WorldWideScience

Sample records for risk assessment sara

  1. System Analysis and Risk Assessment system (SARA) Version 4.0

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis

  2. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  3. System Analysis and Risk Assessment System (SARA), Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

    1992-02-01

    This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

  4. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities

  5. A perspective of PC-based probabilistic risk assessment

    International Nuclear Information System (INIS)

    Sattison, M.B.; Rasmuson, D.M.; Robinson, R.C.; Russell, K.D.; Van Siclen, V.S.

    1987-01-01

    Probabilistic risk assessment (PRA) information has been under-utilized in the past due to the large effort required to input the PRA data and the large expense of the computers needed to run PRA codes. The microcomputer-based Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) System, under development at the Idaho National Engineering Laboratory, have greatly enhanced the ability of managers to use PRA techniques in their decision-making. IRRAS is a tool that allows an analyst to create, modify, update, and reanalyze a plant PRA to keep the risk assessment current with the plant's configuration and operation. The SARA system is used to perform sensitivity studies on the results of a PRA. This type of analysis can be used to evaluate proposed changes to a plant or its operation. The success of these two software projects demonstrate that risk information can be made readily available to those that need it. This is the first step in the development of a true risk management capability

  6. Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

    Science.gov (United States)

    O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

    2008-04-01

    Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.

  7. 2012 SARA Students Technical Report

    International Nuclear Information System (INIS)

    Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

    2012-01-01

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of

  8. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  9. [Forensic assessment of violence risk].

    Science.gov (United States)

    Pujol Robinat, Amadeo; Mohíno Justes, Susana; Gómez-Durán, Esperanza L

    2014-03-01

    Over the last 20 years there have been steps forward in the field of scientific research on prediction and handling different violent behaviors. In this work we go over the classic concept of "criminal dangerousness" and the more current of "violence risk assessment". We analyze the evolution of such assessment from the practice of non-structured clinical expert opinion to current actuarial methods and structured clinical expert opinion. Next we approach the problem of assessing physical violence risk analyzing the HCR-20 (Assessing Risk for Violence) and we also review the classic and complex subject of the relation between mental disease and violence. One of the most problematic types of violence, difficult to assess and predict, is sexual violence. We study the different actuarial and sexual violence risk prediction instruments and in the end we advise an integral approach to the problem. We also go through partner violence risk assessment, describing the most frequently used scales, especially SARA (Spouse Assault Risk Assessment) and EPV-R. Finally we give practical advice on risk assessment, emphasizing the importance of having maximum information about the case, carrying out a clinical examination, psychopathologic exploration and the application of one of the described risk assessment scales. We'll have to express an opinion about the dangerousness/risk of future violence from the subject and some recommendations on the conduct to follow and the most advisable treatment. Copyright © 2014 Elsevier España, S.L. All rights reserved.

  10. News developments at Sara

    International Nuclear Information System (INIS)

    Belmont, J.L.; Fruneau, M.; Martin, P.

    1989-05-01

    SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration

  11. Interpreting the SARA and RCRA training requirements

    International Nuclear Information System (INIS)

    Moreland, W.M.; Wells, S.M.

    1987-01-01

    The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements

  12. SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

    1993-01-01

    This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix

  13. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  14. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  15. Layering of life (Sara novel of Peter Sarić

    Directory of Open Access Journals (Sweden)

    Kostić Dragomir J.

    2015-01-01

    Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safe­guard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.

  16. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  17. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  18. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  19. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  20. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

  1. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  2. Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

    Directory of Open Access Journals (Sweden)

    Tiara Kharisma

    2017-12-01

    Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.

  3. Trends in extinction risk for imperiled species in Canada.

    Directory of Open Access Journals (Sweden)

    Brett Favaro

    Full Text Available Protecting and promoting recovery of species at risk of extinction is a critical component of biodiversity conservation. In Canada, the Committee on the Status of Endangered Wildlife in Canada (COSEWIC determines whether species are at risk of extinction or extirpation, and has conducted these assessments since 1977. We examined trends in COSEWIC assessments to identify whether at-risk species that have been assessed more than once tended to improve, remain constant, or deteriorate in status, as a way of assessing the effectiveness of biodiversity conservation in Canada. Of 369 species that met our criteria for examination, 115 deteriorated, 202 remained unchanged, and 52 improved in status. Only 20 species (5.4% improved to the point where they were 'not at risk', and five of those were due to increased sampling efforts rather than an increase in population size. Species outcomes were also dependent on the severity of their initial assessment; for example, 47% of species that were initially listed as special concern deteriorated between assessments. After receiving an at-risk assessment by COSEWIC, a species is considered for listing under the federal Species at Risk Act (SARA, which is the primary national tool that mandates protection for at-risk species. We examined whether SARA-listing was associated with improved COSEWIC assessment outcomes relative to unlisted species. Of 305 species that had multiple assessments and were SARA-listed, 221 were listed at a level that required identification and protection of critical habitat; however, critical habitat was fully identified for only 56 of these species. We suggest that the Canadian government should formally identify and protect critical habitat, as is required by existing legislation. In addition, our finding that at-risk species in Canada rarely recover leads us to recommend that every effort be made to actively prevent species from becoming at-risk in the first place.

  4. Concurrent software system design supported by SARA at the age of one

    Energy Technology Data Exchange (ETDEWEB)

    Campos, I.M.; Estrin, G.

    A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.

  5. SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

    International Nuclear Information System (INIS)

    Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

    2015-01-01

    SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index

  6. Risk management at hazardous waste sites

    International Nuclear Information System (INIS)

    Travis, C.C.; Doty, C.B.

    1990-01-01

    The Superfund Amendments and Reauthorization Act of 1986 (SARA) provided the Environmental Protection Agency (EPA) with additional resources and direction for the identification, evaluation, and remediation of hazardous waste sites in the United States. SARA established more stringent requirements for the Superfund program, both in terms of the pace of the program and the types of remedial alternatives selected. The central requirement is that remedial alternatives be ''protective of public health and the environment'' and ''significantly and permanently'' reduce the toxicity, mobility, or volume of contaminants. The mandate also requires that potential risk be considered in the decision-making process. This document discusses risk management at hazardous waste sites. Topics include selection of sites for placement on the National Priority List, risk assessment and the decision process, risk reduction and remedial alternative selection, and aquifer restoration. 10 refs., 2 figs

  7. Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

    Directory of Open Access Journals (Sweden)

    Mohammad Supriyadi

    2015-12-01

    Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  11. Reference manual for toxicity and exposure assessment and risk characterization. CERCLA Baseline Risk Assessment

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-01

    The Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA, 1980) (CERCLA or Superfund) was enacted to provide a program for identifying and responding to releases of hazardous substances into the environment. The Superfund Amendments and Reauthorization Act (SARA, 1986) was enacted to strengthen CERCLA by requiring that site clean-ups be permanent, and that they use treatments that significantly reduce the volume, toxicity, or mobility of hazardous pollutants. The National Oil and Hazardous Substances Pollution Contingency Plan (NCP) (USEPA, 1985; USEPA, 1990) implements the CERCLA statute, presenting a process for (1) identifying and prioritizing sites requiring remediation and (2) assessing the extent of remedial action required at each site. The process includes performing two studies: a Remedial Investigation (RI) to evaluate the nature, extent, and expected consequences of site contamination, and a Feasibility Study (FS) to select an appropriate remedial alternative adequate to reduce such risks to acceptable levels. An integral part of the RI is the evaluation of human health risks posed by hazardous substance releases. This risk evaluation serves a number of purposes within the overall context of the RI/FS process, the most essential of which is to provide an understanding of ``baseline`` risks posed by a given site. Baseline risks are those risks that would exist if no remediation or institutional controls are applied at a site. This document was written to (1) guide risk assessors through the process of interpreting EPA BRA policy and (2) help risk assessors to discuss EPA policy with regulators, decision makers, and stakeholders as it relates to conditions at a particular DOE site.

  12. Reference manual for toxicity and exposure assessment and risk characterization. CERCLA Baseline Risk Assessment

    International Nuclear Information System (INIS)

    1995-03-01

    The Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA, 1980) (CERCLA or Superfund) was enacted to provide a program for identifying and responding to releases of hazardous substances into the environment. The Superfund Amendments and Reauthorization Act (SARA, 1986) was enacted to strengthen CERCLA by requiring that site clean-ups be permanent, and that they use treatments that significantly reduce the volume, toxicity, or mobility of hazardous pollutants. The National Oil and Hazardous Substances Pollution Contingency Plan (NCP) (USEPA, 1985; USEPA, 1990) implements the CERCLA statute, presenting a process for (1) identifying and prioritizing sites requiring remediation and (2) assessing the extent of remedial action required at each site. The process includes performing two studies: a Remedial Investigation (RI) to evaluate the nature, extent, and expected consequences of site contamination, and a Feasibility Study (FS) to select an appropriate remedial alternative adequate to reduce such risks to acceptable levels. An integral part of the RI is the evaluation of human health risks posed by hazardous substance releases. This risk evaluation serves a number of purposes within the overall context of the RI/FS process, the most essential of which is to provide an understanding of ''baseline'' risks posed by a given site. Baseline risks are those risks that would exist if no remediation or institutional controls are applied at a site. This document was written to (1) guide risk assessors through the process of interpreting EPA BRA policy and (2) help risk assessors to discuss EPA policy with regulators, decision makers, and stakeholders as it relates to conditions at a particular DOE site

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  2. Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

    Directory of Open Access Journals (Sweden)

    X. Y. Jiang

    2014-08-01

    Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  13. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  14. Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

    International Nuclear Information System (INIS)

    Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

    1983-09-01

    S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron

  15. Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

    Science.gov (United States)

    Zhao, Bryan M; Hoffmann, F Michael

    2006-09-01

    Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  17. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  18. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...

  19. Oil and gas property transfers: Analyzing the environmental risk through the environmental site assessment process

    International Nuclear Information System (INIS)

    Bratberg, D.; Hocker, S.

    1994-01-01

    The Superfund Act made anyone buying contaminated real estate liable for cleanup costs whether they know about the contamination or contributed to the contamination. In 1986, SARA amended the Superfund Act to include a provision known as the ''Innocent Landowner Defense.'' This provision created a defense for purchasers of contaminated property who did not contribute to the contamination and had no reason to believe that the property was contaminated at the time of the real estate transfer. SARA allows the purchasers and lenders to perform an environmental assessment using ''due diligence'' to identify contamination problems existing at a site. Since the passing of SARA, the environmental site assessment (ESA) process has become commonplace during the transfer of commercial real estate. Since the introduction of SARA, many professional associations, governmental agencies, and proposed federal legislation have struggled to produce a standard for conducting Phase 1 ESAs. Only recently has a standard been produced. Until recently, the domestic oil and gas industry has been relatively unconcerned about the Superfund liability issues. This approach was created by Congress's decision in 1980 to temporarily exempt the majority of oil and gas exploration and production wastes from federal hazardous waste rulings. However, new stringent rules governing oil and gas waste management practices are being considered by federal and state regulatory agencies. Based upon this knowledge and the awakening of public awareness, the use of ESAs for oil and gas transactions is increasing

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  4. Assessing the viability of the Species at Risk Act in managing commercial exploitation and recovery of threatened and endangered marine fish in Canada

    OpenAIRE

    Druce, Courtney Danielle

    2012-01-01

    Commercially exploited threatened or endangered marine fish are consistently declined for listing under Canada’s Species at Risk Act (SARA), largely due to predicted socio-economic impacts associated with SARA’s prohibitions. However, commercial exploitation can be exempted from SARA’s general prohibitions. If exemptions were utilized, commercially exploited species could benefit from other aspects of SARA listing, and support continued economic opportunities for fishers. I conducted a litera...

  5. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  7. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  8. DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

    Directory of Open Access Journals (Sweden)

    Fredy Alberto Reyes

    2012-06-01

    Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p

  9. Severe accident recriticality analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

    2001-11-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

  10. Severe accident recriticality analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

    2001-01-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady

  11. Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

    Science.gov (United States)

    Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

    2011-09-01

    The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.

  12. Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

    Directory of Open Access Journals (Sweden)

    P. Balamurugan

    2017-07-01

    Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.

  13. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  14. Transferring generic SARA/OSHA training to US Department of Energy facilities

    International Nuclear Information System (INIS)

    White, A.; McKinley, T.

    1989-01-01

    The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...

  16. SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-05-01

    Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.

  17. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  18. Severe Accident Recriticality Analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  19. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  20. Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

    Directory of Open Access Journals (Sweden)

    Tjitske F. Lawerman

    2017-12-01

    Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  2. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

    DEFF Research Database (Denmark)

    Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

    2017-01-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...

  3. Risk-based management system development for the Advanced Test Reactor

    International Nuclear Information System (INIS)

    Davis, M.L.; Eide, S.A.

    1990-01-01

    A Risk-Based Management System (RBMS) is being developed to facilitate the use of the Advanced Test Reactor (ATR) probabilistic risk assessment to support ATR operation. Most ATR RBMS questions can best be answered using the System Analysis and Risk Assessment System (SARA) developed at the Idaho National Engineering Laboratory. However, some applications may require employment of the other four codes used to develop and report the PRA. These four codes include the Integrated Reliability and Risk Analysis System (IRRAS), SETS, ETA-II, and the Nuclear Computerized Library for Assessing Reactor Reliability (NUCLARR). The ATR RBMS will evolve over three years, and will include the results of the Level 3 and external events analysis

  4. Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

    Directory of Open Access Journals (Sweden)

    Grit Grigoleit

    2011-03-01

    Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.

  5. Layering of life (Sara novel of Peter Sarić)

    OpenAIRE

    Kostić, Dragomir J.

    2015-01-01

    Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  7. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  8. Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

    OpenAIRE

    Beaulé, Sophie

    2014-01-01

    With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...

  9. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

  10. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...

  11. A simple blowdown code for SUPER-SARA loop conditions

    International Nuclear Information System (INIS)

    Fritz, G.

    1981-01-01

    The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  14. Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

    1995-01-01

    Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs

  15. Ecological risk assessment guidance for preparation of remedial investigation/feasibility study work plans

    International Nuclear Information System (INIS)

    Pentecost, E.D.; Vinikour, W.S.

    1993-08-01

    This guidance document (1) provides instructions on preparing the components of an ecological work plan to complement the overall site remedial assessment investigation/feasibility study (RI/FS) work plan and (2) directs the user on how to implement ecological tasks identified in the plan. Under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA), as amended by the Superfired Amendments and Reauthorization Act of 1986 (SARA), an RI/FS work plan win have to be developed as part of the site-remediation scoping the process. Specific guidance on the RI/FS process and the preparation of work plans has been developed by the US Environmental Protection Agency (EPA 1988a). This document provides guidance to US Department of Energy (DOE) staff and contractor personnel for incorporation of ecological information into environmental remediation planning and decision making at CERCLA sites. An overview analysis of early ecological risk assessment methods (i.e., in the 1980s) at Superfund sites was conducted by the EPA (1989a). That review provided a perspective of attention given to ecological issues in some of the first RI/FS studies. By itself, that reference is of somewhat limited value; it does, however, establish a basis for comparison of past practices in ecological risk with current, more refined methods

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  18. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  19. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  20. Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

    Directory of Open Access Journals (Sweden)

    Iserhard, C. A.

    2010-01-01

    Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.

  1. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  2. Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

    Science.gov (United States)

    Venkataraman, Rohini; Yusuf, Kamran

    2017-01-01

    Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.

  3. Land-use evaluation for sustainable construction in a protected area: A case of Sara mountain national park.

    Science.gov (United States)

    Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena

    2018-01-15

    The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  5. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  6. Challenges in Risk Assessment: Quantitative Risk Assessment

    OpenAIRE

    Jacxsens, Liesbeth; Uyttendaele, Mieke; De Meulenaer, Bruno

    2016-01-01

    The process of risk analysis consists out of three components, risk assessment, risk management and risk communication. These components are internationally well spread by Codex Alimentarius Commission as being the basis for setting science based standards, criteria on food safety hazards, e.g. setting maximum limits of mycotoxins in foodstuffs. However, the technical component risk assessment is hard to elaborate and to understand. Key in a risk assessment is the translation of biological or...

  7. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  8. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  9. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  10. AFSC/REFM: Alaska Stock Assessment Results Archive (SARA)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Each year over 50 Alaskan groundfish stock assessments report the condition of Alaskan fisheries resources in the U.S. Exclusive Economic Zone. Stock assessment...

  11. Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

    International Nuclear Information System (INIS)

    Bouldjedri, A.

    1992-06-01

    This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements

  12. Systems analysis programs for hands-on integrated reliability evaluations (SAPHIRE) version 5.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Kvarfordt, K.J.; Skinner, N.L.; Wood, S.T.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs), primarily for nuclear power plants. This volume is the reference manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA database contains PRA data primarily for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility databases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs that may be printed for reports. A preliminary version of the SARA program was completed in August 1985 and has undergone several updates in response to user suggestions and to maintain compatibility with the other SAPHIRE programs. Version 5.0 of SARA provides the same capability as earlier versions and adds the ability to process unlimited cut sets; display fire, flood, and seismic data; and perform more powerful cut set editing

  13. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  14. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  15. Risk assessment

    International Nuclear Information System (INIS)

    Kinchin, G.H.

    1983-01-01

    After defining risk and introducing the concept of individual and societal risk, the author considers each of these, restricting considerations to risk of death. Some probabilities of death arising from various causes are quoted, and attention drawn to the care necessary in making comparisons between sets of data and to the distinction between voluntary and involuntary categories and between early and delayed deaths. The presentation of information on societal risk is discussed and examples given. The history of quantified risk assessment is outlined, particularly related to the nuclear industry, the process of assessing risk discussed: identification of hazard causes, the development of accident chains and the use of event trees, the evaluation of probability through the collection of data and their use with fault trees, and the assessment of consequences of hazards in terms of fatalities. Reference is made to the human element and common-made failures, and to studies supporting the development of reliability assessment techniques. Acceptance criteria are discussed for individual and societal risk in the nuclear field, and it is shown that proposed criteria lead to risks conservative by comparison with risks from day-to-day accidents and other potentially hazardous industries. (U.K.)

  16. Risk Assessment Overview

    Science.gov (United States)

    Prassinos, Peter G.; Lyver, John W., IV; Bui, Chinh T.

    2011-01-01

    Risk assessment is used in many industries to identify and manage risks. Initially developed for use on aeronautical and nuclear systems, risk assessment has been applied to transportation, chemical, computer, financial, and security systems among others. It is used to gain an understanding of the weaknesses or vulnerabilities in a system so modification can be made to increase operability, efficiency, and safety and to reduce failure and down-time. Risk assessment results are primary inputs to risk-informed decision making; where risk information including uncertainty is used along with other pertinent information to assist management in the decision-making process. Therefore, to be useful, a risk assessment must be directed at specific objectives. As the world embraces the globalization of trade and manufacturing, understanding the associated risk become important to decision making. Applying risk assessment techniques to a global system of development, manufacturing, and transportation can provide insight into how the system can fail, the likelihood of system failure and the consequences of system failure. The risk assessment can identify those elements that contribute most to risk and identify measures to prevent and mitigate failures, disruptions, and damaging outcomes. In addition, risk associated with public and environment impact can be identified. The risk insights gained can be applied to making decisions concerning suitable development and manufacturing locations, supply chains, and transportation strategies. While risk assessment has been mostly applied to mechanical and electrical systems, the concepts and techniques can be applied across other systems and activities. This paper provides a basic overview of the development of a risk assessment.

  17. Os suínos da raça Bísara – oportunidades e desafios

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...

  18. Introduction to risk assessment

    International Nuclear Information System (INIS)

    Raina, V.M.

    2002-01-01

    This paper gives an introduction to risk assessment. It discusses the basic concepts of risk assessment, nuclear risk assessment process and products, the role of risk assessment products in nuclear safety assurance, the relationship between risk assessment and other safety analysis and risk assessment and safe operating envelope

  19. Cumulative Risk Assessment (CRA): transforming the way we assess health risks.

    Science.gov (United States)

    Williams, Pamela R D; Dotson, G Scott; Maier, Andrew

    2012-10-16

    Human health risk assessments continue to evolve and now focus on the need for cumulative risk assessment (CRA). CRA involves assessing the combined risk from coexposure to multiple chemical and nonchemical stressors for varying health effects. CRAs are broader in scope than traditional chemical risk assessments because they allow for a more comprehensive evaluation of the interaction between different stressors and their combined impact on human health. Future directions of CRA include greater emphasis on local-level community-based assessments; integrating environmental, occupational, community, and individual risk factors; and identifying and implementing common frameworks and risk metrics for incorporating multiple stressors.

  20. Are doctors risk takers?

    Directory of Open Access Journals (Sweden)

    Pikkel D

    2016-06-01

    Full Text Available Dvora Pikkel,1 Yael Sara Pikkel Igal,2 Adi Sharabi-Nov,3,4 Joseph Pikkel2,51Risk Management and Patient Safety Unit, Assuta Medical Center, Ramat Hahayal, Tel Aviv, 2Faculty of Medicine, Bar-Ilan University, 3Research Wing, Ziv Medical Center, Safed, 4Tel-Hai Academic College, Upper Galilee, 5Department of Ophthalmology, Ziv Medical Center, Safed, Israel Objective: Risk taking affects human behavior in general and decisions in medicine in particular. We used game theory to assess physicians' risk-taking tendencies. Methods: Physicians were recruited to the study by advertisement. It was explained that they would receive a sum of money for correct prediction of the flipping of a coin. They could try to sell their opportunity to flip the coin for an amount of money they determined. The sum offered by the participants was considered an indicator of risk taking. A demographic questionnaire assessed age, sex, seniority, and area of specialization of the participants. A multivariate analysis assessed associations between risk-taking behavior and, seniority, and specialization. Results: Sixty-two physicians participated, 36 males and 26 females, seniority 1–34 years. Of a possible range of 0–10, the mean score for risk taking was 5.5 – just slightly more than indifference. Negative correlations were found between risk taking and seniority, and between risk taking and age (β=–0.45, P<0.001 for both. Surgeons and anesthesiologists showed greater risk taking than did other physicians (β=0.69, P<0.05; and females less than males, though the latter correlation was not statistically significant. Conclusion: Understanding the tendency of physicians to risk taking may elucidate their decision-making processes and contribute to understanding of causes of adverse events and to the education of physicians. Keywords: risk taking, game theory, seniority, surgeons, anesthesiologists

  1. Vascular Risk Factors and Clinical Progression in Spinocerebellar Ataxias

    Directory of Open Access Journals (Sweden)

    Raymond Y. Lo

    2015-02-01

    Full Text Available Background: The contributions of vascular risk factors to spinocerebellar ataxia (SCA are not known.Methods: We studied 319 participants with SCA 1, 2, 3, and 6 and repeatedly measured clinical severity using the Scale for Assessment and Rating of Ataxia (SARA for 2 years. Vascular risk factors were summarized by CHA2DS2-VASc scores as the vascular risk factor index. We employed regression models to study the effects of vascular risk factors on ataxia onset and progression after adjusting for age, sex, and pathological CAG repeats. Our secondary analyses took hyperlipidemia into account.Results: Nearly 60% of SCA participants were at low vascular risks with CHA2DS2-VASc = 0, and 31% scored 2 or greater. Higher CHA2DS2-VASc scores were not associated with either earlier onset or faster progression of ataxia. These findings were not altered after accounting for hyperlipidemia. Discussion: Vascular risks are not common in SCAs and are not associated with earlier onset or faster ataxia progression.

  2. Operational risk assessment.

    Science.gov (United States)

    McKim, Vicky L

    2017-06-01

    In the world of risk management, which encompasses the business continuity disciplines, many types of risk require evaluation. Financial risk is most often the primary focus, followed by product and market risks. Another critical area, which typically lacks a thorough review or may be overlooked, is operational risk. This category encompasses many risk exposure types including those around building structures and systems, environmental issues, nature, neighbours, clients, regulatory compliance, network, data security and so on. At times, insurance carriers will assess internal hazards, but seldom do these assessments include more than a cursory look at other types of operational risk. In heavily regulated environments, risk assessments are required but may not always include thorough assessments of operational exposures. Vulnerabilities may linger or go unnoticed, only to become the catalyst for a business disruption at a later time, some of which are so severe that business recovery becomes nearly impossible. Businesses may suffer loss of clients as the result of a prolonged disruption of services. Comprehensive operational risk assessments can assist in identifying such vulnerabilities, exposures and threats so that the risk can be minimised or removed. This paper lays out how an assessment of this type can be successfully conducted.

  3. Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

    1994-11-01

    The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)

  4. Hepatitis Risk Assessment

    Science.gov (United States)

    ... please visit this page: About CDC.gov . Hepatitis Risk Assessment Recommend on Facebook Tweet Share Compartir Viral Hepatitis. Are you at risk? Take this 5 minute Hepatitis Risk Assessment developed ...

  5. GM Risk Assessment

    Science.gov (United States)

    Sparrow, Penny A. C.

    GM risk assessments play an important role in the decision-making process surrounding the regulation, notification and permission to handle Genetically Modified Organisms (GMOs). Ultimately the role of a GM risk assessment will be to ensure the safe handling and containment of the GMO; and to assess any potential impacts on the environment and human health. A risk assessment should answer all ‘what if’ scenarios, based on scientific evidence.

  6. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  7. Offshore risk assessment

    CERN Document Server

    Vinnem, Jan-Erik

    2014-01-01

      Offshore Risk Assessment was the first book to deal with quantified risk assessment (QRA) as applied specifically to offshore installations and operations. Risk assessment techniques have been used for more than three decades in the offshore oil and gas industry, and their use is set to expand increasingly as the industry moves into new areas and faces new challenges in older regions.   This updated and expanded third edition has been informed by a major R&D program on offshore risk assessment in Norway and summarizes research from 2006 to the present day. Rooted with a thorough discussion of risk metrics and risk analysis methodology,  subsequent chapters are devoted to analytical approaches to escalation, escape, evacuation and rescue analysis of safety and emergency systems.   Separate chapters analyze the main hazards of offshore structures: fire, explosion, collision, and falling objects as well as structural and marine hazards. Risk mitigation and control are discussed, as well as an illustrat...

  8. Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

    Directory of Open Access Journals (Sweden)

    Anita M. Hart

    2012-06-01

    Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.

  9. Concept of risk: risk assessment and nuclear safety

    International Nuclear Information System (INIS)

    Thompson, P.B.

    1980-01-01

    The dissertation is a critical examination of risk assessment and its role in public policy. Nuclear power safety safety issues are selected as the primary source of illustrations and examples. The dissertation examines how risk assessment studies develop a concept of risk which becomes decisive for policy choices. Risk-assessment techniques are interpreted as instruments which secure an evaluation of risk which, in turn, figures prominently in technical reports on nuclear power. The philosophical critique is mounted on two levels. First, an epistemological critique surveys distinctions between the technical concept of risk and more familiar senses of risk. The critique shows that utilization of risk assessment re-structures the concept of risk. The technical concept is contrasted to the function of risk within a decision-maker's conceptual agenda and hierarchy of values. Second, an ethical critique exposes the value commitments of risk assessment recommendations. Although some of these values might be defended for policy decisions, the technical character of risk assessment obfuscates normative issues. Risk assessment is shown to be a form of factual enquiry which, nonetheless, represents a commitment to a specific selection of ethical and social values. Risk assessment should not be interpreted as a primary guide to decision unless the specific values incorporated into its concept of risk are stated explicitly and justified philosophically. Such a statement would allow value questions which have been sublimated by the factual tone of the analytic techniques to be debated on clear, social and ethical grounds

  10. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    OpenAIRE

    Abdullah K. Shehabat

    2016-01-01

    This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

  11. Dutch Risk Assessment tools

    NARCIS (Netherlands)

    Venema, A.

    2015-01-01

    The ‘Risico- Inventarisatie- en Evaluatie-instrumenten’ is the name for the Dutch risk assessment (RA) tools. A RA tool can be used to perform a risk assessment including an evaluation of the identified risks. These tools were among the first online risk assessment tools developed in Europe. The

  12. State of risk assessment

    International Nuclear Information System (INIS)

    Conrad, J.

    1978-03-01

    In view of the growing importance assumed in recent years by scientific work on the calculation, quantification, evaluation and acceptance as well as behavior in the face of risks in general and more specifically, the risks of large industrial plants, the report attempts to provide a survey of the current situation, results and evaluation of this new branch of research, risk assessment. The emphasis of the report is on the basic discussion and criticism of the theoretical and methodological approaches used in the field of risk assessment (section 3). It is concerned above all with - methodical problems of determining and quantifying risks (3.1) - questions of the possibility of risk evaluation and comp arison (3.1, 3.2) - the premises of normative and empirical studies on decision making under risk (3.2, 3.3) - investigations into society's acceptance of risks involved in the introduction of new technologies (3.4) - attempts to combine various aspects of the field of risk assessment in a unified concept (3.5, 3.6, 3.7). Because risk assessment is embedded in the framework of decision theory and technology assessment, it can be implicitly evaluated at a more general level within this framework, as far as its possibilities and weaknesses of method and application are concerned (section 4). Sections 2 and 5 deal with the social context of origin and utilization of risk assessment. Finally, an attempt is made at a summary indicating the possible future development of risk assessment. (orig./HP) [de

  13. Sensorimotor Assessment and Rehabilitative Apparatus

    Science.gov (United States)

    2016-10-01

    become effective addressing health disparities. Title: Ethnic differences in endogenous pain regulation: PET imaging of opioid receptors Grant Number...campaigns, causing physical , sensory, cognitive, and behavioral/emotional changes. Therefore, a significant population of our wounded veterans suffer...collection. Training included medical screening for vestibular pathology, balance and gait assessments, and SARA testing. ii. Train Physical

  14. Risk assessment and risk management of mycotoxins.

    Science.gov (United States)

    2012-01-01

    Risk assessment is the process of quantifying the magnitude and exposure, or probability, of a harmful effect to individuals or populations from certain agents or activities. Here, we summarize the four steps of risk assessment: hazard identification, dose-response assessment, exposure assessment, and risk characterization. Risk assessments using these principles have been conducted on the major mycotoxins (aflatoxins, fumonisins, ochratoxin A, deoxynivalenol, and zearalenone) by various regulatory agencies for the purpose of setting food safety guidelines. We critically evaluate the impact of these risk assessment parameters on the estimated global burden of the associated diseases as well as the impact of regulatory measures on food supply and international trade. Apart from the well-established risk posed by aflatoxins, many uncertainties still exist about risk assessments for the other major mycotoxins, often reflecting a lack of epidemiological data. Differences exist in the risk management strategies and in the ways different governments impose regulations and technologies to reduce levels of mycotoxins in the food-chain. Regulatory measures have very little impact on remote rural and subsistence farming communities in developing countries, in contrast to developed countries, where regulations are strictly enforced to reduce and/or remove mycotoxin contamination. However, in the absence of the relevant technologies or the necessary infrastructure, we highlight simple intervention practices to reduce mycotoxin contamination in the field and/or prevent mycotoxin formation during storage.

  15. Biosafety Risk Assessment Methodology

    Energy Technology Data Exchange (ETDEWEB)

    Caskey, Susan Adele [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). International Biological Threat Reduction Program; Gaudioso, Jennifer M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). International Biological Threat Reduction Program; Salerno, Reynolds Mathewson [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). International Biological Threat Reduction Program; Wagner, Stefan M. [Public Health Agency of Canada, Winnipeg, MB (Canada). Canadian Science Centre for Human and Animal Health (CSCHAH); Shigematsu, Mika [National Inst. of Infectious Diseases (NIID), Tokyo (Japan); Risi, George [Infectious Disease Specialists, P.C, Missoula, MT (United States); Kozlovac, Joe [US Dept. of Agriculture (USDA)., Beltsville, MD (United States); Halkjaer-Knudsen, Vibeke [Statens Serum Inst., Copenhagen (Denmark); Prat, Esmeralda [Bayer CropScience, Monheim am Rhein (Germany)

    2010-10-01

    Laboratories that work with biological agents need to manage their safety risks to persons working the laboratories and the human and animal community in the surrounding areas. Biosafety guidance defines a wide variety of biosafety risk mitigation measures, which include measures which fall under the following categories: engineering controls, procedural and administrative controls, and the use of personal protective equipment; the determination of which mitigation measures should be used to address the specific laboratory risks are dependent upon a risk assessment. Ideally, a risk assessment should be conducted in a manner which is standardized and systematic which allows it to be repeatable and comparable. A risk assessment should clearly define the risk being assessed and avoid over complication.

  16. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    International Nuclear Information System (INIS)

    Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

    2013-01-01

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

  17. 2007 TOXICOLOGY AND RISK ASSESSMENT ...

    Science.gov (United States)

    EPA has announced The 2007 Toxicology and Risk Assessment Conference Cincinnati Marriott North, West Chester (Cincinnati), OHApril 23- 26, 2007 - Click to register!The Annual Toxicology and Risk Assessment Conference is a unique meeting where several Government Agencies come together to discuss toxicology and risk assessment issues that are not only of concern to the government, but also to a broader audience including academia and industry. The theme of this year's conference is Emerging Issues and Challenges in Risk Assessment and the preliminary agenda includes: Plenary Sessions and prominent speakers (tentative) include: Issues of Emerging Chemical ContaminantsUncertainty and Variability in Risk Assessment Use of Mechanistic data in IARC evaluationsParallel Sessions:Uncertainty and Variability in Dose-Response Assessment Recent Advances in Toxicity and Risk Assessment of RDX The Use of Epidemiologic Data for Risk Assessment Applications Cumulative Health Risk Assessment:

  18. Risk Assessment

    Science.gov (United States)

    How the EPA conducts risk assessment to protect human health and the environment. Several assessments are included with the guidelines, models, databases, state-based RSL Tables, local contacts and framework documents used to perform these assessments.

  19. Exploration Health Risks: Probabilistic Risk Assessment

    Science.gov (United States)

    Rhatigan, Jennifer; Charles, John; Hayes, Judith; Wren, Kiley

    2006-01-01

    Maintenance of human health on long-duration exploration missions is a primary challenge to mission designers. Indeed, human health risks are currently the largest risk contributors to the risks of evacuation or loss of the crew on long-duration International Space Station missions. We describe a quantitative assessment of the relative probabilities of occurrence of the individual risks to human safety and efficiency during space flight to augment qualitative assessments used in this field to date. Quantitative probabilistic risk assessments will allow program managers to focus resources on those human health risks most likely to occur with undesirable consequences. Truly quantitative assessments are common, even expected, in the engineering and actuarial spheres, but that capability is just emerging in some arenas of life sciences research, such as identifying and minimize the hazards to astronauts during future space exploration missions. Our expectation is that these results can be used to inform NASA mission design trade studies in the near future with the objective of preventing the higher among the human health risks. We identify and discuss statistical techniques to provide this risk quantification based on relevant sets of astronaut biomedical data from short and long duration space flights as well as relevant analog populations. We outline critical assumptions made in the calculations and discuss the rationale for these. Our efforts to date have focussed on quantifying the probabilities of medical risks that are qualitatively perceived as relatively high risks of radiation sickness, cardiac dysrhythmias, medically significant renal stone formation due to increased calcium mobilization, decompression sickness as a result of EVA (extravehicular activity), and bone fracture due to loss of bone mineral density. We present these quantitative probabilities in order-of-magnitude comparison format so that relative risk can be gauged. We address the effects of

  20. Assessment Matters: Moving beyond Surveys

    Science.gov (United States)

    Wise, Vicki L.; Barham, Mary Ann

    2012-01-01

    The August 16, 2011, "Chronicle of Higher Education" article "Want Data? Ask Students. Again and Again" by Sara Lipka posits that in higher education there is a culture of oversurveying students and too often relying on surveys as the main, or only, way of assessing the impact of programs and services on student satisfaction and learning. Because…

  1. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael

    2012-01-01

    to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...

  2. Hanford Site's Integrated Risk Assessment Program: No-intervention risk assessment

    International Nuclear Information System (INIS)

    Mahaffey, J.A.; Dukelow, J.S. Jr.; Stenner, R.D.

    1994-08-01

    The long-term goal of the Integrated Risk Assessment program (IRAP) is to estimate risks to workers, the public, organizations, and groups with reserved rights to Site access, the ecosystem, and natural resources to aid in managing environmental restoration and waste management at the Hanford Site. For each of these, information is needed about current risks, risks during cleanup, and endstate risks. The objective is three-fold: to determine if and when to remediate, and to what extent; to identify information unavailable but needed to make better cleanup decisions; to establish technology performance criteria for achieving desired cleanup levels; to understand costs and benefits of activities from a Site-wide perspective. The no-intervention risk, assessment is the initial evaluation of public health risks conducted under IRAP. The objective is to identify types of activities that the US Department of Energy (DOE) must accomplish for closure of the Hanford Site, defined as no further DOE intervention. There are two primary conclusions from the no-intervention risk assessment. First, some maintenance and operations activities at Hanford must be continued to protect the public from grave risks. However, when large Hanford expenditures are compared to cleanup progress, funds expended for maintenance and operations must be put in proper perspective. Second, stakeholder's emphasis on public risks at Hanford, as indicated by remediation priorities, are not in line with those estimated. The focus currently is on compliance with regulations, and on dealing with issues which are visible to stakeholders

  3. Chemical Risk Assessment

    Science.gov (United States)

    This course is aimed at providing an overview of the fundamental guiding principles and general methods used in chemical risk assessment. Chemical risk assessment is a complex and ever-evolving process. These principles and methods have been organized by the National Research Cou...

  4. An integrated risk assessment approach: Risk assessment in the programmatic environmental impact statement

    International Nuclear Information System (INIS)

    Morris, J.M.

    1994-01-01

    The following paper is an informal summary of salient points made in the presentation entitled open-quotes An Integrated Risk Assessment Approach: Risk Assessment in the Programmatic Environmental Impact Statement (PEIS).close quotes. This presentation was given at the U.S. DOE Integrated Planning Workshop in Denver, Colorado on June 2, 1994. Integrated decision analysis is very important in environmental restoration and waste management in the evaluation of such things as land use planning, waste load forecasting, cost analyses, and technology development activities. Integrated risk assessment is an approach that addresses multiple components of risk, including: risks from surplus facilities as well as typical environmental restoration sites, risks to the public, risks to workers, ecological risk, risks before, during and after remediation activities, and others

  5. The relation of risk assessment and health impact assessment

    DEFF Research Database (Denmark)

    Ádám, Balázs; Gulis, Gabriel

    2013-01-01

    than assessing a present situation. As part of this process, however, methods applied in risk assessment are used. Risk assessment typically characterises relation of a well-defined risk factor to a well-defined health outcome. Within HIA usually several individual risk assessments are needed...... of the causal chain from the proposal through related health determinants and risk factors to health outcomes. The stepwise analysis, systematic prioritization and consideration of horizontal interactions between the causal pathways make it feasible to use widely recognized risk assessment methods in the HIA......The level and distribution of health risks in a society is substantially influenced by measures of various policies, programmes or projects. Risk assessment can evaluate the nature, likelihood and severity of an adverse effect. Health impact assessment (HIA) provides similar function when used...

  6. Assessment of cardiovascular risk.

    LENUS (Irish Health Repository)

    Cooney, Marie Therese

    2010-10-01

    Atherosclerotic cardiovascular disease (CVD) is the most common cause of death worldwide. Usually atherosclerosis is caused by the combined effects of multiple risk factors. For this reason, most guidelines on the prevention of CVD stress the assessment of total CVD risk. The most intensive risk factor modification can then be directed towards the individuals who will derive the greatest benefit. To assist the clinician in calculating the effects of these multiple interacting risk factors, a number of risk estimation systems have been developed. This review address several issues regarding total CVD risk assessment: Why should total CVD risk be assessed? What risk estimation systems are available? How well do these systems estimate risk? What are the advantages and disadvantages of the current systems? What are the current limitations of risk estimation systems and how can they be resolved? What new developments have occurred in CVD risk estimation?

  7. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  8. Disparities in availability of essential medicines to treat non-communicable diseases in Uganda: A Poisson analysis using the Service Availability and Readiness Assessment.

    Science.gov (United States)

    Armstrong-Hough, Mari; Kishore, Sandeep P; Byakika, Sarah; Mutungi, Gerald; Nunez-Smith, Marcella; Schwartz, Jeremy I

    2018-01-01

    Although the WHO-developed Service Availability and Readiness Assessment (SARA) tool is a comprehensive and widely applied survey of health facility preparedness, SARA data have not previously been used to model predictors of readiness. We sought to demonstrate that SARA data can be used to model availability of essential medicines for treating non-communicable diseases (EM-NCD). We fit a Poisson regression model using 2013 SARA data from 196 Ugandan health facilities. The outcome was total number of different EM-NCD available. Basic amenities, equipment, region, health facility type, managing authority, NCD diagnostic capacity, and range of HIV services were tested as predictor variables. In multivariate models, we found significant associations between EM-NCD availability and region, managing authority, facility type, and range of HIV services. For-profit facilities' EM-NCD counts were 98% higher than public facilities (p < .001). General hospitals and referral health centers had 98% (p = .004) and 105% (p = .002) higher counts compared to primary health centers. Facilities in the North and East had significantly lower counts than those in the capital region (p = 0.015; p = 0.003). Offering HIV care was associated with 35% lower EM-NCD counts (p = 0.006). Offering HIV counseling and testing was associated with 57% higher counts (p = 0.048). We identified multiple within-country disparities in availability of EM-NCD in Uganda. Our findings can be used to identify gaps and guide distribution of limited resources. While the primary purpose of SARA is to assess and monitor health services readiness, we show that it can also be an important resource for answering complex research and policy questions requiring multivariate analysis.

  9. Social humanoid robot SARA: development of the wrist mechanism

    Science.gov (United States)

    Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

    2018-01-01

    This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.

  10. Information needs for risk assessment

    Energy Technology Data Exchange (ETDEWEB)

    DeRosa, C.T.; Choudhury, H.; Schoeny, R.S.

    1990-12-31

    Risk assessment can be thought of as a conceptual approach to bridge the gap between the available data and the ultimate goal of characterizing the risk or hazard associated with a particular environmental problem. To lend consistency to and to promote quality in the process, the US Environmental Protection Agency (EPA) published Guidelines for Risk Assessment of Carcinogenicity, Developmental Toxicity, Germ Cell Mutagenicity and Exposure Assessment, and Risk Assessment of Chemical Mixtures. The guidelines provide a framework for organizing the information, evaluating data, and for carrying out the risk assessment in a scientifically plausible manner. In the absence of sufficient scientific information or when abundant data are available, the guidelines provide alternative methodologies that can be employed in the risk assessment. 4 refs., 3 figs., 2 tabs.

  11. Probabilistic risk assessment as an aid to risk management

    International Nuclear Information System (INIS)

    Garrick, B.J.

