (United States); Anderson, S. Danielle [Idaho National Lab. (INL), Idaho Falls, ID (United States); Casteneda, Cody [Boise State Univ., ID (United States)

    2015-10-01

    This report describes the initial investigation into modeling and simulation tools for application of riverine flooding representation as part of the Risk-Informed Safety Margin Characterization (RISMC) Pathway external hazards evaluations. The report provides examples of different flooding conditions and scenarios that could impact river and watershed systems. Both 2D and 3D modeling approaches are described.

  20. Carolina bays of the Savannah River Plant

    Energy Technology Data Exchange (ETDEWEB)

    Schalles, J.F. (Creighton Univ., Omaha, NE (USA)); Sharitz, R.R.; Gibbons, J.W.; Leversee, G.J.; Knox, J.N. (Savannah River Ecology Lab., Aiken, SC (USA))

    1989-01-01

    Much of the research to date on the Carolina bays of the Savannah River Plant and elsewhere has focused on certain species or on environmental features. Different levels of detail exist for different groups of organisms and reflect the diverse interests of previous investigators. This report summarizes aspects of research to date and presents data from numerous studies. 70 refs., 14 figs., 12 tabs.