    1982-01-01

    Probabilistic risk assessments are providing important insights into nuclear power plant safety. Their value is two-fold: first as a means of quantifying nuclear plant risk including contributors to risk, and second as an aid to risk management. A risk assessment provides an analytical plant model that can be the basis for performing meaningful decision analyses for controlling safety. It is the aspect of quantitative risk management that makes probabilistic risk assessment an important technical discipline of the future

  12. Methodology of environmental risk assessment management

    Directory of Open Access Journals (Sweden)

    Saša T. Bakrač

    2012-04-01

    Full Text Available Successful protection of environment is mostly based on high-quality assessment of potential and present risks. Environmental risk management is a complex process which includes: identification, assessment and control of risk, namely taking measures in order to minimize the risk to an acceptable level. Environmental risk management methodology: In addition to these phases in the management of environmental risk, appropriate measures that affect the reduction of risk occurrence should be implemented: - normative and legal regulations (laws and regulations, - appropriate organizational structures in society, and - establishing quality monitoring of environment. The emphasis is placed on the application of assessment methodologies (three-model concept, as the most important aspect of successful management of environmental risk. Risk assessment methodology - European concept: The first concept of ecological risk assessment methodology is based on the so-called European model-concept. In order to better understand this ecological risk assessment methodology, two concepts - hazard and risk - are introduced. The European concept of environmental risk assessment has the following phases in its implementation: identification of hazard (danger, identification of consequences (if there is hazard, estimate of the scale of consequences, estimate of consequence probability and risk assessment (also called risk characterization. The European concept is often used to assess risk in the environment as a model for addressing the distribution of stressors along the source - path - receptor line. Risk assessment methodology - Canadian concept: The second concept of the methodology of environmental risk assessment is based on the so-called Canadian model-concept. The assessment of ecological risk includes risk arising from natural events (floods, extreme weather conditions, etc., technological processes and products, agents (chemical, biological, radiological, etc

  13. Strategic Risk Assessment

    Science.gov (United States)

    Derleth, Jason; Lobia, Marcus

    2009-01-01

    This slide presentation provides an overview of the attempt to develop and demonstrate a methodology for the comparative assessment of risks across the entire portfolio of NASA projects and assets. It includes information about strategic risk identification, normalizing strategic risks, calculation of relative risk score, and implementation options.

  14. Overview of risk assessment

    International Nuclear Information System (INIS)

    Rimington, J.D.

    1992-01-01

    The paper begins by defining some terms, and then refer to a number of technical and other difficulties. Finally it attempts to set out why risk assessment is important and what its purposes are. 2) First, risk and risk assessment - what are they?. 3) Risk is a subject of universal significance. Life is very uncertain, and we can achieve no object or benefit in it except by approaching nearer to particular hazards which lie between us and our objects. That approach represents acceptance of risk. 4) Risk assessment is a way of systematising our approach to hazard with a view to determining what is more and what is less risky. It helps us in the end to diminish our exposure while obtaining whatever benefits we have in mind, or to optimise the risks and the benefits

  15. Overview of risk assessment

    Energy Technology Data Exchange (ETDEWEB)

    Rimington, J D [Health and Safety Executive (United Kingdom)

    1992-07-01

    The paper begins by defining some terms, and then refer to a number of technical and other difficulties. Finally it attempts to set out why risk assessment is important and what its purposes are. 2) First, risk and risk assessment - what are they?. 3) Risk is a subject of universal significance. Life is very uncertain, and we can achieve no object or benefit in it except by approaching nearer to particular hazards which lie between us and our objects. That approach represents acceptance of risk. 4) Risk assessment is a way of systematising our approach to hazard with a view to determining what is more and what is less risky. It helps us in the end to diminish our exposure while obtaining whatever benefits we have in mind, or to optimise the risks and the benefits.

  16. [Urban ecological risk assessment: a review].

    Science.gov (United States)

    Wang, Mei-E; Chen, Wei-Ping; Peng, Chi

    2014-03-01

    With the development of urbanization and the degradation of urban living environment, urban ecological risks caused by urbanization have attracted more and more attentions. Based on urban ecology principles and ecological risk assessment frameworks, contents of urban ecological risk assessment were reviewed in terms of driven forces, risk resources, risk receptors, endpoints and integrated approaches for risk assessment. It was suggested that types and degrees of urban economical and social activities were the driven forces for urban ecological risks. Ecological functional components at different levels in urban ecosystems as well as the urban system as a whole were the risk receptors. Assessment endpoints involved in changes of urban ecological structures, processes, functional components and the integrity of characteristic and function. Social-ecological models should be the major approaches for urban ecological risk assessment. Trends for urban ecological risk assessment study should focus on setting a definite protection target and criteria corresponding to assessment endpoints, establishing a multiple-parameter assessment system and integrative assessment approaches.

  17. Risk Assessment and Integration Team (RAIT) Portfolio Risk Analysis Strategy

    Science.gov (United States)

    Edwards, Michelle

    2010-01-01

    Impact at management level: Qualitative assessment of risk criticality in conjunction with risk consequence, likelihood, and severity enable development of an "investment policy" towards managing a portfolio of risks. Impact at research level: Quantitative risk assessments enable researchers to develop risk mitigation strategies with meaningful risk reduction results. Quantitative assessment approach provides useful risk mitigation information.

  18. [Risk Assessment and Risk Management of Chemicals in China].

    Science.gov (United States)

    Wang, Tie-yu; Zhou, Yun-qiao; Li, Qi-feng; Lü, Yong-long

    2016-02-15

    Risk assessment and risk management have been increasingly approved as an effective approach for appropriate disposal and scientific management of chemicals. This study systematically analyzed the risk assessment methods of chemicals from three aspects including health risk, ecological risk and regional risk. Based on the current situation of classification and management towards chemicals in China, a specific framework of risk management on chemicals was proposed by selecting target chemicals, predominant industries and related stakeholders as the objects. The results of the present study will provide scientific support for improving risk assessment and reasonable management of chemicals in China.

  19. Patient caries risk assessment

    DEFF Research Database (Denmark)

    Twetman, Svante; Fontana, Margherita

    2009-01-01

    Risk assessment is an essential component in the decision-making process for the correct prevention and management of dental caries. Multiple risk factors and indicators have been proposed as targets in the assessment of risk of future disease, varying sometimes based on the age group at which...... they are targeted. Multiple reviews and systematic reviews are available in the literature on this topic. This chapter focusses primarily on results of reviews based on longitudinal studies required to establish the accuracy of caries risk assessment. These findings demonstrate that there is a strong body...... of evidence to support that caries experience is still, unfortunately, the single best predictor for future caries development. In young children, prediction models which include a variety of risk factors seem to increase the accuracy of the prediction, while the usefulness of additional risk factors...

  20. Building better environmental risk assessments

    Directory of Open Access Journals (Sweden)

    Raymond eLayton

    2015-08-01

    Full Text Available Risk assessment is a reasoned, structured approach to address uncertainty based on scientific and technical evidence. It forms the foundation for regulatory decision making, which is bound by legislative and policy requirements, as well as the need for making timely decisions using available resources. In order to be most useful, environmental risk assessments (ERA for genetically modified (GM crops should provide consistent, reliable, and transparent results across all types of GM crops, traits, and environments. The assessments must also separate essential information from scientific or agronomic data of marginal relevance or value for evaluating risk and complete the assessment in a timely fashion. Challenges in conducting ERAs differ across regulatory systems – examples are presented from Canada, Malaysia, and Argentina. One challenge faced across the globe is the conduct of risk assessments with limited resources. This challenge can be overcome by clarifying risk concepts, placing greater emphasis on data critical to assess environmental risk (for example, phenotypic and plant performance data rather than molecular data, and adapting advances in risk analysis from other relevant disciplines.

  1. Building Better Environmental Risk Assessments

    Science.gov (United States)

    Layton, Raymond; Smith, Joe; Macdonald, Phil; Letchumanan, Ramatha; Keese, Paul; Lema, Martin

    2015-01-01

    Risk assessment is a reasoned, structured approach to address uncertainty based on scientific and technical evidence. It forms the foundation for regulatory decision-making, which is bound by legislative and policy requirements, as well as the need for making timely decisions using available resources. In order to be most useful, environmental risk assessments (ERAs) for genetically modified (GM) crops should provide consistent, reliable, and transparent results across all types of GM crops, traits, and environments. The assessments must also separate essential information from scientific or agronomic data of marginal relevance or value for evaluating risk and complete the assessment in a timely fashion. Challenges in conducting ERAs differ across regulatory systems – examples are presented from Canada, Malaysia, and Argentina. One challenge faced across the globe is the conduct of risk assessments with limited resources. This challenge can be overcome by clarifying risk concepts, placing greater emphasis on data critical to assess environmental risk (for example, phenotypic and plant performance data rather than molecular data), and adapting advances in risk analysis from other relevant disciplines. PMID:26301217

  2. Building Better Environmental Risk Assessments.

    Science.gov (United States)

    Layton, Raymond; Smith, Joe; Macdonald, Phil; Letchumanan, Ramatha; Keese, Paul; Lema, Martin

    2015-01-01

    Risk assessment is a reasoned, structured approach to address uncertainty based on scientific and technical evidence. It forms the foundation for regulatory decision-making, which is bound by legislative and policy requirements, as well as the need for making timely decisions using available resources. In order to be most useful, environmental risk assessments (ERAs) for genetically modified (GM) crops should provide consistent, reliable, and transparent results across all types of GM crops, traits, and environments. The assessments must also separate essential information from scientific or agronomic data of marginal relevance or value for evaluating risk and complete the assessment in a timely fashion. Challenges in conducting ERAs differ across regulatory systems - examples are presented from Canada, Malaysia, and Argentina. One challenge faced across the globe is the conduct of risk assessments with limited resources. This challenge can be overcome by clarifying risk concepts, placing greater emphasis on data critical to assess environmental risk (for example, phenotypic and plant performance data rather than molecular data), and adapting advances in risk analysis from other relevant disciplines.

  3. Risk Assessment Stability: A Revalidation Study of the Arizona Risk/Needs Assessment Instrument

    Science.gov (United States)

    Schwalbe, Craig S.

    2009-01-01

    The actuarial method is the gold standard for risk assessment in child welfare, juvenile justice, and criminal justice. It produces risk classifications that are highly predictive and that may be robust to sampling error. This article reports a revalidation study of the Arizona Risk/Needs Assessment instrument, an actuarial instrument for juvenile…

  4. Remedial investigation report on waste area grouping 5 at Oak Ridge National Laboratory, Oak Ridge, Tennessee. Volume 4, Appendix C, Risk assessment

    International Nuclear Information System (INIS)

    1995-09-01

    Waste Area Grouping (WAG) 5 is part of Oak Ridge National Laboratory (ORNL) and is located on the United States Department of Energy's Oak Ridge Reservation (DOE-ORR). The site lies southeast of Haw Ridge in Melton Valley and comprises approximately 32 ha (80 ac) [12 ha (30 ac) of forested area and the balance in grassed fields]. Waste Area Grouping 5 consists of several contaminant source areas for the disposal of low-level radioactive, transuranic (TRU), and fissile wastes (1959 to 1973) as well as inorganic and organic chemical wastes. Wastes were buried in trenches and auger holes. Radionuclides from buried wastes are being transported by shallow groundwater to Melton Branch and White Oak Creek. Different chemicals of potential concern (COPCs) were identified (e.g., cesium-137, strontium-90, radium-226, thorium-228, etc.); other constituents and chemicals, such as vinyl chloride, bis(2-ethylhexyl)phthalate, trichloroethene, were also identified as COPCs. Based on the results of this assessment contaminants of concern (COCs) were subsequently identified. The objectives of the WAG 5 Baseline Human Health Risk Assessment (BHHRA) are to document the potential health hazards (i.e., risks) that may result from contaminants on or released from the site and provide information necessary for reaching informed remedial decisions. As part of the DOE-Oak Ridge Operations (ORO), ORNL and its associated waste/contamination sites fall under the auspices of the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), also known as Superfund under the Superfund Amendments and Reauthorization Act (SARA). The results of the BHHRA will (1) document and evaluate risks to human health, (2) help determine the need for remedial action, (3) determine chemical concentrations protective of current and future human receptors, and (4) help select and compare various remedial alternatives.

  5. RISK MANAGEMENT: AN INTEGRATED APPROACH TO RISK MANAGEMENT AND ASSESSMENT

    Directory of Open Access Journals (Sweden)

    Szabo Alina

    2012-12-01

    Full Text Available Purpose: The objective of this paper is to offer an overview over risk management cycle by focusing on prioritization and treatment, in order to ensure an integrated approach to risk management and assessment, and establish the ‘top 8-12’ risks report within the organization. The interface with Internal Audit is ensured by the implementation of the scoring method to prioritize risks collected from previous generated risk report. Methodology/approach: Using evidence from other research in the area and the professional expertise, this article outlines an integrated approach to risk assessment and risk management reporting processes, by separating the risk in two main categories: strategic and operational risks. The focus is on risk prioritization and scoring; the final output will comprise a mix of strategic and operational (‘top 8-12’ risks, which should be used to establish the annual Internal Audit plan. Originality/value: By using an integrated approach to risk assessment and risk management will eliminate the need for a separate Internal Audit risk assessment over prevailing risks. It will reduce the level of risk assessment overlap by different functions (Tax, Treasury, Information System over the same risk categories as a single methodology, is used and will align timings of risk assessment exercises. The risk prioritization by usage of risk and control scoring criteria highlights the combination between financial and non-financial impact criteria allowing risks that do not naturally lend themselves to a financial amount to be also assessed consistently. It is emphasized the usage of score method to prioritize the risks included in the annual audit plan in order to increase accuracy and timelines.

  6. The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

    International Nuclear Information System (INIS)

    Iazzourene, F.

    1982-01-01

    The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr

  7. Instructional materials for SARA/OSHA training. Volume 1, General site working training

    Energy Technology Data Exchange (ETDEWEB)

    Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

    1988-04-01

    This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.

  8. Risk assessment: 'A consumer's perspective'

    International Nuclear Information System (INIS)

    Waterhouse, Rachel

    1992-01-01

    The paper assesses the concept of risk, risk assessment and tolerability of risk from consumer point of view. Review of existing UK and EC directives on certain products and appliances is also covered

  9. Risk assessment: 'A consumer's perspective'

    Energy Technology Data Exchange (ETDEWEB)

    Waterhouse, Rachel [Consumer' s Association, Health and Safety Commission (United Kingdom)

    1992-07-01

    The paper assesses the concept of risk, risk assessment and tolerability of risk from consumer point of view. Review of existing UK and EC directives on certain products and appliances is also covered.

  10. Using risk assessment in periodontics.

    Science.gov (United States)

    Woodman, Alan J

    2014-08-01

    Risk assessment has become a regular feature in both dental practice and society as a whole, and principles used to assess risk in society are similar to those used in a clinical setting. Although the concept of risk assessment as a prognostic indicator for periodontal disease incidence and activity is well established in the management of periodontitis, the use of risk assessment to manage the practical treatment of periodontitis and its sequelae appears to have less foundation. A simple system of initial risk assessment - building on the use of the Basic Periodontal Examination (BPE), clinical, medical and social factors - is described, linked to protocols for delivering care suited to general dental practice and stressing the role of long-term supportive care. The risks of not treating the patient are considered, together with the possible causes of failure, and the problems of successful treatment are illustrated by the practical management of post-treatment recession.

  11. A total risk assessment methodology for security assessment

    International Nuclear Information System (INIS)

    Auilar, Richard; Pless, Daniel J.; Kaplan, Paul Garry; Silva, Consuelo Juanita; Rhea, Ronald Edward; Wyss, Gregory Dane; Conrad, Stephen Hamilton

    2009-01-01

    Sandia National Laboratories performed a two-year Laboratory Directed Research and Development project to develop a new collaborative risk assessment method to enable decision makers to fully consider the interrelationships between threat, vulnerability, and consequence. A five-step Total Risk Assessment Methodology was developed to enable interdisciplinary collaborative risk assessment by experts from these disciplines. The objective of this process is promote effective risk management by enabling analysts to identify scenarios that are simultaneously achievable by an adversary, desirable to the adversary, and of concern to the system owner or to society. The basic steps are risk identification, collaborative scenario refinement and evaluation, scenario cohort identification and risk ranking, threat chain mitigation analysis, and residual risk assessment. The method is highly iterative, especially with regard to scenario refinement and evaluation. The Total Risk Assessment Methodology includes objective consideration of relative attack likelihood instead of subjective expert judgment. The 'probability of attack' is not computed, but the relative likelihood for each scenario is assessed through identifying and analyzing scenario cohort groups, which are groups of scenarios with comparable qualities to the scenario being analyzed at both this and other targets. Scenarios for the target under consideration and other targets are placed into cohort groups under an established ranking process that reflects the following three factors: known targeting, achievable consequences, and the resources required for an adversary to have a high likelihood of success. The development of these target cohort groups implements, mathematically, the idea that adversaries are actively choosing among possible attack scenarios and avoiding scenarios that would be significantly suboptimal to their objectives. An adversary who can choose among only a few comparable targets and scenarios (a

  12. Supporting Risk Assessment: Accounting for Indirect Risk to Ecosystem Components.

    Directory of Open Access Journals (Sweden)

    Cathryn Clarke Murray

    Full Text Available The multi-scalar complexity of social-ecological systems makes it challenging to quantify impacts from human activities on ecosystems, inspiring risk-based approaches to assessments of potential effects of human activities on valued ecosystem components. Risk assessments do not commonly include the risk from indirect effects as mediated via habitat and prey. In this case study from British Columbia, Canada, we illustrate how such "indirect risks" can be incorporated into risk assessments for seventeen ecosystem components. We ask whether (i the addition of indirect risk changes the at-risk ranking of the seventeen ecosystem components and if (ii risk scores correlate with trophic prey and habitat linkages in the food web. Even with conservative assumptions about the transfer of impacts or risks from prey species and habitats, the addition of indirect risks in the cumulative risk score changes the ranking of priorities for management. In particular, resident orca, Steller sea lion, and Pacific herring all increase in relative risk, more closely aligning these species with their "at-risk status" designations. Risk assessments are not a replacement for impact assessments, but-by considering the potential for indirect risks as we demonstrate here-they offer a crucial complementary perspective for the management of ecosystems and the organisms within.

  13. 24 CFR 35.315 - Risk assessment.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Risk assessment. 35.315 Section 35... Provided by a Federal Agency Other Than HUD § 35.315 Risk assessment. Each owner shall complete a risk assessment in accordance with 40 CFR 745.227(d). Each risk assessment shall be completed in accordance with...

  14. Exploring the uncertainties in cancer risk assessment using the integrated probabilistic risk assessment (IPRA) approach.

    Science.gov (United States)

    Slob, Wout; Bakker, Martine I; Biesebeek, Jan Dirk Te; Bokkers, Bas G H

    2014-08-01

    Current methods for cancer risk assessment result in single values, without any quantitative information on the uncertainties in these values. Therefore, single risk values could easily be overinterpreted. In this study, we discuss a full probabilistic cancer risk assessment approach in which all the generally recognized uncertainties in both exposure and hazard assessment are quantitatively characterized and probabilistically evaluated, resulting in a confidence interval for the final risk estimate. The methodology is applied to three example chemicals (aflatoxin, N-nitrosodimethylamine, and methyleugenol). These examples illustrate that the uncertainty in a cancer risk estimate may be huge, making single value estimates of cancer risk meaningless. Further, a risk based on linear extrapolation tends to be lower than the upper 95% confidence limit of a probabilistic risk estimate, and in that sense it is not conservative. Our conceptual analysis showed that there are two possible basic approaches for cancer risk assessment, depending on the interpretation of the dose-incidence data measured in animals. However, it remains unclear which of the two interpretations is the more adequate one, adding an additional uncertainty to the already huge confidence intervals for cancer risk estimates. © 2014 Society for Risk Analysis.

  15. Supporting Risk Assessment: Accounting for Indirect Risk to Ecosystem Components

    Science.gov (United States)

    Mach, Megan E.; Martone, Rebecca G.; Singh, Gerald G.; O, Miriam; Chan, Kai M. A.

    2016-01-01

    The multi-scalar complexity of social-ecological systems makes it challenging to quantify impacts from human activities on ecosystems, inspiring risk-based approaches to assessments of potential effects of human activities on valued ecosystem components. Risk assessments do not commonly include the risk from indirect effects as mediated via habitat and prey. In this case study from British Columbia, Canada, we illustrate how such “indirect risks” can be incorporated into risk assessments for seventeen ecosystem components. We ask whether (i) the addition of indirect risk changes the at-risk ranking of the seventeen ecosystem components and if (ii) risk scores correlate with trophic prey and habitat linkages in the food web. Even with conservative assumptions about the transfer of impacts or risks from prey species and habitats, the addition of indirect risks in the cumulative risk score changes the ranking of priorities for management. In particular, resident orca, Steller sea lion, and Pacific herring all increase in relative risk, more closely aligning these species with their “at-risk status” designations. Risk assessments are not a replacement for impact assessments, but—by considering the potential for indirect risks as we demonstrate here—they offer a crucial complementary perspective for the management of ecosystems and the organisms within. PMID:27632287

  16. Avalanche risk assessment in Russia

    Science.gov (United States)

    Komarov, Anton; Seliverstov, Yury; Sokratov, Sergey; Glazovskaya, Tatiana; Turchaniniva, Alla

    2017-04-01

    The avalanche prone area covers about 3 million square kilometers or 18% of total area of Russia and pose a significant problem in most mountain regions of the country. The constant growth of economic activity, especially in the North Caucasus region and therefore the increased avalanche hazard lead to the demand of the large-scale avalanche risk assessment methods development. Such methods are needed for the determination of appropriate avalanche protection measures as well as for economic assessments during all stages of spatial planning of the territory. The requirement of natural hazard risk assessments is determined by the Federal Law of Russian Federation. However, Russian Guidelines (SP 11-103-97; SP 47.13330.2012) are not clearly presented concerning avalanche risk assessment calculations. A great size of Russia territory, vast diversity of natural conditions and large variations in type and level of economic development of different regions cause significant variations in avalanche risk values. At the first stage of research the small scale avalanche risk assessment was performed in order to identify the most common patterns of risk situations and to calculate full social risk and individual risk. The full social avalanche risk for the territory of country was estimated at 91 victims. The area of territory with individual risk values lesser then 1×10(-6) covers more than 92 % of mountain areas of the country. Within these territories the safety of population can be achieved mainly by organizational activities. Approximately 7% of mountain areas have 1×10(-6) - 1×10(-4) individual risk values and require specific mitigation measures to protect people and infrastructure. Territories with individual risk values 1×10(-4) and above covers about 0,1 % of the territory and include the most severe and hazardous mountain areas. The whole specter of mitigation measures is required in order to minimize risk. The future development of such areas is not recommended

  17. Risk assessment in international operations

    International Nuclear Information System (INIS)

    Stricklin, Daniela L.

    2008-01-01

    During international peace-keeping missions, a diverse number of non-battle hazards may be encountered, which range from heavily polluted areas, endemic disease, toxic industrial materials, local violence, traffic, and even psychological factors. Hence, elevated risk levels from a variety of sources are encountered during deployments. With the emphasis within the Swedish military moving from national defense towards prioritization of international missions in atypical environments, the risk of health consequences, including long term health effects, has received greater consideration. The Swedish military is interested in designing an optimal approach for assessment of health threats during deployments. The Medical Intelligence group at FOI CBRN Security and Defence in Umea has, on request from and in collaboration with the Swedish Armed Forces, reviewed a variety of international health threat and risk assessment models for military operations. Application of risk assessment methods used in different phases of military operations will be reviewed. An overview of different international approaches used in operational risk management (ORM) will be presented as well as a discussion of the specific needs and constraints for health risk assessment in military operations. This work highlights the specific challenges of risk assessment that are unique to the deployment setting such as the assessment of exposures to a variety of diverse hazards concurrently

  18. Implications of probabilistic risk assessment

    International Nuclear Information System (INIS)

    Cullingford, M.C.; Shah, S.M.; Gittus, J.H.

    1987-01-01

    Probabilistic risk assessment (PRA) is an analytical process that quantifies the likelihoods, consequences and associated uncertainties of the potential outcomes of postulated events. Starting with planned or normal operation, probabilistic risk assessment covers a wide range of potential accidents and considers the whole plant and the interactions of systems and human actions. Probabilistic risk assessment can be applied in safety decisions in design, licensing and operation of industrial facilities, particularly nuclear power plants. The proceedings include a review of PRA procedures, methods and technical issues in treating uncertainties, operating and licensing issues and future trends. Risk assessment for specific reactor types or components and specific risks (eg aircraft crashing onto a reactor) are used to illustrate the points raised. All 52 articles are indexed separately. (U.K.)

  19. Uncertainties in risk assessment at USDOE facilities

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, L.D.; Holtzman, S.; Meinhold, A.F.; Morris, S.C.; Rowe, M.D.

    1994-01-01

    The United States Department of Energy (USDOE) has embarked on an ambitious program to remediate environmental contamination at its facilities. Decisions concerning cleanup goals, choices among cleanup technologies, and funding prioritization should be largely risk-based. Risk assessments will be used more extensively by the USDOE in the future. USDOE needs to develop and refine risk assessment methods and fund research to reduce major sources of uncertainty in risk assessments at USDOE facilities. The terms{open_quote} risk assessment{close_quote} and{open_quote} risk management{close_quote} are frequently confused. The National Research Council (1983) and the United States Environmental Protection Agency (USEPA, 1991a) described risk assessment as a scientific process that contributes to risk management. Risk assessment is the process of collecting, analyzing and integrating data and information to identify hazards, assess exposures and dose responses, and characterize risks. Risk characterization must include a clear presentation of {open_quotes}... the most significant data and uncertainties...{close_quotes} in an assessment. Significant data and uncertainties are {open_quotes}...those that define and explain the main risk conclusions{close_quotes}. Risk management integrates risk assessment information with other considerations, such as risk perceptions, socioeconomic and political factors, and statutes, to make and justify decisions. Risk assessments, as scientific processes, should be made independently of the other aspects of risk management (USEPA, 1991a), but current methods for assessing health risks are based on conservative regulatory principles, causing unnecessary public concern and misallocation of funds for remediation.

  20. Uncertainties in risk assessment at USDOE facilities

    International Nuclear Information System (INIS)

    Hamilton, L.D.; Holtzman, S.; Meinhold, A.F.; Morris, S.C.; Rowe, M.D.

    1994-01-01

    The United States Department of Energy (USDOE) has embarked on an ambitious program to remediate environmental contamination at its facilities. Decisions concerning cleanup goals, choices among cleanup technologies, and funding prioritization should be largely risk-based. Risk assessments will be used more extensively by the USDOE in the future. USDOE needs to develop and refine risk assessment methods and fund research to reduce major sources of uncertainty in risk assessments at USDOE facilities. The terms open-quote risk assessment close-quote and open-quote risk management close-quote are frequently confused. The National Research Council (1983) and the United States Environmental Protection Agency (USEPA, 1991a) described risk assessment as a scientific process that contributes to risk management. Risk assessment is the process of collecting, analyzing and integrating data and information to identify hazards, assess exposures and dose responses, and characterize risks. Risk characterization must include a clear presentation of open-quotes... the most significant data and uncertainties...close quotes in an assessment. Significant data and uncertainties are open-quotes...those that define and explain the main risk conclusionsclose quotes. Risk management integrates risk assessment information with other considerations, such as risk perceptions, socioeconomic and political factors, and statutes, to make and justify decisions. Risk assessments, as scientific processes, should be made independently of the other aspects of risk management (USEPA, 1991a), but current methods for assessing health risks are based on conservative regulatory principles, causing unnecessary public concern and misallocation of funds for remediation

  1. Advanced Test Reactor outage risk assessment

    International Nuclear Information System (INIS)

    Thatcher, T.A.; Atkinson, S.A.

    1997-01-01

    Beginning in 1997, risk assessment was performed for each Advanced Test Reactor (ATR) outage aiding the coordination of plant configuration and work activities (maintenance, construction projects, etc.) to minimize the risk of reactor fuel damage and to improve defense-in-depth. The risk assessment activities move beyond simply meeting Technical Safety Requirements to increase the awareness of risk sensitive configurations, to focus increased attention on the higher risk activities, and to seek cost-effective design or operational changes that reduce risk. A detailed probabilistic risk assessment (PRA) had been performed to assess the risk of fuel damage during shutdown operations including heavy load handling. This resulted in several design changes to improve safety; however, evaluation of individual outages had not been performed previously and many risk insights were not being utilized in outage planning. The shutdown PRA provided the necessary framework for assessing relative and absolute risk levels and assessing defense-in-depth. Guidelines were written identifying combinations of equipment outages to avoid. Screening criteria were developed for the selection of work activities to receive review. Tabulation of inherent and work-related initiating events and their relative risk level versus plant mode has aided identification of the risk level the scheduled work involves. Preoutage reviews are conducted and post-outage risk assessment is documented to summarize the positive and negative aspects of the outage with regard to risk. The risk for the outage is compared to the risk level that would result from optimal scheduling of the work to be performed and to baseline or average past performance

  2. GAR Global Risk Assessment

    Science.gov (United States)

    Maskrey, Andrew; Safaie, Sahar

    2015-04-01

    Disaster risk management strategies, policies and actions need to be based on evidence of current disaster loss and risk patterns, past trends and future projections, and underlying risk factors. Faced with competing demands for resources, at any level it is only possible to priorities a range of disaster risk management strategies and investments with adequate understanding of realised losses, current and future risk levels and impacts on economic growth and social wellbeing as well as cost and impact of the strategy. The mapping and understanding of the global risk landscape has been greatly enhanced by the latest iteration of the GAR Global Risk Assessment and the objective of this submission is to present the GAR global risk assessment which contributed to Global Assessment Report (GAR) 2015. This initiative which has been led by UNISDR, was conducted by a consortium of technical institutions from around the world and has covered earthquake, cyclone, riverine flood, and tsunami probabilistic risk for all countries of the world. In addition, the risks associated with volcanic ash in the Asia-Pacific region, drought in various countries in sub-Saharan Africa and climate change in a number of countries have been calculated. The presentation will share thee results as well as the experience including the challenges faced in technical elements as well as the process and recommendations for the future of such endeavour.

  3. Deterministic quantitative risk assessment development

    Energy Technology Data Exchange (ETDEWEB)

    Dawson, Jane; Colquhoun, Iain [PII Pipeline Solutions Business of GE Oil and Gas, Cramlington Northumberland (United Kingdom)

    2009-07-01

    Current risk assessment practice in pipeline integrity management is to use a semi-quantitative index-based or model based methodology. This approach has been found to be very flexible and provide useful results for identifying high risk areas and for prioritizing physical integrity assessments. However, as pipeline operators progressively adopt an operating strategy of continual risk reduction with a view to minimizing total expenditures within safety, environmental, and reliability constraints, the need for quantitative assessments of risk levels is becoming evident. Whereas reliability based quantitative risk assessments can be and are routinely carried out on a site-specific basis, they require significant amounts of quantitative data for the results to be meaningful. This need for detailed and reliable data tends to make these methods unwieldy for system-wide risk k assessment applications. This paper describes methods for estimating risk quantitatively through the calibration of semi-quantitative estimates to failure rates for peer pipeline systems. The methods involve the analysis of the failure rate distribution, and techniques for mapping the rate to the distribution of likelihoods available from currently available semi-quantitative programs. By applying point value probabilities to the failure rates, deterministic quantitative risk assessment (QRA) provides greater rigor and objectivity than can usually be achieved through the implementation of semi-quantitative risk assessment results. The method permits a fully quantitative approach or a mixture of QRA and semi-QRA to suit the operator's data availability and quality, and analysis needs. For example, consequence analysis can be quantitative or can address qualitative ranges for consequence categories. Likewise, failure likelihoods can be output as classical probabilities or as expected failure frequencies as required. (author)

  4. Evaluation of thermal risk assessment

    International Nuclear Information System (INIS)

    Loos, J.J.; Perry, E.S.

    1993-01-01

    Risk assessment was done in 1983 to estimate the ecological hazard of increasing the generating load and thermal output of an electric generating station. Subsequently, long-term monitoring in the vicinity of the station allowed verification of the predictions made in the risk assessment. This presentation will review the efficacy of early risk assessment methods in producing useful predictions from a resource management point of view. In 1984, the Chalk Point Generating facility of the Potomac Electric Power Company increased it's median generating load by 100%. Prior to this operational change, the Academy of Natural Sciences of Philadelphia synthesized site specific data, model predictions, and results from literature to assess the risk of additional waste heat to the Patuxent River subestuary of Chesapeake Bay. Risk was expressed as the number of days per year that various species of fish and the blue crab would be expected to avoid the discharge vicinity. Accuracy of these predictions is assessed by comparing observed fish and crab distributions and their observed frequencies of avoidance to those predicted. It is concluded that the predictions of this early risk assessment were sufficiently accurate to produce a reliable resource management decision

  5. On risk assessment of energy production

    International Nuclear Information System (INIS)

    Kunii, Katsuhiko

    2005-07-01

    Today we cannot ignore the risk of health and/or environment by energy production such as power generation since the risk has been made large enough. In this report an information survey has been done in order to know the outline and points of risk assessment. Based on the information of reports and literature about risk assessment, have been surveyed mainly the external cost assessment of power generation (in which quantification of health and/or environment risk has been done), in addition, risks of disasters, accidents, investments, finance etc. and impacts of those risks on social activities. The remarks obtained by the survey are as follows: 1) Some of external cost assessment of power generation show different results even if the assessment conditions of technology, site, etc. are mostly the same. It is necessary to remark on the information such as basic data, model, background, application limit of assessment considering the reliability. 2) Especially it is considered that the reliability of risk assessment is not enough at present because of the lack of basic data. (author)

  6. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0: Models and Results Database (MAR-D) reference manual. Volume 8

    International Nuclear Information System (INIS)

    Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs), primarily for nuclear power plants. The primary function of MAR-D is to create a data repository for completed PRAs and Individual Plant Examinations (IPEs) by providing input, conversion, and output capabilities for data used by IRRAS, SARA, SETS, and FRANTIC software. As probabilistic risk assessments and individual plant examinations are submitted to the NRC for review, MAR-D can be used to convert the models and results from the study for use with IRRAS and SARA. Then, these data can be easily accessed by future studies and will be in a form that will enhance the analysis process. This reference manual provides an overview of the functions available within MAR-D and step-by-step operating instructions

  7. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  8. Defense Programs Transportation Risk Assessment

    International Nuclear Information System (INIS)

    Clauss, D.B.

    1994-01-01

    This paper provides an overview of the methodology used in a probabilistic transportation risk assessment conducted to assess the probabilities and consequences of inadvertent dispersal of radioactive materials arising from severe transportation accidents. The model was developed for the Defense Program Transportation Risk Assessment (DPTRA) study. The analysis incorporates several enhancements relative to previous risk assessments of hazardous materials transportation including newly-developed statistics on the frequencies and severities of tractor semitrailer accidents and detailed route characterization using the 1990 Census data

  9. Risk Factor Assessment Branch (RFAB)

    Science.gov (United States)

    The Risk Factor Assessment Branch (RFAB) focuses on the development, evaluation, and dissemination of high-quality risk factor metrics, methods, tools, technologies, and resources for use across the cancer research continuum, and the assessment of cancer-related risk factors in the population.

  10. Risk assessments ensure safer power

    Energy Technology Data Exchange (ETDEWEB)

    1982-02-19

    A growth industry is emerging devoted to the study and comparison of the economic, social and health risks posed by large industrial installations. Electricity generation is one area coming under particularly close scrutiny. Types of risk, ways of assessing risk and the difference between experts' analyses and the public perception of risk are given. An example of improved risk assessment helping to reduce deaths and injuries in coal mining is included.

  11. Risk assessment

    DEFF Research Database (Denmark)

    Pedersen, Liselotte; Rasmussen, Kirsten; Elsass, Peter

    2010-01-01

    International research suggests that using formalized risk assessment methods may improve the predictive validity of professionals' predictions of risk of future violence. This study presents data on forensic psychiatric patients discharged from a forensic unit in Denmark in year 2001-2002 (n=107...... and the individual dynamic items strengthen the use of this scheme in clinical practice. (PsycINFO Database Record (c) 2010 APA, all rights reserved) (journal abstract)...

  12. Sudden Cardiac Arrest (SCA) Risk Assessment

    Science.gov (United States)

    ... HRS Find a Specialist Share Twitter Facebook SCA Risk Assessment Sudden Cardiac Arrest (SCA) occurs abruptly and without ... people of all ages and health conditions. Start Risk Assessment The Sudden Cardiac Arrest (SCA) Risk Assessment Tool ...

  13. Integrated climate change risk assessment:

    DEFF Research Database (Denmark)

    Kaspersen, Per Skougaard; Halsnæs, Kirsten

    2017-01-01

    Risk assessments of flooding in urban areas during extreme precipitation for use in, for example, decision-making regarding climate adaptation, are surrounded by great uncertainties stemming from climate model projections, methods of downscaling and the assumptions of socioeconomic impact models...... to address the complex linkages between the different kinds of data required in assessing climate adaptation. It emphasizes that the availability of spatially explicit data can reduce the overall uncertainty of the risk assessment and assist in identifying key vulnerable assets. The usefulness...... of such a framework is demonstrated by means of a risk assessment of flooding from extreme precipitation for the city of Odense, Denmark. A sensitivity analysis shows how the presence of particularly important assets, such as cultural and historical heritage, may be addressed in assessing such risks. The output...

  14. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  15. Assessing Your Weight and Health Risk

    Science.gov (United States)

    ... Health Professional Resources Assessing Your Weight and Health Risk Assessment of weight and health risk involves using ... risk for developing obesity-associated diseases or conditions. Risk Factors for Health Topics Associated With Obesity Along ...

  16. Risk assessment theory, methods, and applications

    CERN Document Server

    Rausand, Marvin

    2011-01-01

    With its balanced coverage of theory and applications along with standards and regulations, Risk Assessment: Theory, Methods, and Applications serves as a comprehensive introduction to the topic. The book serves as a practical guide to current risk analysis and risk assessment, emphasizing the possibility of sudden, major accidents across various areas of practice from machinery and manufacturing processes to nuclear power plants and transportation systems. The author applies a uniform framework to the discussion of each method, setting forth clear objectives and descriptions, while also shedding light on applications, essential resources, and advantages and disadvantages. Following an introduction that provides an overview of risk assessment, the book is organized into two sections that outline key theory, methods, and applications. * Introduction to Risk Assessment defines key concepts and details the steps of a thorough risk assessment along with the necessary quantitative risk measures. Chapters outline...

  17. A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

    OpenAIRE

    Carvalho, Marieta

    2014-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...

  18. The issue of risk dilution in risk assessments

    International Nuclear Information System (INIS)

    Wilmot, R.; Robinson, P.

    2004-01-01

    This paper explores an issue that was first highlighted more than 20 years ago during an inquiry concerning the Sizeweli B nuclear power station in the UK. In the probabilistic safety assessment for this plant, the proponent had apparently reduced its estimates of risk by admitting to increased uncertainty about the timing of certain events. This situation is counter-intuitive, since an increase in uncertainty about the factors contributing to safety would be expected to lead to less confidence and hence to greater risk. This paradoxical situation was termed 'risk dilution' and it has been a topic of interest to reviewers of safety cases since. The recent international peer review of the Yucca Mountain performance assessments concluded that there was a potential for risk dilution in the assumptions and calculations presented. The next section describes how assumptions about the timing of events and other aspects of an assessment may lead to risk dilution, and this is followed by two examples based on recent performance assessments. The final section discusses how potential problems can be identified in safety cases, and the types of response that a regulator might adopt as a result. (authors)

  19. Risk Assessment in the Maritime Industry

    Directory of Open Access Journals (Sweden)

    M. Mousavi

    2017-02-01

    Full Text Available Risk assessment is a well-developed field which many operators are currently applying to improve their operations and reduce their risk exposure. This paper is intended to provide an overview of the risk assessment for mariners in the Maritime transportation. The risks addressed are primarily those affecting the safety of a vessel, facility or operation. The concept of risk is defined, and the methods available to assess the risks associated with an operation are described. Regulatory requirements that have prompted the development of modern risk assessment practices are described, and future regulatory trends are discussed. There are many different analysis techniques and models that have been developed to aid in conducting risk assessments. A key to any successful risk analysis is choosing the right method (or combination of methods for the situation at hand. This is achieved through critical analysis of the available data concerning marine crises. This paper provides a brief introduction to some of the analysis methods available and suggests risk analysis approaches to support different types of decision making within the maritime transportation to cope with crises. Finally, as awareness of risk assessment increases, the benefits which can be realized through its application will continue to increase. Organizations in both the public and the private sector are becoming more and more familiar with the benefits associated with risk-based approaches to managing safety and consequently reducing crisis in maritime transportation.

  20. Análise SWOT global da exploração dos suínos da raça Bísara

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...

  1. The MARINA Risk Assessment Strategy: A Flexible Strategy for Efficient Information Collection and Risk Assessment of Nanomaterials.

    Science.gov (United States)

    Bos, Peter M J; Gottardo, Stefania; Scott-Fordsmand, Janeck J; van Tongeren, Martie; Semenzin, Elena; Fernandes, Teresa F; Hristozov, Danail; Hund-Rinke, Kerstin; Hunt, Neil; Irfan, Muhammad-Adeel; Landsiedel, Robert; Peijnenburg, Willie J G M; Sánchez Jiménez, Araceli; van Kesteren, Petra C E; Oomen, Agnes G

    2015-11-27

    An engineered nanomaterial (ENM) may actually consist of a population of primary particles, aggregates and agglomerates of various sizes. Furthermore, their physico-chemical characteristics may change during the various life-cycle stages. It will probably not be feasible to test all varieties of all ENMs for possible health and environmental risks. There is therefore a need to further develop the approaches for risk assessment of ENMs. Within the EU FP7 project Managing Risks of Nanoparticles (MARINA) a two-phase risk assessment strategy has been developed. In Phase 1 (Problem framing) a base set of information is considered, relevant exposure scenarios (RESs) are identified and the scope for Phase 2 (Risk assessment) is established. The relevance of an RES is indicated by information on exposure, fate/kinetics and/or hazard; these three domains are included as separate pillars that contain specific tools. Phase 2 consists of an iterative process of risk characterization, identification of data needs and integrated collection and evaluation of data on the three domains, until sufficient information is obtained to conclude on possible risks in a RES. Only data are generated that are considered to be needed for the purpose of risk assessment. A fourth pillar, risk characterization, is defined and it contains risk assessment tools. This strategy describes a flexible and efficient approach for data collection and risk assessment which is essential to ensure safety of ENMs. Further developments are needed to provide guidance and make the MARINA Risk Assessment Strategy operational. Case studies will be needed to refine the strategy.

  2. The MARINA Risk Assessment Strategy: A Flexible Strategy for Efficient Information Collection and Risk Assessment of Nanomaterials

    Directory of Open Access Journals (Sweden)

    Peter M. J. Bos

    2015-11-01

    Full Text Available An engineered nanomaterial (ENM may actually consist of a population of primary particles, aggregates and agglomerates of various sizes. Furthermore, their physico-chemical characteristics may change during the various life-cycle stages. It will probably not be feasible to test all varieties of all ENMs for possible health and environmental risks. There is therefore a need to further develop the approaches for risk assessment of ENMs. Within the EU FP7 project Managing Risks of Nanoparticles (MARINA a two-phase risk assessment strategy has been developed. In Phase 1 (Problem framing a base set of information is considered, relevant exposure scenarios (RESs are identified and the scope for Phase 2 (Risk assessment is established. The relevance of an RES is indicated by information on exposure, fate/kinetics and/or hazard; these three domains are included as separate pillars that contain specific tools. Phase 2 consists of an iterative process of risk characterization, identification of data needs and integrated collection and evaluation of data on the three domains, until sufficient information is obtained to conclude on possible risks in a RES. Only data are generated that are considered to be needed for the purpose of risk assessment. A fourth pillar, risk characterization, is defined and it contains risk assessment tools. This strategy describes a flexible and efficient approach for data collection and risk assessment which is essential to ensure safety of ENMs. Further developments are needed to provide guidance and make the MARINA Risk Assessment Strategy operational. Case studies will be needed to refine the strategy.

  3. Business risks, functions, methods of assessment and ways to reduce risk

    Directory of Open Access Journals (Sweden)

    A.V. Mihalchuk

    2015-06-01

    Full Text Available For successful existence in a market economy entrepreneur have to take bold actions, and this increases the risk. The article describes the concept of entrepreneurship and business risk, positive and negative aspects of functions of risk in business. Therefore, it is necessary to assess the risk properly and be able to manage it to achieve the most effective results in the market. In market conditions the problem of assessing and accounting market becomes independent theoretical and practical significance as an important component of the theory and practice of management. Risk - a key element of business activities. Development of risk situations can lead to both the occurrence of adverse effects (losses, lost profits, and positive results for a company in the form of increased profit. This article describes: the concept of entrepreneurship, risk and business risks, characteristic of positive and negative aspects of risk functions in business, methods of assessment and risk reduction, shows formulae and examples you can use to assess risk in an enterprise. Analyzing already established methods of risk assessment a number of rules were proposed in order to reduce business risk.

  4. Risk Assessment

    OpenAIRE

    Hrdová, Edita

    2012-01-01

    This diploma thesis is focused on companies risk evaluation before endorsement of Loan deriving from business relationships. The aim of this thesis is not only to describe individual steps of risk assessment, but also perfom analysis of particular companies based on available data, i.e. Balance sheet, Profit and Loss statement and external rating and after that propose solution for each company. My analysis will be based on theoretical knowledge, further on experience related to my job role a...

  5. HTGR accident and risk assessment

    International Nuclear Information System (INIS)

    Silady, F.A.; Everline, C.J.; Houghton, W.J.

    1982-01-01

    This paper is a synopsis of the high-temperature gas-cooled reactor probabilistic risk assessments (PRAs) performed by General Atomic Company. Principal topics presented include: HTGR safety assessments, peer interfaces, safety research, process gas explosions, quantitative safety goals, licensing applications of PRA, enhanced safety, investment risk assessments, and PRA design integration

  6. Anthropic Risk Assessment on Biodiversity

    Science.gov (United States)

    Piragnolo, M.; Pirotti, F.; Vettore, A.; Salogni, G.

    2013-01-01

    This paper presents a methodology for risk assessment of anthropic activities on habitats and species. The method has been developed for Veneto Region, in order to simplify and improve the quality of EIA procedure (VINCA). Habitats and species, animals and plants, are protected by European Directive 92/43/EEC and 2009/147/EC but they are subject at hazard due to pollution produced by human activities. Biodiversity risks may conduct to deterioration and disturbance in ecological niches, with consequence of loss of biodiversity. Ecological risk assessment applied on Natura 2000 network, is needed to best practice of management and monitoring of environment and natural resources. Threats, pressure and activities, stress and indicators may be managed by geodatabase and analysed using GIS technology. The method used is the classic risk assessment in ecological context, and it defines the natural hazard as influence, element of risk as interference and vulnerability. Also it defines a new parameter called pressure. It uses risk matrix for the risk analysis on spatial and temporal scale. The methodology is qualitative and applies the precautionary principle in environmental assessment. The final product is a matrix which excludes the risk and could find application in the development of a territorial information system.

  7. Risk assessment and the environment

    International Nuclear Information System (INIS)

    Fisk, D.J.

    1992-01-01

    This paper reviews the use of risk assessment techniques in the field of environment protection. I will argue that in some important instances the development of environment policy has been a source of fruitful development of a risk based methodologies. In other cases the importation of risk assessment techniques has proved much more problematic. As the scope of environmental regulation increases so does the possibility of inconsistent and arbitrary solutions to problems. The need for a more systematic approach to the development of environmental regulation has never been stronger, so it is important to understand the reasons for the mixed success of risk assessment. This applies equally to those nations with long traditions of the regulation of private sector industry and those just beginning on this course. The way ahead may be to extend our ideas of how to express risk and uncertainty. Some of the recent cause celebres of environment policy show this challenge very clearly. As an example, this paper will look at the problem of assessing the risk of man-made climate change

  8. Risk assessment and the environment

    Energy Technology Data Exchange (ETDEWEB)

    Fisk, D J [Department of the Environment (United Kingdom)

    1992-07-01

    This paper reviews the use of risk assessment techniques in the field of environment protection. I will argue that in some important instances the development of environment policy has been a source of fruitful development of a risk based methodologies. In other cases the importation of risk assessment techniques has proved much more problematic. As the scope of environmental regulation increases so does the possibility of inconsistent and arbitrary solutions to problems. The need for a more systematic approach to the development of environmental regulation has never been stronger, so it is important to understand the reasons for the mixed success of risk assessment. This applies equally to those nations with long traditions of the regulation of private sector industry and those just beginning on this course. The way ahead may be to extend our ideas of how to express risk and uncertainty. Some of the recent cause celebres of environment policy show this challenge very clearly. As an example, this paper will look at the problem of assessing the risk of man-made climate change.

  9. Nuclear insurance risk assessment using risk-based methodology

    International Nuclear Information System (INIS)

    Wendland, W.G.

    1992-01-01

    This paper presents American Nuclear Insurers' (ANI's) and Mutual Atomic Energy Liability Underwriters' (MAELU's) process and experience for conducting nuclear insurance risk assessments using a risk-based methodology. The process is primarily qualitative and uses traditional insurance risk assessment methods and an approach developed under the auspices of the American Society of Mechanical Engineers (ASME) in which ANI/MAELU is an active sponsor. This process assists ANI's technical resources in identifying where to look for insurance risk in an industry in which insurance exposure tends to be dynamic and nonactuarial. The process is an evolving one that also seeks to minimize the impact on insureds while maintaining a mutually agreeable risk tolerance

  10. Risk assessment for halogenated solvents

    International Nuclear Information System (INIS)

    Travis, C.C.

    1988-01-01

    A recent development in the cancer risk area is the advent of biologically based pharmacokinetic and pharmacodynamic models. These models allow for the incorporation of biological and mechanistic data into the risk assessment process. These advances will not only improve the risk assessment process for halogenated solvents but will stimulate and guide basic research in the biological area

  11. RESIDUAL RISK ASSESSMENT: ETHYLENE OXIDE ...

    Science.gov (United States)

    This document describes the residual risk assessment for the Ethylene Oxide Commercial Sterilization source category. For stationary sources, section 112 (f) of the Clean Air Act requires EPA to assess risks to human health and the environment following implementation of technology-based control standards. If these technology-based control standards do not provide an ample margin of safety, then EPA is required to promulgate addtional standards. This document describes the methodology and results of the residual risk assessment performed for the Ethylene Oxide Commercial Sterilization source category. The results of this analyiss will assist EPA in determining whether a residual risk rule for this source category is appropriate.

  12. Risk assessment: An employer's perspective

    International Nuclear Information System (INIS)

    Williams, K.C.

    1992-01-01

    There is no question that a careful assessment of risk is essential for safe industrial operations. For that reason, a thoughtful analysis of the effectiveness of available risk assessment technologies is prerequisite for responsible corporate decision making. An 'employer's' perspective on risk assessment cannot be constrained by any artificial restrictions which that term may imply. In reality, all those who are involved in the execution of an industrial enterprise: managers, regulators, the affected public, and especially those employees exposed to hazards, are necessarily partners in assessment of risk. The perspective of this paper is that of the oil and gas industry, in which the author's organization, Exxon Company, International, participates. The paper addresses what Exxon requires to assess and manage risk in its worldwide operations. The author is aware, however, through contacts with industry colleagues, that some of Exxon's initiatives are representative of similar actions being taken by others. 1992 is the European Year of Safety, Health and Hygiene, coinciding with the United Kingdom's Presidency of the European Council. It is also the year in which new 'goal-setting' regulations covering safety in the U.K. offshore oil industry were put forward by the Health and Safety Commission. These regulations, based largely on Lord Cullen's recommendations following the Piper Alpha tragedy, set the pace for safety in the British North Sea and will significantly impact the safety of offshore oil installations worldwide. The requirement for risk assessment, using a systematic process of analysing and evaluating risk, is a key component of this safety regime

  13. Risk assessment: An employer's perspective

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K C [Exxon International (United States)

    1992-07-01

    There is no question that a careful assessment of risk is essential for safe industrial operations. For that reason, a thoughtful analysis of the effectiveness of available risk assessment technologies is prerequisite for responsible corporate decision making. An 'employer's' perspective on risk assessment cannot be constrained by any artificial restrictions which that term may imply. In reality, all those who are involved in the execution of an industrial enterprise: managers, regulators, the affected public, and especially those employees exposed to hazards, are necessarily partners in assessment of risk. The perspective of this paper is that of the oil and gas industry, in which the author's organization, Exxon Company, International, participates. The paper addresses what Exxon requires to assess and manage risk in its worldwide operations. The author is aware, however, through contacts with industry colleagues, that some of Exxon's initiatives are representative of similar actions being taken by others. 1992 is the European Year of Safety, Health and Hygiene, coinciding with the United Kingdom's Presidency of the European Council. It is also the year in which new 'goal-setting' regulations covering safety in the U.K. offshore oil industry were put forward by the Health and Safety Commission. These regulations, based largely on Lord Cullen's recommendations following the Piper Alpha tragedy, set the pace for safety in the British North Sea and will significantly impact the safety of offshore oil installations worldwide. The requirement for risk assessment, using a systematic process of analysing and evaluating risk, is a key component of this safety regime.

  14. RELEVANCE OF PROCESS RISK ASSESSMENT IN AIRLINES

    OpenAIRE

    Oksana G. Feoktistova; Igor K. Turkin; Sergey V. Barinov

    2017-01-01

    The notion of “the concept on assumed risk” that took over from the outdated concept of absolute security is analyzed, the increasing significance of operating risk assessment at the present stage is noted. Some basic risk assessment techniques are considered. Matrix technique of risk assessment is considered more thoroughly, and it may be used in risk assessment of airlines in the context of labour protection management system.The ability to correctly assess risks and develop appropriate pre...

  15. An abuse of risk assessment: how regulatory agencies improperly adopted LNT for cancer risk assessment.

    Science.gov (United States)

    Calabrese, Edward J

    2015-04-01

    The Genetics Panel of the National Academy of Sciences' Committee on Biological Effects of Atomic Radiation (BEAR) recommended the adoption of the linear dose-response model in 1956, abandoning the threshold dose-response for genetic risk assessments. This recommendation was quickly generalized to include somatic cells for cancer risk assessment and later was instrumental in the adoption of linearity for carcinogen risk assessment by the Environmental Protection Agency. The Genetics Panel failed to provide any scientific assessment to support this recommendation and refused to do so when later challenged by other leading scientists. Thus, the linearity model used in cancer risk assessment was based on ideology rather than science and originated with the recommendation of the NAS BEAR Committee Genetics Panel. Historical documentation in support of these conclusions is provided in the transcripts of the Panel meetings and in previously unexamined correspondence among Panel members.

  16. A framework for combining social impact assessment and risk assessment

    NARCIS (Netherlands)

    Mahmoudi, Hossein; Renn, Ortwin; Vanclay, Frank; Hoffmann, Volker; Karami, Ezatollah

    An increasing focus on integrative approaches is one of the current trends in impact assessment. There is potential to combine impact assessment with various other forms of assessment, such as risk assessment, to make impact assessment and the management of social risks more effective. We identify

  17. A framework for combining social impact assessment and risk assessment

    NARCIS (Netherlands)

    Mahmoudi, Hossein; Renn, Ortwin; Vanclay, Frank; Hoffmann, Volker; Karami, Ezatollah

    2013-01-01

    An increasing focus on integrative approaches is one of the current trends in impact assessment. There is potential to combine impact assessment with various other forms of assessment, such as risk assessment, to make impact assessment and the management of social risks more effective. We identify

  18. Risk indices in comparative risk assessment studies

    International Nuclear Information System (INIS)

    Hubert, P.

    1984-01-01

    More than a decade ago the development of comparative risk assessment studies aroused overwhelming interest. There was no doubt that data on the health and safety aspects of energy systems would greatly benefit, or even end, the debate on nuclear energy. Although such attempts are still strongly supported, the rose-coloured expectations of the early days have faded. The high uncertainties, and the contradictory aspect, of the first results might explain this evolution. The loose connection between the range of computed risk indices and the questions on which the debate was focused is another reason for this decline in interest. Important research work is being carried out aiming at reducing the different kinds of uncertainties. Rather than the uncertainties, the paper considers the meaning of available risk indices and proposes more significant indices with respect to the goals of risk assessment. First, the indices which are of frequent use in comparative studies are listed. The stress is put on a French comparative study from which most examples are drawn. Secondly, the increase in magnitude of the indices and the decrease in the attributability of the risk to a given system is shown to be a consequence of the trend towards more comprehensive analyses. Thirdly, the ambiguity of such indices as the collective occupational risk is underlined, and a possible solution is suggested. Whenever risk assessments are related to pragmatic decision making problems it is possible to find satisfactory risk indices. The development of cost-effectiveness analyses and the proposals for quantitative safety goals clearly demonstrate this point. In the field of comparison of social impacts some proposals are made, but there remain some gaps still to be filled. (author)

  19. Aspects regarding explosion risk assessment

    Directory of Open Access Journals (Sweden)

    Părăian Mihaela

    2017-01-01

    Full Text Available Explosive risk occurs in all activities involving flammable substances in the form of gases, vapors, mists or dusts which, in mixture with air, can generate an explosive atmosphere. As explosions can cause human losses and huge material damage, the assessment of the explosion risk and the establishment of appropriate measures to reduce it to acceptable levels according to the standards and standards in force is of particular importance for the safety and health of people and goods.There is no yet a recognized method of assessing the explosion risk, but regardless of the applied method, the likelihood of an explosive atmosphere occurrence has to be determined, together with the occurrence of an efficient ignition source and the magnitude of foreseeable consequences. In assessment processes, consequences analysis has a secondary importance since it’s likely that explosions would always involve considerable damage, starting from important material damages and up to human damages that could lead to death.The purpose of the work is to highlight the important principles and elements to be taken into account for a specific risk assessment. An essential element in assessing the risk of explosion in workplaces where explosive atmospheres may occur is technical installations and personal protective equipment (PPE that must be designed, manufactured, installed and maintained so that they cannot generate a source of ignition. Explosion prevention and protection requirements are governed by specific norms and standards, and a main part of the explosion risk assessment is related to the assessment of the compliance of the equipment / installation with these requirements.

  20. Chlorine transportation risk assessment

    International Nuclear Information System (INIS)

    Lautkaski, Risto; Mankamo, Tuomas.

    1977-02-01

    An assessment has been made on the toxication risk of the population due to the bulk rail transportation of liquid chlorine in Finland. Fourteen typical rail accidents were selected and their probability was estimated using the accident file of the Finnish State Railways. The probability of a chlorine leak was assessed for each type of accident separately using four leak size categories. The assessed leakage probability was dominated by station accidents, especially by collisions of a chlorine tanker and a locomotive. Toxication hazard areas were estimated for the leak categories. A simple model was constructed to describe the centring of the densely populated areas along the railway line. A comparison was made between the obtained risk and some other risks including those due to nuclear reactor accidents. (author)

  1. Probabilistic risk assessment, Volume I

    International Nuclear Information System (INIS)

    Anon.

    1982-01-01

    This book contains 158 papers presented at the International Topical Meeting on Probabilistic Risk Assessment held by the American Nuclear Society (ANS) and the European Nuclear Society (ENS) in Port Chester, New York in 1981. The meeting was second in a series of three. The main focus of the meeting was on the safety of light water reactors. The papers discuss safety goals and risk assessment. Quantitative safety goals, risk assessment in non-nuclear technologies, and operational experience and data base are also covered. Included is an address by Dr. Chauncey Starr

  2. Risk assessment in maritime transportation

    International Nuclear Information System (INIS)

    Soares, C. Guedes; Teixeira, A.P.

    2001-01-01

    A review is presented of different approaches to quantify the risk in maritime transportation. The discussion of several accident statistics provides a global assessment of the risk levels and its differentiation in ship types and main types of ship losses. Early studies in the probability of ship loss by foundering and capsizing are reviewed. The approaches used to assess the risk of structural design are addressed. Finally a brief account is given of recent development of using formal safety assessments to support decision making on legislation applicable internationally to maritime transportation

  3. Framework for ecological risk assessment

    International Nuclear Information System (INIS)

    Rodier, D.; Norton, S.

    1992-02-01

    Increased interest in ecological issues such as global climate change, habitat loss, acid deposition, reduced biological diversity, and the ecological impacts of pesticides and toxic chemicals prompts this U.S. Environmental Protection Agency (EPA) report, A Framework for Ecological Risk Assessment ('Framework Report'). The report describes basic elements, or a framework, for evaluating scientific information on the adverse effects of physical and chemical stressors on the environment. The framework offers starting principles and a simple structure as guidance for current ecological risk assessments and as a foundation for future EPA proposals for risk assessment guidelines

  4. Risk assessment instruments in clinical practice.

    Science.gov (United States)

    Côté, Gilles; Crocker, Anne G; Nicholls, Tonia L; Seto, Michael C

    2012-04-01

    To determine whether the items in one of the most widely validated instruments of violence risk assessment, the Historical-Clinical-Risk Management-20 (HCR-20), are used in review board hearings to assess the risk of violence by people found Not Criminally Responsible on account of Mental Disorder (NCRMD). This study was conducted from October 2004 to August 2006 in Quebec's sole forensic psychiatric hospital and 2 large civil psychiatric hospitals designated for the care of people declared NCRMD in the Montreal metropolitan area. The risk assessments presented by clinicians at annual review board hearings and the boards' rationale for the release or detention of people found NCRMD were contrasted with the risk assessments conducted by the research team using the HCR-20. The final sample was comprised of 96 men. Very few of the risk factors identified by prior research (HCR-20 items) were mentioned in the hearing process, whether in clinical reports, discussions during the hearing, or in the disposition justification. The findings confirm that there remains a significant gap between research evidence and risk assessment practice.

  5. Reevaluating Interrater Reliability in Offender Risk Assessment

    NARCIS (Netherlands)

    van der Knaap, L.M.; Leenarts, L.E.W.; Born, M.P.; Oosterveld, P.

    2012-01-01

    Offender risk and needs assessment, one of the pillars of the risk-need-responsivity model of offender rehabilitation, usually depends on raters assessing offender risk and needs. The few available studies of interrater reliability in offender risk assessment are, however, limited in the

  6. Quantitative risk assessment system (QRAS)

    Science.gov (United States)

    Weinstock, Robert M (Inventor); Smidts, Carol S (Inventor); Mosleh, Ali (Inventor); Chang, Yung-Hsien (Inventor); Swaminathan, Sankaran (Inventor); Groen, Francisco J (Inventor); Tan, Zhibin (Inventor)

    2001-01-01

    A quantitative risk assessment system (QRAS) builds a risk model of a system for which risk of failure is being assessed, then analyzes the risk of the system corresponding to the risk model. The QRAS performs sensitivity analysis of the risk model by altering fundamental components and quantifications built into the risk model, then re-analyzes the risk of the system using the modifications. More particularly, the risk model is built by building a hierarchy, creating a mission timeline, quantifying failure modes, and building/editing event sequence diagrams. Multiplicities, dependencies, and redundancies of the system are included in the risk model. For analysis runs, a fixed baseline is first constructed and stored. This baseline contains the lowest level scenarios, preserved in event tree structure. The analysis runs, at any level of the hierarchy and below, access this baseline for risk quantitative computation as well as ranking of particular risks. A standalone Tool Box capability exists, allowing the user to store application programs within QRAS.

  7. Ecosystem services as assessment endpoints for ecological risk assessment.

    Science.gov (United States)

    Munns, Wayne R; Rea, Anne W; Suter, Glenn W; Martin, Lawrence; Blake-Hedges, Lynne; Crk, Tanja; Davis, Christine; Ferreira, Gina; Jordan, Steve; Mahoney, Michele; Barron, Mace G

    2016-07-01

    Ecosystem services are defined as the outputs of ecological processes that contribute to human welfare or have the potential to do so in the future. Those outputs include food and drinking water, clean air and water, and pollinated crops. The need to protect the services provided by natural systems has been recognized previously, but ecosystem services have not been formally incorporated into ecological risk assessment practice in a general way in the United States. Endpoints used conventionally in ecological risk assessment, derived directly from the state of the ecosystem (e.g., biophysical structure and processes), and endpoints based on ecosystem services serve different purposes. Conventional endpoints are ecologically important and susceptible entities and attributes that are protected under US laws and regulations. Ecosystem service endpoints are a conceptual and analytical step beyond conventional endpoints and are intended to complement conventional endpoints by linking and extending endpoints to goods and services with more obvious benefit to humans. Conventional endpoints can be related to ecosystem services even when the latter are not considered explicitly during problem formulation. To advance the use of ecosystem service endpoints in ecological risk assessment, the US Environmental Protection Agency's Risk Assessment Forum has added generic endpoints based on ecosystem services (ES-GEAE) to the original 2003 set of generic ecological assessment endpoints (GEAEs). Like conventional GEAEs, ES-GEAEs are defined by an entity and an attribute. Also like conventional GEAEs, ES-GEAEs are broadly described and will need to be made specific when applied to individual assessments. Adoption of ecosystem services as a type of assessment endpoint is intended to improve the value of risk assessment to environmental decision making, linking ecological risk to human well-being, and providing an improved means of communicating those risks. Integr Environ Assess Manag

  8. La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

    Directory of Open Access Journals (Sweden)

    Umberto Fortis

    2014-04-01

    Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.

  9. Using toxicokinetic-toxicodynamic modeling as an acute risk assessment refinement approach in vertebrate ecological risk assessment.

    Science.gov (United States)

    Ducrot, Virginie; Ashauer, Roman; Bednarska, Agnieszka J; Hinarejos, Silvia; Thorbek, Pernille; Weyman, Gabriel

    2016-01-01

    Recent guidance identified toxicokinetic-toxicodynamic (TK-TD) modeling as a relevant approach for risk assessment refinement. Yet, its added value compared to other refinement options is not detailed, and how to conduct the modeling appropriately is not explained. This case study addresses these issues through 2 examples of individual-level risk assessment for 2 hypothetical plant protection products: 1) evaluating the risk for small granivorous birds and small omnivorous mammals of a single application, as a seed treatment in winter cereals, and 2) evaluating the risk for fish after a pulsed treatment in the edge-of-field zone. Using acute test data, we conducted the first tier risk assessment as defined in the European Food Safety Authority (EFSA) guidance. When first tier risk assessment highlighted a concern, refinement options were discussed. Cases where the use of models should be preferred over other existing refinement approaches were highlighted. We then practically conducted the risk assessment refinement by using 2 different models as examples. In example 1, a TK model accounting for toxicokinetics and relevant feeding patterns in the skylark and in the wood mouse was used to predict internal doses of the hypothetical active ingredient in individuals, based on relevant feeding patterns in an in-crop situation, and identify the residue levels leading to mortality. In example 2, a TK-TD model accounting for toxicokinetics, toxicodynamics, and relevant exposure patterns in the fathead minnow was used to predict the time-course of fish survival for relevant FOCUS SW exposure scenarios and identify which scenarios might lead to mortality. Models were calibrated using available standard data and implemented to simulate the time-course of internal dose of active ingredient or survival for different exposure scenarios. Simulation results were discussed and used to derive the risk assessment refinement endpoints used for decision. Finally, we compared the

  10. Hanford Site baseline risk assessment methodology

    International Nuclear Information System (INIS)

    1993-03-01

    This methodology has been developed to prepare human health and environmental evaluations of risk as part of the Comprehensive Environmental Response, Compensation, and Liability Act remedial investigations (RIs) and the Resource Conservation and Recovery Act facility investigations (FIs) performed at the Hanford Site pursuant to the Hanford Federal Facility Agreement and Consent Order referred to as the Tri-Party Agreement. Development of the methodology has been undertaken so that Hanford Site risk assessments are consistent with current regulations and guidance, while providing direction on flexible, ambiguous, or undefined aspects of the guidance. The methodology identifies Site-specific risk assessment considerations and integrates them with approaches for evaluating human and environmental risk that can be factored into the risk assessment program supporting the Hanford Site cleanup mission. Consequently, the methodology will enhance the preparation and review of individual risk assessments at the Hanford Site

  11. RELEVANCE OF PROCESS RISK ASSESSMENT IN AIRLINES

    Directory of Open Access Journals (Sweden)

    Oksana G. Feoktistova

    2017-01-01

    Full Text Available The notion of “the concept on assumed risk” that took over from the outdated concept of absolute security is analyzed, the increasing significance of operating risk assessment at the present stage is noted. Some basic risk assessment techniques are considered. Matrix technique of risk assessment is considered more thoroughly, and it may be used in risk assessment of airlines in the context of labour protection management system.The ability to correctly assess risks and develop appropriate precautionary measures will allow airlines to avoid incidents leading to drastic consequences for staff, as well as to direct and indirect costs for the enterprise among which there could be singled out both direct property damage and loss of profit and expenses connected to incident investigation, penalty and compensation payment, loss of business reputation and so on. To reduce the rate of accidents and to develop safe activities skills for airlines staff a risk assessment chart is supposed to be implemented, which will be an efficient accidents prevention involving the staff in the process and making them follow safe working conditions.Process risk assessment is an integral part of assessment of the whole enterprise activity and work efficiency of a department and particular workers evaluation system. Labour protection activity should be based on risk identification and its control. Risk assessment is a keystone of labour protection activity planning.

  12. Uncertainty quantification in flood risk assessment

    Science.gov (United States)

    Blöschl, Günter; Hall, Julia; Kiss, Andrea; Parajka, Juraj; Perdigão, Rui A. P.; Rogger, Magdalena; Salinas, José Luis; Viglione, Alberto

    2017-04-01

    Uncertainty is inherent to flood risk assessments because of the complexity of the human-water system, which is characterised by nonlinearities and interdependencies, because of limited knowledge about system properties and because of cognitive biases in human perception and decision-making. On top of the uncertainty associated with the assessment of the existing risk to extreme events, additional uncertainty arises because of temporal changes in the system due to climate change, modifications of the environment, population growth and the associated increase in assets. Novel risk assessment concepts are needed that take into account all these sources of uncertainty. They should be based on the understanding of how flood extremes are generated and how they change over time. They should also account for the dynamics of risk perception of decision makers and population in the floodplains. In this talk we discuss these novel risk assessment concepts through examples from Flood Frequency Hydrology, Socio-Hydrology and Predictions Under Change. We believe that uncertainty quantification in flood risk assessment should lead to a robust approach of integrated flood risk management aiming at enhancing resilience rather than searching for optimal defense strategies.

  13. Reevaluating Interrater Reliability in Offender Risk Assessment

    Science.gov (United States)

    van der Knaap, Leontien M.; Leenarts, Laura E. W.; Born, Marise Ph.; Oosterveld, Paul

    2012-01-01

    Offender risk and needs assessment, one of the pillars of the risk-need-responsivity model of offender rehabilitation, usually depends on raters assessing offender risk and needs. The few available studies of interrater reliability in offender risk assessment are, however, limited in the generalizability of their results. The present study…

  14. Enhancing the ecological risk assessment process.

    Science.gov (United States)

    Dale, Virginia H; Biddinger, Gregory R; Newman, Michael C; Oris, James T; Suter, Glenn W; Thompson, Timothy; Armitage, Thomas M; Meyer, Judith L; Allen-King, Richelle M; Burton, G Allen; Chapman, Peter M; Conquest, Loveday L; Fernandez, Ivan J; Landis, Wayne G; Master, Lawrence L; Mitsch, William J; Mueller, Thomas C; Rabeni, Charles F; Rodewald, Amanda D; Sanders, James G; van Heerden, Ivor L

    2008-07-01

    The Ecological Processes and Effects Committee of the US Environmental Protection Agency Science Advisory Board conducted a self-initiated study and convened a public workshop to characterize the state of the ecological risk assessment (ERA), with a view toward advancing the science and application of the process. That survey and analysis of ERA in decision making shows that such assessments have been most effective when clear management goals were included in the problem formulation; translated into information needs; and developed in collaboration with decision makers, assessors, scientists, and stakeholders. This process is best facilitated when risk managers, risk assessors, and stakeholders are engaged in an ongoing dialogue about problem formulation. Identification and acknowledgment of uncertainties that have the potential to profoundly affect the results and outcome of risk assessments also improves assessment effectiveness. Thus we suggest 1) through peer review of ERAs be conducted at the problem formulation stage and 2) the predictive power of risk-based decision making be expanded to reduce uncertainties through analytical and methodological approaches like life cycle analysis. Risk assessment and monitoring programs need better integration to reduce uncertainty and to evaluate risk management decision outcomes. Postdecision audit programs should be initiated to evaluate the environmental outcomes of risk-based decisions. In addition, a process should be developed to demonstrate how monitoring data can be used to reduce uncertainties. Ecological risk assessments should include the effects of chemical and nonchemical stressors at multiple levels of biological organization and spatial scale, and the extent and resolution of the pertinent scales and levels of organization should be explicitly considered during problem formulation. An approach to interpreting lines of evidence and weight of evidence is critically needed for complex assessments, and it would

  15. A framework for combining social impact assessment and risk assessment

    Energy Technology Data Exchange (ETDEWEB)

    Mahmoudi, Hossein, E-mail: mahmoudi@uni-hohenheim.de [Department of Social Sciences in Agriculture, University of Hohenheim (Germany); Environmental Sciences Research Institute, Shahid Beheshti University, G.C. (Iran, Islamic Republic of); Renn, Ortwin [Department of Technology and Environmental Sociology (and DIALOGIK), University of Stuttgart (Germany); Vanclay, Frank [Department of Cultural Geography, Faculty of Spatial Sciences, University of Groningen, Groningen (Netherlands); Hoffmann, Volker [Department of Social Sciences in Agriculture, University of Hohenheim (Germany); Karami, Ezatollah [College of Agriculture, Shiraz University, Shiraz (Iran, Islamic Republic of)

    2013-11-15

    An increasing focus on integrative approaches is one of the current trends in impact assessment. There is potential to combine impact assessment with various other forms of assessment, such as risk assessment, to make impact assessment and the management of social risks more effective. We identify the common features of social impact assessment (SIA) and social risk assessment (SRA), and discuss the merits of a combined approach. A hybrid model combining SIA and SRA to form a new approach called, ‘risk and social impact assessment’ (RSIA) is introduced. RSIA expands the capacity of SIA to evaluate and manage the social impacts of risky projects such as nuclear energy as well as natural hazards and disasters such as droughts and floods. We outline the three stages of RSIA, namely: impact identification, impact assessment, and impact management. -- Highlights: • A hybrid model to combine SIA and SRA namely RSIA is proposed. • RSIA can provide the proper mechanism to assess social impacts of natural hazards. • RSIA can play the role of ex-post as well as ex-ante assessment. • For some complicated and sensitive cases like nuclear energy, conducting a RSIA is necessary.

  16. A framework for combining social impact assessment and risk assessment

    International Nuclear Information System (INIS)

    Mahmoudi, Hossein; Renn, Ortwin; Vanclay, Frank; Hoffmann, Volker; Karami, Ezatollah

    2013-01-01

    An increasing focus on integrative approaches is one of the current trends in impact assessment. There is potential to combine impact assessment with various other forms of assessment, such as risk assessment, to make impact assessment and the management of social risks more effective. We identify the common features of social impact assessment (SIA) and social risk assessment (SRA), and discuss the merits of a combined approach. A hybrid model combining SIA and SRA to form a new approach called, ‘risk and social impact assessment’ (RSIA) is introduced. RSIA expands the capacity of SIA to evaluate and manage the social impacts of risky projects such as nuclear energy as well as natural hazards and disasters such as droughts and floods. We outline the three stages of RSIA, namely: impact identification, impact assessment, and impact management. -- Highlights: • A hybrid model to combine SIA and SRA namely RSIA is proposed. • RSIA can provide the proper mechanism to assess social impacts of natural hazards. • RSIA can play the role of ex-post as well as ex-ante assessment. • For some complicated and sensitive cases like nuclear energy, conducting a RSIA is necessary

  17. Risk assessment [Chapter 9

    Science.gov (United States)

    Dennis S. Ojima; Louis R. Iverson; Brent L. Sohngen; James M. Vose; Christopher W. Woodall; Grant M. Domke; David L. Peterson; Jeremy S. Littell; Stephen N. Matthews; Anantha M. Prasad; Matthew P. Peters; Gary W. Yohe; Megan M. Friggens

    2014-01-01

    What is "risk" in the context of climate change? How can a "risk-based framework" help assess the effects of climate change and develop adaptation priorities? Risk can be described by the likelihood of an impact occurring and the magnitude of the consequences of the impact (Yohe 2010) (Fig. 9.1). High-magnitude impacts are always...

  18. Risk assessment - black art or science?

    International Nuclear Information System (INIS)

    Moore, G.

    1988-01-01

    Measures of risk can be divided into two categories, those that observe or calculate the risk of a process or project, and those that rely on the level of risk as perceived by the people during the assessment. Collection of data of accidents (where cause and effect are obvious) and experiments on animals which can then be extrapolated to humans, are two ways of risk assessment. Mathematical models and computerized simulations, using either fault tree analysis or Monte Carlo methods are explained simply. Using these methods, experts are able to perceive risk fairly realistically. However, the general public's perception of risk is often quite different, as potential risk is assessed in different ways. The concept of tolerable risk is considered, particularly with reference to nuclear reactors such as Sizewell-B. The need to inform the public of safeguards and safety procedures so they have a better understanding of the risks of nuclear power is stressed. (U.K.)

  19. Leveraging Existing Laboratory Capacity towards Universal Health ...

    African Journals Online (AJOL)

    Adequately equipped clinical laboratories should provide early warning signals of health risks. The Assessment categorized the laboratories at three levels relating to the type of facility, these being hospital, health center and health post. This study used results from the SARA to determine the ability to make timely diagnosis ...

  20. Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests

    International Nuclear Information System (INIS)

    Eifler, W.; Shepherd, I.M.

    1983-01-01

    Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix

  1. Concerning ethical risk assessment

    International Nuclear Information System (INIS)

    Boeckle, F.

    1991-01-01

    After a fundamental consideration of the concept of responsibility and 'long-term responsibility' for late sequelae, the problems of an ehtical assessment of risks were illustrated: The concept of risk itself poses three problems - predicting the probability of occurrence, assessing the damage = subjective classification of the degree of damage, determining whether the advantages outweigh the risks. It is not possible to weigh the advantages and risks against each other without assessing the goals and the priorities which have been set. Here ethics is called for, because it concerns itself with the reasonableness of evaluative decisions. Its task is to enable us to become aware of and comprehend our system of values in all of its complexity in reference to real life. Ethics can only fulfill its task if it helps us to adopt an integral perspective, i.e. if it centers on the human being. 'One must assess all technical and economic innovations in terms of whether they are beneficial to the development of mankind on a long-term basis. They are only to be legitimized insofar as they prove themselves to be a means of liberating mankind and contributing to his sense of dignity and identity, as a means of bringing human beings together and encouraging them to care for one another, and as a means of protecting the natural basis of our existence. (orig./HSCH) [de

  2. Ecological risk assessment

    National Research Council Canada - National Science Library

    Suter, Glenn W; Barnthouse, L. W. (Lawrence W)

    2007-01-01

    Ecological risk assessment is commonly applied to the regulation of chemicals, the remediation of contaminated sites, the monitoring of importation of exotic organisms, the management of watersheds...

  3. A risk communication case study: the Nevada risk assessment/management program

    International Nuclear Information System (INIS)

    Hechanova, A.E.

    2001-01-01

    The Nevada Risk Assessment/Management Program is part of a national effort by the U.S. Department of Energy (Grant DE-FG01-96EW56093) to develop new sources of information and approaches to risk assessment, risk management, risk communication and public outreach as these objectives relate to the ecological and human health effects of radioactive and hazardous material management and site remediation activities. This paper reviews the innovation behind the Nevada Risk Assessment/Management Program and presents a synopsis of the effort that began in 1995 and will officially conclude on April 30, 2000. (author)

  4. Caries risk assessment in children

    DEFF Research Database (Denmark)

    Twetman, S

    2016-01-01

    PURPOSE: To summarise the findings of recent systematic reviews (SR) covering caries risk assessment in children, updated with recent primary studies. METHODS: A search for relevant papers published 2012-2014 was conducted in electronic databases. The systematic reviews were quality assessed...... displayed a high risk of bias. CONCLUSIONS: Based on the present summary of literature, it may be concluded: (1) a caries risk assessment should be carried out at the child's first dental visit and reassessments should be done during childhood (D); (2) multivariate models display a better accuracy than...... the use of single predictors and this is especially true for preschool children (C); (3) there is no clearly superior method to predict future caries and no evidence to support the use of one model, program, or technology before the other (C); and (4) the risk category should be linked to appropriate...

  5. [Regional atmospheric environment risk source identification and assessment].

    Science.gov (United States)

    Zhang, Xiao-Chun; Chen, Wei-Ping; Ma, Chun; Zhan, Shui-Fen; Jiao, Wen-Tao

    2012-12-01

    Identification and assessment for atmospheric environment risk source plays an important role in regional atmospheric risk assessment and regional atmospheric pollution prevention and control. The likelihood exposure and consequence assessment method (LEC method) and the Delphi method were employed to build a fast and effective method for identification and assessment of regional atmospheric environment risk sources. This method was applied to the case study of a large coal transportation port in North China. The assessment results showed that the risk characteristics and the harm degree of regional atmospheric environment risk source were in line with the actual situation. Fast and effective identification and assessment of risk source has laid an important foundation for the regional atmospheric environmental risk assessment and regional atmospheric pollution prevention and control.

  6. OPPT workplan risk assessment for Trichloroethylene ...

    Science.gov (United States)

    The assessment will focus on uses of TCE as a degreaser and in consumer products used by individuals in the arts/crafts field. Given the range of endpoints (cancer, non-cancer; the latter includes potential effects on the developing fetus), it is expected that susceptible populations would be children (as bystanders physically near the actual consumer use of the products) and adults of all ages (including pregnant women). Thus, the assessment will focus on all human/lifestages. EPA anticipates issuing draft risk assessments for public review and comment as they are completed. At the conclusion of the review process, if an assessment of specific uses indicates significant risk, EPA will evaluate and pursue appropriate risk reduction actions, as warranted. If an assessment indicates no significant risk, EPA will conclude its current work on assessment of those specified targeted uses of that chemical. Over time, additional chemicals will be added to the work plan as more data are developed and more chemicals screened.

  7. In vitro residual anti-bacterial activity of difloxacin, sarafloxacin and their photoproducts after photolysis in water

    International Nuclear Information System (INIS)

    Kusari, Souvik; Prabhakaran, Deivasigamani; Lamshoeft, Marc; Spiteller, Michael

    2009-01-01

    Fluoroquinolones like difloxacin (DIF) and sarafloxacin (SARA) are adsorbed in soil and enter the aquatic environment wherein they are subjected to photolytic degradation. To evaluate the fate of DIF and SARA, their photolysis was performed in water under stimulated natural sunlight conditions. DIF primarily degrades to SARA. On prolonged photodegradation, seven photoproducts were elucidated by HR-LC-MS/MS, three of which were entirely novel. The residual anti-bacterial activities of DIF, SARA and their photoproducts were studied against a group of pathogenic strains. DIF and SARA revealed potency against both Gram-positive and -negative bacteria. The photoproducts also exhibited varying degrees of efficacies against the tested bacteria. Even without isolating the individual photoproducts, their impact on the aquatic environment could be assessed. Therefore, the present results call for prudence in estimating the fate of these compounds in water and in avoiding emergence of resistance in bacteria caused by the photoproducts of DIF and SARA. - Assessment of the residual anti-bacterial efficacies of difloxacin, sarafloxacin and their photoproducts in water, and estimating their impact on the aquatic environment in inducing resistance to microorganisms.

  8. Tools for Microbiological risk assessment

    DEFF Research Database (Denmark)

    Bassett, john; Nauta, Maarten; Lindqvist, Roland

    can increase the understanding of microbiological risks in foods. It is timely to inform food safety professionals about the availability and utility of MRA tools. Therefore, the focus of this report is to aid the food safety manager by providing a concise summary of the tools available for the MRA......Microbiological Risk Assessment (MRA) has emerged as a comprehensive and systematic approach for addressing the risk of pathogens in specific foods and/or processes. At government level, MRA is increasingly recognised as a structured and objective approach to understand the level of risk in a given...... food/pathogen scenario. Tools developed so far support qualitative and quantitative assessments of the risk that a food pathogen poses to a particular population. Risk can be expressed as absolute numbers or as relative (ranked) risks. The food industry is beginning to appreciate that the tools for MRA...

  9. Modeling for operational event risk assessment

    International Nuclear Information System (INIS)

    Sattison, M.B.

    1997-01-01

    The U.S. Nuclear Regulatory Commission has been using risk models to evaluate the risk significance of operational events in U.S. commercial nuclear power plants for more seventeen years. During that time, the models have evolved in response to the advances in risk assessment technology and insights gained with experience. Evaluation techniques fall into two categories, initiating event assessments and condition assessments. The models used for these analyses have become uniquely specialized for just this purpose

  10. Risk assessment of forensic patients: nurses' role.

    Science.gov (United States)

    Encinares, Maxima; McMaster, Jeff James; McNamee, Jim

    2005-03-01

    One of the unique roles of forensic nurses is to conduct risk assessments. Establishing a therapeutic nurse-patient relationship helps forensic nurses perform accurate and useful risk assessments. Accurate risk assessments can facilitate formulation of individualized risk management plans, designed to meet patients' needs and ensure public safety. The importance of forensic nurses' knowledge and application of appropriate communication and proper documentation cannot be overemphasized.

  11. Ethical dimensions in assessing technical risks

    International Nuclear Information System (INIS)

    Birnbacher, D.

    1991-01-01

    Contrary to the present tendency of partially impact-independent technology assessment, the author does not see a difference between a risk-benefit analysis and an ethical technology assessment. As long as the risk-benefit analysis is truly comprehensive, both fall together. This does not mean that convictions of those who have their doubts about some new technologies, independently of impact assessments, may be disregarded in purely consequential risk evaluations. On the contrary, qualms of representatives of these principles, just as any other stable non-acceptance, have to be included as aggravating negative elements in technology assessments. (orig./HSCH) [de

  12. Total cardiovascular disease risk assessment: a review.

    LENUS (Irish Health Repository)

    Cooney, Marie Therese

    2011-09-01

    The high risk strategy for the prevention of cardiovascular disease (CVD) requires an assessment of an individual\\'s total CVD risk so that the most intensive risk factor management can be directed towards those at highest risk. Here we review developments in the assessment and estimation of total CVD risk.

  13. Risk assessment of carcinogens in food

    International Nuclear Information System (INIS)

    Barlow, Susan; Schlatter, Josef

    2010-01-01

    Approaches for the risk assessment of carcinogens in food have evolved as scientific knowledge has advanced. Early methods allowed little more than hazard identification and an indication of carcinogenic potency. Evaluation of the modes of action of carcinogens and their broad division into genotoxic and epigenetic (non-genotoxic, non-DNA reactive) carcinogens have played an increasing role in determining the approach followed and provide possibilities for more detailed risk characterisation, including provision of quantitative estimates of risk. Reliance on experimental animal data for the majority of risk assessments and the fact that human exposures to dietary carcinogens are often orders of magnitude below doses used in experimental studies has provided a fertile ground for discussion and diverging views on the most appropriate way to offer risk assessment advice. Approaches used by national and international bodies differ, with some offering numerical estimates of potential risks to human health, while others express considerable reservations about the validity of quantitative approaches requiring extrapolation of dose-response data below the observed range and instead offer qualitative advice. Recognising that qualitative advice alone does not provide risk managers with information on which to prioritise the need for risk management actions, a 'margin of exposure' approach for substances that are both genotoxic and carcinogenic has been developed, which is now being used by the World Health Organization and the European Food Safety Authority. This review describes the evolution of risk assessment advice on carcinogens and discusses examples of ways in which carcinogens in food have been assessed in Europe.

  14. Risk assessment of carcinogens in food.

    Science.gov (United States)

    Barlow, Susan; Schlatter, Josef

    2010-03-01

    Approaches for the risk assessment of carcinogens in food have evolved as scientific knowledge has advanced. Early methods allowed little more than hazard identification and an indication of carcinogenic potency. Evaluation of the modes of action of carcinogens and their broad division into genotoxic and epigenetic (non-genotoxic, non-DNA reactive) carcinogens have played an increasing role in determining the approach followed and provide possibilities for more detailed risk characterisation, including provision of quantitative estimates of risk. Reliance on experimental animal data for the majority of risk assessments and the fact that human exposures to dietary carcinogens are often orders of magnitude below doses used in experimental studies has provided a fertile ground for discussion and diverging views on the most appropriate way to offer risk assessment advice. Approaches used by national and international bodies differ, with some offering numerical estimates of potential risks to human health, while others express considerable reservations about the validity of quantitative approaches requiring extrapolation of dose-response data below the observed range and instead offer qualitative advice. Recognising that qualitative advice alone does not provide risk managers with information on which to prioritise the need for risk management actions, a "margin of exposure" approach for substances that are both genotoxic and carcinogenic has been developed, which is now being used by the World Health Organization and the European Food Safety Authority. This review describes the evolution of risk assessment advice on carcinogens and discusses examples of ways in which carcinogens in food have been assessed in Europe.

  15. Impact of shutdown risk on risk-based assessment of technical specifications

    International Nuclear Information System (INIS)

    Deriot, S.

    1992-10-01

    This paper describes the current work performed by the Research and Development Division of EDF concerning risk-based assessment of Operating Technical Specifications (OTS). The current risk-based assessment of OTS at EDF is presented. Then, the level 1 Probabilistic Safety Assessment of unit 3 of the Paluel nuclear power station (called PSA 1300) is described. It is fully computerized and takes into account the risk in shutdown states. A case study is presented. It shows that the fact of considering shutdown risk suggests that the current OTS should be modified

  16. Risk Assessment Uncertainties in Cybersecurity Investments

    Directory of Open Access Journals (Sweden)

    Andrew Fielder

    2018-06-01

    Full Text Available When undertaking cybersecurity risk assessments, it is important to be able to assign numeric values to metrics to compute the final expected loss that represents the risk that an organization is exposed to due to cyber threats. Even if risk assessment is motivated by real-world observations and data, there is always a high chance of assigning inaccurate values due to different uncertainties involved (e.g., evolving threat landscape, human errors and the natural difficulty of quantifying risk. Existing models empower organizations to compute optimal cybersecurity strategies given their financial constraints, i.e., available cybersecurity budget. Further, a general game-theoretic model with uncertain payoffs (probability-distribution-valued payoffs shows that such uncertainty can be incorporated in the game-theoretic model by allowing payoffs to be random. This paper extends previous work in the field to tackle uncertainties in risk assessment that affect cybersecurity investments. The findings from simulated examples indicate that although uncertainties in cybersecurity risk assessment lead, on average, to different cybersecurity strategies, they do not play a significant role in the final expected loss of the organization when utilising a game-theoretic model and methodology to derive these strategies. The model determines robust defending strategies even when knowledge regarding risk assessment values is not accurate. As a result, it is possible to show that the cybersecurity investments’ tool is capable of providing effective decision support.

  17. Engineering aspects of probabilistic risk assessment

    International Nuclear Information System (INIS)

    vonHerrmann, J.L.; Wood, P.J.

    1984-01-01

    Over the last decade, the use of probabilistic risk assessment (PRA) in the nuclear industry has expanded significantly. In these analyses the probabilities of experiencing certain undesired events (for example, a plant accident which results in damage to the nuclear fuel) are estimated and the consequences of these events are evaluated in terms of some common measure. These probabilities and consequences are then combined to form a representation of the risk associated with the plant studied. In the relatively short history of probabilistic risk assessment of nuclear power plants, the primary motivation for these studies has been the quantitative assessment of public risk associated with a single plant or group of plants. Accordingly, the primary product of most PRAs performed to date has been a 'risk curve' in which the probability (or expected frequency) of exceeding a certain consequence level is plotted against that consequence. The most common goal of these assessments has been to demonstrate the 'acceptability' of the calculated risk by comparison of the resultant risk curve to risk curves associated with other plants or with other societal risks. Presented here are brief descriptions of some alternate applications of PRAs, a discussion of how these other applications compare or contrast with the currently popular uses of PRA, and a discussion of the relative benefits of each

  18. Insurance World in Transition: Changes in Global Risk Taking and Risk Assessment

    Science.gov (United States)

    Michel, Gero; Tiampo, Kristy

    2015-04-01

    Catastrophe insurance risk assessment, risk taking, and regulation has evolved over the last 20 years and is gearing up for significant further change in the years ahead. Changes in regulation and influx of capital have put profit margins for catastrophe risk products under pressure despite the fact that changes in climate as well as increasing insurance penetration is expected to heighten demand. As a result, reinsurance strategies are moving away from catastrophe risk. In addition, lower margins require cheaper and more efficient risk assessment methods and processes which are contrary to evolving analytical tools and methods that had increased expenses in line with growing margins over the last decade. New capital providers are less familiar with and less willing to accept complex supply chains for risk management, relationship-driven business and tedious data exchange and management processes. Risk takers claim new measures and ask for more flexibility in the use of tools. The current concepts of catastrophe insurance risk assessment are hence under thorough scrutiny. This presentation deals with the changing landscape in catastrophe insurance risk assessment and risk hedging and discusses changes in catastrophe risk assessment products and demand. How likely is it that private, small and nimble hazard and risk consulting groups - increasingly emanating from larger science organizations - will replace large established firms in their role to assess risk? What role do public-private academic partnerships play in assuming risk for catastrophe insurance and what role could they play in the future? What are the opportunities and downsides of the current changes in risk taking and hedging? What is needed from the scientific community in order to fill the gaps in risk management and who is likely to take advantage of the current changes?

  19. Identification of new proton-rich rare earth nuclei by means of the coupled system helium jet-isotope separator of SARA

    International Nuclear Information System (INIS)

    Ollivier, T.

    1986-01-01

    In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr

  20. Health risk assessment of exposure to ionizing radiation

    International Nuclear Information System (INIS)

    Ogata, Hiromitsu

    2011-01-01

    Risk assessment is an essential process for evaluating the human health effects of exposure to ionizing radiation and for determining acceptable levels of exposure. There are two major components of radiation risk assessment: a measure of exposure level and a measure of disease occurrence. For quantitative estimation of health risks, it is important to evaluate the association between exposure and disease occurrence using epidemiological or experimental data. In these approaches, statistical risk models are used particularly for estimating cancer risks related to exposure to low levels of radiation. This paper presents a summary of basic models and methods of risk assessment for studying exposure-risk relationships. Moreover, quantitative risk estimates are subject to several sources of uncertainty due to inherent limitations in risk assessment studies. This paper also discusses the limitations of radiation risk assessment. (author)

  1. Sovereign default risk assessment

    NARCIS (Netherlands)

    Rijken, H.A.; Altman, E.I.

    2013-01-01

    We propose a new approach toward assessing sovereign risk by examining rigorously the health and aggregate default risk of a nation's private corporate sector. Models can be utilised to measure the probability of default of the non-financial sector cumulatively for five years, both as an absolute

  2. Safety analysis, risk assessment, and risk acceptance criteria

    International Nuclear Information System (INIS)

    Jamali, K.

    1997-01-01

    This paper discusses a number of topics that relate safety analysis as documented in the Department of Energy (DOE) safety analysis reports (SARs), probabilistic risk assessments (PRA) as characterized primarily in the context of the techniques that have assumed some level of formality in commercial nuclear power plant applications, and risk acceptance criteria as an outgrowth of PRA applications. DOE SARs of interest are those that are prepared for DOE facilities under DOE Order 5480.23 and the implementing guidance in DOE STD-3009-94. It must be noted that the primary area of application for DOE STD-3009 is existing DOE facilities and that certain modifications of the STD-3009 approach are necessary in SARs for new facilities. Moreover, it is the hazard analysis (HA) and accident analysis (AA) portions of these SARs that are relevant to the present discussions. Although PRAs can be qualitative in nature, PRA as used in this paper refers more generally to all quantitative risk assessments and their underlying methods. HA as used in this paper refers more generally to all qualitative risk assessments and their underlying methods that have been in use in hazardous facilities other than nuclear power plants. This discussion includes both quantitative and qualitative risk assessment methods. PRA has been used, improved, developed, and refined since the Reactor Safety Study (WASH-1400) was published in 1975 by the Nuclear Regulatory Commission (NRC). Much debate has ensued since WASH-1400 on exactly what the role of PRA should be in plant design, reactor licensing, 'ensuring' plant and process safety, and a large number of other decisions that must be made for potentially hazardous activities. Of particular interest in this area is whether the risks quantified using PRA should be compared with numerical risk acceptance criteria (RACs) to determine whether a facility is 'safe.' Use of RACs requires quantitative estimates of consequence frequency and magnitude

  3. PRECIS -- A probabilistic risk assessment system

    International Nuclear Information System (INIS)

    Peterson, D.M.; Knowlton, R.G. Jr.

    1996-01-01

    A series of computer tools has been developed to conduct the exposure assessment and risk characterization phases of human health risk assessments within a probabilistic framework. The tools are collectively referred to as the Probabilistic Risk Evaluation and Characterization Investigation System (PRECIS). With this system, a risk assessor can calculate the doses and risks associated with multiple environmental and exposure pathways, for both chemicals and radioactive contaminants. Exposure assessment models in the system account for transport of contaminants to receptor points from a source zone originating in unsaturated soils above the water table. In addition to performing calculations of dose and risk based on initial concentrations, PRECIS can also be used in an inverse manner to compute soil concentrations in the source area that must not be exceeded if prescribed limits on dose or risk are to be met. Such soil contaminant levels, referred to as soil guidelines, are computed for both single contaminants and chemical mixtures and can be used as action levels or cleanup levels. Probabilistic estimates of risk, dose and soil guidelines are derived using Monte Carlo techniques

  4. Risk assessment of soil contamination criteria

    International Nuclear Information System (INIS)

    King, C.M.; Marter, W.L.; Montaque, D.F.; Holton, G.A.

    1987-06-01

    Criteria have been developed to select radioactive and nonradioactive contaminants at waste sites detailed analysis and risk assessment. These criteria were based on soil and water quality guidelines developed by various government agencies to determine if the criteria were appropriate. We performed a risk assessment of a hypothetical site which contained radioactive and nonradioactive contaminants at levels equal to the criteria values. Risks to the public from atmospheric, surface water, and groundwater exposure pathways were examined. Health risks to the public from atmospheric releases of radioactive and nonradioactive materials from a waste at soil criteria contamination levels are low. Health risks to the maximally exposed individual to chemical carcinogens are considerably below traditional EPA action levels. And health risks to the maximally exposed individual to atmospherically released radioactive contaminants is 1.88 x 10 -7 , more than a factor of 5 less than 10 -6 . Based on our atmospheric exposure pathways analysis and risk assessment, the applied soil criteria are appropriate for screening out unimportant risk contributors to human health from atmospheric exposure pathways. 13 refs., 3 figs., 7 tabs

  5. Risk assessment for transport operations

    International Nuclear Information System (INIS)

    Appleton, P.R.; Miles, J.C.

    1990-01-01

    The world-wide safety of the transport of radioactive material is based on the IAEA Transport Regulations. Risk assessment can provide quantitative data to help in the demonstration, understanding and improvement of the effectiveness of the Regulations in assuring safety. In this Paper the methodology, data and computer codes necessary and available for transport risk assessment are reviewed. Notable examples of assessments carried out over the past 15 years are briefly described along with current research, and the benefits and limitations of the techniques are discussed. (author)

  6. Assessing Extinction Risk: Integrating Genetic Information

    Directory of Open Access Journals (Sweden)

    Jason Dunham

    1999-06-01

    Full Text Available Risks of population extinction have been estimated using a variety of methods incorporating information from different spatial and temporal scales. We briefly consider how several broad classes of extinction risk assessments, including population viability analysis, incidence functions, and ranking methods integrate information on different temporal and spatial scales. In many circumstances, data from surveys of neutral genetic variability within, and among, populations can provide information useful for assessing extinction risk. Patterns of genetic variability resulting from past and present ecological and demographic events, can indicate risks of extinction that are otherwise difficult to infer from ecological and demographic analyses alone. We provide examples of how patterns of neutral genetic variability, both within, and among populations, can be used to corroborate and complement extinction risk assessments.

  7. Risk assessment of metal vapor arcing

    Science.gov (United States)

    Hill, Monika C. (Inventor); Leidecker, Henning W. (Inventor)

    2009-01-01

    A method for assessing metal vapor arcing risk for a component is provided. The method comprises acquiring a current variable value associated with an operation of the component; comparing the current variable value with a threshold value for the variable; evaluating compared variable data to determine the metal vapor arcing risk in the component; and generating a risk assessment status for the component.

  8. Assessing reservoir operations risk under climate change

    Science.gov (United States)

    Brekke, L.D.; Maurer, E.P.; Anderson, J.D.; Dettinger, M.D.; Townsley, E.S.; Harrison, A.; Pruitt, T.

    2009-01-01

    Risk-based planning offers a robust way to identify strategies that permit adaptive water resources management under climate change. This paper presents a flexible methodology for conducting climate change risk assessments involving reservoir operations. Decision makers can apply this methodology to their systems by selecting future periods and risk metrics relevant to their planning questions and by collectively evaluating system impacts relative to an ensemble of climate projection scenarios (weighted or not). This paper shows multiple applications of this methodology in a case study involving California's Central Valley Project and State Water Project systems. Multiple applications were conducted to show how choices made in conducting the risk assessment, choices known as analytical design decisions, can affect assessed risk. Specifically, risk was reanalyzed for every choice combination of two design decisions: (1) whether to assume climate change will influence flood-control constraints on water supply operations (and how), and (2) whether to weight climate change scenarios (and how). Results show that assessed risk would motivate different planning pathways depending on decision-maker attitudes toward risk (e.g., risk neutral versus risk averse). Results also show that assessed risk at a given risk attitude is sensitive to the analytical design choices listed above, with the choice of whether to adjust flood-control rules under climate change having considerably more influence than the choice on whether to weight climate scenarios. Copyright 2009 by the American Geophysical Union.

  9. NASA Human System Risk Assessment Process

    Science.gov (United States)

    Francisco, D.; Romero, E.

    2016-01-01

    NASA utilizes an evidence based system to perform risk assessments for the human system for spaceflight missions. The center of this process is the multi-disciplinary Human System Risk Board (HSRB). The HSRB is chartered from the Chief Health and Medical Officer (OCHMO) at NASA Headquarters. The HSRB reviews all human system risks via an established comprehensive risk and configuration management plan based on a project management approach. The HSRB facilitates the integration of human research (terrestrial and spaceflight), medical operations, occupational surveillance, systems engineering and many other disciplines in a comprehensive review of human system risks. The HSRB considers all factors that influence human risk. These factors include pre-mission considerations such as screening criteria, training, age, sex, and physiological condition. In mission factors such as available countermeasures, mission duration and location and post mission factors such as time to return to baseline (reconditioning), post mission health screening, and available treatments. All of the factors influence the total risk assessment for each human risk. The HSRB performed a comprehensive review of all potential inflight medical conditions and events and over the course of several reviews consolidated the number of human system risks to 30, where the greatest emphasis is placed for investing program dollars for risk mitigation. The HSRB considers all available evidence from human research and, medical operations and occupational surveillance in assessing the risks for appropriate mitigation and future work. All applicable DRMs (low earth orbit for 6 and 12 months, deep space for 30 days and 1 year, a lunar mission for 1 year, and a planetary mission for 3 years) are considered as human system risks are modified by the hazards associated with space flight such as microgravity, exposure to radiation, distance from the earth, isolation and a closed environment. Each risk has a summary

  10. Risk assessment research and technology assessment

    International Nuclear Information System (INIS)

    Albach, H.; Schade, D.; Sinn, H.

    1991-01-01

    The concepts and approaches for technology assessment, the targets and scientific principles, as well as recognizable deficits and recommendations concerning purposeful strategies for the promotion of this research field require a dialog between those concerned. Conception, deficits, and the necessary measures for risk assessment research and technology assessment were discussed as well as ethical aspects. The problematic nature of using organisms altered through genetic engineering in the open land, traffic and transport, site restoration, nuclear energy, and isotope applications were subjects particularly dealt with. (DG) [de

  11. Assessment of Interpersonal Risk (AIR) in Adults with Learning Disabilities and Challenging Behaviour--Piloting a New Risk Assessment Tool

    Science.gov (United States)

    Campbell, Martin; McCue, Michael

    2013-01-01

    A new risk assessment tool, "Assessment of Interpersonal Risk" (AIR), was piloted and evaluated to measure risk factors and compatibility between individuals living in an assessment and treatment unit in one NHS area. The adults with learning disabilities in this unit had severe and enduring mental health problems and/or behaviour that is severely…

  12. Alteration in Fecal Microbiota Associated with Grain-induced Subacute Ruminal Acidosis Challenge in Dairy Cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    in the field are often not detected. Thus, other and better markers of SARA are needed. The purpose of this research was to study the feces microbiome during SARA and assess the possibilities of using feces microbial markers as indicators of SARA. Methods: Six lactating, rumen cannulated, Danish Holstein cows...... were used in a blocked design study including two blocks. In the first block, two cows received control diet and two cows received SARA-challenge diet. In the second block, former control cows received SARA diet while two new cows received control diet. Cows received a total mixed ration (TMR; 24......% concentrate) for four weeks before the trial. SARA was induced by gradual substitution of 40% of TMR with grain pellets (50:50 wheat:barley) over 3 days. Full SARA diet was fed for four days. Rumen pH was measured continuously by indwelling probes (eCow). Feces samples were taken at 9 am and 9 pm on last day...

  13. Significance of earthquake risk in nuclear power plant probabilistic risk assessments

    International Nuclear Information System (INIS)

    Sues, R.H.; Amico, P.J.; Campbell, R.D.

    1990-01-01

    During the last eight years, approximately 25 utility-sponsored probabilistic risk assessments (PRAs) have been conducted for US nuclear reactors. Of these, ten have been published, seven of which have included complete seismic risk assessment. The results of the seven published PRAs are reviewed here in order to ascertain the significance of the risk due to earthquake initiating events. While PRA methodology has been in a state of development over the past seven years, and the results are subject to interpretation (as discussed in the paper), from the review conducted it is clear that earthquake-induced initiating events are important risk contributors. It is concluded that earthquake initiating events should not be dismissed, a priori, in any nuclear plant risk assessment. (orig.)

  14. The capabilities and applications of the saphire 5.0 safety assessment software

    International Nuclear Information System (INIS)

    Russell, K.D.; Wood, S.T.; Kvarfordt, K.J.

    1994-01-01

    The System Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a suite of computer programs that were developed to create and analyze a probabilistic risk assessment (PRA) of a nuclear power plant. The programs in this suite include: Models and Results Data Base (MAR-D) software, Integrated Reliability and Risk Analysis System (IRRAS) software, System Analysis and Risk Assessment (SARA) software, and Fault tree, Event tree, and Piping and instrumentation diagram (FEP) graphical editor. Each of these programs performs a specific function in taking a PRA from the conceptual state all the way to publication. This paper provides an overview of the features and capabilities provided in version 5.0 of this software system. Some major new features include the ability to store unlimited cut sets, the ability to perform location transformations, the ability to perform seismic analysis, the ability to perform automated rule based recovery analysis and end state cut set partitioning, the ability to perform end state analysis, a new alphanumeric fault tree editor, and a new alphanumeric event tree editor. Many enhancements and improvements to the user interface as well as a significant reduction in the time required to perform an analysis are included in version 5.0. These new features and capabilities provide a powerful set of PC based PRA analysis tools

  15. Chemical Risk Assessment: Traditional vs Public Health ...

    Science.gov (United States)

    Preventing adverse health impacts from exposures to environmental chemicals is fundamental to protecting individual and public health. When done efficiently and properly, chemical risk assessment enables risk management actions that minimize the incidence and impacts of environmentally-induced diseases related to chemical exposure. However, traditional chemical risk assessment is faced with multiple challenges with respect to predicting and preventing disease in human populations, and epidemiological studies increasingly report observations of adverse health effects at exposure levels predicted from animal studies to be safe for humans. This discordance reinforces concerns about the adequacy of contemporary risk assessment practices (Birnbaum, Burke, & Jones, 2016) for protecting public health. It is becoming clear that to protect public health more effectively, future risk assessments will need to use the full range of available data, draw on innovative methods to integrate diverse data streams, and consider health endpoints that also reflect the range of subtle effects and morbidities observed in human populations. Given these factors, there is a need to reframe chemical risk assessment to be more clearly aligned with the public health goal of minimizing environmental exposures associated with disease. Preventing adverse health impacts from exposures to environmental chemicals is fundamental to protecting individual and public health. Chemical risk assessments

  16. Risk-assessment methodology for fast breeder reactors

    International Nuclear Information System (INIS)

    Ott, K.O.

    1976-04-01

    The methods applied or proposed for risk assessment of nuclear reactors are reviewed, particularly with respect to their applicability for risk assessment of future commercial fast breeder reactors. All methods are based on the calculation of accident consequences for relatively few accident scenarios. The role and general impact of uncertainties in fast-reactor accident analysis are discussed. The discussion shows the need for improvement of the methodology. A generalized and improved risk-assessment methodology is outlined and proposed (accident-spectra-progression approach). The generalization consists primarily of an explicit treatment of uncertainties throughout the accident progression. The results of this method are obtained in form of consequence distributions. The width and shape of the distributions depend in part on the superposition of the uncertainties. The first moment of the consequence distribution gives an improved prediction of the ''average'' consequence. The higher-consequence moments can be used for consideration of risk aversion. The assessment of the risk of one or a certain number of nuclear reactors can only provide an ''isolated'' risk assessment. The general problem of safety risk assessment and its relation to public acceptance of certain modes of power production is a much broader problem area, which is also discussed

  17. The evolution of violence risk assessment.

    Science.gov (United States)

    Monahan, John; Skeem, Jennifer L

    2014-10-01

    Many instruments have been published in recent years to improve the ability of mental health clinicians to estimate the likelihood that an individual will behave violently toward others. Increasingly, these instruments are being applied in response to laws that require specialized risk assessments. In this review, we present a framework that goes beyond the "clinical" and "actuarial" dichotomy to describe a continuum of structured approaches to risk assessment. Despite differences among them, there is little evidence that one instrument predicts violence better than another. We believe that these group-based instruments are useful for assessing an individual's risk, and that the instrument should be chosen based on the purpose of the assessment.

  18. Environmental Comparative Risk Assessment: A Case Study

    International Nuclear Information System (INIS)

    Ali, M.M.

    2007-01-01

    Health and environmental impacts associated with energy production and industrial activities as well as food production and agricultural activities have had great concern in the last decades. Early activities emerged in late 80s of the last century through an Inter- Agency project (lAEA, UNDY, WHO, ... ) on the comparative risk assessment from energy systems and industrial complexes. A work-shop on Risk Assessment and Management in large industrial areas was held in Alexandria Egypt on 20-33 Det 1993, sponsored by IAEA. Several conferences, experts work groups and workshops were held there of Recent trends in determining risks are: 1. Use of probabilistic risk assessment approach to identify hazardous activities and accident scenario. 2. development of data base on failure probabilities and appropriate physical models. 3. Development of related directives and regulations and criteria Comparative risk assessment case study as a tool for comparing risk is emphasized Criteria of exposure to human and ecological risks are addressed

  19. Risk assessment approach for Rokkasho reprocessing plant

    International Nuclear Information System (INIS)

    Ootou, Y.; Tamauchi, Y.; Hayashi, Y.; Takebe, K.; Miyata, T.

    2006-01-01

    Full text: It is desirable that the operation and maintenance of Rokkasho Reprocessing Plant (RRP) be established and conducted with maximum effectiveness and efficiency, making the best use of risk information to help the plant achieve further enhanced safety. Risk assessment is applied for RRP, and upgraded risk information is established. In the basic design phase, the potential incidents and accidents that might occur in the plant were identified systematically and exhaustively adopting the HAZOP method. After screening the potential for occurrence, the design basis accidents (DBAs) were identified and it was confirmed that the plant would not put the general public at risk of significant radiation exposure in the case of such accidents, even when assuming the single failure of dynamic apparatus in the prevention and mitigation systems. To support the deterministic safety assessment mentioned above, the risk assessment was conducted during the basic design phase. Of the DBAs and out-of-design basis accidents excluded from DBAs because of extremely rare occurrence possibilities, the risk assessment was conducted for such accidents which might cause relatively high consequence for the general public. The risk assessment was conducted using the PSA method generally used for nuclear power plants. After that, a review of the occurrence frequency assessment for some of the accidents was made, taking into account information relating to detailed design and operation procedures. Typical examples are a loss of the hydrogen scavenging function in the plutonium solution tank and a loss of cooling capability in the high-active liquid waste storage tank. The occurrence frequency for a loss of the hydrogen scavenging function was less than 10 -5 /year. The occurrence frequency for a loss of cooling capability was less than 10 -7 /year. In addition, an importance assessment (FV index, Risk Achievement Worth) was conducted, such as a contribution to the occurrence frequency

  20. The Risk Assessment at the Workplace of Assembly Operation

    Directory of Open Access Journals (Sweden)

    Marek Burda

    2014-01-01

    Full Text Available Risk Assessment Process by FMEA method involve hazard identification, risk assessment and risk control processes and their input is fundamental to a successful EH&S system. This Risk assessment tool follows the general process and requirements of the Health and Safety Risk Assessment Procedure.

  1. Research into specific risk assessment in project financing

    Directory of Open Access Journals (Sweden)

    Ivana Bestvina Bukvić

    2013-12-01

    Full Text Available An assessment of investment justification in terms of risk enables the decision maker (investor to select, among available alternatives, the one with the most favourable correlation between the expected profit and assumed risk. At the micro level, the uncertainty of business success is extremely high in production activities, which is an additional incentive for taking a comprehensive approach to the issue of investment decision-making and the development of risk assessment techniques applicable in this particular segment of industry. Given the complexity of the manufacturing process, the length of the production cycle, market conditions, and entity-specific risks (which are difficult to measure, projects in manufacturing industry require a detailed and comprehensive assessment of specific risk factors and their cost-effectiveness. Ne - vertheless, since specific risks can be diversified, investment proposal assessments in practice usually do not cover their quantification and analysis. However, the majority of business entities do not have enough active projects in various industries to be able to fully diversify their business and thus minimize the level of specific risks. The impact of specific factors becomes one of the most important elements for business success. This paper analyses how far risk assessment methods regarding specific risks are used in practice. Furthermore, it analyses the significance of specific risks for total investment risk. This study gives new insi - ghts into the significance of specific risks to the overall investment assessment and the need for permanent development of traditionally used investment assessment models.

  2. Risk assessment of complex accident scenarios

    International Nuclear Information System (INIS)

    Kluegel, Jens-Uwe

    2012-01-01

    The use of methods of risk assessment in accidents in nuclear plants is based on an old tradition. The first consistent systematic study is considered to be the Rasmussen Study of the U.S. Nuclear Regulatory Commission, NRC, WASH-1400. Above and beyond the realm of nuclear technology, there is an extensive range of accident, risk and reliability research into technical-administrative systems. In the past, it has been this area of research which has led to the development of concepts of safety precautions of the type also introduced into nuclear technology (barrier concept, defense in depth, single-failure criterion), where they are now taken for granted as trivial concepts. Also for risk analysis, nuclear technology made use of methods (such as event and fault tree analyses) whose origins were outside the nuclear field. One area in which the use of traditional methods of probabilistic safety analysis is encountering practical problems is risk assessment of complex accident scenarios in nuclear technology. A definition is offered of the term 'complex accident scenarios' in nuclear technology. A number of problems are addressed which arise in the use of traditional PSA procedures in risk assessment of complex accident scenarios. Cases of complex accident scenarios are presented to demonstrate methods of risk assessment which allow robust results to be obtained even when traditional techniques of risk analysis are maintained as a matter of principle. These methods are based on the use of conditional risk metrics. (orig.)

  3. Aquatic Macrophyte Risk Assessment for Pesticides

    NARCIS (Netherlands)

    Maltby, L.; Arnold, D.; Arts, G.H.P.; Davies, J.; Heimbach, F.; Pickl, C.; Poulsen, V.

    2009-01-01

    Given the essential role that primary producers play in aquatic ecosystems, it is imperative that the potential risk of pesticides to the structure and functioning of aquatic plants is adequately assessed. This book discusses the assessment of the risk of pesticides with herbicidal activity to

  4. Risk assessment and risk transfer from an insurerś point of view

    Science.gov (United States)

    Ebner, G.

    2009-04-01

    Risk, a word that causes a lot of associations in human brains. Many of us don't like risks. Since hundreds of years insurance is the most common way to get rid of the financial consequences when risks convert to damages. This article deals with commercial risks and the possibilities of risk transfer, an important task within the field of risk management. For commercial entities it is very important to transfer risks, threatening the competitiveness or even worse the existence of a company. At the beginning of insurance it was more the less a bet between merchants and rich people. Later on mutual societies were taking place. Today we see a complex insurance industry with insurers, reinsurers, self insuring possibilities via captives and much more. This complex system, with all the different ways to deal with risk transfer requires a professional risk assessment! Risk assessment is based on knowledge about the threatened assets, the likelihood that they will be damaged, the threats and the possibilities to protect these assets. Assets may be tangible or intangible. Assessing risks is not a precise calculation that delivers a result without any doubt. But insurers and insured need a basis to fix a premium, both of them can agree. This contribution will present a system to assess risks and to find the right risk-transfer-premiums.

  5. Risk assessment and management in IOR projects

    International Nuclear Information System (INIS)

    Goodyear, S.G.; Gregory, A.T.

    1994-01-01

    The application of IOR techniques is one of the investment opportunities open to Exploration and Production companies. A project will only go forward if the perceived balance between the rewards and the risks is acceptable. IOR projects may be ruled out because they are considered to involve significantly higher risks than conventional developments. Therefore, some means of evaluating the actual level of risk may be required if the full economic benefits from IOR techniques are to be realized. Risk assessment is a key element in safety cases, where a well-established methodology for quantifying risk exists. This paper discusses the extension of these methods to IOR project risk assessment. Combining reservoir and IOR technique uncertainties with their impact on project performance allows project risk to be better quantified. The results of the risk assessment are presented in terms of a risk-reward diagram that plots the probability surface for possible project outcomes as a function of NPV (reward) and exposure (risk)

  6. Risk assessment and nuclear power

    International Nuclear Information System (INIS)

    Bodansky, D.

    1982-01-01

    The range of risk perceptions involving nuclear power is so great that there is little hope of bridging extreme positions, but a consensus based upon reasoned discussion among uncommitted people could determine a sensible path. Our concerns over the uncertainties of risk assessment have made it increasingly difficult to make responsible decisions fast enough to deal with modern needs. The result is an immobility in energy matters that can point to a 2% reduction in oil use as its only triumph. The risk of nuclear war as a result of military action over energy issues suggests to some that the solution is to abolish nuclear power (however impractical) and to others that a rapid spread of nuclear power will eliminate energy as an incentive for war. If nuclear war is the major risk to consider, risk assessments need to include the risks of war, as well as those of carbon dioxide buildup and socio-economic disruptions, all of which loom larger than the risks of nuclear-plant accidents. Energy choices should be aimed at diminishing these major risks, even if they include the use of nuclear power. 26 references

  7. Risk assessment handbook

    International Nuclear Information System (INIS)

    Farmer, F.G.; Jones, J.L.; Hunt, R.N.; Roush, M.L.; Wierman, T.E.

    1990-09-01

    The Probabilistic Risk Assessment Unit at EG ampersand G Idaho has developed this handbook to provide guidance to a facility manager exploring the potential benefit to be gained by performance of a risk assessment properly scoped to meet local needs. This document is designed to help the manager control the resources expended commensurate with the risks being managed and to assure that the products can be used programmatically to support future needs in order to derive maximum beneflt from the resources expended. We present a logical and functional mapping scheme between several discrete phases of project definition to ensure that a potential customer, working with an analyst, is able to define the areas of interest and that appropriate methods are employed in the analysis. In addition the handbook is written to provide a high-level perspective for the analyst. Previously, the needed information was either scattered or existed only in the minds of experienced analysts. By compiling this information and exploring the breadth of knowledge which exists within the members of the PRA Unit, the functional relationships between the customers' needs and the product have been established

  8. Risk Assessment of Genetically Modified Microorganisms

    DEFF Research Database (Denmark)

    Jacobsen, B. L.; Wilcks, Andrea

    2001-01-01

    the industry, national administration and research institutions were gathered to discuss which elements should be considered in a risk assessment of genetically modified microorganisms used as food or food ingredients. The existing EU and national regulations were presented, together with the experiences......The rapid development of recombinant DNA techniques for food organisms urges for an ongoing discussion on the risk assessment of both new as traditional use of microorganisms in food production. This report, supported by the Nordic Council of Ministers, is the result of a workshop where people from...... with risk assessment of these organisms in each Nordic country....

  9. Subjective risk assessment for planning conservation projects

    International Nuclear Information System (INIS)

    Game, Edward T; Fitzsimons, James A; Lipsett-Moore, Geoff; McDonald-Madden, Eve

    2013-01-01

    Conservation projects occur under many types of uncertainty. Where this uncertainty can affect achievement of a project’s objectives, there is risk. Understanding risks to project success should influence a range of strategic and tactical decisions in conservation, and yet, formal risk assessment rarely features in the guidance or practice of conservation planning. We describe how subjective risk analysis tools can be framed to facilitate the rapid identification and assessment of risks to conservation projects, and how this information should influence conservation planning. Our approach is illustrated with an assessment of risks to conservation success as part of a conservation plan for the work of The Nature Conservancy in northern Australia. Risks can be both internal and external to a project, and occur across environmental, social, economic and political systems. Based on the relative importance of a risk and the level of certainty in its assessment we propose a series of appropriate, project level responses including research, monitoring, and active amelioration. Explicit identification, prioritization, and where possible, management of risks are important elements of using conservation resources in an informed and accountable manner. (letter)

  10. INCORPORATING NONCHEMICAL STRESSORS INTO CUMMULATIVE RISK ASSESSMENTS

    Science.gov (United States)

    The risk assessment paradigm has begun to shift from assessing single chemicals using "reasonable worst case" assumptions for individuals to considering multiple chemicals and community-based models. Inherent in community-based risk assessment is examination of all stressors a...

  11. A risk communication case study: the Nevada risk assessment/management program

    International Nuclear Information System (INIS)

    Hechanova, A.E.

    2000-01-01

    The Nevada Risk Assessment/Management Program (NRAMP) is part of a national effort by the U.S. Department of Energy (DOE) to develop new sources of information and approaches to risk assessment, risk management, risk communication and public outreach as these objectives relate to the ecological and human health effects of radioactive and hazardous material management and site remediation activities. This paper reviews the innovation behind the NRAMP project and presents a synopsis of the NRAMP effort which occurred from 1995 to 2000. The primary goals of the DOE in awarding the cooperative agreement establishing NRAMP were to (I) use a risk-based approach to evaluate the consequences of alternative actions in DOE's Environmental Remediation Programs at sites in Nevada and (2) use a neutral and credible institution outside the DOE to perform the risk assessments and contribute to public education about environmental management issues at the Nevada Test Site. (author)

  12. Approaches to risk assessment in food allergy

    DEFF Research Database (Denmark)

    Madsen, Charlotte Bernhard; Hattersley, S.; Buck, J.

    2009-01-01

    modelling is considered to be the most promising approach for use in population risk assessment (which is a particular focus for risk managers). For all approaches, further improvement of input data is desirable, particularly data on consumption patterns/food choices in food allergic consumers, data...... models. The workshop concluded that all the three approaches to safety and risk assessment of allergenic foods should continue to be considered. A particular strength of the MoE and probabilistic approaches is that they do not rely on low-dose extrapolations with its inherent issues. Probabilistic......A workshop was organised to investigate whether risk assessment strategies and methodologies used in classical/conventional toxicology may be used for risk assessment of allergenic foods. to discuss the advantages and limitations of different approaches and to determine the research needed to move...

  13. Hanford waste vitrification systems risk assessment

    International Nuclear Information System (INIS)

    Miller, W.C.; Hamilton, D.W.; Holton, L.K.; Bailey, J.W.

    1991-09-01

    A systematic Risk Assessment was performed to identify the technical, regulatory, and programmatic uncertainties and to quantify the risks to the Hanford Site double-shell tank waste vitrification program baseline (as defined in December 1990). Mitigating strategies to reduce the overall program risk were proposed. All major program elements were evaluated, including double-shell tank waste characterization, Tank Farms, retrieval, pretreatment, vitrification, and grouting. Computer-based techniques were used to quantify risks to proceeding with construction of the Hanford Waste Vitrification Plant on the present baseline schedule. Risks to the potential vitrification of single-shell tank wastes and cesium and strontium capsules were also assessed. 62 refs., 38 figs., 26 tabs

  14. Analysis of existing risk assessments, and list of suggestions

    CERN Document Server

    Heimsch, Laura

    2016-01-01

    The scope of this project was to analyse risk assessments made at CERN and extracting some crucial information about the different methodologies used, profiles of people who make the risk assessments, and gathering information of whether the risk matrix was used and if the acceptable level of risk was defined. Second step of the project was to trigger discussion inside HSE about risk assessment by suggesting a risk matrix and a risk assessment template.

  15. Risk monitor-a tool for computer aided risk assessment for NPPs

    International Nuclear Information System (INIS)

    Vinod, Gopika; Saraf, R.K.; Babar, A.K.; Kushwaha, H.S.; Hadap, Nikhil

    2001-01-01

    Considerable changes occur in components status and system design and subsequent operation due to changes in plant configuration and their operating procedures. These changes are organised because some components are randomly down and other can be planned for test, maintenance and repair. This results in a fluctuation of risk level over operating time, which is termed as risk profile. Probabilistic Safety Assessment (PSA) is an analytical technique for assessing the risk by integrating diverse aspects of design and operation of a Nuclear Power Plant. Risk can be defined as the product of the probability of an accident and the consequences from that accident. Reactor Safety Division of BARC has developed PC based tool, which can assess the risk profile. This package can be used to optimise the operation in Nuclear Power Plants with respect to a minimum risk level over the operating time, and is termed as Risk Monitor. Risk Monitor is user friendly and can re-evaluate core damage frequency for changes in component status, test interval, initiating event frequency etc. Plant restoration advice, when the plant is in high risk configuration, current status of all plant equipment, and equipment prioritization are also provided by the package. (author)

  16. Site remediation guided by risk assessment

    International Nuclear Information System (INIS)

    McBean, E.A.; Gowing, A.; Pieczonka, G.

    2002-01-01

    'Full text:' Risk assessment (RA) provides an effective tool for identifying hazards with respect to human health and ecological receptors, hazards that arise from contaminants in the environment. Risk assessment relies upon: hazard identification/problem formulation; toxicity assessment; exposure assessment; and risk characterization. Hence, risk assessment provides an effective guide for site remediation through the identification of the associated risks arising from pre- and potential post-remediation activities. As a demonstration of this decision-making process, a site-specific risk assessment (SSRA) was performed on a chemical producing facility. Historical waste practices during the production of DDT compounds resulted in impacted site soils and sediment and soils of the creek passing through the facility. The purpose of the SSRA was to derive site-specific cleanup values for the impacted on-site soils, creek sediments, and embankment soils, incorporating human and ecological receptors associated with the environmental media. The human exposure pathways considered were dermal contact, incidental ingestion, and inhalation of the various soils. The potential human receptors were industrial workers, construction workers, trespassers, and off-site residents. Ingestion of fish from the creek by residents was also evaluated in the human health risk assessment (HHRA). Food web analyses were used to evaluate the impact of exposure to chemical compounds in aquatic sediments and related soils by ecological receptors such as the great blue heron, raccoon, and mink. The SSRA involved modelling the daily chemical intake by receptors and the transfer of chemicals to identified secondary media (e.g., ambient air or animal tissues) that are also potential exposure media. These models, while using the site-specific chemical data in the source media, possess uncertainties associated with default parameters that are only approximations and not site-specific (e.g., soil

  17. Surgery Risk Assessment (SRA) Database

    Data.gov (United States)

    Department of Veterans Affairs — The Surgery Risk Assessment (SRA) database is part of the VA Surgical Quality Improvement Program (VASQIP). This database contains assessments of selected surgical...

  18. Cultural heuristics in risk assessment of HIV/AIDS

    NARCIS (Netherlands)

    Bailey, A.; Hutter, I.

    2006-01-01

    Behaviour change models in HIV prevention tend to consider that risky sexual behaviours reflect risk assessments and that by changing risk assessments behaviour can be changed. Risk assessment is however culturally constructed. Individuals use heuristics or bounded cognitive devices derived from

  19. Defining Probability in Sex Offender Risk Assessment.

    Science.gov (United States)

    Elwood, Richard W

    2016-12-01

    There is ongoing debate and confusion over using actuarial scales to predict individuals' risk of sexual recidivism. Much of the debate comes from not distinguishing Frequentist from Bayesian definitions of probability. Much of the confusion comes from applying Frequentist probability to individuals' risk. By definition, only Bayesian probability can be applied to the single case. The Bayesian concept of probability resolves most of the confusion and much of the debate in sex offender risk assessment. Although Bayesian probability is well accepted in risk assessment generally, it has not been widely used to assess the risk of sex offenders. I review the two concepts of probability and show how the Bayesian view alone provides a coherent scheme to conceptualize individuals' risk of sexual recidivism.

  20. Completion of risk assessment and monitoring within forensic psychiatry.

    Science.gov (United States)

    Galappathie, Nuwan; Heeramun, Ragini; Jethwa, Krishma

    2009-04-01

    There is a clear need for high standards of risk assessment and monitoring within forensic psychiatry. This has been highlighted by a number of high profile homicide enquires which have called for better standards of multidisciplinary risk assessment and monitoring. There are no national standards for risk assessment. We conducted a study to audit electronically the completion rate of a service-designed risk assessment document within Fromside, a medium secure unit in the UK. The completion rates for key sections of 64 risk assessment documents were assessed. Only 48 of the 64 (75%) documents were electronically available. The completion rates ranged from 59/64 (92%) for the retrospective risk review to 46/64 (72%) for relapse indicators. Only 35/64 (55%) risk documents were updated within the last three months. We found that the use of risk profile documents has helped achieve good standards of risk assessment, however greater priority needs to be given to ongoing monitoring. We recommend that consideration is given to the development of national guidelines for multidisciplinary risk assessment and monitoring.

  1. Quantifying risk and accuracy in cancer risk assessment: the process and its role in risk management problem-solving.

    Science.gov (United States)

    Turturro, A; Hart, R W

    1987-01-01

    A better understanding of chemical-induced cancer has led to appreciation of similarities to problems addressed by risk management of radiation-induced toxicity. Techniques developed for cancer risk assessment of toxic substances can be generalized to toxic agents. A recent problem-solving approach for risk management of toxic substances developed for the U.S. Department of Health and Human Services, and the role of risk assessment and how uncertainty should be treated within the context of this approach, is discussed. Finally, two different methods, research into the assumptions underlying risk assessment and the modification of risk assessment/risk management documents, are used to illustrate how the technique can be applied.

  2. Risk Assessment for an Unmanned Merchant Ship

    Directory of Open Access Journals (Sweden)

    Ø.J. Rødseth

    2015-09-01

    Full Text Available The MUNIN project is doing a feasibility study on an unmanned bulk carrier on an intercontinental voyage. To develop the technical and operational concepts, MUNIN has used a risk-based design method, based on the Formal Safety Analysis method which is also recommended by the International Mari-time Organization. Scenario analysis has been used to identify risks and to simplify operational scope. Systematic hazard identification has been used to find critical safety and security risks and how to address these. Technology and operational concept testing is using a hypothesis-based test method, where the hypotheses have been created as a result of the risk assessment. Finally, the cost-benefit assessment will also use results from the risk assessment. This paper describes the risk assessment method, some of the most important results and also describes how the results have been or will be used in the different parts of the project.

  3. Hanford Site Risk Assessment Methodology. Revision 3

    International Nuclear Information System (INIS)

    1995-05-01

    This methodology has been developed to prepare human health and ecological evaluations of risk as part of the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) remedial investigations (RI) and the Resource conservation and Recovery Act of 1976 (RCRA) facility investigations (FI) performed at the Hanford Site pursuant to the hanford Federal Facility Agreement and Consent Order (Ecology et al. 1994), referred to as the Tri-Party Agreement. Development of the methodology has been undertaken so that Hanford Site risk assessments are consistent with current regulations and guidance, while providing direction on flexible, ambiguous, or undefined aspects of the guidance. The methodology identifies site-specific risk assessment considerations and integrates them with approaches for evaluating human and ecological risk that can be factored into the risk assessment program supporting the Hanford Site cleanup mission. Consequently, the methodology will enhance the preparation and review of individual risk assessments at the Hanford Site

  4. Assessment and uncertainty analysis of groundwater risk.

    Science.gov (United States)

    Li, Fawen; Zhu, Jingzhao; Deng, Xiyuan; Zhao, Yong; Li, Shaofei

    2018-01-01

    Groundwater with relatively stable quantity and quality is commonly used by human being. However, as the over-mining of groundwater, problems such as groundwater funnel, land subsidence and salt water intrusion have emerged. In order to avoid further deterioration of hydrogeological problems in over-mining regions, it is necessary to conduct the assessment of groundwater risk. In this paper, risks of shallow and deep groundwater in the water intake area of the South-to-North Water Transfer Project in Tianjin, China, were evaluated. Firstly, two sets of four-level evaluation index system were constructed based on the different characteristics of shallow and deep groundwater. Secondly, based on the normalized factor values and the synthetic weights, the risk values of shallow and deep groundwater were calculated. Lastly, the uncertainty of groundwater risk assessment was analyzed by indicator kriging method. The results meet the decision maker's demand for risk information, and overcome previous risk assessment results expressed in the form of deterministic point estimations, which ignore the uncertainty of risk assessment. Copyright © 2017 Elsevier Inc. All rights reserved.

  5. Risk assessment using probabilistic standards

    International Nuclear Information System (INIS)

    Avila, R.

    2004-01-01

    A core element of risk is uncertainty represented by plural outcomes and their likelihood. No risk exists if the future outcome is uniquely known and hence guaranteed. The probability that we will die some day is equal to 1, so there would be no fatal risk if sufficiently long time frame is assumed. Equally, rain risk does not exist if there was 100% assurance of rain tomorrow, although there would be other risks induced by the rain. In a formal sense, any risk exists if, and only if, more than one outcome is expected at a future time interval. In any practical risk assessment we have to deal with uncertainties associated with the possible outcomes. One way of dealing with the uncertainties is to be conservative in the assessments. For example, we may compare the maximal exposure to a radionuclide with a conservatively chosen reference value. In this case, if the exposure is below the reference value then it is possible to assure that the risk is low. Since single values are usually compared; this approach is commonly called 'deterministic'. Its main advantage lies in the simplicity and in that it requires minimum information. However, problems arise when the reference values are actually exceeded or might be exceeded, as in the case of potential exposures, and when the costs for realizing the reference values are high. In those cases, the lack of knowledge on the degree of conservatism involved impairs a rational weighing of the risks against other interests. In this presentation we will outline an approach for dealing with uncertainties that in our opinion is more consistent. We will call it a 'fully probabilistic risk assessment'. The essence of this approach consists in measuring the risk in terms of probabilities, where the later are obtained from comparison of two probabilistic distributions, one reflecting the uncertainties in the outcomes and one reflecting the uncertainties in the reference value (standard) used for defining adverse outcomes. Our first aim

  6. Aggregate Exposure and Cumulative Risk Assessment--Integrating Occupational and Non-occupational Risk Factors.

    Science.gov (United States)

    Lentz, T J; Dotson, G S; Williams, P R D; Maier, A; Gadagbui, B; Pandalai, S P; Lamba, A; Hearl, F; Mumtaz, M

    2015-01-01

    Occupational exposure limits have traditionally focused on preventing morbidity and mortality arising from inhalation exposures to individual chemical stressors in the workplace. While central to occupational risk assessment, occupational exposure limits have limited application as a refined disease prevention tool because they do not account for all of the complexities of the work and non-occupational environments and are based on varying health endpoints. To be of greater utility, occupational exposure limits and other risk management tools could integrate broader consideration of risks from multiple exposure pathways and routes (aggregate risk) as well as the combined risk from exposure to both chemical and non-chemical stressors, within and beyond the workplace, including the possibility that such exposures may cause interactions or modify the toxic effects observed (cumulative risk). Although still at a rudimentary stage in many cases, a variety of methods and tools have been developed or are being used in allied risk assessment fields to incorporate such considerations in the risk assessment process. These approaches, which are collectively referred to as cumulative risk assessment, have potential to be adapted or modified for occupational scenarios and provide a tangible path forward for occupational risk assessment. Accounting for complex exposures in the workplace and the broader risks faced by the individual also requires a more complete consideration of the composite effects of occupational and non-occupational risk factors to fully assess and manage worker health problems. Barriers to integrating these different factors remain, but new and ongoing community-based and worker health-related initiatives may provide mechanisms for identifying and integrating risk from aggregate exposures and cumulative risks from all relevant sources, be they occupational or non-occupational.

  7. Systems Toxicology: The Future of Risk Assessment.

    Science.gov (United States)

    Sauer, John Michael; Hartung, Thomas; Leist, Marcel; Knudsen, Thomas B; Hoeng, Julia; Hayes, A Wallace

    2015-01-01

    Risk assessment, in the context of public health, is the process of quantifying the probability of a harmful effect to individuals or populations from human activities. With increasing public health concern regarding the potential risks associated with chemical exposure, there is a need for more predictive and accurate approaches to risk assessment. Developing such an approach requires a mechanistic understanding of the process by which xenobiotic substances perturb biological systems and lead to toxicity. Supplementing the shortfalls of traditional risk assessment with mechanistic biological data has been widely discussed but not routinely implemented in the evaluation of chemical exposure. These mechanistic approaches to risk assessment have been generally referred to as systems toxicology. This Symposium Overview article summarizes 4 talks presented at the 35th Annual Meeting of the American College of Toxicology. © The Author(s) 2015.

  8. Risk assessment in support of plant health

    DEFF Research Database (Denmark)

    Jeger, Michael; Schans, Jan; Lövei, Gabor L.

    2012-01-01

    environmental risk assessment and the evaluation of risk reducing options. Quantitative approaches have become increasingly important during this time. The Panel has developed such methods in climatic mapping (in association with the Joint Research Councils), application of spatial spread models, re......With the establishment of the Plant Health Panel in 2006, EFSA became the body responsible for risk assessment in the plant health area for the European Union (EU). Since then more than 70 outputs have been produced dealing with the full range of organisms harmful to plant health across all crop...... types and plants in the environment. There has been an increasing trend towards producing scientific opinions which are full pest risk assessments for the whole EU territory. In its work, and as a contribution to the wider development of risk assessment methodology, the Panel has developed a series...

  9. Performing the lockout/tagout risk assessment.

    Science.gov (United States)

    Wallace, W Jon

    2007-03-01

    Lockout/tagout provides the greatest level routine, repetitive, and integral to the production process, a risk assessment should be performed. If the task performed poses an unacceptable risk, acceptable risk reduction methods should be implemented to reduce the risk to acceptable levels.

  10. Bioassay-based risk assessment of complex mixtures

    International Nuclear Information System (INIS)

    Donnelly, K.C.; Huebner, H.J.

    1996-01-01

    The baseline risk assessment often plays an integral role in various decision-making processes at Superfund sites. The present study reports on risk characterizations prepared for seven complex mixtures using biological and chemical analysis. Three of the samples (A, B, and C) were complex mixtures of polycyclic aromatic hydrocarbons (PAHs) extracted from coal tar; while four samples extracted from munitions-contaminated soil contained primarily nitroaromatic hydrocarbons. The chemical-based risk assessment ranked sample C as least toxic, while the risk associated with samples A and B was approximately equal. The microbial bioassay was in general agreement for the coal tar samples. The weighted activity of the coal tar extracts in Salmonella was 4,960 for sample C, and 162,000 and 206,000 for samples A and B, respectively. The bacterial mutagenicity of 2,4,6-trinitrotoluene contaminated soils exhibited an indirect correlation with chemical-based risk assessment. The aqueous extract of sample 004 induced 1,292 net revertants in Salmonella, while the estimated risk to ingestion and dermal adsorption was 2E-9. The data indicate that the chemical-based risk assessment accurately predicted the genotoxicity of the PAHs, while the accuracy of the risk assessment for munitions contaminated soils was limited due to the presence of metabolites of TNT degradation. The biological tests used in this research provide a valuable compliment to chemical analysis for characterizing the genotoxic risk of complex mixtures

  11. The role of service readiness and health care facility factors in attrition from Option B+ in Haiti: a joint examination of electronic medical records and service provision assessment survey data.

    Science.gov (United States)

    Lipira, Lauren; Kemp, Christopher; Domercant, Jean Wysler; Honoré, Jean Guy; Francois, Kesner; Puttkammer, Nancy

    2018-01-01

    Option B+ is a strategy wherein pregnant or breastfeeding women with HIV are enrolled in lifelong antiretroviral therapy (ART) for prevention of mother-to-child transmission (PMTCT) of HIV. In Haiti, attrition from Option B+ is problematic and variable across health care facilities. This study explores service readiness and other facility factors as predictors of Option B+ attrition in Haiti. This analysis used longitudinal data from 2012 to 2014 from the iSanté electronic medical record system and cross-sectional data from Haiti's 2013 Service Provision Assessment. Predictors included Service Availability and Readiness Assessment (SARA) measures for antenatal care (ANC), PMTCT, HIV care services and ART services; general facility characteristics and patient-level factors. Multivariable Cox proportional hazards models modelled the time to first attrition. Analysis of data from 3147 women at 63 health care facilities showed no significant relationships between SARA measures and attrition. Having integrated ANC/PMTCT care and HIV-related training were significant protective factors. Being a public-sector facility, having a greater number of quality improvement activities and training in ANC were significant risk factors. Several facility-level factors were associated with Option B+ attrition. Future research is needed to explore unmeasured facility factors, clarify causal relationships, and incorporate community-level factors into the analysis of Option B+ attrition. © The Author(s) 2018. Published by Oxford University Press on behalf of Royal Society of Tropical Medicine and Hygiene. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  12. An integrated framework for health and ecological risk assessment

    International Nuclear Information System (INIS)

    Suter, Glenn W.; Vermeire, Theo; Munns, Wayne R.; Sekizawa, Jun

    2005-01-01

    The worldHealth Organization's (WHO's) International Program for Chemical Safety has developed a framework for performing risk assessments that integrate the assessment of risks to human health and risks to nonhuman organisms and ecosystems. The WHO's framework recognizes that stakeholders and risk managers have their own processes that are parallel to the scientific process of risk assessment and may interact with the risk assessment at various points, depending on the context. Integration of health and ecology provides consistent expressions of assessment results, incorporates the interdependence of humans and the environment, uses sentinel organisms, and improves the efficiency and quality of assessments relative to independent human health and ecological risk assessments. The advantage of the framework to toxicologists lies in the opportunity to use understanding of toxicokinetics and toxicodynamics to inform the integrated assessment of all exposed species

  13. Risk assessment of radiation carcinogenesis

    International Nuclear Information System (INIS)

    Kai, Michiaki

    2012-01-01

    This commentary describes the radiation cancer risk assessed by international organizations other than ICRP, assessed for radon and for internal exposure, in the series from the aspect of radiation protection of explaining the assessments done until ICRP Pub. 103. Statistic significant increase of cancer formation is proved at higher doses than 100-200 mSv. At lower doses, with use of mathematical model, United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR) reported the death probability due to the excess lifetime risk (ELR) at 100 mSv of 0.36-0.77% for solid tumors and 0.03-0.05% for leukemia, and NRC in US, the risk of exposure-induced prevalence and death (REID) per 100 thousands persons of 800 (male)/1,310 (female) and 410/610, respectively. Both are essentially based on findings in A-bomb survivors. The assessment for Rn is described here not on dose. UK and US analyses of pooled raw data in case control studies revealed the significant increase of lung cancer formation at as low level as 100 Bq Rn/m3. Their analyses also showed the significance of smoking, which had been realized as a confounding factor in risk analysis of Rn for uranium miners. The death probability until the age of 85 y was found to be 1.2 x 10 -4 in non-smokers and 24 x 10 -4 in smokers/ Working Level Month (WLM). Increased thyroid cancer incidence has been known in Chernobyl Accident, which is realized as a result of internal exposure of radioiodine; however, the relationship between the internal dose to thyroid and its cancer prevalence resembles that in the case of external exposure. There is no certain evidence against the concept that risk of internal exposure is similar to and/or lower than, the external one although assessment of the internal exposure risk accompanies uncertainty depending on the used model and ingested dose. International Commission on Radiological Protection (ICRP) recommendations hitherto have been important and precious despite

  14. Ethics of Risk. Kristin Shrader-Frechette's Philosophical Critique of Risk Assessment

    International Nuclear Information System (INIS)

    Heikkeroe, Topi

    2006-01-01

    This paper addresses risk assessment from a philosophical point of view. It presents and critically reviews the work of Kristin Shrader-Frechette. It introduces the ethical, epistemological, and methodological issues related to risk assessment. The paper focuses on the ethical questions of justice in risk decisions. It opens by framing the relationship between ethics and technology in the modern world. Then the paper turns to a brief description of risk assessment as a central method in technological decision making. It proceeds to show how Shrader-Frechette analyzes ethical and political aspects of risk assessment. The central argumentation In her critique follows RawIsian lines: distributive and participatory inequalities in creating technological constructions need to be justified. To clarify this requirement she formulates the Principle of Prima Facie Political Equity (PPFPE), which is her central tool in most of her ethical criticism, for instance, in relation to the future generations: prima facie. all generations should be treated equally. Brief critical remarks conclude the paper. They touch upon placing Shrader-Frechette's project on the academic chart and her liberal individualist anthropology

  15. A Tutorial on Probablilistic Risk Assessement and its Role in Risk-Informed Decision Making

    Science.gov (United States)

    Dezfuli, Homayoon

    2010-01-01

    This slide presentation reviews risk assessment and its role in risk-informed decision making. It includes information on probabilistic risk assessment, typical risk management process, origins of risk matrix, performance measures, performance objectives and Bayes theorem.

  16. Risk assessment and multi-criteria decision-making

    International Nuclear Information System (INIS)

    Segerstaahl, Boris

    1989-01-01

    Risk assessment and analysis is connected to the policy framework used in decision-making on issues concerning technological risk. A review of the problems created by different views concerning the fundamental structure of risk concepts is used as a way to describe the structure of risk assessment studies as used in decision-making. The fundamental difference between judgments based on assessments and on perceptions is analyzed in order to explain the dynamics of the decision making process. A proposed effort to study the energy sector as a dynamic endless game implementing a mixed strategy is suggested. (author)

  17. Comparative Risk Assessment to Inform Adaptation Priorities for the Natural Environment: Observations from the First UK Climate Change Risk Assessment

    Directory of Open Access Journals (Sweden)

    Iain Brown

    2015-11-01

    Full Text Available Risk assessment can potentially provide an objective framework to synthesise and prioritise climate change risks to inform adaptation policy. However, there are significant challenges in the application of comparative risk assessment procedures to climate change, particularly for the natural environment. These challenges are evaluated with particular reference to the first statutory Climate Change Risk Assessment (CCRA and evidence review procedures used to guide policy for the UK government. More progress was achieved on risk identification, screening and prioritisation compared to risk quantification. This was due to the inherent complexity and interdependence of ecological risks and their interaction with socio-economic drivers as well as a climate change. Robust strategies to manage risk were identified as those that coordinate organisational resources to enhance ecosystem resilience, and to accommodate inevitable change, rather than to meet specific species or habitats targets. The assessment also highlighted subjective and contextual components of risk appraisal including ethical issues regarding the level of human intervention in the natural environment and the proposed outcomes of any intervention. This suggests that goals for risk assessment need to be more clearly explicated and assumptions on tolerable risk declared as a primer for further dialogue on expectations for managed outcomes. Ecosystem-based adaptation may mean that traditional habitats and species conservation goals and existing regulatory frameworks no longer provide the best guide for long-term risk management thereby challenging the viability of some existing practices.

  18. Assessment of health risks of policies

    International Nuclear Information System (INIS)

    Ádám, Balázs; Molnár, Ágnes; Ádány, Róza; Bianchi, Fabrizio; Bitenc, Katarina; Chereches, Razvan; Cori, Liliana; Fehr, Rainer; Kobza, Joanna; Kollarova, Jana

    2014-01-01

    The assessment of health risks of policies is an inevitable, although challenging prerequisite for the inclusion of health considerations in political decision making. The aim of our project was to develop a so far missing methodological guide for the assessment of the complex impact structure of policies. The guide was developed in a consensual way based on experiences gathered during the assessment of specific national policies selected by the partners of an EU project. Methodological considerations were discussed and summarized in workshops and pilot tested on the EU Health Strategy for finalization. The combined tool, which includes a textual guidance and a checklist, follows the top-down approach, that is, it guides the analysis of causal chains from the policy through related health determinants and risk factors to health outcomes. The tool discusses the most important practical issues of assessment by impact level. It emphasises the transparent identification and prioritisation of factors, the consideration of the feasibility of exposure and outcome assessment with special focus on quantification. The developed guide provides useful methodological instructions for the comprehensive assessment of health risks of policies that can be effectively used in the health impact assessment of policy proposals. - Highlights: • Methodological guide for the assessment of health risks of policies is introduced. • The tool is developed based on the experiences from several case studies. • The combined tool consists of a textual guidance and a checklist. • The top-down approach is followed through the levels of the full impact chain. • The guide provides assistance for the health impact assessment of policy proposals

  19. Assessment of health risks of policies

    Energy Technology Data Exchange (ETDEWEB)

    Ádám, Balázs, E-mail: badam@cmss.sdu.dk [Unit for Health Promotion Research, Faculty of Health Sciences, University of Southern Denmark, Niels Bohrs Vej 9, DK-6700 Esbjerg (Denmark); Department of Preventive Medicine, Faculty of Public Health, University of Debrecen, P.O. Box 9, H-4012 Debrecen (Hungary); Molnár, Ágnes, E-mail: MolnarAg@smh.ca [Department of Preventive Medicine, Faculty of Public Health, University of Debrecen, P.O. Box 9, H-4012 Debrecen (Hungary); Centre for Research on Inner City Health, Keenan Research Centre, Li Ka Shing Knowledge Institute, St Michael' s Hospital, Victoria 209, Rm. 3-26.22, M5B 1C6 Toronto, Ontario (Canada); Ádány, Róza, E-mail: adany.roza@sph.unideb.hu [Department of Preventive Medicine, Faculty of Public Health, University of Debrecen, P.O. Box 9, H-4012 Debrecen (Hungary); Bianchi, Fabrizio, E-mail: Fabriepi@ifc.cnr.it [Unit of Environmental Epidemiology, Institute of Clinical Physiology, National Council of Research, Moruzzi 1, 56124 Pisa (Italy); Bitenc, Katarina, E-mail: katarina.bitenc@ivz-rs.si [National Institute of Public Health, Trubarjeva 2, SI-1000 Ljubljana (Slovenia); Chereches, Razvan, E-mail: razvan.m.chereches@gmail.com [Faculty of Political, Administrative and Communication Sciences, Babes-Bolyai University, Strada Mihail Kogalniceanu 1, 3400 Cluj (Romania); Cori, Liliana, E-mail: liliana.cori@ifc.cnr.it [Unit of Environmental Epidemiology, Institute of Clinical Physiology, National Council of Research, Moruzzi 1, 56124 Pisa (Italy); Fehr, Rainer, E-mail: rainer.fehr@uni-bielefeld.de [NRW Centre for Health, Westerfeldstr. 35-37, 33611 Bielefeld (Germany); Kobza, Joanna, E-mail: koga1@poczta.onet.pl [Public Health Department, Silesian Medical University, 18 Medykow Street, 40-752 Katowice (Poland); Kollarova, Jana, E-mail: janakollarova@yahoo.com [Department of Health Promotion, Regional Public Health Authority, Ipelska 1, 04011 Kosice (Slovakia); and others

    2014-09-15

    The assessment of health risks of policies is an inevitable, although challenging prerequisite for the inclusion of health considerations in political decision making. The aim of our project was to develop a so far missing methodological guide for the assessment of the complex impact structure of policies. The guide was developed in a consensual way based on experiences gathered during the assessment of specific national policies selected by the partners of an EU project. Methodological considerations were discussed and summarized in workshops and pilot tested on the EU Health Strategy for finalization. The combined tool, which includes a textual guidance and a checklist, follows the top-down approach, that is, it guides the analysis of causal chains from the policy through related health determinants and risk factors to health outcomes. The tool discusses the most important practical issues of assessment by impact level. It emphasises the transparent identification and prioritisation of factors, the consideration of the feasibility of exposure and outcome assessment with special focus on quantification. The developed guide provides useful methodological instructions for the comprehensive assessment of health risks of policies that can be effectively used in the health impact assessment of policy proposals. - Highlights: • Methodological guide for the assessment of health risks of policies is introduced. • The tool is developed based on the experiences from several case studies. • The combined tool consists of a textual guidance and a checklist. • The top-down approach is followed through the levels of the full impact chain. • The guide provides assistance for the health impact assessment of policy proposals.

  20. Assessing and managing multiple risks in a changing world ...

    Science.gov (United States)

    Roskilde University (Denmark) hosted a November 2015 workshop, Environmental Risk—Assessing and Managing Multiple Risks in a Changing World. This Focus article presents the consensus recommendations of 30 attendees from 9 countries regarding implementation of a common currency (ecosystem services) for holistic environmental risk assessment and management; improvements to risk assessment and management in a complex, human-modified, and changing world; appropriate development of protection goals in a 2-stage process; dealing with societal issues; risk-management information needs; conducting risk assessment of risk management; and development of adaptive and flexible regulatory systems. The authors encourage both cross-disciplinary and interdisciplinary approaches to address their 10 recommendations: 1) adopt ecosystem services as a common currency for risk assessment and management; 2) consider cumulative stressors (chemical and nonchemical) and determine which dominate to best manage and restore ecosystem services; 3) fully integrate risk managers and communities of interest into the risk-assessment process; 4) fully integrate risk assessors and communities of interest into the risk-management process; 5) consider socioeconomics and increased transparency in both risk assessment and risk management; 6) recognize the ethical rights of humans and ecosystems to an adequate level of protection; 7) determine relevant reference conditions and the proper ecological c

  1. Risk assessment and risk management in managed aquifer recharge

    CSIR Research Space (South Africa)

    Page, D

    2012-06-01

    Full Text Available This chapter presents the methodologies used for risk assessment and risk management in MAR in Australia and the European Union, qualitative and quantitative approaches adopted within the RECLAIM Water project and case studies where the outcomes...

  2. Cloud computing assessing the risks

    CERN Document Server

    Carstensen, Jared; Golden, Bernard

    2012-01-01

    Cloud Computing: Assessing the risks answers these questions and many more. Using jargon-free language and relevant examples, analogies and diagrams, it is an up-to-date, clear and comprehensive guide the security, governance, risk, and compliance elements of Cloud Computing.

  3. Quantified risk assessment - a nuclear industry viewpoint

    International Nuclear Information System (INIS)

    Thomson, J.R.

    1994-01-01

    This paper presents a brief summary of the methodology used for the assessment of risk arising from fuel handling and dismantling operations in advanced gas-cooled reactor power stations. The difficulties with and problems arising from such risk assessments are discussed. In particular, difficulties arise from (i) the onerous risk criteria that nuclear plants are expected to satisfy, (ii) the necessary complexity of the plant, (iii) the conflicting requirements for the fault consequence assessments to be bounding but not grossly pessimistic, and (iv) areas of fault frequency assessment which contain possibly subjective considerations such as software and common mode failure. (author)

  4. SPECIFIC METHOD OF RISK ASSESSMENT IN TOURISM ENTERPRISES

    Directory of Open Access Journals (Sweden)

    Andreea ARMEAN

    2014-12-01

    Full Text Available The objective of this paper is to present an innovative method of risk assessment for tourism businesses. The contribution to literature is the novelty of this method of following paths: is an ante-factum assessment not post-factum; risk assessment is based on perception rather than results; is based on specific risks tourism enterprises not on the overall risks. Is an asset-research methodology and consists in generating its own method of risk assessment based on the ideas summarized from the literature studied. The aim established is tourism enterprises from Romania. The data necessary for the application of this method will result from applying to top level management of tourism enterprises, a questionnaire about risk perception. The results from this study will help identify and measure the risks specific to tourism enterprises. The applicability of the results is to improve risk management in these enterprises.

  5. New approaches for improving cardiovascular risk assessment.

    Science.gov (United States)

    Paredes, Simão; Rocha, Teresa; Mendes, Diana; Carvalho, Paulo; Henriques, Jorge; Morais, João; Ferreira, Jorge; Mendes, Miguel

    2016-01-01

    Clinical guidelines recommend the use of cardiovascular risk assessment tools (risk scores) to predict the risk of events such as cardiovascular death, since these scores can aid clinical decision-making and thereby reduce the social and economic costs of cardiovascular disease (CVD). However, despite their importance, risk scores present important weaknesses that can diminish their reliability in clinical contexts. This study presents a new framework, based on current risk assessment tools, that aims to minimize these limitations. Appropriate application and combination of existing knowledge is the main focus of this work. Two different methodologies are applied: (i) a combination scheme that enables data to be extracted and processed from various sources of information, including current risk assessment tools and the contributions of the physician; and (ii) a personalization scheme based on the creation of patient groups with the purpose of identifying the most suitable risk assessment tool to assess the risk of a specific patient. Validation was performed based on a real patient dataset of 460 patients at Santa Cruz Hospital, Lisbon, Portugal, diagnosed with non-ST-segment elevation acute coronary syndrome. Promising results were obtained with both approaches, which achieved sensitivity, specificity and geometric mean of 78.79%, 73.07% and 75.87%, and 75.69%, 69.79% and 72.71%, respectively. The proposed approaches present better performances than current CVD risk scores; however, additional datasets are required to back up these findings. Copyright © 2015 Sociedade Portuguesa de Cardiologia. Published by Elsevier España. All rights reserved.

  6. Environmental Risk Communication through Qualitative Risk Assessment

    Directory of Open Access Journals (Sweden)

    Sabre J. Coleman

    2014-06-01

    Full Text Available Environmental analysts are often hampered in communicating the risks of environmental contaminants due to the myriad of regulatory requirements that are applicable. The use of a qualitative, risk-based control banding strategy for assessment and control of potential environmental contaminants provides a standardized approach to improve risk communication. Presented is a model that provides an effective means for determining standardized responses and controls for common environmental issues based on the level of risk. The model is designed for integration within an occupational health and safety management system to provide a multidisciplinary environmental and occupational risk management approach. This environmental model, which utilizes multidisciplinary control banding strategies for delineating risk, complements the existing Risk Level Based Management System, a proven method in a highly regulated facility for occupational health and safety. A simplified environmental risk matrix is presented that is stratified over four risk levels. Examples of qualitative environmental control banding strategies are presented as they apply to United States regulations for construction, research activities, facility maintenance, and spill remediation that affect air, water, soil, and waste disposal. This approach offers a standardized risk communication language for multidisciplinary issues that will improve communications within and between environmental health and safety professionals, workers, and management.

  7. Can we (actually) assess global risk?

    Science.gov (United States)

    Di Baldassarre, Giuliano

    2013-04-01

    The evaluation of the dynamic interactions of the different components of global risk (e.g. hazard, exposure, vulnerability or resilience) is one of the main challenges in risk assessment and management. In state-of-the-art approaches for the analysis of risk, natural and socio-economic systems are typically treated separately by using different methods. In flood risk studies, for instance, physical scientists typically focus on the study of the probability of flooding (i.e. hazard), while social scientists mainly examine the exposure, vulnerability or resilience to flooding. However, these different components are deeply interconnected. Changes in flood hazard might trigger changes in vulnerability, and vice versa. A typical example of these interactions is the so-called "levee effect", whereby heightening levees to reduce the probability of flooding often leads to increase the potential adverse consequences of flooding as people often perceive that flood risk was completely eliminated once the levee was raised. These interconnections between the different components of risk remain largely unexplored and poorly understood. This lack of knowledge is of serious concern as it limits our ability to plan appropriate risk prevention measures. To design flood control structures, for example, state-of-the-art models can indeed provide quantitative assessments of the corresponding risk reduction associated to the lower probability of flooding. Nevertheless, current methods cannot estimate how, and to what extent, such a reduction might trigger a future increase of the potential adverse consequences of flooding (the aforementioned "levee effect"). Neither can they evaluate how the latter might (in turn) lead to the requirement of additional flood control structures. Thus, while many progresses have been made in the static assessment of flood risk, more inter-disciplinary research is required for the development of methods for dynamic risk assessment, which is very much

  8. Operationalization Of The Professional Risks Assessment Activity

    Science.gov (United States)

    Ivascu, Victoria Larisa; Cirjaliu, Bianca; Draghici, Anca

    2015-07-01

    Professional risks assessment approach (integration of analysis and evaluation processes) is linked with the general concerns of nowadays companies for their employees' health and safety assurances, in the context of organizations sustainable development. The paper presents an approach for the operationalization of the professional risk assessment activity in companies through the implementation and use of the OnRisk platform (this have been tested in some industrial companies). The short presentation of the relevant technical reports and statistics on OSH management at the European Union level underlines the need for the development of a professional risks assessment. Finally, there have been described the designed and developed OnRisk platform as a web platform together with some case studies that have validate the created tool.

  9. Methodology for technical risk assessment

    International Nuclear Information System (INIS)

    Waganer, L.M.; Zuckerman, D.S.

    1983-01-01

    A methodology has been developed for and applied to the assessment of the technical risks associated with an evolving technology. This methodology, originally developed for fusion by K. W. Billman and F. R. Scott at EPRI, has been applied to assess the technical risk of a fuel system for a fusion reactor. Technical risk is defined as the risk that a particular technology or component which is currently under development will not achieve a set of required technical specifications (i.e. probability of failure). The individual steps in the technical risk assessment are summarized. The first step in this methodology is to clearly and completely quantify the technical requirements for the particular system being examined. The next step is to identify and define subsystems and various options which appear capable of achieving the required technical performance. The subsystem options are then characterized regarding subsystem functions, interface requirements with the subsystems and systems, important components, developmental obstacles and technical limitations. Key technical subsystem performance parameters are identified which directly or indirectly relate to the system technical specifications. Past, existing and future technical performance data from subsystem experts are obtained by using a Bayesian Interrogation technique. The input data is solicited in the form of probability functions. Thus the output performance of the system is expressed as probability functions

  10. Overcoming barriers to integrating economic analysis into risk assessment.

    Science.gov (United States)

    Hoffmann, Sandra

    2011-09-01

    Regulatory risk analysis is designed to provide decisionmakers with a clearer understanding of how policies are likely to affect risk. The systems that produce risk are biological, physical, and social and economic. As a result, risk analysis is an inherently interdisciplinary task. Yet in practice, risk analysis has been interdisciplinary in only limited ways. Risk analysis could provide more accurate assessments of risk if there were better integration of economics and other social sciences into risk assessment itself. This essay examines how discussions about risk analysis policy have influenced the roles of various disciplines in risk analysis. It explores ways in which integrated bio/physical-economic modeling could contribute to more accurate assessments of risk. It reviews examples of the kind of integrated economics-bio/physical modeling that could be used to enhance risk assessment. The essay ends with a discussion of institutional barriers to greater integration of economic modeling into risk assessment and provides suggestions on how these might be overcome. © 2011 Society for Risk Analysis.

  11. Regional scale ecological risk assessment: using the relative risk model

    National Research Council Canada - National Science Library

    Landis, Wayne G

    2005-01-01

    ...) in the performance of regional-scale ecological risk assessments. The initial chapters present the methodology and the critical nature of the interaction between risk assessors and decision makers...

  12. Risk assessment future cash flows

    OpenAIRE

    Chachina H. G.

    2012-01-01

    This article is about risk assessment in planning future cash flows. Discount rate in DCF-model must include four factors: risk cash flow, inflation, value of investments, turnover assets. This has an influence net present value cash flow and make his incomparable.

  13. Improving pandemic influenza risk assessment

    Science.gov (United States)

    Assessing the pandemic risk posed by specific non-human influenza A viruses remains a complex challenge. As influenza virus genome sequencing becomes cheaper, faster and more readily available, the ability to predict pandemic potential from sequence data could transform pandemic influenza risk asses...

  14. Framework for Shared Drinking Water Risk Assessment.

    Energy Technology Data Exchange (ETDEWEB)

    Lowry, Thomas Stephen [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Tidwell, Vincent C. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Peplinski, William John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mitchell, Roger [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Binning, David [AEM Corp., Herndon, VA (United States); Meszaros, Jenny [AEM Corp., Herndon, VA (United States)

    2017-01-01

    Central to protecting our nation's critical infrastructure is the development of methodologies for prioritizing action and supporting resource allocation decisions associated with risk-reduction initiatives. Toward this need a web-based risk assessment framework that promotes the anonymous sharing of results among water utilities is demonstrated. Anonymous sharing of results offers a number of potential advantages such as assistance in recognizing and correcting bias, identification of 'unknown, unknowns', self-assessment and benchmarking for the local utility, treatment of shared assets and/or threats across multiple utilities, and prioritization of actions beyond the scale of a single utility. The constructed framework was demonstrated for three water utilities. Demonstration results were then compared to risk assessment results developed using a different risk assessment application by a different set of analysts.

  15. 76 FR 44891 - Monsanto Co.; Availability of Petition, Plant Pest Risk Assessment, and Environmental Assessment...

    Science.gov (United States)

    2011-07-27

    ...] Monsanto Co.; Availability of Petition, Plant Pest Risk Assessment, and Environmental Assessment for... Monsanto petition, our plant pest risk assessment, and our draft environmental assessment for the proposed...-2817 before coming. The petition, draft environmental assessment, and plant pest risk assessment are...

  16. The Next Generation of Risk Assessment Multi-Year Study—Highlights of Findings, Applications to Risk Assessment, and Future Directions

    Science.gov (United States)

    Cote, Ila; Andersen, Melvin E.; Ankley, Gerald T.; Barone, Stanley; Birnbaum, Linda S.; Boekelheide, Kim; Bois, Frederic Y.; Burgoon, Lyle D.; Chiu, Weihsueh A.; Crawford-Brown, Douglas; Crofton, Kevin M.; DeVito, Michael; Devlin, Robert B.; Edwards, Stephen W.; Guyton, Kathryn Z.; Hattis, Dale; Judson, Richard S.; Knight, Derek; Krewski, Daniel; Lambert, Jason; Maull, Elizabeth Anne; Mendrick, Donna; Paoli, Gregory M.; Patel, Chirag Jagdish; Perkins, Edward J.; Poje, Gerald; Portier, Christopher J.; Rusyn, Ivan; Schulte, Paul A.; Simeonov, Anton; Smith, Martyn T.; Thayer, Kristina A.; Thomas, Russell S.; Thomas, Reuben; Tice, Raymond R.; Vandenberg, John J.; Villeneuve, Daniel L.; Wesselkamper, Scott; Whelan, Maurice; Whittaker, Christine; White, Ronald; Xia, Menghang; Yauk, Carole; Zeise, Lauren; Zhao, Jay; DeWoskin, Robert S.

    2016-01-01

    Background: The Next Generation (NexGen) of Risk Assessment effort is a multi-year collaboration among several organizations evaluating new, potentially more efficient molecular, computational, and systems biology approaches to risk assessment. This article summarizes our findings, suggests applications to risk assessment, and identifies strategic research directions. Objective: Our specific objectives were to test whether advanced biological data and methods could better inform our understanding of public health risks posed by environmental exposures. Methods: New data and methods were applied and evaluated for use in hazard identification and dose–response assessment. Biomarkers of exposure and effect, and risk characterization were also examined. Consideration was given to various decision contexts with increasing regulatory and public health impacts. Data types included transcriptomics, genomics, and proteomics. Methods included molecular epidemiology and clinical studies, bioinformatic knowledge mining, pathway and network analyses, short-duration in vivo and in vitro bioassays, and quantitative structure activity relationship modeling. Discussion: NexGen has advanced our ability to apply new science by more rapidly identifying chemicals and exposures of potential concern, helping characterize mechanisms of action that influence conclusions about causality, exposure–response relationships, susceptibility and cumulative risk, and by elucidating new biomarkers of exposure and effects. Additionally, NexGen has fostered extensive discussion among risk scientists and managers and improved confidence in interpreting and applying new data streams. Conclusions: While considerable uncertainties remain, thoughtful application of new knowledge to risk assessment appears reasonable for augmenting major scope assessments, forming the basis for or augmenting limited scope assessments, and for prioritization and screening of very data limited chemicals. Citation: Cote I

  17. Probabilistic risk assessment: Number 219

    International Nuclear Information System (INIS)

    Bari, R.A.

    1985-01-01

    This report describes a methodology for analyzing the safety of nuclear power plants. A historical overview of plants in the US is provided, and past, present, and future nuclear safety and risk assessment are discussed. A primer on nuclear power plants is provided with a discussion of pressurized water reactors (PWR) and boiling water reactors (BWR) and their operation and containment. Probabilistic Risk Assessment (PRA), utilizing both event-tree and fault-tree analysis, is discussed as a tool in reactor safety, decision making, and communications. (FI)

  18. Risk assessment under deep uncertainty: A methodological comparison

    International Nuclear Information System (INIS)

    Shortridge, Julie; Aven, Terje; Guikema, Seth

    2017-01-01

    Probabilistic Risk Assessment (PRA) has proven to be an invaluable tool for evaluating risks in complex engineered systems. However, there is increasing concern that PRA may not be adequate in situations with little underlying knowledge to support probabilistic representation of uncertainties. As analysts and policy makers turn their attention to deeply uncertain hazards such as climate change, a number of alternatives to traditional PRA have been proposed. This paper systematically compares three diverse approaches for risk analysis under deep uncertainty (qualitative uncertainty factors, probability bounds, and robust decision making) in terms of their representation of uncertain quantities, analytical output, and implications for risk management. A simple example problem is used to highlight differences in the way that each method relates to the traditional risk assessment process and fundamental issues associated with risk assessment and description. We find that the implications for decision making are not necessarily consistent between approaches, and that differences in the representation of uncertain quantities and analytical output suggest contexts in which each method may be most appropriate. Finally, each methodology demonstrates how risk assessment can inform decision making in deeply uncertain contexts, informing more effective responses to risk problems characterized by deep uncertainty. - Highlights: • We compare three diverse approaches to risk assessment under deep uncertainty. • A simple example problem highlights differences in analytical process and results. • Results demonstrate how methodological choices can impact risk assessment results.

  19. Participatory Risk Assessment for Environmental Decision-Making

    International Nuclear Information System (INIS)

    Homan, Jacqueline; Petts, Judith

    2001-01-01

    Recent research, discussion and practice in the role environmental decision-making as an integral part of a democratic society have resulted in legislation, policy and guidance that encourage, and indeed may require, greater participation. The focus of this research paper is to explore these participatory ideas in the context of environmental risk assessment. Participation methods have generic application. However, the importance of fitting method to purpose requires that different contexts and issues relative to the objectives be addressed. In relation to environmental risk assessment these issues include: the complexity of risk issues per se; the inherent uncertainty that dominates any risk assessment; the quantitative nature of many risk assessments and the difficulty of dealing with low probability-high consequence outconies; the possibility of controversy in relation to decisions involving risk and thus the careful attention needed to the process and identification of participants; the traditional role and culture of experts in risk decisions and the challenge of reconciling this with the role of lay knowledge and the potential for the public to act as quality assurers in the risk decision process; the tendency for people to need reassurance when confronted with risk, even during a participation process; the need to acknowledge the public's ability to deal with complex technical issues and the need for information and data to respond to their questions, and the fact that 'risk' per se will often not be the only issue of public concern. The contributions to the risk debate from the social sciences are having considerable influence on the practice of environmental decision-making. Calls for increased stakeholder involvement in risk decisions are requiring greater access to and engagement with environmental risk assessments. Mechanisms for this level of involvement, however, are not well defined. For these aspirational calls to be realised in practice, decision

  20. Participatory Risk Assessment for Environmental Decision-Making

    Energy Technology Data Exchange (ETDEWEB)

    Homan, Jacqueline; Petts, Judith [Univ. of Birmingham (United Kingdom). Centre for Environmental Research and Training; Pollard, Simon; Twigger-Ross, Clare [National Centre for Risk Analysis and Options Appraisal, London (United Kingdom)

    2001-07-01

    Recent research, discussion and practice in the role environmental decision-making as an integral part of a democratic society have resulted in legislation, policy and guidance that encourage, and indeed may require, greater participation. The focus of this research paper is to explore these participatory ideas in the context of environmental risk assessment. Participation methods have generic application. However, the importance of fitting method to purpose requires that different contexts and issues relative to the objectives be addressed. In relation to environmental risk assessment these issues include: the complexity of risk issues per se; the inherent uncertainty that dominates any risk assessment; the quantitative nature of many risk assessments and the difficulty of dealing with low probability-high consequence outconies; the possibility of controversy in relation to decisions involving risk and thus the careful attention needed to the process and identification of participants; the traditional role and culture of experts in risk decisions and the challenge of reconciling this with the role of lay knowledge and the potential for the public to act as quality assurers in the risk decision process; the tendency for people to need reassurance when confronted with risk, even during a participation process; the need to acknowledge the public's ability to deal with complex technical issues and the need for information and data to respond to their questions, and the fact that 'risk' per se will often not be the only issue of public concern. The contributions to the risk debate from the social sciences are having considerable influence on the practice of environmental decision-making. Calls for increased stakeholder involvement in risk decisions are requiring greater access to and engagement with environmental risk assessments. Mechanisms for this level of involvement, however, are not well defined. For these aspirational calls to be realised in

  1. Advances in risk assessment for climate change adaptation policy

    Science.gov (United States)

    Adger, W. Neil; Brown, Iain; Surminski, Swenja

    2018-01-01

    Climate change risk assessment involves formal analysis of the consequences, likelihoods and responses to the impacts of climate change and the options for addressing these under societal constraints. Conventional approaches to risk assessment are challenged by the significant temporal and spatial dynamics of climate change; by the amplification of risks through societal preferences and values; and through the interaction of multiple risk factors. This paper introduces the theme issue by reviewing the current practice and frontiers of climate change risk assessment, with specific emphasis on the development of adaptation policy that aims to manage those risks. These frontiers include integrated assessments, dealing with climate risks across borders and scales, addressing systemic risks, and innovative co-production methods to prioritize solutions to climate challenges with decision-makers. By reviewing recent developments in the use of large-scale risk assessment for adaptation policy-making, we suggest a forward-looking research agenda to meet ongoing strategic policy requirements in local, national and international contexts. This article is part of the theme issue ‘Advances in risk assessment for climate change adaptation policy’. PMID:29712800

  2. Advances in risk assessment for climate change adaptation policy.

    Science.gov (United States)

    Adger, W Neil; Brown, Iain; Surminski, Swenja

    2018-06-13

    Climate change risk assessment involves formal analysis of the consequences, likelihoods and responses to the impacts of climate change and the options for addressing these under societal constraints. Conventional approaches to risk assessment are challenged by the significant temporal and spatial dynamics of climate change; by the amplification of risks through societal preferences and values; and through the interaction of multiple risk factors. This paper introduces the theme issue by reviewing the current practice and frontiers of climate change risk assessment, with specific emphasis on the development of adaptation policy that aims to manage those risks. These frontiers include integrated assessments, dealing with climate risks across borders and scales, addressing systemic risks, and innovative co-production methods to prioritize solutions to climate challenges with decision-makers. By reviewing recent developments in the use of large-scale risk assessment for adaptation policy-making, we suggest a forward-looking research agenda to meet ongoing strategic policy requirements in local, national and international contexts.This article is part of the theme issue 'Advances in risk assessment for climate change adaptation policy'. © 2018 The Author(s).

  3. Advances in risk assessment for climate change adaptation policy

    Science.gov (United States)

    Adger, W. Neil; Brown, Iain; Surminski, Swenja

    2018-06-01

    Climate change risk assessment involves formal analysis of the consequences, likelihoods and responses to the impacts of climate change and the options for addressing these under societal constraints. Conventional approaches to risk assessment are challenged by the significant temporal and spatial dynamics of climate change; by the amplification of risks through societal preferences and values; and through the interaction of multiple risk factors. This paper introduces the theme issue by reviewing the current practice and frontiers of climate change risk assessment, with specific emphasis on the development of adaptation policy that aims to manage those risks. These frontiers include integrated assessments, dealing with climate risks across borders and scales, addressing systemic risks, and innovative co-production methods to prioritize solutions to climate challenges with decision-makers. By reviewing recent developments in the use of large-scale risk assessment for adaptation policy-making, we suggest a forward-looking research agenda to meet ongoing strategic policy requirements in local, national and international contexts. This article is part of the theme issue `Advances in risk assessment for climate change adaptation policy'.

  4. General approaches to the risk assessment of chemicals

    Energy Technology Data Exchange (ETDEWEB)

    Murphy, Patrick [Commission of the European Communities, Directorate General XI, Environment, Nuclear Safety and Civil Protection (Belgium)

    1992-07-01

    In the context of the UNCED 92 'Earth Summit' in Rio, the following definition of chemical risk assessment has been developed: 'Chemical risk assessment is a scientific process that identifies and quantifies the potential adverse effects on human health or ecosystems of defined exposures to chemical substances, to mixtures that include chemicals, or to chemically hazardous processes or situations. Risk itself is the probability of the occurrence of a defined adverse effect in a defined group and in defined circumstances'. I would not be so impertinent as to try and improve upon a definition that has the tacit endorsement of the majority of world-leaders. Furthermore, I consider that too many man-years have been spent discussing this topic. Thankfully the UNCED definition recognises chemical risk assessment as being a process and not some immutable physical law. In this presentation I will attempt to explain some of the details and mechanisms of that process but first of all it is worthwhile to spend a few moments putting chemical risk assessment in its proper context and asking the simple question: why do we want/need to assess the potential risk of chemicals?. In general terms, chemicals risk assessment is carried out in order to ensure that neither man (consumer/worker/general public) nor the environment are exposed to unacceptable risks arising from the production, use and disposal of chemicals. At a national and/or international level, risk assessments are performed by the regulatory authorities before they accept notification dossiers (e.g. new industrial chemicals) or grant authorizations (e.g. pharmaceuticals, pesticides, cosmetics, food additives). At the local level, plant-operators must carry out risk assessments to ensure that in the particular circumstances of their factory the workers are adequately protected and that satisfactory accident prevention and contingency plans are prepared. Similarly, local authorities must carry out risk assessments before

  5. General approaches to the risk assessment of chemicals

    International Nuclear Information System (INIS)

    Murphy, Patrick

    1992-01-01

    In the context of the UNCED 92 'Earth Summit' in Rio, the following definition of chemical risk assessment has been developed: 'Chemical risk assessment is a scientific process that identifies and quantifies the potential adverse effects on human health or ecosystems of defined exposures to chemical substances, to mixtures that include chemicals, or to chemically hazardous processes or situations. Risk itself is the probability of the occurrence of a defined adverse effect in a defined group and in defined circumstances'. I would not be so impertinent as to try and improve upon a definition that has the tacit endorsement of the majority of world-leaders. Furthermore, I consider that too many man-years have been spent discussing this topic. Thankfully the UNCED definition recognises chemical risk assessment as being a process and not some immutable physical law. In this presentation I will attempt to explain some of the details and mechanisms of that process but first of all it is worthwhile to spend a few moments putting chemical risk assessment in its proper context and asking the simple question: why do we want/need to assess the potential risk of chemicals?. In general terms, chemicals risk assessment is carried out in order to ensure that neither man (consumer/worker/general public) nor the environment are exposed to unacceptable risks arising from the production, use and disposal of chemicals. At a national and/or international level, risk assessments are performed by the regulatory authorities before they accept notification dossiers (e.g. new industrial chemicals) or grant authorizations (e.g. pharmaceuticals, pesticides, cosmetics, food additives). At the local level, plant-operators must carry out risk assessments to ensure that in the particular circumstances of their factory the workers are adequately protected and that satisfactory accident prevention and contingency plans are prepared. Similarly, local authorities must carry out risk assessments before

  6. New method for assessing risks of email

    Science.gov (United States)

    Raja, Seyyed H.; Afrooz, Farzad

    2013-03-01

    E-mail technology, has become one of the requirements of human lives for correspondence between individuals. Given this, the important point is that the messages, server and client of e-mail and correspondences that exchanged between different people have acceptable security, to make people sure to use of this technology. In the information age, many of financial and non financial transactions are done electronically, data exchange takes place via the internet and theft and manipulation of data can make exorbitant cost in terms of integrity, financial, political, economic and culture. E-mail correspondence in there is same and it is very important. With review took place, a method that will focus on email system for risks assessment is not provided. We are examining ways of assessing for other systems and their strengths and weaknesses, then we use Mr Convery method for assessing email risks which it is for assessing network risks. At the end of paper we have offered special table for email risk assessment.

  7. Advancing environmental risk assessment for transgenic biofeedstock crops

    Directory of Open Access Journals (Sweden)

    Wolt Jeffrey D

    2009-11-01

    Full Text Available Abstract Transgenic modification of plants is a key enabling technology for developing sustainable biofeedstocks for biofuels production. Regulatory decisions and the wider acceptance and development of transgenic biofeedstock crops are considered from the context of science-based risk assessment. The risk assessment paradigm for transgenic biofeedstock crops is fundamentally no different from that of current generation transgenic crops, except that the focus of the assessment must consider the unique attributes of a given biofeedstock crop and its environmental release. For currently envisioned biofeedstock crops, particular emphasis in risk assessment will be given to characterization of altered metabolic profiles and their implications relative to non-target environmental effects and food safety; weediness and invasiveness when plants are modified for abiotic stress tolerance or are domesticated; and aggregate risk when plants are platforms for multi-product production. Robust risk assessments for transgenic biofeedstock crops are case-specific, initiated through problem formulation, and use tiered approaches for risk characterization.

  8. Models for Pesticide Risk Assessment

    Science.gov (United States)

    EPA considers the toxicity of the pesticide as well as the amount of pesticide to which a person or the environments may be exposed in risk assessment. Scientists use mathematical models to predict pesticide concentrations in exposure assessment.

  9. Low-frequency fields - health risk assessment

    International Nuclear Information System (INIS)

    Bernhardt, J.

    1993-01-01

    The author briefly reviews the biological actions and effects of low-frequency fields, epidemiological studies and discusses health risks in detail. He describes the assessment principles of the International Commission on Non-ionizing Radiation Protection (ICNIRP), medical principles for risk assessment, determination of limits and thesholds, and aspects of prevention. This is supplemented to by several fables and literature list. (Uhe) [de

  10. Improving antenatal risk assessment in women exposed to high risks.

    Science.gov (United States)

    Perry, Natasha; Newman, Louise K; Hunter, Mick; Dunlop, Adrian

    2015-01-01

    Antenatal substance use and related psychosocial risk factors are known to increase the likelihood of child protection involvement; less is known about the predictive nature of maternal reflective functioning (RF) in this population. This preliminary study assessed psychosocial and psychological risk factors for a group of substance dependent women exposed to high risks in pregnancy, and their impact on child protection involvement. Pregnant women on opiate substitution treatment (n = 11) and a comparison group (n = 15) were recruited during their third trimester to complete measures of RF (Pregnancy Interview), childhood trauma, mental health and psychosocial assessments. At postnatal follow-up, RF was reassessed (Parent Development Interview - Revised Short Version) and mother-infant dyads were videotaped to assess emotional availability (EA). Child protection services were contacted to determine if any concerns had been raised for infant safety. Significant between-group differences were observed for demographics, psychosocial factors, trauma and mental health symptoms. Unexpectedly, no significant differences were found for RF or EA between groups. Eight women in the 'exposed to high risks' group became involved with child protection services. Reflective functioning was not significantly associated with psychosocial risk factors, and therefore did not mediate the outcome of child protection involvement. Women 'exposed to high risks' were equally able to generate a model of their own and their infants' mental states and should not be seen within a deficit perspective. Further research is required to better understand the range of risk factors that predict child protection involvement in high risk groups. © The Author(s) 2013.

  11. 78 FR 15894 - Draft Qualitative Risk Assessment of Risk of Activity/Food Combinations for Activities (Outside...

    Science.gov (United States)

    2013-03-13

    .... FDA-2012-N-1258] Draft Qualitative Risk Assessment of Risk of Activity/Food Combinations for... comment period for a document entitled ``Draft Qualitative Risk Assessment of Risk of Activity/ [[Page... ``Draft Qualitative Risk Assessment of Risk of Activity/Food Combinations for Activities (Outside the Farm...

  12. Assessment of risk from radiation sources

    International Nuclear Information System (INIS)

    Subbaratnam, T.; Madhvanath, U.; Somasundaram, S.

    1976-01-01

    Assessment of risk from exposure to ionizing radiations from man-made radiation sources and nuclear installations has to be viewed from three aspects, namely, dose-effect relationship (genetic and somatic) for humans, calculation of doses or dose-commitments to population groups, assessment of risk to radiation workers and the population at large from the current levels of exposure from nuclear industry and comparison of risk estimates with other industries in a modern society. These aspects are discussed in brief. On the basis of available data, it is shown that estimated incidence of genetic diseases and cancers due to exposure of population to radiation from nuclear industry is negligible in comparison with their natural incidence, and radiation risks to the workers in nuclear industry are much lower than the risks in other occupations. (M.G.B.)

  13. Assessment of fracture risk

    International Nuclear Information System (INIS)

    Kanis, John A.; Johansson, Helena; Oden, Anders; McCloskey, Eugene V.

    2009-01-01

    Fractures are a common complication of osteoporosis. Although osteoporosis is defined by bone mineral density at the femoral neck, other sites and validated techniques can be used for fracture prediction. Several clinical risk factors contribute to fracture risk independently of BMD. These include age, prior fragility fracture, smoking, excess alcohol, family history of hip fracture, rheumatoid arthritis and the use of oral glucocorticoids. These risk factors in conjunction with BMD can be integrated to provide estimates of fracture probability using the FRAX tool. Fracture probability rather than BMD alone can be used to fashion strategies for the assessment and treatment of osteoporosis.

  14. Taking the Risk Out of Risk Assessment

    Science.gov (United States)

    2005-01-01

    The ability to understand risks and have the right strategies in place when risky events occur is essential in the workplace. More and more organizations are being confronted with concerns over how to measure their risks or what kind of risks they can take when certain events transpire that could have a negative impact. NASA is one organization that faces these challenges on a daily basis, as effective risk management is critical to the success of its missions especially the Space Shuttle missions. On July 29, 1996, former NASA Administrator Daniel Goldin charged NASA s Office of Safety and Mission Assurance with developing a probabilistic risk assessment (PRA) tool to support decisions on the funding of Space Shuttle upgrades. When issuing the directive, Goldin said, "Since I came to NASA [in 1992], we've spent billions of dollars on Shuttle upgrades without knowing how much they improve safety. I want a tool to help base upgrade decisions on risk." Work on the PRA tool began immediately. The resulting prototype, the Quantitative Risk Assessment System (QRAS) Version 1.0, was jointly developed by NASA s Marshall Space Flight Center, its Office of Safety and Mission Assurance, and researchers at the University of Maryland. QRAS software automatically expands the reliability logic models of systems to evaluate the probability of highly detrimental outcomes occurring in complex systems that are subject to potential accident scenarios. Even in its earliest forms, QRAS was used to begin PRA modeling of the Space Shuttle. In parallel, the development of QRAS continued, with the goal of making it a world-class tool, one that was especially suited to NASA s unique needs. From the beginning, an important conceptual goal in the development of QRAS was for it to help bridge the gap between the professional risk analyst and the design engineer. In the past, only the professional risk analyst could perform, modify, use, and perhaps even adequately understand PRA. NASA wanted

  15. Research on risk assessment for maritime transport of radioactive materials. Preparation of maritime accident data for risk assessment

    International Nuclear Information System (INIS)

    Odano, Naoteru; Sawada, Ken-ichi; Mochiduki, Hiromitsu; Hirao, Yoshihiro; Asami, Mitsufumi

    2010-01-01

    Maritime transport of radioactive materials has been playing an important role in the nuclear fuel cycle in Japan. Due to recent increase of transported radioactive materials and diversification of transport packages with enlargement of nuclear research, development and utilization, safety securement for maritime transport of radioactive materials is one of important issues in the nuclear fuel cycle. Based squarely on the current circumstances, this paper summarizes discussion on importance of utilization of results of risk assessment for maritime transport of radioactive materials. A plan for development of comprehensive methodology to assess risks in maritime transport of radioactive materials is also described. Preparations of database of maritime accident to be necessary for risk assessment are also summarized. The prepared data could be utilized for future quantitative risk assessment, such as the event trees and fault trees analyses, for maritime transport of radioactive materials. The frequency of severe accident that the package might be damaged is also estimated using prepared data. (author)

  16. Reducing the harms associated with risk assessments

    International Nuclear Information System (INIS)

    Montague, Peter

    2004-01-01

    Risk assessments are the intellectual products of dedicated public health and environmental professionals. Like many other products, risk assessments carry with them the potential for both good and harm. This paper briefly examines some of the harms to which risk assessments have contributed, and then suggests that the legal 'duty to warn' doctrine offers a logical and practical way to reduce some of these harms. The paper suggests concepts that could be incorporated into warnings accompanying every formal risk assessment as routine 'boiler plate' addenda, just as other potentially harmful products, such as lawn mowers and cook stoves, are accompanied by warnings. Finally, the paper briefly examines the 'Code of Ethics and Standards of Practice for Environmental Professionals' (promulgated by the National Association of Environmental Professionals) and shows that the suggested warnings are consistent with recommended practices for environmental professionals

  17. Formulation and Presentation of Risk Assessments to Address Risk Targets for Radioactive Waste Disposal

    International Nuclear Information System (INIS)

    Wilmot, R.D.

    2002-10-01

    The Swedish regulators have been active in the field of performance assessment of radioactive waste disposal facilities for many years and have developed sophisticated approaches to the development of scenarios and other aspects of assessments. These assessments have generally used dose as the assessment end-point. Regulations recently established in Sweden (SSI FS 1998:1) have introduced a risk criterion for radioactive waste disposal: the annual risk of harmful effects after closure of a disposal facility should not exceed 10 -6 for a representative individual in the group exposed to the greatest risk. This report evaluates different approaches to the definition and use of probabilities in the context of risk assessments, and examines the presentation of the results of risk assessments in safety cases to meet risk targets. The report illustrates the strengths and weaknesses of different possible approaches to risk assessment by reference to assessments in other countries, and provides suggestions for future activity and development in this area by the Swedish regulators. The review of experience in other countries has led to a number of key observations relevant to the conduct of regulatory work on risk assessments and preparations for review. These highlight the importance of developing a protocol for conducting calculations, and linking such a protocol to the requirements of risk assessment calculations and to existing code and model capabilities. There are a number of decisions and assumptions required in developing a risk assessment methodology that could potentially affect the calculated results. These assumptions are independent of the analysis of performance, and relate to issues such as the expectation value of risk, risk dilution, the definition of probability density functions and achieving convergence. A review of a proponent's risk assessment should address these issues in determining the appropriateness and validity of the results presented

  18. Formulation and Presentation of Risk Assessments to Address Risk Targets for Radioactive Waste Disposal

    Energy Technology Data Exchange (ETDEWEB)

    Wilmot, R.D. [Galson Sciences Ltd, Oakham (United Kingdom)

    2002-10-01

    The Swedish regulators have been active in the field of performance assessment of radioactive waste disposal facilities for many years and have developed sophisticated approaches to the development of scenarios and other aspects of assessments. These assessments have generally used dose as the assessment end-point. Regulations recently established in Sweden (SSI FS 1998:1) have introduced a risk criterion for radioactive waste disposal: the annual risk of harmful effects after closure of a disposal facility should not exceed 10{sup -6} for a representative individual in the group exposed to the greatest risk. This report evaluates different approaches to the definition and use of probabilities in the context of risk assessments, and examines the presentation of the results of risk assessments in safety cases to meet risk targets. The report illustrates the strengths and weaknesses of different possible approaches to risk assessment by reference to assessments in other countries, and provides suggestions for future activity and development in this area by the Swedish regulators. The review of experience in other countries has led to a number of key observations relevant to the conduct of regulatory work on risk assessments and preparations for review. These highlight the importance of developing a protocol for conducting calculations, and linking such a protocol to the requirements of risk assessment calculations and to existing code and model capabilities. There are a number of decisions and assumptions required in developing a risk assessment methodology that could potentially affect the calculated results. These assumptions are independent of the analysis of performance, and relate to issues such as the expectation value of risk, risk dilution, the definition of probability density functions and achieving convergence. A review of a proponent's risk assessment should address these issues in determining the appropriateness and validity of the results presented

  19. Efforts to utilize risk assessment at nuclear power plants

    International Nuclear Information System (INIS)

    Narumiya, Yoshiyuki

    2015-01-01

    Risk assessment means the use of the outputs that have been obtained through risk identification and risk analysis (risk information), followed by the determination of the response policy by comparing these outputs with the risk of judgement standards. This paper discusses the use of risk information with multifaceted nature and its significance, and the challenges to the further penetration of these items. As the lessons and risk assessment learnt from the past accidents, this paper takes up the cases of the severe accidents of Three Mile Island, Chernobyl, and Fukushima Daiichi power stations, and discusses their causes and expansion factors. In particular, at Fukushima Daiichi Nuclear Power Station, important lessons were shortage in measures against the superimposition of earthquake and tsunami, and the insufficient use of risk assessment. This paper classified risk assessment from the viewpoint of risk information, and showed the contents and index for each item of risk reduction trends, risk increase trends, and measures according to the importance of risk. As the benefits of activities due to risk assessment, this paper referred to the application cases of the probabilistic risk assessment (PRA) of IAEA, and summarized the application activities of 10 items of risk indexes by classifying them to safety benefits and operational benefits. For example, in the item of flexible Allowed Outage Time (AOT), the avoidance of plant shutdown and the flexibility improvement of maintenance scheduling at a plant are corresponding to the above-mentioned benefits, respectively. (A.O.)

  20. Risk assessment of safety violations for coal mines

    Energy Technology Data Exchange (ETDEWEB)

    Megan Orsulaka; Vladislav Kecojevicb; Larry Graysona; Antonio Nietoa [Pennsylvania State University, University Park, PA (United States). Dept of Energy and Mineral Engineering

    2010-09-15

    This article presents an application of a risk assessment approach in characterising the risks associated with safety violations in underground bituminous mines in Pennsylvania using the Mine Safety and Health Administration (MSHA) citation database. The MSHA database on citations provides an opportunity to assess risks in mines through scrutiny of violations of mandatory safety standards. In this study, quantitative risk assessment is performed, which allows determination of the frequency of occurrence of safety violations (through associated citations) as well as the consequences of them in terms of penalty assessments. Focus is on establishing risk matrices on citation experiences of mines, which can give early indication of emerging potentially serious problems. The resulting frequency, consequence and risk rankings present valuable tools for prioritising resource allocations, determining control strategies, and could potentially contribute to more proactive prevention of incidents and injuries.

  1. Hanford Site baseline risk assessment methodology. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    1993-03-01

    This methodology has been developed to prepare human health and environmental evaluations of risk as part of the Comprehensive Environmental Response, Compensation, and Liability Act remedial investigations (RIs) and the Resource Conservation and Recovery Act facility investigations (FIs) performed at the Hanford Site pursuant to the Hanford Federal Facility Agreement and Consent Order referred to as the Tri-Party Agreement. Development of the methodology has been undertaken so that Hanford Site risk assessments are consistent with current regulations and guidance, while providing direction on flexible, ambiguous, or undefined aspects of the guidance. The methodology identifies Site-specific risk assessment considerations and integrates them with approaches for evaluating human and environmental risk that can be factored into the risk assessment program supporting the Hanford Site cleanup mission. Consequently, the methodology will enhance the preparation and review of individual risk assessments at the Hanford Site.

  2. Multi-attribute risk assessment for risk ranking of natural gas pipelines

    International Nuclear Information System (INIS)

    Brito, A.J.; Almeida, A.T. de

    2009-01-01

    The paper presents a decision model for risk assessment and for risk ranking of sections of natural gas pipelines based on multi-attribute utility theory. Pipeline hazard scenarios are surveyed and the reasons for a risk assessment model based on a multi-attribute approach are presented. Three dimensions of impact and the need to translate decision-makers' preferences into risk management decisions are highlighted. The model approaches these factors by using a multi-attribute utility function, in order to produce multi-dimensional risk measurements. By using decision analysis concepts, this model quantitatively incorporates the decision-maker's preferences and behavior regarding risk within clear and consistent risk measurements. In order to support the prioritizing of critical sections of pipeline in natural gas companies, this multi-attribute model also allows sections of pipeline to be ranked into a risk hierarchy. A numerical application based on a real case study was undertaken so that the effectiveness of the decision model could be verified

  3. Assessment, Planning, and Execution Considerations for Conjunction Risk Assessment and Mitigation Operations

    Science.gov (United States)

    Frigm, Ryan C.; Levi, Joshua A.; Mantziaras, Dimitrios C.

    2010-01-01

    An operational Conjunction Assessment Risk Analysis (CARA) concept is the real-time process of assessing risk posed by close approaches and reacting to those risks if necessary. The most effective way to completely mitigate conjunction risk is to perform an avoidance maneuver. The NASA Goddard Space Flight Center has implemented a routine CARA process since 2005. Over this period, considerable experience has been gained and many lessons have been learned. This paper identifies and presents these experiences as general concepts in the description of the Conjunction Assessment, Flight Dynamics, and Flight Operations methodologies and processes. These general concepts will be tied together and will be exemplified through a case study of an actual high risk conjunction event for the Aura mission.

  4. Recovery in environmental risk assessment at EFSA

    NARCIS (Netherlands)

    Brock, T.C.M.

    2016-01-01

    EFSA performs environmental risk assessments (ERAs) for single potential stressors such as plant protection products, genetically modified organisms and feed additives and for invasive alien species that are harmful for plant health. In this risk assessment domain, the EFSA Scientific Committee

  5. Apperception and assessment of technological risks

    International Nuclear Information System (INIS)

    Hoyos, C.; Hauke, G.

    1986-01-01

    Risk is defined to be the possibility to induce damage or loss. Any person confronted with risk in his activities has to assess the risk in every case. The author explains a number of actions and events that have been worked out to train people in better management of risk, especially in the working environment. (DG) [de

  6. Food allergy and risk assessment: Current status and future directions

    Science.gov (United States)

    Remington, Benjamin C.

    2017-09-01

    Risk analysis is a three part, interactive process that consists of a scientific risk assessment, a risk management strategy and an exchange of information through risk communication. Quantitative risk assessment methodologies are now available and widely used for assessing risks regarding the unintentional consumption of major, regulated allergens but new or modified proteins can also pose a risk of de-novo sensitization. The risks due to de-novo sensitization to new food allergies are harder to quantify. There is a need for a systematic, comprehensive battery of tests and assessment strategy to identify and characterise de-novo sensitization to new proteins and the risks associated with them. A risk assessment must be attuned to answer the risk management questions and needs. Consequently, the hazard and risk assessment methods applied and the desired information are determined by the requested outcome for risk management purposes and decisions to be made. The COST Action network (ImpARAS, www.imparas.eu) has recently started to discuss these risk management criteria from first principles and will continue with the broader subject of improving strategies for allergen risk assessment throughout 2016-2018/9.

  7. Risk assessment techniques with applicability in marine engineering

    Science.gov (United States)

    Rudenko, E.; Panaitescu, F. V.; Panaitescu, M.

    2015-11-01

    Nowadays risk management is a carefully planned process. The task of risk management is organically woven into the general problem of increasing the efficiency of business. Passive attitude to risk and awareness of its existence are replaced by active management techniques. Risk assessment is one of the most important stages of risk management, since for risk management it is necessary first to analyze and evaluate risk. There are many definitions of this notion but in general case risk assessment refers to the systematic process of identifying the factors and types of risk and their quantitative assessment, i.e. risk analysis methodology combines mutually complementary quantitative and qualitative approaches. Purpose of the work: In this paper we will consider as risk assessment technique Fault Tree analysis (FTA). The objectives are: understand purpose of FTA, understand and apply rules of Boolean algebra, analyse a simple system using FTA, FTA advantages and disadvantages. Research and methodology: The main purpose is to help identify potential causes of system failures before the failures actually occur. We can evaluate the probability of the Top event.The steps of this analize are: the system's examination from Top to Down, the use of symbols to represent events, the use of mathematical tools for critical areas, the use of Fault tree logic diagrams to identify the cause of the Top event. Results: In the finally of study it will be obtained: critical areas, Fault tree logical diagrams and the probability of the Top event. These results can be used for the risk assessment analyses.

  8. Natural risks assessment and management (project of monograph)

    International Nuclear Information System (INIS)

    Ragozin, A.L.

    1998-01-01

    Full text of publication follows: large-scale theoretic and practical works on the issue of natural risk assessment and management started in Russia in the end of the 80's. By now there has been made a considerable progress, which allowed for the preparation of a collective monograph on the subject mentioned in the title of this abstract. It is supposed to be published in 1999 in order to become a Russian contribution to the International Decade of Natural Disasters Reduction. The monograph included 6 chapters with the following titles: 1. Methodological foundations of natural risk analysis and assessment. 2. Investigating and forecasting natural hazards for the purpose of risk assessment. 3. Assessment of economic, social and ecological damage from natural hazards. 4, Theory of natural risk assessment. 5. Examples of natural risk assessment and mapping. 6. Natural risk management. In the report there is described the content of the monograph and unsolved questions are discussed. Executive editor offers all international experts to cooperate in the compilation of this monograph, which is to be completed by the end of 1998, especially of chapter 5 and 6. (author)

  9. Resource handbook on transport risk assessment (invited paper)

    International Nuclear Information System (INIS)

    Chen, S.Y.; Biwer, B.M.; Monette, F.A.; Luna, R.; Weiner, R.; Yoshimura, R.; Detrick, C.; Dunn, T.; Maheras, S.; Bhatnager, S.; Kapoor, A.K.

    2003-01-01

    The US Department of Energy's (DOE's) National Transportation Program established the DOE Transportation Risk Assessment Working Group (TRAWG) to develop the Resource Handbook on DOE Transportation Risk Assessment, published in July 2002. The working group is comprised of technical experts representing DOE national laboratories, the DOE Naval Reactors Program, and DOE contractors. The motivation behind preparing this handbook was to document and disseminate lessons learned and information accumulated from more than 20 years of experience by DOE and its contractors in preparing transport risk assessments that address the shipment of virtually all types of radioactive materials and wastes. The handbook is intended to serve as a primary source of information on conducting transport risk assessments for shipments of radioactive materials or wastes under both normal and accident conditions. The paper provides an overview of the information contained in the handbook. It should be recognised that development of radioactive materials transport risk assessment is an ongoing process, and that the analysis methods are regularly improved. The Resource Handbook on DOE Transportation Risk Assessment appears on the Web at www.ntp.doe.gov/transrisk_handbook.pdf. (author)

  10. Safety and security risk assessments--now demystified!

    Science.gov (United States)

    White, Donald E

    2011-01-01

    Safety/security risk assessments no longer need to spook nor baffle healthcare safety/security managers. This grid template provides at-at-glance quick lookup of the possible threats, the affected people and things, a priority ranking of these risks, and a workable solution for each risk. Using the standard document, spreadsheet, or graphics software already available on your computer, you can easily use a scientific method to produce professional looking risk assessments that get quickly understood by both senior managers and first responders alike!

  11. Military Ecological Risk Assessment Framework (MERAF) for Assessment of Risks of Military Training and Testing to Natural Resources

    Energy Technology Data Exchange (ETDEWEB)

    Suter II, G.W.

    2003-06-18

    The objective of this research is to provide the DoD with a framework based on a systematic, risk-based approach to assess impacts for management of natural resources in an ecosystem context. This risk assessment framework is consistent with, but extends beyond, the EPA's ecological risk assessment framework, and specifically addresses DoD activities and management needs. MERAF is intended to be consistent with existing procedures for environmental assessment and planning with DoD testing and training. The intention is to supplement these procedures rather than creating new procedural requirements. MERAF is suitable for use for training and testing area assessment and management. It does not include human health risks nor does it address specific permitting or compliance requirements, although it may be useful in some of these cases. Use of MERAF fits into the National Environmental Policy Act (NEPA) process by providing a consistent and rigorous way of organizing and conducting the technical analysis for Environmental Impact Statements (EISs) (Sigal 1993; Carpenter 1995; Canter and Sadler 1997). It neither conflicts with, nor replaces, procedural requirements within the NEPA process or document management processes already in place within DoD.

  12. Ecological Risk Assessment of Genetically Modified Higher Plants (GMHP)

    DEFF Research Database (Denmark)

    Kjær, C.; Damgaard, C.; Kjellsson, G.

    Preface This publication is a first version of a manual identifying the data needs for ecological risk assessment of genetically modified higher plants (GMHP). It is the intention of the authors to stimulate further discussion of what data are needed in order to conduct a proper ecological risk...... of the project Biotechnology: elements in environmental risk assessment of genetically modified plants. December 1999 Christian Kjær Introduction In ecological risk assessment of transgenic plants, information on a wide range of subjects is needed for an effective and reliable assessment procedure...... in the amendment to the directive. This report suggests a structured way to identify the type of data needed to perform a sound ecological risk assessment for genetically modified higher plants (GMHP). The identified data types are intended to support the evaluation of the following risks: risk of invasion...

  13. Occupational health policies on risk assessment in Japan.

    Science.gov (United States)

    Horie, Seichi

    2010-09-01

    Industrial Safety and Health Law (ISH Law) of Japan requires abnormalities identified in evaluations of worker health and working environments are reported to occupational physicians, and employers are advised of measures to ensure appropriate accommodations in working environments and work procedures. Since the 1980s, notions of a risk assessment and occupational safety and health management system were expected to further prevent industrial accidents. In 2005, ISH Law stipulated workplace risk assessment using the wording "employers shall endeavor." Following the amendment, multiple documents and guidelines for risk assessment for different work procedures were developed. They require ISH Laws to be implemented fully and workplaces to plan and execute measures to reduce risks, ranking them from those addressing potential hazards to those requiring workers to wear protective articles. A governmental survey in 2005 found the performance of risk assessment was 20.4% and common reasons for not implementing risk assessments were lack of adequate personnel or knowledge. ISH Law specifies criminal penalties for both individuals and organizations. Moreover, under the Labor Contract Law promulgated in 2007, employers are obliged to make reasonable efforts to ensure employee health for foreseeable and avoidable risks. Therefore, enterprises neglecting even the non-binding provisions of guidelines are likely to suffer significant business impact if judged to be responsible for industrial accidents or occupational disease. To promote risk assessment, we must strengthen technical, financial, and physical support from public-service organizations, encourage the dissemination of good practices to reduce risks, and consider additional employer incentives, including relaxed mandatory regulations.

  14. Occupational Health Policies on Risk Assessment in Japan

    Directory of Open Access Journals (Sweden)

    Seichi Horie

    2010-09-01

    Full Text Available Industrial Safety and Health Law (ISH Law of Japan requires abnormalities identifi ed in evaluations of worker health and working environments are reported to occupational physicians, and employers are advised of measures to ensure appropriate accommodations in working environments and work procedures. Since the 1980s, notions of a risk assessment and occupational safety and health management system were expected to further prevent industrial accidents. In 2005, ISH Law stipulated workplace risk assessment using the wording “employers shall endeavor.” Following the amendment, multiple documents and guidelines for risk assessment for different work procedures were developed. They require ISH Laws to be implemented fully and workplaces to plan and execute measures to reduce risks, ranking them from those addressing potential hazards to those requiring workers to wear protective articles. A governmental survey in 2005 found the performance of risk assessment was 20.4% and common reasons for not implementing risk assessments were lack of adequate personnel or knowledge. ISH Law specifi es criminal penalties for both individuals and organizations. Moreover, under the Labor Contract Law promulgated in 2007, employers are obliged to make reasonable efforts to ensure employee health for foreseeable and avoidable risks. Therefore, enterprises neglecting even the non-binding provisions of guidelines are likely to suffer signifi cant business impact if judged to be responsible for industrial accidents or occupational disease. To promote risk assessment, we must strengthen technical, fi nancial, and physical support from public-service organizations, encourage the dissemination of good practices to reduce risks, and consider additional employer incentives, including relaxed mandatory regulations.

  15. Integral risk assessment

    International Nuclear Information System (INIS)

    Chakraborty, S.; Yadigaroglu, G.

    1991-01-01

    The series of lectures which forms the basis of this book and took place in the winter of 1989/90 at the ETH in Zuerich were held for the purpose of discussing the stage of development of our system of ethics in view of the extremely fast pace of technological progress and the risks which accompany it. Legal, psychological and political aspects of the problem were examined, but the emphasis was placed on ethical aspects. The effects which are examined in conventional risk analyses can be considered as a part of the ethical and social aspects involved, and in turn, the consideration of ethical and social aspects can be viewed as an extension of the conventional form of risk analysis. In any case, among risk experts, the significance of ethical and social factors is uncontested, especially as regards activities which can have far-reaching repurcussions. Some objective difficulties interfere with this goal, however: - No generally acknowledged set of ethical values exists. - Cultural influences and personal motives can interfere. - Normally a risk assessment is carried out in reference to individual facilities and within a small, clearly defined framework. Under certain circumstances, generalizations which are made for complete technological systems can lead to completely different conclusions. One contribution deals with integral views of the risks of atomic energy from an ethical and social perspective. (orig.) [de

  16. Risk Assessment in Finland: Theory and Practice

    Directory of Open Access Journals (Sweden)

    Hannu Anttonen

    2010-09-01

    Full Text Available The Finnish risk assessment practice is based on the Occupational Safety and Health Act aiming to improve working conditions in order maintain the employees' work ability, and to prevent occupational accidents and diseases. In practice there are hundreds of risk assessment methods in use. A simple method is used in SME's and more complex risk evaluation methods in larger work places. Does the risk management function in the work places in Finland? According to our experience something more is needed. That is, understanding of common and company related benefits of risk management. The wider conclusion is that commitment for risk assessment in Finland is high enough. However, in those enterprises where OSH management was at an acceptable level or above it, there were also more varied and more successfully accomplished actions to remove or reduce the risks than in enterprises, where OSH management was in lower level. In risk assessment it is important to process active technical prevention and exact communication, increase work place attraction and increase job satisfaction and motivation. Investments in occupational safety and health are also good business. Low absenteeism due to illness or accidents increases directly the production results by improved quality and quantity of the product. In general Finnish studies have consistently shown that the return of an invested euro is three to seven-old. In national level, according to our calculations the savings could be even 20% of our gross national product.

  17. RISK MANAGEMENT: AN INTEGRATED APPROACH TO RISK MANAGEMENT AND ASSESSMENT

    OpenAIRE

    Szabo Alina

    2012-01-01

    Purpose: The objective of this paper is to offer an overview over risk management cycle by focusing on prioritization and treatment, in order to ensure an integrated approach to risk management and assessment, and establish the ‘top 8-12’ risks report within the organization. The interface with Internal Audit is ensured by the implementation of the scoring method to prioritize risks collected from previous generated risk report. Methodology/approach: Using evidence from other research in ...

  18. Genetic toxicology and cancer risk assessment

    National Research Council Canada - National Science Library

    Choy, Wai Nang

    2001-01-01

    ... their risks to humans are obvious goals for the protection of public health. When exposure is unavoidable, an accurate estimation of human risk as a result of exposure is essential for making regulatory decisions. Quantitative cancer risk assessment is an intricate process that utilizes knowledge from many different scien...

  19. Supplementing quantitative risk assessments with a stage addressing the risk understanding of the decision maker

    International Nuclear Information System (INIS)

    Aven, Terje

    2016-01-01

    A quantitative probabilistic risk assessment produces a conditional risk description given the knowledge of the analysts (formulated to a large extent through assumptions). However, important aspects of the risk may be concealed in the background knowledge of the analyst and the assumptions. This paper discusses this issue, the main purpose being to present a two-stage risk assessment approach where the second stage addresses the risk understanding of the decision maker. This second-stage is to a large extent qualitative. The approach is novel with its separation between the analysts' conditional risk descriptions using probability judgments, and the decision maker's risk understanding. The approach aims at improving the use of risk assessment in practical decision making by ensuring that the results of the risk assessments are properly interpreted and the key aspects of risk, uncertainty and knowledge are brought to attention for the decision makers. Examples are used to illustrate the approach. - Highlights: • A quantitative risk assessment produces a conditional risk description. • The decision maker (DM) needs to address risk beyond this description. • The paper presents a related two-stage process, covering analyst and DM judgments. • The second stage relates to the DM's risk understanding. • Strength of knowledge judgments are included in both stages.

  20. Automatic breast cancer risk assessment from digital mammograms

    DEFF Research Database (Denmark)

    Karemore, Gopal Raghunath; Brandt, Sami; Karssemeijer, N

    Purpose: Textural characteristics of the breast tissue structure on mammogram have been shown to improve breast cancer risk assessment in several large studies. Currently, however, the texture is not used to assess risk in standard clinical procedures or involved in general breast cancer risk ass...

  1. Critical notes on microbiological risk assessment of food

    NARCIS (Netherlands)

    Reij, M.W.; Schothorst, van M.

    2000-01-01

    Although numerous papers on Microbiological Risk Assessment (MRA) of food products have been published, a number of issues related to it remain unresolved. This paper explains the role of Microbiological Risk Assessment in the context of Risk Analysis as outlined by Codex Alimentarius. It reviews

  2. Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973

    Directory of Open Access Journals (Sweden)

    Guillermina Feudal

    2017-12-01

    Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.

  3. Assessment and perception of risk

    Energy Technology Data Exchange (ETDEWEB)

    Daglish, J

    1981-01-01

    A recent two-day meeting was called by the Royal Society to discuss all types of risks, but symptomatic of the concerns of most of those present, the discussion centred mainly on the risks inherent in energy production and use. Among the subjects considered were public perception of differing risks, and how these are ranked, and risks versus benefits. Quotations from and summaries of many of the papers presented show that it was generally felt that scientists must be very careful in the way that they use numerical assessments of risk and that they should pay more attention than they have to social and political factors.

  4. Probabilistic risk assessment in the nuclear power industry

    International Nuclear Information System (INIS)

    Fullwood, R.R.; Hall, R.E.

    1988-01-01

    This book describes the more important improvements in risk assessment methodology developed over the last decade. The book covers the following areas - a general view of risk pertaining to nuclear power, mathematics necessary to understand the text, a concise overview of the light water reactors and their features for protecting the public, probabilities and consequences calculated to form risk assessment to the plant, and 34 applications of probabilistic risk assessment (PRA) in the power generation industry. There is a glossary of acronyms and unusual words and a list of references. (author)

  5. 78 FR 64428 - Draft Qualitative Risk Assessment of Risk of Activity/Animal Food Combinations for Activities...

    Science.gov (United States)

    2013-10-29

    .... FDA-2013-N-1043] Draft Qualitative Risk Assessment of Risk of Activity/Animal Food Combinations for... entitled ``Draft Qualitative Risk Assessment of Risk of Activity/Animal Food Combinations for Activities...(n) of the FD&C Act. II. Qualitative Risk Assessment As explained in the draft RA, we conducted the...

  6. Metal Vapor Arcing Risk Assessment Tool

    Science.gov (United States)

    Hill, Monika C.; Leidecker, Henning W.

    2010-01-01

    The Tin Whisker Metal Vapor Arcing Risk Assessment Tool has been designed to evaluate the risk of metal vapor arcing and to help facilitate a decision toward a researched risk disposition. Users can evaluate a system without having to open up the hardware. This process allows for investigating components at risk rather than spending time and money analyzing every component. The tool points to a risk level and provides direction for appropriate action and documentation.

  7. Violence Risk Assessment Practices in Denmark: A Multidisciplinary National Survey

    Directory of Open Access Journals (Sweden)

    Nielsen Louise Hjort

    2015-12-01

    Full Text Available With a quadrupling of forensic psychiatric patients in Denmark over the past 20 years, focus on violence risk assessment practices across the country has increased. However, information is lacking regarding Danish risk assessment practice across professional disciplines and clinical settings; little is known about how violence risk assessments are conducted, which instruments are used for what purposes, and how mental health professionals rate their utility and costs. As part of a global survey exploring the application of violence risk assessment across 44 countries, the current study investigated Danish practice across several professional disciplines and settings in which forensic and high-risk mental health patients are assessed and treated. In total, 125 mental health professionals across the country completed the survey. The five instruments that respondents reported most commonly using for risk assessment, risk management planning and risk monitoring were Broset, HCR-20, the START, the PCL-R, and the PCL:SV. Whereas the HCR-20 was rated highest in usefulness for risk assessment, the START was rated most useful for risk management and risk monitoring. No significant differences in utility were observed across professional groups. Unstructured clinical judgments were reported to be faster but more expensive to conduct than using a risk assessment instrument. Implications for clinical practice are discussed.

  8. An approach to risk assessment

    DEFF Research Database (Denmark)

    Simonsen, L.; Lund, S. P.; Hass, Ulla

    1998-01-01

    of Ministers with the task to propose criteria for neurotoxicity. Functional effects on the nervous system, such as reduction in memory and learning ability, decrease in attention, and alteration of behavior due to toxic chemicals in the environment is now being acknowledged as an important public health...... indicate that numerous persons are exposed in the working as well as in the general environment to several chemicals, for which almost no data on the effect on subtle neurophysiological functions are available. Development of an approach to risk assessment dealing with this problem is a major challenge...... in the nineties. Different approaches to risk assessment are discussed, the quality of the databases available for hazard assessment are evaluated, and the needs for further research are identified. (C) 1996 Intox Press, Inc....

  9. Hormesis in Regulatory risk assessment - Science and Science Policy.

    Science.gov (United States)

    Gray, George

    2011-01-01

    This brief commentary will argue that whether hormesis is considered in regulatory risk assessment is a matter less of science than of science policy. I will first discuss the distinction between science and science policy and their roles in regulatory risk assessment. Then I will focus on factors that influence science policy, especially as it relates to the conduct of risk assessments to inform regulatory decisions, with a focus on the U.S. Environmental Protection Agency (EPA). The key questions will then be how does hormesis interact with current concepts of science and science policy for risk assessment? Finally, I look ahead to factors that may increase, or decrease, the likelihood of hormesis being incorporated into regulatory risk assessment.

  10. 76 FR 37770 - Monsanto Co.; Availability of Petition, Plant Pest Risk Assessment, and Environmental Assessment...

    Science.gov (United States)

    2011-06-28

    ...] Monsanto Co.; Availability of Petition, Plant Pest Risk Assessment, and Environmental Assessment for... available for public comment the Monsanto petition, our plant pest risk assessment, and our draft... plant pest risk assessment are also available on the APHIS Web site at: http://www.aphis.usda.gov/brs...

  11. Colon Cancer Risk Assessment - Gauss Program

    Science.gov (United States)

    An executable file (in GAUSS) that projects absolute colon cancer risk (with confidence intervals) according to NCI’s Colorectal Cancer Risk Assessment Tool (CCRAT) algorithm. GAUSS is not needed to run the program.

  12. Microbiological risk assessment and public health

    International Nuclear Information System (INIS)

    Roger Skinner

    1992-01-01

    Despite the advances made in risk assessment i the past twenty years, in areas as diverse as toxicology and offshore engineering, the risk assessment approach has made little impact on those addressing the microbiological aspects of public health. In this paper the advances which have been made are discussed and the difficulties preventing the wider application of microbiological risk assessment (MRA) to public health are considered. The term microbiological risk is used here to mean the probability of contracting a disease caused by a microorganism. I intend to demonstrate that the dynamic nature of microorganisms and the unique nature of the relationship between a pathogen (a microorganism which causes disease) and its host create special challenges for those involved in MRA. Although these problems are difficult they are not intractable. Indeed in some cases partial solutions have already been found and applied. It is hoped that this paper will help stimulate further thought and consideration in a variety of disciplines so that these challenges can be met, thereby allowing MRA to fulfil its potential

  13. Microbiological risk assessment and public health

    Energy Technology Data Exchange (ETDEWEB)

    Skinner, Roger

    1992-07-01

    Despite the advances made in risk assessment i the past twenty years, in areas as diverse as toxicology and offshore engineering, the risk assessment approach has made little impact on those addressing the microbiological aspects of public health. In this paper the advances which have been made are discussed and the difficulties preventing the wider application of microbiological risk assessment (MRA) to public health are considered. The term microbiological risk is used here to mean the probability of contracting a disease caused by a microorganism. I intend to demonstrate that the dynamic nature of microorganisms and the unique nature of the relationship between a pathogen (a microorganism which causes disease) and its host create special challenges for those involved in MRA. Although these problems are difficult they are not intractable. Indeed in some cases partial solutions have already been found and applied. It is hoped that this paper will help stimulate further thought and consideration in a variety of disciplines so that these challenges can be met, thereby allowing MRA to fulfil its potential.

  14. On the use of conservatism in risk assessments

    International Nuclear Information System (INIS)

    Aven, Terje

    2016-01-01

    It is common to use conservatism in risk assessments, replacing uncertain quantities with values that lead to a higher level of risk. It is argued that the approach represents a practical method for dealing with uncertainties and lack of knowledge in risk assessment. If the computed probabilities meet the pre-defined criteria with the conservative quantities, there is strong support for the “real risk” to meet these criteria. In this paper we look more closely into this practice, the main aims being to clarify what it actually means and what the implications are, as well as providing some recommendations. The paper concludes that conservatism should be avoided in risk assessments – “best judgements” should be the ruling thinking, to allow for meaningful comparisons of options. By incorporating sensitivity analyses and strength of knowledge judgements for the background knowledge on which the assigned probabilities are based, the robustness of the conclusions can be more adequately assessed. - Highlights: • The paper clarifies the meaning of conservatism in risk assessments. • It is shown that a conservative policy has severe shortcomings. • It is concluded that conservatism should be avoided in risk assessments. • “Best judgements” should be the ruling thinking. • Sensitivity analyses and strength of knowledge judgements are required.

  15. Modern biogeochemistry environmental risk assessment

    CERN Document Server

    Bashkin, Vladimir N

    2006-01-01

    Most books deal mainly with various technical aspects of ERA description and calculationsAims at generalizing the modern ideas of both biogeochemical and environmental risk assessment during recent yearsAims at supplementing the existing books by providing a modern understanding of mechanisms that are responsible for the ecological risk for human beings and ecosystem

  16. Test reactor risk assessment methodology

    International Nuclear Information System (INIS)

    Jennings, R.H.; Rawlins, J.K.; Stewart, M.E.

    1976-04-01

    A methodology has been developed for the identification of accident initiating events and the fault modeling of systems, including common mode identification, as these methods are applied in overall test reactor risk assessment. The methods are exemplified by a determination of risks to a loss of primary coolant flow in the Engineering Test Reactor

  17. Risk assessment techniques for civil aviation security

    Energy Technology Data Exchange (ETDEWEB)

    Tamasi, Galileo, E-mail: g.tamasi@enac.rupa.i [Ente Nazionale per l' Aviazione Civile-Direzione Progetti, Studi e Ricerche, Via di Villa Ricotti, 42, 00161 Roma (Italy); Demichela, Micaela, E-mail: micaela.demichela@polito.i [SAfeR-Centro Studi su Sicurezza, Affidabilita e Rischi, Dipartimento di Scienza dei Materiali e Ingegneria Chimica, Politecnico di Torino, Corso Duca degli Abruzzi, 24, 10129 Torino (Italy)

    2011-08-15

    Following the 9/11 terrorists attacks in New York a strong economical effort was made to improve and adapt aviation security, both in infrastructures as in airplanes. National and international guidelines were promptly developed with the objective of creating a security management system able to supervise the identification of risks and the definition and optimization of control measures. Risk assessment techniques are thus crucial in the above process, since an incorrect risk identification and quantification can strongly affect both the security level as the investments needed to reach it. The paper proposes a set of methodologies to qualitatively and quantitatively assess the risk in the security of civil aviation and the risk assessment process based on the threats, criticality and vulnerabilities concepts, highlighting their correlation in determining the level of risk. RAMS techniques are applied to the airport security system in order to analyze the protection equipment for critical facilities located in air-side, allowing also the estimation of the importance of the security improving measures vs. their effectiveness.

  18. Risk assessment techniques for civil aviation security

    International Nuclear Information System (INIS)

    Tamasi, Galileo; Demichela, Micaela

    2011-01-01

    Following the 9/11 terrorists attacks in New York a strong economical effort was made to improve and adapt aviation security, both in infrastructures as in airplanes. National and international guidelines were promptly developed with the objective of creating a security management system able to supervise the identification of risks and the definition and optimization of control measures. Risk assessment techniques are thus crucial in the above process, since an incorrect risk identification and quantification can strongly affect both the security level as the investments needed to reach it. The paper proposes a set of methodologies to qualitatively and quantitatively assess the risk in the security of civil aviation and the risk assessment process based on the threats, criticality and vulnerabilities concepts, highlighting their correlation in determining the level of risk. RAMS techniques are applied to the airport security system in order to analyze the protection equipment for critical facilities located in air-side, allowing also the estimation of the importance of the security improving measures vs. their effectiveness.

  19. Risk assessment of power systems models, methods, and applications

    CERN Document Server

    Li, Wenyuan

    2014-01-01

    Risk Assessment of Power Systems addresses the regulations and functions of risk assessment with regard to its relevance in system planning, maintenance, and asset management. Brimming with practical examples, this edition introduces the latest risk information on renewable resources, the smart grid, voltage stability assessment, and fuzzy risk evaluation. It is a comprehensive reference of a highly pertinent topic for engineers, managers, and upper-level students who seek examples of risk theory applications in the workplace.

  20. Do pressure ulcer risk assessment scales improve clinical practice?

    Directory of Open Access Journals (Sweden)

    Jan Kottner

    2010-07-01

    Full Text Available Jan Kottner1, Katrin Balzer21Department of Nursing Science, Charité-Universitätsmedizin Berlin, Germany; 2Nursing Research Group, Institute for Social Medicine, Universitätsklinikum Schleswig-Holstein, Lübeck, GermanyAbstract: Standardized assessment instruments are deemed important for estimating pressure ulcer risk. Today, more than 40 so-called pressure ulcer risk assessment scales are available but still there is an ongoing debate about their usefulness. From a measurement point of view pressure ulcer (PU risk assessment scales have serious limitations. Empirical evidence supporting the validity of PU risk assessment scale scores is weak and obtained scores contain varying amounts of measurement error. The concept of pressure ulcer risk is strongly related to the general health status and severity of illness. A clinical impact due do the application of these scales could also not be demonstrated. It is questionable whether completion of standardized pressure ulcer risk scales in clinical practice is really needed.Keywords: Braden pressure ulcer, prevention, risk assessment, nursing assessment, predictive value, clinical effectiveness, review

  1. Coupling mode-destination accessibility with seismic risk assessment to identify at-risk communities

    International Nuclear Information System (INIS)

    Miller, Mahalia; Baker, Jack W.

    2016-01-01

    In this paper, we develop a framework for coupling mode-destination accessibility with quantitative seismic risk assessment to identify communities at high risk for travel disruptions after an earthquake. Mode-destination accessibility measures the ability of people to reach destinations they desire. We use a probabilistic seismic risk assessment procedure, including a stochastic set of earthquake events, ground-motion intensity maps, damage maps, and realizations of traffic and accessibility impacts. For a case study of the San Francisco Bay Area, we couple our seismic risk framework with a practical activity-based traffic model. As a result, we quantify accessibility risk probabilistically by community and household type. We find that accessibility varies more strongly as a function of travelers' geographic location than as a function of their income class, and we identify particularly at-risk communities. We also observe that communities more conducive to local trips by foot or bike are predicted to be less impacted by losses in accessibility. This work shows the potential to link quantitative risk assessment methodologies with high-resolution travel models used by transportation planners. Quantitative risk metrics of this type should have great utility for planners working to reduce risk to a region's infrastructure systems. - Highlights: • We couple mode-destination accessibility with probabilistic seismic risk assessment. • Results identify communities at high risk for post-earthquake travel disruptions. • Accessibility varies more as a function of home location than by income. • Our model predicts reduced accessibility risk for more walking-friendly communities.

  2. Development of a system utilizing data of risk assessment

    International Nuclear Information System (INIS)

    Nagasaka, Akihiko; Takano, Kenichi; Ebisu, Mitsuhiro; Aikawa, Tadashi; Hayase, Kenichi

    2004-01-01

    This report deals with a concrete method of utilizing data of risk assessment. First, the authors point out the necessity to assess all stages of jobs (planning, meeting with contractors, performing phase of task, etc.) in risk assessment bout jobs in electric power company, because most jobs are performed by contract system and risks of a job are distributed over electric company, contractors and subcontractors. Secondly, risks estimated from past accidents and near-miss events must be included. If these 2 requirements are fulfilled, data of risk assessment can be more useful. Then below 4 forms of present data of risk assessment were developed. A form to be used in job planning stage in electric companies for efficient investment planning in safety measures. A form to be used in meetings between electric companies and contractors for checking accident prevention methods. A form to be used in meetings between contractors and subcontractors for enhancing a shared awareness of risk. A form to be used in tool box meetings for confirming safe condition and inheriting of ability of risk perception. Additionally, a data base system of risk assessment about 4 jobs was developed. This system prints out about 4 forms for each job and is useful for PDCA of safety activities. (author)

  3. Probabilistic risk assessment in nuclear power plant regulation

    Energy Technology Data Exchange (ETDEWEB)

    Wall, J B

    1980-09-01

    A specific program is recommended to utilize more effectively probabilistic risk assessment in nuclear power plant regulation. It is based upon the engineering insights from the Reactor Safety Study (WASH-1400) and some follow-on risk assessment research by USNRC. The Three Mile Island accident is briefly discussed from a risk viewpoint to illustrate a weakness in current practice. The development of a probabilistic safety goal is recommended with some suggestions on underlying principles. Some ongoing work on risk perception and the draft probabilistic safety goal being reviewed on Canada is described. Some suggestions are offered on further risk assessment research. Finally, some recent U.S. Nuclear Regulatory Commission actions are described.

  4. Disease state fingerprint for fall risk assessment.

    Science.gov (United States)

    Similä, Heidi; Immonen, Milla

    2014-01-01

    Fall prevention is an important and complex multifactorial challenge, since one third of people over 65 years old fall at least once every year. A novel application of Disease State Fingerprint (DSF) algorithm is presented for holistic visualization of fall risk factors and identifying persons with falls history or decreased level of physical functioning based on fall risk assessment data. The algorithm is tested with data from 42 older adults, that went through a comprehensive fall risk assessment. Within the study population the Activities-specific Balance Confidence (ABC) scale score, Berg Balance Scale (BBS) score and the number of drugs in use were the three most relevant variables, that differed between the fallers and non-fallers. This study showed that the DSF visualization is beneficial in inspection of an individual's significant fall risk factors, since people have problems in different areas and one single assessment scale is not enough to expose all the people at risk.

  5. Analysis of Alternatives for Risk Assessment Methodologies and Tools

    Energy Technology Data Exchange (ETDEWEB)

    Nachtigal, Noel M. [Sandia National Lab. (SNL-CA), Livermore, CA (United States). System Analytics; Fruetel, Julia A. [Sandia National Lab. (SNL-CA), Livermore, CA (United States). Systems Research and Analysis; Gleason, Nathaniel J. [Sandia National Lab. (SNL-CA), Livermore, CA (United States). Systems Research and Analysis; Helms, Jovana [Sandia National Lab. (SNL-CA), Livermore, CA (United States). Systems Research and Analysis; Imbro, Dennis Raymond [Sandia National Lab. (SNL-CA), Livermore, CA (United States). Systems Research and Analysis; Sumner, Matthew C. [Sandia National Lab. (SNL-CA), Livermore, CA (United States). Systems Research and Analysis

    2013-10-01

    The purpose of this document is to provide a basic overview and understanding of risk assessment methodologies and tools from the literature and to assess the suitability of these methodologies and tools for cyber risk assessment. Sandia National Laboratories (SNL) performed this review in support of risk modeling activities performed for the Stakeholder Engagement and Cyber Infrastructure Resilience (SECIR) division of the Department of Homeland Security (DHS) Office of Cybersecurity and Communications (CS&C). The set of methodologies and tools covered in this document is not intended to be exhaustive; instead, it focuses on those that are commonly used in the risk assessment community. The classification of methodologies and tools was performed by a group of analysts with experience in risk analysis and cybersecurity, and the resulting analysis of alternatives has been tailored to address the needs of a cyber risk assessment.

  6. Microbiological risk assessment for personal care products.

    Science.gov (United States)

    Stewart, S E; Parker, M D; Amézquita, A; Pitt, T L

    2016-12-01

    Regulatory decisions regarding microbiological safety of cosmetics and personal care products are primarily hazard-based, where the presence of a potential pathogen determines decision-making. This contrasts with the Food industry where it is a commonplace to use a risk-based approach for ensuring microbiological safety. A risk-based approach allows consideration of the degree of exposure to assess unacceptable health risks. As there can be a number of advantages in using a risk-based approach to safety, this study explores the Codex Alimentarius (Codex) four-step Microbiological Risk Assessment (MRA) framework frequently used in the Food industry and examines how it can be applied to the safety assessment of personal care products. The hazard identification and hazard characterization steps (one and two) of the Codex MRA framework consider the main microorganisms of concern. These are addressed by reviewing the current industry guidelines for objectionable organisms and analysing reports of contaminated products notified by government agencies over a recent 5-year period, together with examples of reported outbreaks. Data related to estimation of exposure (step three) are discussed, and examples of possible calculations and references are included. The fourth step, performed by the risk assessor (risk characterization), is specific to each assessment and brings together the information from the first three steps to assess the risk. Although there are very few documented uses of the MRA approach for personal care products, this study illustrates that it is a practicable and sound approach for producing products that are safe by design. It can be helpful in the context of designing products and processes going to market and with setting of microbiological specifications. Additionally, it can be applied reactively to facilitate decision-making when contaminated products are released on to the marketplace. Currently, the knowledge available may only allow a

  7. Assessment factors for human health risk assessment: a discussion paper

    NARCIS (Netherlands)

    Vermeire TG; Stevenson H; Pieters MN; Rennen M; Slob W; Hakkert BC; Nederlandse organisatie voor; CSR; LEO; TNO-ITV

    1998-01-01

    The general goal of this discussion paper is to contribute towards further harmonisation of the human health risk assessment. It discusses the development of a formal, harmonised set of default assessment factors. The status quo with regard to assessment factors is reviewed. Options are presented

  8. Risk Assessment of Shellfish Toxins

    Directory of Open Access Journals (Sweden)

    Rex Munday

    2013-11-01

    Full Text Available Complex secondary metabolites, some of which are highly toxic to mammals, are produced by many marine organisms. Some of these organisms are important food sources for marine animals and, when ingested, the toxins that they produce may be absorbed and stored in the tissues of the predators, which then become toxic to animals higher up the food chain. This is a particular problem with shellfish, and many cases of poisoning are reported in shellfish consumers each year. At present, there is no practicable means of preventing uptake of the toxins by shellfish or of removing them after harvesting. Assessment of the risk posed by such toxins is therefore required in order to determine levels that are unlikely to cause adverse effects in humans and to permit the establishment of regulatory limits in shellfish for human consumption. In the present review, the basic principles of risk assessment are described, and the progress made toward robust risk assessment of seafood toxins is discussed. While good progress has been made, it is clear that further toxicological studies are required before this goal is fully achieved.

  9. Cultural heuristics in risk assessment of HIV/AIDS.

    Science.gov (United States)

    Bailey, Ajay; Hutter, Inge

    2006-01-01

    Behaviour change models in HIV prevention tend to consider that risky sexual behaviours reflect risk assessments and that by changing risk assessments behaviour can be changed. Risk assessment is however culturally constructed. Individuals use heuristics or bounded cognitive devices derived from broader cultural meaning systems to rationalize uncertainty. In this study, we identify some of the cultural heuristics used by migrant men in Goa, India to assess their risk of HIV infection from different sexual partners. Data derives from a series of in-depth interviews and a locally informed survey. Cultural heuristics identified include visual heuristics, heuristics of gender roles, vigilance and trust. The paper argues that, for more culturally informed HIV/AIDS behaviour change interventions, knowledge of cultural heuristics is essential.

  10. Incorporating ecological risk assessment into remedial investigation/feasibility study work plans

    International Nuclear Information System (INIS)

    1994-06-01

    This guidance document (1) provides instructions on preparing the components of an ecological work plan to complement the overall site remedial investigation/feasibility study (RI/FS) work plan and (2) directs the user on how to implement ecological tasks identified in the plan. Under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA), as amended by the Superfund Amendments and Reauthorization Act of 1986 (SARA), and RI/FS work plan will have to be developed as part of the site-remediation scoping process. Specific guidance on the RI/FS process and the preparation of work plans has been developed by the US Environmental Protection Agency (EPA 1988a). This document provides guidance to US Department of Energy (DOE) staff and contractor personnel for incorporation of ecological information into environmental remediation planning and decision making at CERCLA sites

  11. Incorporating ecological risk assessment into remedial investigation/feasibility study work plans

    Energy Technology Data Exchange (ETDEWEB)

    1994-06-01

    This guidance document (1) provides instructions on preparing the components of an ecological work plan to complement the overall site remedial investigation/feasibility study (RI/FS) work plan and (2) directs the user on how to implement ecological tasks identified in the plan. Under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA), as amended by the Superfund Amendments and Reauthorization Act of 1986 (SARA), and RI/FS work plan will have to be developed as part of the site-remediation scoping process. Specific guidance on the RI/FS process and the preparation of work plans has been developed by the US Environmental Protection Agency (EPA 1988a). This document provides guidance to US Department of Energy (DOE) staff and contractor personnel for incorporation of ecological information into environmental remediation planning and decision making at CERCLA sites.

  12. Guidance on the environmental risk assessment of plant pests

    DEFF Research Database (Denmark)

    Baker, R.; Candresse, T.; Dormannsne Simon, E.

    2011-01-01

    The European Food Safety Authority (EFSA) requested the Panel on Plant Health to develop a methodology for assessing the environmental risks posed by harmful organisms that may enter, establish and spread in the European Union. To do so, the Panel first reviewed the methods for assessing...... the environmental risks of plant pests that have previously been used in pest risk assessment. The limitations identified by the review led the Panel to define the new methodology for environmental risk assessment which is described in this guidance document. The guidance is primarily addressed to the EFSA PLH...... (biodiversity) and the functional (ecosystem services) aspects of the environment, this new approach includes methods for assessing both aspects for the first time in a pest risk assessment scheme. A list of questions has been developed for the assessor to evaluate the consequences for structural biodiversity...

  13. US EPA's Ecological Risk Assessment Support Center ...

    Science.gov (United States)

    BackgroundThe ERASC provides technical information and addresses scientific questions of concern or interest on topics relevant to ecological risk assessment at hazardous waste sites for EPA's Office of Solid Waste and Emergency Response (OSWER) personnel and the Office of Resource Conservation and Recovery (ORCR) staff. Requests are channeled to ERASC through the Ecological Risk Assessment Forum (ERAF). To assess emerging and complex scientific issues that require expert judgment, the ERASC relies on the expertise of scientists and engineers located throughout EPA's Office of Research and Development (ORD) labs and centers.ResponseERASC develops responses that reflect the state of the science for ecological risk assessment and also provides a communication point for the distribution of the responses to other interested parties. For further information, contact Ecology_ERASC@epa.gov or call 513-569-7940.

  14. Safety culture' is integrating 'human' into risk assessment

    International Nuclear Information System (INIS)

    Sugimoto, Taiji

    2014-01-01

    Significance of Fukushima nuclear power accident requested reconsideration of safety standards, of which we had usually no doubt. Risk assessment standard (JIS B 9702), Which was used for repetition of database preparation and cumulative assessment, defined allowable risk and residual risk. However, work site and immediate assessment was indispensable beside such assessment so as to ensure safety. Risk of casualties was absolutely not acceptable in principle and judgments to approve allowable risk needed accountability, which was reminded by safety culture proposed by IAEA and also identified by investigation of organizational cause of Columbia accident. Actor of safety culture would be organization and individual, and mainly individual. Realization of safety culture was conducted by personnel having moral consciousness and firm sense of mission in the course of jobs and working daily with sweat pouring. Safety engineering/technology should have framework integrating human as such totality. (T. Tanaka)

  15. Evaluating the Risk of Child Abuse: The Child Abuse Risk Assessment Scale (CARAS)

    Science.gov (United States)

    Chan, Ko Ling

    2012-01-01

    The present study developed the Child Abuse Risk Assessment Scale (CARAS), an actuarial instrument for the assessment of the risk of physical child abuse. Data of 2,363 Chinese parents (47.7% male) living in Hong Kong were used in the analyses. Participants were individually interviewed with a questionnaire assessing their perpetration of child…

  16. The use of quantitative risk assessment in HACCP

    NARCIS (Netherlands)

    Hoornstra, E.; Northolt, M.D.; Notermans, S.; Barendsz, A.W.

    2001-01-01

    During the hazard analysis as part of the development of a HACCP-system, first the hazards (contaminants) have to be identified and then the risks have to be assessed. Often, this assessment is restricted to a qualitative analysis. By using elements of quantitative risk assessment (QRA) the hazard

  17. Laboratory Biosafety and Biosecurity Risk Assessment Technical Guidance Document

    Energy Technology Data Exchange (ETDEWEB)

    Astuto-Gribble, Lisa M; Caskey, Susan Adele

    2014-07-01

    The purpose of this document is threefold: 1) to describe the laboratory bio safety and biosecurity risk assessment process and its conceptual framework; 2) provide detailed guidance and suggested methodologies on how to conduct a risk assessment; and 3) present some practical risk assessment process strategies using realistic laboratory scenarios.

  18. Creation of a Risk Assessment Methodology

    OpenAIRE

    Lefebvre, Nicolas

    2007-01-01

    This report is a presentation of the work realised during an internship at the consultancy division of Thales Security Systems from September 2005 to June 2006. Thales Security Systems is part of Thales, an international group in defence, aeronautics, etc. The work realised consisted in the creation of a new risk assessment methodology for a commercial offer called HELP, standing for Human, Environmental, Logical and Physical security. As a basis for the work, 5 existing risk assessment metho...

  19. Risk and dose assessment methods in gamma knife QA

    International Nuclear Information System (INIS)

    Banks, W.W.; Jones, E.D.; Rathbun, P.

    1992-10-01

    Traditional methods used in assessing risk in nuclear power plants may be inappropriate to use in assessing medical radiation risks. The typical philosophy used in assessing nuclear reactor risks is machine dominated with only secondary attention paid to the human component, and only after critical machine failure events have been identified. In assessing the risk of a misadministrative radiation dose to patients, the primary source of failures seems to stem overwhelmingly, from the actions of people and only secondarily from machine mode failures. In essence, certain medical misadministrations are dominated by human events not machine failures. Radiological medical devices such as the Leksell Gamma Knife are very simple in design, have few moving parts, and are relatively free from the risks of wear when compared with a nuclear power plant. Since there are major technical differences between a gamma knife and a nuclear power plant, one must select a particular risk assessment method which is sensitive to these system differences and tailored to the unique medical aspects of the phenomena under study. These differences also generate major shifts in the philosophy and assumptions which drive the risk assessment (Machine-centered vs Person-centered) method. We were prompted by these basic differences to develop a person-centered approach to risk assessment which would reflect these basic philosophical and technological differences, have the necessary resolution in its metrics, and be highly reliable (repeatable). The risk approach chosen by the Livermore investigative team has been called the ''Relative Risk Profile Method'' and has been described in detail by Banks and Paramore, (1983)

  20. Water risk assessment in China based on the improved Water Risk Filter

    Science.gov (United States)

    Hong, G.; Yaqin, Q.; Qiong, L.; Cunwen, N.; Na, W.; Jiajia, L.; Jongde, G.; Na, Z.; Xiangyi, D.

    2014-09-01

    Finding an effective way to deal with the water crisis and the relationship between water and development is a major issue for all levels of government and different economic sectors across the world. Scientific understanding of water risk is the basis for achieving a scientific relationship between water and development, and water risk assessment is currently an important research focus. To effectively deal with the global water crisis, the World Wide Fund for Nature and German Investment and Development Company Limited proposed the concept of water risk and released an online Water Risk Filter in March 2012, which has been applied to at least 85 countries. To comprehensively and accurately reflect the situation of water risk in China, this study adjusts the water risk assessment indicators in the Water Risk Filter, taking the actual situation in China and the difficulty of obtaining the information about the indicators into account, and proposes an index system for water risk evaluation for China which consists of physical risk, regulatory risk and reputational risk. The improved Water Risk Filter is further used to assess the sources and causes of the water risks in 10 first-class and seven second-class water resource areas (WRAs). The results indicate that the water risk for the whole country is generally medium and low, while those for different regions in the country vary greatly, and those for southern regions are generally lower than those for northern regions. Government regulatory and policy implementation as well as media supervision in northern regions should be strengthened to reduce the water risk. The research results may provide decision support and references for both governments and industrial enterprises in identifying water risks, formulating prevention and control policies, and improving water resources management in China.

  1. Water risk assessment in China based on the improved Water Risk Filter

    Directory of Open Access Journals (Sweden)

    G. Hong

    2014-09-01

    Full Text Available Finding an effective way to deal with the water crisis and the relationship between water and development is a major issue for all levels of government and different economic sectors across the world. Scientific understanding of water risk is the basis for achieving a scientific relationship between water and development, and water risk assessment is currently an important research focus. To effectively deal with the global water crisis, the World Wide Fund for Nature and German Investment and Development Company Limited proposed the concept of water risk and released an online Water Risk Filter in March 2012, which has been applied to at least 85 countries. To comprehensively and accurately reflect the situation of water risk in China, this study adjusts the water risk assessment indicators in the Water Risk Filter, taking the actual situation in China and the difficulty of obtaining the information about the indicators into account, and proposes an index system for water risk evaluation for China which consists of physical risk, regulatory risk and reputational risk. The improved Water Risk Filter is further used to assess the sources and causes of the water risks in 10 first-class and seven second-class water resource areas (WRAs. The results indicate that the water risk for the whole country is generally medium and low, while those for different regions in the country vary greatly, and those for southern regions are generally lower than those for northern regions. Government regulatory and policy implementation as well as media supervision in northern regions should be strengthened to reduce the water risk. The research results may provide decision support and references for both governments and industrial enterprises in identifying water risks, formulating prevention and control policies, and improving water resources management in China.

  2. A comparison of radiological risk assessment models: Risk assessment models used by the BEIR V Committee, UNSCEAR, ICRP, and EPA (for NESHAP)

    International Nuclear Information System (INIS)

    Wahl, L.E.

    1994-03-01

    Radiological risk assessments and resulting risk estimates have been developed by numerous national and international organizations, including the National Research Council's fifth Committee on the Biological Effects of Ionizing Radiations (BEIR V), the United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR), and the International Commission on Radiological Protection (ICRP). A fourth organization, the Environmental Protection Agency (EPA), has also performed a risk assessment as a basis for the National Emission Standards for Hazardous Air Pollutants (NESHAP). This paper compares the EPA's model of risk assessment with the models used by the BEIR V Committee, UNSCEAR, and ICRP. Comparison is made of the values chosen by each organization for several model parameters: populations used in studies and population transfer coefficients, dose-response curves and dose-rate effects, risk projection methods, and risk estimates. This comparison suggests that the EPA has based its risk assessment on outdated information and that the organization should consider adopting the method used by the BEIR V Committee, UNSCEAR, or ICRP

  3. Assessment factors for human health risk assessment: A discussion paper

    NARCIS (Netherlands)

    Vermeire, T.; Stevenson, H.; Pieters, M.N.; Rennen, M.; Slob, W.; Hakkert, B.C.

    1999-01-01

    The general goal of this discussion paper is to contribute toward the further harmonization of human health risk assessment. It first discusses the development of a formal, harmonized set of assessment factors. The status quo with regard to assessment factors is reviewed, that is, the type of

  4. Facts and values in risk assessment

    International Nuclear Information System (INIS)

    Cross, Frank B.

    1998-01-01

    Risk, as commonly understood, is a complex melange of facts, values, and fears. While this complexity of public risk perception is now broadly recognized, its implications are insufficiently explored. Public risk perceptions offer p poor guide for public policymaking. Popular assessments of risk are tainted by misinformation and unreliable heuristics. While subjective considerations, often called values, play a role in public perception of risk, those 'values' are often inappropriate for government decisionmaking. Reliance on public perceptions of risk means more premature deaths. Public risk perception also is systematically skewed contrary to the interests of the disadvantaged. Strict probabilistic risk measures generally provide a superior guide for government regulatory policy

  5. Applying Multi-Criteria Analysis Methods for Fire Risk Assessment

    Directory of Open Access Journals (Sweden)

    Pushkina Julia

    2015-11-01

    Full Text Available The aim of this paper is to prove the application of multi-criteria analysis methods for optimisation of fire risk identification and assessment process. The object of this research is fire risk and risk assessment. The subject of the research is studying the application of analytic hierarchy process for modelling and influence assessment of various fire risk factors. Results of research conducted by the authors can be used by insurance companies to perform the detailed assessment of fire risks on the object and to calculate a risk extra charge to an insurance premium; by the state supervisory institutions to determine the compliance of a condition of object with requirements of regulations; by real state owners and investors to carry out actions for decrease in degree of fire risks and minimisation of possible losses.

  6. III: Use of biomarkers as Risk Indicators in Environmental Risk Assessment of oil based discharges offshore.

    Science.gov (United States)

    Sanni, Steinar; Lyng, Emily; Pampanin, Daniela M

    2017-06-01

    Offshore oil and gas activities are required not to cause adverse environmental effects, and risk based management has been established to meet environmental standards. In some risk assessment schemes, Risk Indicators (RIs) are parameters to monitor the development of risk affecting factors. RIs have not yet been established in the Environmental Risk Assessment procedures for management of oil based discharges offshore. This paper evaluates the usefulness of biomarkers as RIs, based on their properties, existing laboratory biomarker data and assessment methods. Data shows several correlations between oil concentrations and biomarker responses, and assessment principles exist that qualify biomarkers for integration into risk procedures. Different ways that these existing biomarkers and methods can be applied as RIs in a probabilistic risk assessment system when linked with whole organism responses are discussed. This can be a useful approach to integrate biomarkers into probabilistic risk assessment related to oil based discharges, representing a potential supplement to information that biomarkers already provide about environmental impact and risk related to these kind of discharges. Copyright © 2016 Elsevier Ltd. All rights reserved.

  7. Application of Risk Assessment Tools in the Continuous Risk Management (CRM) Process

    Science.gov (United States)

    Ray, Paul S.

    2002-01-01

    Marshall Space Flight Center (MSFC) of the National Aeronautics and Space Administration (NASA) is currently implementing the Continuous Risk Management (CRM) Program developed by the Carnegie Mellon University and recommended by NASA as the Risk Management (RM) implementation approach. The four most frequently used risk assessment tools in the center are: (a) Failure Modes and Effects Analysis (FMEA), Hazard Analysis (HA), Fault Tree Analysis (FTA), and Probabilistic Risk Analysis (PRA). There are some guidelines for selecting the type of risk assessment tools during the project formulation phase of a project, but there is not enough guidance as to how to apply these tools in the Continuous Risk Management process (CRM). But the ways the safety and risk assessment tools are used make a significant difference in the effectiveness in the risk management function. Decisions regarding, what events are to be included in the analysis, to what level of details should the analysis be continued, make significant difference in the effectiveness of risk management program. Tools of risk analysis also depends on the phase of a project e.g. at the initial phase of a project, when not much data are available on hardware, standard FMEA cannot be applied; instead a functional FMEA may be appropriate. This study attempted to provide some directives to alleviate the difficulty in applying FTA, PRA, and FMEA in the CRM process. Hazard Analysis was not included in the scope of the study due to the short duration of the summer research project.

  8. [Risk assessment and risk control for occupational exposure to chemical toxicants from an isophorone nitrile device].

    Science.gov (United States)

    Wang, Dejun; Fu, Xiaokuan; Kong, Fanling; Sui, Shaofeng; Jiang, Yuanyuan; Du, Yinglin; Zhou, Jingyang

    2014-06-01

    Risk assessment and risk control for occupational exposure to chemical toxicants were performed on an isophorone nitrile device with an annual production of 5,000 tons, based on improved Singaporean semi-quantitative risk assessment method, with consideration of actual situation in China and in the present project. With the use of engineering analysis and identification of occupational hazards in the improved Singaporean semi-quantitative risk assessment method, hazard rating (HR) and risk assessment were performed on chemical toxicants from an isophorone nitrile device with an annual production of 5,000 tons. The chemical toxicants in the isophorone nitrile device were mainly isophorone, hydrocyanic acid, methanol, phosphoric acid, sodium hydroxide, and sodium cyanide; the HR values were mild hazard (2), extreme hazard (5), mild hazard (2), mild hazard (2), moderate hazard (3), and extreme hazard (5), respectively, and the corresponding exposure rating (ER) values were 2.09, 2.72, 2.76, 1.68, 2.0, and 1.59, respectively. The risk of chemical toxicants in this project was assessed according to the formula Risk = [HR×ER](1/2). Hydrocyanic acid was determined as high risk, sodium hydroxide and sodium cyanide as medium risk, and isophorone, methanol, and phosphoric acid as low risk. Priority in handling of risks was determined by risk rating. The table of risk control measure was established for pre-assessment of occupational hazards. With risk assessment in this study, we concluded that the isophorone nitrile device with 5,000 ton annual production was a high-occupational hazard device. This device is a project of extreme occupational hazard. The improved Singaporean semi-quantitative risk assessment method is a scientific and applicable method, and is especially suitable for pre-evaluation of on-site project with no analogy.

  9. Preventive risk assessment in forensic child and youth care

    NARCIS (Netherlands)

    Assink, M.

    2017-01-01

    Risk assessment is central to the work of forensic mental health professionals, since it serves as a guide for prevention and intervention strategies. For effective risk assessment, knowledge on risk factors and their effects as well as the availability of valid and reliable instruments for risk

  10. Approaches and methods of risk assessment

    International Nuclear Information System (INIS)

    Rowe, W.D.

    1983-01-01

    The classification system of risk assessment includes the categories: 1) risk comparisons, 2) cost-effectiveness of risk reduction, 3) balancing of costs, risks and benefits against one another, 4. Metasystems. An overview of methods and systems reveals that no single method can be applied to all cases and situations. The visibility of the process and the absolute consideration of all aspects of judging are, however, of first and fore most importance. (DG) [de

  11. External Threat Risk Assessment Algorithm (ExTRAA)

    Energy Technology Data Exchange (ETDEWEB)

    Powell, Troy C. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-08-01

    Two risk assessment algorithms and philosophies have been augmented and combined to form a new algorit hm, the External Threat Risk Assessment Algorithm (ExTRAA), that allows for effective and statistically sound analysis of external threat sources in relation to individual attack methods . In addition to the attack method use probability and the attack method employment consequence, t he concept of defining threat sources is added to the risk assessment process. Sample data is tabulated and depicted in radar plots and bar graphs for algorithm demonstration purposes. The largest success of ExTRAA is its ability to visualize the kind of r isk posed in a given situation using the radar plot method.

  12. Systematic Suicide Risk Assessment for Patients With Schizophrenia

    DEFF Research Database (Denmark)

    Pedersen, Charlotte Gjørup; Wallenstein Jensen, Signe Olrik; Gradus, Jaimie

    2013-01-01

    Objectives: Systematic suicide risk assessment is recommended for patients with schizophrenia; however, little is known about the implementation of suicide risk assessment in routine clinical practice. The study aimed to determine the use of systematic suicide risk assessment at discharge...... and predictors of suicide attempt among hospitalized patients with schizophrenia in Denmark. Methods: A one-year follow-up study was conducted of 9,745 patients with schizophrenia who were discharged from psychiatric wards and registered in a national population-based schizophrenia registry between 2005 and 2009....... Results: The proportion of patients receiving suicide risk assessment at discharge from a psychiatric ward increased from 72% (95% confidence interval [CI]=71%-74%) in 2005, when the national monitoring began, to 89% (CI.89%-90%) in 2009. Within one year after discharge, 1% of all registered patients had...

  13. A Hierarchal Risk Assessment Model Using the Evidential Reasoning Rule

    Directory of Open Access Journals (Sweden)

    Xiaoxiao Ji

    2017-02-01

    Full Text Available This paper aims to develop a hierarchical risk assessment model using the newly-developed evidential reasoning (ER rule, which constitutes a generic conjunctive probabilistic reasoning process. In this paper, we first provide a brief introduction to the basics of the ER rule and emphasize the strengths for representing and aggregating uncertain information from multiple experts and sources. Further, we discuss the key steps of developing the hierarchical risk assessment framework systematically, including (1 formulation of risk assessment hierarchy; (2 representation of both qualitative and quantitative information; (3 elicitation of attribute weights and information reliabilities; (4 aggregation of assessment information using the ER rule and (5 quantification and ranking of risks using utility-based transformation. The proposed hierarchical risk assessment framework can potentially be implemented to various complex and uncertain systems. A case study on the fire/explosion risk assessment of marine vessels demonstrates the applicability of the proposed risk assessment model.

  14. Development of Integrated Assessment Technology of Risk and Performance

    International Nuclear Information System (INIS)

    Yang, Jun Eon; Kang, Dae Il; Kang, Hyun Gook

    2010-04-01

    The main idea and contents are summarized as below 1) Development of new risk/performance assessment system innovating old labor-intensive risk assessment structure - New consolidated risk assessment technology from various hazard(flood, fire, seismic in NPP) - BOP model development for performance monitoring - Consolidated risk/performance management system for consistency and efficiency of NPP 2) Resolution technology for pending issues in PSA - Base technology for PSA of digital I and C system - Base technology for seismic PSA reflecting domestic seismic characteristics and aging effect - Uncertainty reduction technology for level 2 PSA and best estimation of containment failure frequency 3) Next generation risk/performance assessment technology - Human-induced error reduction technology for efficient operation of a NPP

  15. Risk assessment for federal regulatory decisions on organisms produced through biotechnology

    International Nuclear Information System (INIS)

    Payne, John H.; Medley, Terry L.

    1992-01-01

    This article discusses: 1. Purposes and history of risk assessment: application to biotechnology; 2. Framework in the United States for decisions on organisms produced through biotechnology; 3. Choosing from among potential approaches to assessment: a). exposure assessment does not equate to risk assessment: what are the hazards?; b). Setting risk assessment priorities; c). 'Quantitative' environmental and 'quantitative' ecological risk assessments; d). Ecological risk assessments based on biological and ecological principles. 4. The bases for good regulatory decisions

  16. Risk assessment for federal regulatory decisions on organisms produced through biotechnology

    Energy Technology Data Exchange (ETDEWEB)

    Payne, John H; Medley, Terry L [Biotechnology, Biologics and Environmental Protection Animal and Plant Health Inspection Service, U.S. Department of Agriculture, Hyattsville, MD (United States)

    1992-07-01

    This article discusses: 1. Purposes and history of risk assessment: application to biotechnology; 2. Framework in the United States for decisions on organisms produced through biotechnology; 3. Choosing from among potential approaches to assessment: a). exposure assessment does not equate to risk assessment: what are the hazards?; b). Setting risk assessment priorities; c). 'Quantitative' environmental and 'quantitative' ecological risk assessments; d). Ecological risk assessments based on biological and ecological principles. 4. The bases for good regulatory decisions.

  17. Model of MSD Risk Assessment at Workplace

    OpenAIRE

    K. Sekulová; M. Šimon

    2015-01-01

    This article focuses on upper-extremity musculoskeletal disorders risk assessment model at workplace. In this model are used risk factors that are responsible for musculoskeletal system damage. Based on statistic calculations the model is able to define what risk of MSD threatens workers who are under risk factors. The model is also able to say how MSD risk would decrease if these risk factors are eliminated.

  18. Explaining probalistic risk assessment in common language

    International Nuclear Information System (INIS)

    Wong, J.W.

    1994-01-01

    Probabilistic human health risk assessment is explained in ordinary language using a hypothetical example and the ingestion equation from EPA's Risk Assessment Guidance for Superfund. A section on understanding probabilities and probability distributions used in a Monte Carlo simulation is included as well as an appendix showing the computer run and the technical assumptions behind it

  19. Assessment and management of suicide risk in primary care.

    Science.gov (United States)

    Saini, Pooja; While, David; Chantler, Khatidja; Windfuhr, Kirsten; Kapur, Navneet

    2014-01-01

    Risk assessment and management of suicidal patients is emphasized as a key component of care in specialist mental health services, but these issues are relatively unexplored in primary care services. To examine risk assessment and management in primary and secondary care in a clinical sample of individuals who were in contact with mental health services and died by suicide. Data collection from clinical proformas, case records, and semistructured face-to-face interviews with general practitioners. Primary and secondary care data were available for 198 of the 336 cases (59%). The overall agreement in the rating of risk between services was poor (overall κ = .127, p = .10). Depression, care setting (after discharge), suicidal ideation at last contact, and a history of self-harm were associated with a rating of higher risk. Suicide prevention policies were available in 25% of primary care practices, and 33% of staff received training in suicide risk assessments. Risk is difficult to predict, but the variation in risk assessment between professional groups may reflect poor communication. Further research is required to understand this. There appears to be a relative lack of suicide risk assessment training in primary care.

  20. Competing risk theory and radiation risk assessment

    International Nuclear Information System (INIS)

    Groer, P.G.

    1980-01-01

    New statistical procedures are applied to estimate cumulative distribution functions (c.d.f.), force of mortality, and latent period for radiation-induced malignancies. It is demonstrated that correction for competing risks influences the shape of dose response curves, estimates of the latent period, and of the risk from ionizing radiations. The equivalence of the following concepts is demonstrated: force of mortality, hazard rate, and age or time specific incidence. This equivalence makes it possible to use procedures from reliability analysis and demography for radiation risk assessment. Two methods used by reliability analysts - hazard plotting and total time on test plots - are discussed in some detail and applied to characterize the hazard rate in radiation carcinogenesis. C.d.f.'s with increasing, decreasing, or constant hazard rate have different shapes and are shown to yield different dose-response curves for continuous irradiation. Absolute risk is shown to be a sound estimator only if the force of mortality is constant for the exposed and the control group. Dose-response relationships that use the absolute risk as a measure for the effect turn out to be special cases of dose-response relationships that measure the effect with cumulative incidence. (H.K.)

  1. Ecological models and pesticide risk assessment: current modeling practice.

    Science.gov (United States)

    Schmolke, Amelie; Thorbek, Pernille; Chapman, Peter; Grimm, Volker

    2010-04-01

    Ecological risk assessments of pesticides usually focus on risk at the level of individuals, and are carried out by comparing exposure and toxicological endpoints. However, in most cases the protection goal is populations rather than individuals. On the population level, effects of pesticides depend not only on exposure and toxicity, but also on factors such as life history characteristics, population structure, timing of application, presence of refuges in time and space, and landscape structure. Ecological models can integrate such factors and have the potential to become important tools for the prediction of population-level effects of exposure to pesticides, thus allowing extrapolations, for example, from laboratory to field. Indeed, a broad range of ecological models have been applied to chemical risk assessment in the scientific literature, but so far such models have only rarely been used to support regulatory risk assessments of pesticides. To better understand the reasons for this situation, the current modeling practice in this field was assessed in the present study. The scientific literature was searched for relevant models and assessed according to nine characteristics: model type, model complexity, toxicity measure, exposure pattern, other factors, taxonomic group, risk assessment endpoint, parameterization, and model evaluation. The present study found that, although most models were of a high scientific standard, many of them would need modification before they are suitable for regulatory risk assessments. The main shortcomings of currently available models in the context of regulatory pesticide risk assessments were identified. When ecological models are applied to regulatory risk assessments, we recommend reviewing these models according to the nine characteristics evaluated here. (c) 2010 SETAC.

  2. Risk Assessment and Risk Management in Offenders with Intellectual Disabilities: Are We There Yet?

    Science.gov (United States)

    Pouls, Claudia; Jeandarme, Inge

    2015-01-01

    Research on risk assessment and risk management in offenders with intellectual disabilities (OIDs), although far behind compared to the mainstream offender literature, is now expanding. The current review provides an overview of the predictive value of risk assessment and treatment outcome monitoring tools developed for both mainstream forensic…

  3. Managing industrial risk--having a tested and proven system to prevent and assess risk.

    Science.gov (United States)

    Heller, Stephen

    2006-03-17

    Some relatively easy techniques exist to improve the risk picture/profile to aid in preventing losses. Today with the advent of computer system resources, focusing on specific aspects of risk through systematic scoring and comparison, the risk analysis can be relatively easy to achieve. Techniques like these demonstrate how working experience and common sense can be combined mathematically into a flexible risk management tool or risk model for analyzing risk. The risk assessment methodology provided by companies today is no longer the ideas and practices of one group or even one company. It is reflective of the practice of many companies, as well as the ideas and expertise of academia and government regulators. The use of multi-criteria decision making (MCDM) techniques for making critical decisions has been recognized for many years for a variety of purposes. In today's computer age, the easy accessing and user-friendly nature for using these techniques, makes them a favorable choice for use in the risk assessment environment. The new user of these methodologies should find many ideas directly applicable to his or her needs when approaching risk decision making. The user should find their ideas readily adapted, with slight modification, to accurately reflect a specific situation using MCDM techniques. This makes them an attractive feature for use in assessment and risk modeling. The main advantage of decision making techniques, such as MCDM, is that in the early stages of a risk assessment, accurate data on industrial risk, and failures are lacking. In most cases, it is still insufficient to perform a thorough risk assessment using purely statistical concepts. The practical advantages towards deviating from strict data-driven protocol seem to outweigh the drawbacks. Industry failure data often comes at a high cost when a loss occurs. We can benefit from this unfortunate acquisition of data through the continuous refining of our decisions by incorporating this new

  4. Review of the Brunswick Steam Electric Plant Probabilistic Risk Assessment

    International Nuclear Information System (INIS)

    Sattison, M.B.; Davis, P.R.; Satterwhite, D.G.; Gilmore, W.E.; Gregg, R.E.

    1989-11-01

    A review of the Brunswick Steam Electric Plant probabilistic risk Assessment was conducted with the objective of confirming the safety perspectives brought to light by the probabilistic risk assessment. The scope of the review included the entire Level I probabilistic risk assessment including external events. This is consistent with the scope of the probabilistic risk assessment. The review included an assessment of the assumptions, methods, models, and data used in the study. 47 refs., 14 figs., 15 tabs

  5. Risk assessment for SAGD well blowouts

    Energy Technology Data Exchange (ETDEWEB)

    Worth, D.; Alhanati, F.; Lastiwka, M. [C-FER Technologies, Edmonton, AB (Canada); Crepin, S. [Petrocedeno, Caracas (Venezuela)

    2008-10-15

    This paper discussed a steam assisted gravity drainage (SAGD) pilot project currently being conducted in Venezuela's Orinoco Belt. A risk assessment was conducted as part of the pilot program in order to evaluate the use of single barrier completions in conjunction with a blowout response plan. The study considered 3 options: (1) an isolated double barrier completion with a downhole safety valve (DHSV) in the production tubing string and a packer in the production casing annulus; (2) a partially isolated completion with no DHSV and a packer in the production casing annulus; and (3) an open single barrier completion with no additional downhole barriers. A reservoir model was used to assess the blowout flowing potential of SAGD well pairs. The probability of a blowout was estimated using fault tree analysis techniques. Risk was determined for various blowout scenarios, including blowouts during normal and workover operations, as well as blowouts through various flow paths. Total risk for each completion scenario was also determined at 3 different time periods within the production life of the well pair. The possible consequences of a blowout were assessed using quantitative consequence models. Results of the study showed that environmental and economic risks were much higher for the open completion technique. Higher risks were also associated with the earlier life of the completion strings. 20 refs., 3 tabs., 19 figs.

  6. Human reliability assessment and probabilistic risk assessment

    International Nuclear Information System (INIS)

    Embrey, D.E.; Lucas, D.A.

    1989-01-01

    Human reliability assessment (HRA) is used within Probabilistic Risk Assessment (PRA) to identify the human errors (both omission and commission) which have a significant effect on the overall safety of the system and to quantify the probability of their occurrence. There exist a variey of HRA techniques and the selection of an appropriate one is often difficult. This paper reviews a number of available HRA techniques and discusses their strengths and weaknesses. The techniques reviewed include: decompositional methods, time-reliability curves and systematic expert judgement techniques. (orig.)

  7. Ethical aspects of the assessment of technical risks

    International Nuclear Information System (INIS)

    Birnbacher, D.

    1991-01-01

    When technology assessment goes over into technology politics, then questions arise which can only be answered in an ethical way. Questions like, which risk strategy has to be the basis for decision-making, and is a decision for or against the development, introduction or maintenance of a certain technology to be based at all on risk assessments? The author considers pure consequentialistic ethics the most plausible option, and does not see a basic difference in a risk-benefit analysis and ethical technology assessment. (DG) [de

  8. Assessing risk from intelligent attacks: A perspective on approaches

    International Nuclear Information System (INIS)

    Guikema, Seth D.; Aven, Terje

    2010-01-01

    Assessing the uncertainties in and severity of the consequences of intelligent attacks are fundamentally different from risk assessment for accidental events and other phenomena with inherently random failures. Intelligent attacks against a system involve adaptation on the part of the adversary. The probabilities of the initiating events depend on the risk management actions taken, and they may be more difficult to assess due to high degrees of epistemic uncertainty about the motivations and future actions of adversaries. Several fundamentally different frameworks have been proposed for assessing risk from intelligent attacks. These include basing risk assessment and management on game theoretic modelling of attacker actions, using a probabilistic risk analysis (PRA) approach based on eliciting probabilities of different initiating events from appropriate experts, assessing uncertainties beyond probabilities and expected values, and ignoring the probabilities of the attacks and choosing to protect highest valued targets. In this paper we discuss and compare the fundamental assumptions that underlie each of these approaches. We then suggest a new framework that makes the fundamental assumptions underlying the approaches clear to decision makers and presents them with a suite of results from conditional risk analysis methods. Each of the conditional methods presents the risk from a specified set of fundamental assumptions, allowing the decision maker to see the impacts of these assumptions on the risk management strategies considered and to weight the different conditional results with their assessments of the relative likelihood of the different sets of assumptions.

  9. Innovative human health and ecological risk assessment techniques at Hanford

    International Nuclear Information System (INIS)

    Clarke, S.; Jones, K.; Goller, E.

    1993-01-01

    The open-quotes Hanford Site Baseline Risk Assessment Methodologyclose quotes (HSBRAM) was developed to enhance the preparation of risk assessments supporting the Hanford site cleanup mission. This methodology satisfies a Hanford federal facility agreement and consent order (tri-party agreement) milestone and is used to evaluate the risk to human health and the environment under the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) and the Resource Conservation and Recovery Act (RCRA). The methodology was prepared by the Hanford Risk Assessment Committee (RAC) consisting of tri-party representatives: the U.S. Department of Energy, the State of Washington Department of Ecology, and the U.S. Environmental Protection Agency (EPA), with associated contractors. The risk assessment guidance provided by EPA is sufficiently general to permit tailoring of specific parameters to meet the risk assessment needs of individual sites. The RAC utilized EPA's Risk Assessment Guidance for Superfund, (RAGS) as the cornerstone of the HSBRAM. The RAC added necessary Hanford-specific elements to construct a complete risk assessment guidance for utilization as an independent document. The HSBRAM is a living document because the RAC charter emphasizes the importance of continued methodology reevaluation. The HSBRAM also provides guidelines for the application of EPA's open-quotes Framework for Ecological Risk Assessmentclose quotes to Hanford-specific environmental baseline risk assessments by including endangered and threatened species in addition to sensitive habitats potentially associated with the Hanford site and guidance for selection of ecotoxicological data. Separate negotiations for the selection of risk parameters for each operable unit were avoided by defining parameters in the HSBRAM. There are 78 past-practice operable units at Hanford requiring risk assessments

  10. DETERMINANTS OF RISK ASSESSMENT PROCESS IN CRITICAL ENERGY INFRASTRUCTURE

    Directory of Open Access Journals (Sweden)

    Przemysław Borkowski

    2016-06-01

    Full Text Available Article deals with the problem of risk assessment in critical energy infrastructure. Firstly the critical infrastructure in energy sector is discussed than risk identification methodology for application to critical infrastructure is proposed. Specific conditions resulting from features of critical infrastructure are addressed in the context of risk assessment procedure. The limits of such a procedure are outlined and critical factors influencing different stages of risk assessment process are researched in view of specificity of the sector.

  11. THE MODEL FOR RISK ASSESSMENT ERP-SYSTEMS INFORMATION SECURITY

    Directory of Open Access Journals (Sweden)

    V. S. Oladko

    2016-12-01

    Full Text Available The article deals with the problem assessment of information security risks in the ERP-system. ERP-system functions and architecture are studied. The model malicious impacts on levels of ERP-system architecture are composed. Model-based risk assessment, which is the quantitative and qualitative approach to risk assessment, built on the partial unification 3 methods for studying the risks of information security - security models with full overlapping technique CRAMM and FRAP techniques developed.

  12. Handling Interdependencies in Climate Change Risk Assessment

    Directory of Open Access Journals (Sweden)

    Richard J. Dawson

    2015-12-01

    Full Text Available Typically, a climate change risk assessment focuses on individual sectors or hazards. However, interdependencies between climate risks manifest themselves via functional, physical, geographical, economic, policy and social mechanisms. These can occur over a range of spatial or temporal scales and with different strengths of coupling. Three case studies are used to demonstrate how interdependencies can significantly alter the nature and magnitude of risk, and, consequently, investment priorities for adaptation. The three examples explore interdependencies that arise from (1 climate loading dependence; (2 mediation of two climate impacts by physical processes operating over large spatial extents; and, (3 multiple risks that are influenced by shared climatic and socio-economic drivers. Drawing upon learning from these case studies, and other work, a framework for the analysis and consideration of interdependencies in climate change risk assessment has been developed. This is an iterative learning loop that involves defining the system, scoping interaction mechanisms, applying appropriate modelling tools, identifying vulnerabilities and opportunities, and assessing the performance of adaptation interventions.

  13. Ethics of Risk. Kristin Shrader-Frechette's Philosophical Critique of Risk Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Heikkeroe, Topi [Univ. of Helsinki (Finland). Centre for Social Ethics

    2006-09-15

    This paper addresses risk assessment from a philosophical point of view. It presents and critically reviews the work of Kristin Shrader-Frechette. It introduces the ethical, epistemological, and methodological issues related to risk assessment. The paper focuses on the ethical questions of justice in risk decisions. It opens by framing the relationship between ethics and technology in the modern world. Then the paper turns to a brief description of risk assessment as a central method in technological decision making. It proceeds to show how Shrader-Frechette analyzes ethical and political aspects of risk assessment. The central argumentation In her critique follows RawIsian lines: distributive and participatory inequalities in creating technological constructions need to be justified. To clarify this requirement she formulates the Principle of Prima Facie Political Equity (PPFPE), which is her central tool in most of her ethical criticism, for instance, in relation to the future generations: prima facie. all generations should be treated equally. Brief critical remarks conclude the paper. They touch upon placing Shrader-Frechette's project on the academic chart and her liberal individualist anthropology.

  14. Environmental Risk Assessment Strategy for Nanomaterials

    Directory of Open Access Journals (Sweden)

    Janeck J. Scott‐Fordsmand

    2017-10-01

    Full Text Available An Environmental Risk Assessment (ERA for nanomaterials (NMs is outlined in this paper. Contrary to other recent papers on the subject, the main data requirements, models and advancement within each of the four risk assessment domains are described, i.e., in the: (i materials, (ii release, fate and exposure, (iii hazard and (iv risk characterisation domains. The material, which is obviously the foundation for any risk assessment, should be described according to the legislatively required characterisation data. Characterisation data will also be used at various levels within the ERA, e.g., exposure modelling. The release, fate and exposure data and models cover the input for environmental distribution models in order to identify the potential (PES and relevant exposure scenarios (RES and, subsequently, the possible release routes, both with regard to which compartment(s NMs are distributed in line with the factors determining the fate within environmental compartment. The initial outcome in the risk characterisation will be a generic Predicted Environmental Concentration (PEC, but a refined PEC can be obtained by applying specific exposure models for relevant media. The hazard information covers a variety of representative, relevant and reliable organisms and/or functions, relevant for the RES and enabling a hazard characterisation. The initial outcome will be hazard characterisation in test systems allowing estimating a Predicted No-Effect concentration (PNEC, either based on uncertainty factors or on a NM adapted version of the Species Sensitivity Distributions approach. The risk characterisation will either be based on a deterministic risk ratio approach (i.e., PEC/PNEC or an overlay of probability distributions, i.e., exposure and hazard distributions, using the nano relevant models.

  15. Environmental Risk Assessment Strategy for Nanomaterials.

    Science.gov (United States)

    Scott-Fordsmand, Janeck J; Peijnenburg, Willie J G M; Semenzin, Elena; Nowack, Bernd; Hunt, Neil; Hristozov, Danail; Marcomini, Antonio; Irfan, Muhammad-Adeel; Jiménez, Araceli Sánchez; Landsiedel, Robert; Tran, Lang; Oomen, Agnes G; Bos, Peter M J; Hund-Rinke, Kerstin

    2017-10-19

    An Environmental Risk Assessment (ERA) for nanomaterials (NMs) is outlined in this paper. Contrary to other recent papers on the subject, the main data requirements, models and advancement within each of the four risk assessment domains are described, i.e., in the: (i) materials, (ii) release, fate and exposure, (iii) hazard and (iv) risk characterisation domains. The material, which is obviously the foundation for any risk assessment, should be described according to the legislatively required characterisation data. Characterisation data will also be used at various levels within the ERA, e.g., exposure modelling. The release, fate and exposure data and models cover the input for environmental distribution models in order to identify the potential (PES) and relevant exposure scenarios (RES) and, subsequently, the possible release routes, both with regard to which compartment(s) NMs are distributed in line with the factors determining the fate within environmental compartment. The initial outcome in the risk characterisation will be a generic Predicted Environmental Concentration (PEC), but a refined PEC can be obtained by applying specific exposure models for relevant media. The hazard information covers a variety of representative, relevant and reliable organisms and/or functions, relevant for the RES and enabling a hazard characterisation. The initial outcome will be hazard characterisation in test systems allowing estimating a Predicted No-Effect concentration (PNEC), either based on uncertainty factors or on a NM adapted version of the Species Sensitivity Distributions approach. The risk characterisation will either be based on a deterministic risk ratio approach (i.e., PEC/PNEC) or an overlay of probability distributions, i.e., exposure and hazard distributions, using the nano relevant models.

  16. Transparent Global Seismic Hazard and Risk Assessment

    Science.gov (United States)

    Smolka, Anselm; Schneider, John; Pinho, Rui; Crowley, Helen

    2013-04-01

    Vulnerability to earthquakes is increasing, yet advanced reliable risk assessment tools and data are inaccessible to most, despite being a critical basis for managing risk. Also, there are few, if any, global standards that allow us to compare risk between various locations. The Global Earthquake Model (GEM) is a unique collaborative effort that aims to provide organizations and individuals with tools and resources for transparent assessment of earthquake risk anywhere in the world. By pooling data, knowledge and people, GEM acts as an international forum for collaboration and exchange, and leverages the knowledge of leading experts for the benefit of society. Sharing of data and risk information, best practices, and approaches across the globe is key to assessing risk more effectively. Through global projects, open-source IT development and collaborations with more than 10 regions, leading experts are collaboratively developing unique global datasets, best practice, open tools and models for seismic hazard and risk assessment. Guided by the needs and experiences of governments, companies and citizens at large, they work in continuous interaction with the wider community. A continuously expanding public-private partnership constitutes the GEM Foundation, which drives the collaborative GEM effort. An integrated and holistic approach to risk is key to GEM's risk assessment platform, OpenQuake, that integrates all above-mentioned contributions and will become available towards the end of 2014. Stakeholders worldwide will be able to calculate, visualise and investigate earthquake risk, capture new data and to share their findings for joint learning. Homogenized information on hazard can be combined with data on exposure (buildings, population) and data on their vulnerability, for loss assessment around the globe. Furthermore, for a true integrated view of seismic risk, users can add social vulnerability and resilience indices to maps and estimate the costs and benefits

  17. Environmental risk assessment system for phosphogypsum tailing dams.

    Science.gov (United States)

    Sun, Xin; Ning, Ping; Tang, Xiaolong; Yi, Honghong; Li, Kai; Zhou, Lianbi; Xu, Xianmang

    2013-01-01

    This paper may be of particular interest to the readers as it provides a new environmental risk assessment system for phosphogypsum tailing dams. In this paper, we studied the phosphogypsum tailing dams which include characteristics of the pollution source, environmental risk characteristics and evaluation requirements to identify the applicable environmental risk assessment methods. Two analytical methods, that is, the analytic hierarchy process (AHP) and fuzzy logic, were used to handle the complexity of the environmental and nonquantitative data. Using our assessment method, different risk factors can be ranked according to their contributions to the environmental risk, thereby allowing the calculation of their relative priorities during decision making. Thus, environmental decision-makers can use this approach to develop alternative management strategies for proposed, ongoing, and completed PG tailing dams.

  18. The use of comparative risk assessment in decision making

    International Nuclear Information System (INIS)

    Chicken, J.C.; Hayns, M.R.; Tolley, B.

    1989-01-01

    This paper justifies: 1) Comparative risk assessment provides a way of establishing whether or not the risks associated with a novel proposal are likely to satisfy current norms. 2) Comparative risk assessment is an aid to decision making when for some reason there is inadequate quantitative data about the risks associated with a project. 3) One problem is that there is no single universally acceptable norm. Norms vary both with time and from activity to activity. The spread of acceptable norms spans at least two orders of magnitude. 4) For any comparative risk assessment to be considered more than a suggestion on how acceptable a risk is, the risks that are compared must be similar and located in similar cultural and geographical environments. 5) Ulitmately justification of the acceptability of a project must be based on data generated directly by the project itself and any opinion based on comparative evidence must be iteratively revised as direct hard evidence becomes available. 6) Comparative risk assessment has a useful role in presentations to the lay public about the acceptability of a particular risk. 7) There may be more problems in making a comparative assessment of risk acceptability in socio-political terms than in technical or economic terms. The central requirement that the comparison must be based on data from similar cultural backgrounds is often hard to satisfy in relation to socio-political considerations

  19. Assessing risk of draft survey by AHP method

    Science.gov (United States)

    Xu, Guangcheng; Zhao, Kuimin; Zuo, Zhaoying; Liu, Gang; Jian, Binguo; Lin, Yan; Fan, Yukun; Wang, Fei

    2018-04-01

    The paper assesses the risks of vessel floating in the seawater for draft survey by using the analytic hierarchy process. On this basis, the paper established draft survey risk index from the view of draft reading, ballast water, fresh water, and calculation process and so on. Then the paper proposes the method to deal with risk assessment using one concrete sample.

  20. Safety analysis and risk assessment handbook

    International Nuclear Information System (INIS)

    Peterson, V.L.; Colwell, R.G.; Dickey, R.L.

    1997-01-01

    This Safety Analysis and Risk Assessment Handbook (SARAH) provides guidance to the safety analyst at the Rocky Flats Environmental Technology Site (RFETS) in the preparation of safety analyses and risk assessments. Although the older guidance (the Rocky Flats Risk Assessment Guide) continues to be used for updating the Final Safety Analysis Reports developed in the mid-1980s, this new guidance is used with all new authorization basis documents. With the mission change at RFETS came the need to establish new authorization basis documents for its facilities, whose functions had changed. The methodology and databases for performing the evaluations that support the new authorization basis documents had to be standardized, to avoid the use of different approaches and/or databases for similar accidents in different facilities. This handbook presents this new standardized approach. The handbook begins with a discussion of the requirements of the different types of authorization basis documents and how to choose the one appropriate for the facility to be evaluated. It then walks the analyst through the process of identifying all the potential hazards in the facility, classifying them, and choosing the ones that need to be analyzed further. It then discusses the methods for evaluating accident initiation and progression and covers the basic steps in a safety analysis, including consequence and frequency binning and risk ranking. The handbook lays out standardized approaches for determining the source terms of the various accidents (including airborne release fractions, leakpath factors, etc.), the atmospheric dispersion factors appropriate for Rocky Flats, and the methods for radiological and chemical consequence assessments. The radiological assessments use a radiological open-quotes templateclose quotes, a spreadsheet that incorporates the standard values of parameters, whereas the chemical assessments use the standard codes ARCHIE and ALOHA

  1. Selective critique of risk assessments with recommendations for improving methodology and practise

    International Nuclear Information System (INIS)

    Aven, Terje

    2011-01-01

    Risk assessments are often criticised for defending activities that could harm the environment and human health. The risk assessments produce numbers which are used to prove that the risk associated with the activity is acceptable. In this way, risk assessments seem to be a tool generally serving business. Government agencies have based their regulations on the use of risk assessment and the prevailing practise is supported by the regulations. In this paper, we look more closely into this critique. Are risk assessments being misused or are risk assessments simply not a suitable tool for guiding decision-making in the face of risks and uncertainties? Is the use of risk assessments not servicing public interests? We argue that risk assessments may provide useful decision support but the quality of the risk assessments and the associated risk assessment processes need to be improved. In this paper, three main improvement areas (success factors) are identified and discussed: (1) the scientific basis of the risk assessments needs to be strengthened, (2) the risk assessments need to provide a much broader risk picture than what is typically the case today. Separate uncertainty analyses should be carried out, extending the traditional probabilistic-based analyses and (3) the cautionary and precautionary principles need to be seen as rational risk management approaches, and their application would, to a large extent, be based on risk and uncertainty assessments.

  2. Bayesian Networks for enterprise risk assessment

    Science.gov (United States)

    Bonafede, C. E.; Giudici, P.

    2007-08-01

    According to different typologies of activity and priority, risks can assume diverse meanings and it can be assessed in different ways. Risk, in general, is measured in terms of a probability combination of an event (frequency) and its consequence (impact). To estimate the frequency and the impact (severity) historical data or expert opinions (either qualitative or quantitative data) are used. Moreover, qualitative data must be converted in numerical values or bounds to be used in the model. In the case of enterprise risk assessment the considered risks are, for instance, strategic, operational, legal and of image, which many times are difficult to be quantified. So in most cases only expert data, gathered by scorecard approaches, are available for risk analysis. The Bayesian Networks (BNs) are a useful tool to integrate different information and in particular to study the risk's joint distribution by using data collected from experts. In this paper we want to show a possible approach for building a BN in the particular case in which only prior probabilities of node states and marginal correlations between nodes are available, and when the variables have only two states.

  3. Documentation design for probabilistic risk assessment

    International Nuclear Information System (INIS)

    Parkinson, W.J.; von Herrmann, J.L.

    1985-01-01

    This paper describes a framework for documentation design of probabilistic risk assessment (PRA) and is based on the EPRI document NP-3470 ''Documentation Design for Probabilistic Risk Assessment''. The goals for PRA documentation are stated. Four audiences are identified which PRA documentation must satisfy, and the documentation consistent with the needs of the various audiences are discussed, i.e., the Summary Report, the Executive Summary, the Main Report, and Appendices. The authors recommend the documentation specifications discussed herein as guides rather than rigid definitions

  4. Risk assessment, session 1-4. International conference 1992. Part 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1992-07-01

    The international conference on Risk Assessment, 5-9 October 1992, London was organised by the Health and Safety Commission of the UK and co-sponsored by a number of regional and international organizations namely: the European Commission, the ILO, the OECD and WHO. The main sessions of the conference cover what risk assessment means, the role of risk assessment in devising policies and regulations; and risk assessment in practice.

  5. Risk assessment, session 1-4. International conference 1992. Part 1

    International Nuclear Information System (INIS)

    1992-01-01

    The international conference on Risk Assessment, 5-9 October 1992, London was organised by the Health and Safety Commission of the UK and co-sponsored by a number of regional and international organizations namely: the European Commission, the ILO, the OECD and WHO. The main sessions of the conference cover what risk assessment means, the role of risk assessment in devising policies and regulations; and risk assessment in practice

  6. An employee/trade union perspective to risk assessment

    International Nuclear Information System (INIS)

    Aro, Pekka O.

    1992-01-01

    Risk assessment does not easily lend itself to precise description. In some of its current forms of application, it is little more than a modern way of throwing bones or looking at tea leaves or the entrails of sheep, like our ancestors used to do not so many centuries ago (the only real difference being perhaps that laboratory rats are cheaper and less messy than sheep). A its best, however, risk assessment can be used as a good tool to identify the needs for changes required to reduce hazards and to prevent accidents to humans or damage to the environment. This paper approaches risk assessment as a tool, highlighting the need and usefulness as well as the right of employees and their representatives to participate in all the steps involved in assessing the risks of the workplace and its environment

  7. ILO activities in the field of risk assessment

    Energy Technology Data Exchange (ETDEWEB)

    Pinnagoda, C [Occupational Safety and Health Branch, Working Conditions and Environment Department, International Labor Organization, Geneva (Switzerland)

    1992-07-01

    Control of chemical risks has become a matter of increasing concern for the occupational safety and health activities of the ILO. Its chemical safety programme focuses attention on a series of comprehensive measures to promote national level action for effective control of chemical risks aimed at the protection of workers and consequently of the general public. The supply and use of information based on risk assessment for exposure control and the application of practical improvement measures through improved risk management and training continue to receive increasing importance. The important and direct role of employers and workers in the assessment of risks and planning and implementation of workplace improvements is an identified need. Risk assessment is a component of the chemical safety programme of the ILO that places significant emphasis on: the setting of international standards that lay down basic principles in chemical risk assessment and control; national level action to promote coherent policies and programmes on safety in the use of chemicals and prevention of industrial disasters (major hazard control); technical advisory services through the development of guides and training programmes that focus on workplace participatory approaches; collection and dissemination of practical information; and technical co-operation assistance to developing countries.

  8. ILO activities in the field of risk assessment

    International Nuclear Information System (INIS)

    Pinnagoda, C.

    1992-01-01

    Control of chemical risks has become a matter of increasing concern for the occupational safety and health activities of the ILO. Its chemical safety programme focuses attention on a series of comprehensive measures to promote national level action for effective control of chemical risks aimed at the protection of workers and consequently of the general public. The supply and use of information based on risk assessment for exposure control and the application of practical improvement measures through improved risk management and training continue to receive increasing importance. The important and direct role of employers and workers in the assessment of risks and planning and implementation of workplace improvements is an identified need. Risk assessment is a component of the chemical safety programme of the ILO that places significant emphasis on: the setting of international standards that lay down basic principles in chemical risk assessment and control; national level action to promote coherent policies and programmes on safety in the use of chemicals and prevention of industrial disasters (major hazard control); technical advisory services through the development of guides and training programmes that focus on workplace participatory approaches; collection and dissemination of practical information; and technical co-operation assistance to developing countries

  9. Uncertainties in risk assessment and decision making

    International Nuclear Information System (INIS)

    Starzec, Peter; Purucker, Tom; Stewart, Robert

    2008-02-01

    The general concept for risk assessment in accordance with the Swedish model for contaminated soil implies that the toxicological reference value for a given receptor is first back-calculated to a corresponding concentration of a compound in soil and (if applicable) then modified with respect to e.g. background levels, acute toxicity, and factor of safety. This result in a guideline value that is subsequently compared to the observed concentration levels. Many sources of uncertainty exist when assessing whether the risk for a receptor is significant or not. In this study, the uncertainty aspects have been addressed from three standpoints: 1. Uncertainty in the comparison between the level of contamination (source) and a given risk criterion (e.g. a guideline value) and possible implications on subsequent decisions. This type of uncertainty is considered to be most important in situations where a contaminant is expected to be spatially heterogeneous without any tendency to form isolated clusters (hotspots) that can be easily delineated, i.e. where mean values are appropriate to compare to the risk criterion. 2. Uncertainty in spatial distribution of a contaminant. Spatial uncertainty should be accounted for when hotspots are to be delineated and the volume of soil contaminated with levels above a stated decision criterion has to be assessed (quantified). 3. Uncertainty in an ecological exposure model with regard to the moving pattern of a receptor in relation to spatial distribution of contaminant in question. The study points out that the choice of methodology to characterize the relation between contaminant concentration and a pre-defined risk criterion is governed by a conceptual perception of the contaminant's spatial distribution and also depends on the structure of collected data (observations). How uncertainty in transition from contaminant concentration into risk criterion can be quantified was demonstrated by applying hypothesis tests and the concept of

  10. Evaluation of a constipation risk assessment scale.

    Science.gov (United States)

    Zernike, W; Henderson, A

    1999-06-01

    This project was undertaken in order to evaluate the utility of a constipation risk assessment scale and the accompanying bowel management protocol. The risk assessment scale was primarily introduced to teach and guide staff in managing constipation when caring for patients. The intention of the project was to reduce the incidence of constipation in patients during their admission to hospital.

  11. The impact of the human genome project on risk assessment

    International Nuclear Information System (INIS)

    Katarzyna Doerffer; Paul Unrau.

    1996-01-01

    The radiation protection approach to risk assessment assumes that cancer induction following radiation exposure is purely random. Present risk assessment methods derive risk from cancer incidence frequencies in exposed populations and associate disease outcomes totally with the level of exposure to ionizing red aeon. Exposure defines a risk factor that affects the probability of the disease outcome. But cancer risk can be affected by other risk factors such as underlying genetic factors (predisposition) of the exposed organism. These genetic risk factors are now becoming available for incorporation into ionizing radiation risk assessment Progress in the Human Genome Project (HOP) will lead to direct assays to measure the effects of genetic risk determinants in disease outcomes. When all genetic risk determinants are known and incorporated into risk assessment it will be possible to reevaluate the role of ionizing radiation in the causation of cancer. (author)

  12. Integrating human behaviour dynamics into flood disaster risk assessment

    Science.gov (United States)

    Aerts, J. C. J. H.; Botzen, W. J.; Clarke, K. C.; Cutter, S. L.; Hall, J. W.; Merz, B.; Michel-Kerjan, E.; Mysiak, J.; Surminski, S.; Kunreuther, H.

    2018-03-01

    The behaviour of individuals, businesses, and government entities before, during, and immediately after a disaster can dramatically affect the impact and recovery time. However, existing risk-assessment methods rarely include this critical factor. In this Perspective, we show why this is a concern, and demonstrate that although initial efforts have inevitably represented human behaviour in limited terms, innovations in flood-risk assessment that integrate societal behaviour and behavioural adaptation dynamics into such quantifications may lead to more accurate characterization of risks and improved assessment of the effectiveness of risk-management strategies and investments. Such multidisciplinary approaches can inform flood-risk management policy development.

  13. Historical relationship between performance assessment for radioactive waste disposal and other types of risk assessment

    International Nuclear Information System (INIS)

    Rechard, R.P.

    1999-01-01

    This article describes the evolution of the process for assessing the hazards of a geologic disposal system for radioactive waste and, similarly, nuclear power reactors, and the relationship of this process with other assessments of risk, particularly assessments of hazards from manufactured carcinogenic chemicals during use and disposal. This perspective reviews the common history of scientific concepts for risk assessment developed until the 1950s. Computational tools and techniques developed in the late 1950s and early 1960s to analyze the reliability of nuclear weapon delivery systems were adopted in the early 1970s for probabilistic risk assessment of nuclear power reactors, a technology for which behavior was unknown. In turn, these analyses became an important foundation for performance assessment of nuclear waste disposal in the late 1970s. The evaluation of risk to human health and the environment from chemical hazards is built on methods for assessing the dose response of radionuclides in the 1950s. Despite a shared background, however, societal events, often in the form of legislation, have affected the development path for risk assessment for human health, producing dissimilarities between these risk assessments and those for nuclear facilities. An important difference is the regulator's interest in accounting for uncertainty

  14. Uncertainty in ecological risk assessment: A statistician's view

    International Nuclear Information System (INIS)

    Smith, E.P.

    1995-01-01

    Uncertainty is a topic that has different meanings to researchers, modelers, managers and policy makers. The perspective of this presentation will be on the modeling view of uncertainty and its quantitative assessment. The goal is to provide some insight into how a statistician visualizes and addresses the issue of uncertainty in ecological risk assessment problems. In ecological risk assessment, uncertainty arises from many sources and is of different type depending on what is studies, where it is studied and how it is studied. Some major sources and their impact are described. A variety of quantitative approaches to modeling uncertainty are characterized and a general taxonomy given. Examples of risk assessments of lake acidification, power plant impact assessment and the setting of standards for chemicals will be used discuss approaches to quantitative assessment of uncertainty and some of the potential difficulties

  15. Risk assessment: A European Community perspective

    International Nuclear Information System (INIS)

    Haigh, R.

    1992-01-01

    The world is a risky place in which to live! The world tolerates that 750,000 deaths occur on the roads each year. Society has not yet come to terms with the added burden that urbanisation brings to developing countries. Pollution from the use of fossil fuels creates incalculable loss to the world's environment and to the health of its inhabitants. The misuse of chemicals provokes suffering and deformity. In the European Community alone, over 21 million tonnes of toxic waste have to be treated each year. Of course, there are different types of risk: individual and societal. Individuals continue to travel by air in defiance of terrorists or faulty machinery. Whilst society urges caution in diet and nutrition, the individual is probably more worried about food additives that he is about eating too much or making a rigorous appraisal of the value of his die!. As the conference progresses many people will die from the causes of malnutrition, from war or societal neglect while we, individually, will be more at risk from overeating. In other words, we perceive risks is in a multitude of ways. We tolerate these risks according to our perception of what we feel is acceptable without carrying out scientific assessment of the relative severity of those risks. If applied at a governmental level, this subjective tolerance can lead to unnecessary burdens or constraints that are disproportionate to the risk. Clearly, this is not acceptable for policy makers. We have just seen the closure of the UNCED World Conference on the Environment in Rio de Janeiro, where the absolute need for more effective cooperation in the protection of the environment and the world inhabitants was convincingly demonstrated. The European Communities already coordinate risk assessment with its twelve Member States in a large number of areas and is increasing its international cooperation. We have recognized that it is no longer possible to carry out effective risk assessment in one country alone or to

  16. Risk assessment: A European Community perspective

    Energy Technology Data Exchange (ETDEWEB)

    Haigh, R [Industrial Medicine and Hygiene Unit Health and Safety Directorate, Directorate-General Employment, Industrial Relations and Social Affairs Commission of the European Communities, Luxembourg (Luxembourg)

    1992-07-01

    The world is a risky place in which to live{exclamation_point} The world tolerates that 750,000 deaths occur on the roads each year. Society has not yet come to terms with the added burden that urbanisation brings to developing countries. Pollution from the use of fossil fuels creates incalculable loss to the world's environment and to the health of its inhabitants. The misuse of chemicals provokes suffering and deformity. In the European Community alone, over 21 million tonnes of toxic waste have to be treated each year. Of course, there are different types of risk: individual and societal. Individuals continue to travel by air in defiance of terrorists or faulty machinery. Whilst society urges caution in diet and nutrition, the individual is probably more worried about food additives that he is about eating too much or making a rigorous appraisal of the value of his die{exclamation_point}. As the conference progresses many people will die from the causes of malnutrition, from war or societal neglect while we, individually, will be more at risk from overeating. In other words, we perceive risks is in a multitude of ways. We tolerate these risks according to our perception of what we feel is acceptable without carrying out scientific assessment of the relative severity of those risks. If applied at a governmental level, this subjective tolerance can lead to unnecessary burdens or constraints that are disproportionate to the risk. Clearly, this is not acceptable for policy makers. We have just seen the closure of the UNCED World Conference on the Environment in Rio de Janeiro, where the absolute need for more effective cooperation in the protection of the environment and the world inhabitants was convincingly demonstrated. The European Communities already coordinate risk assessment with its twelve Member States in a large number of areas and is increasing its international cooperation. We have recognized that it is no longer possible to carry out effective risk

  17. 78 FR 3824 - Draft Qualitative Risk Assessment of Risk of Activity/Food Combinations for Activities (Outside...

    Science.gov (United States)

    2013-01-16

    .... FDA-2012-N-1258] Draft Qualitative Risk Assessment of Risk of Activity/Food Combinations for... entitled ``Draft Qualitative Risk Assessment of Risk of Activity/Food Combinations for Activities (Outside... defined in the regulation promulgated under section 418(n) of the FD&C Act. II. Qualitative Risk...

  18. Quantitative Microbial Risk Assessment Tutorial - Primer

    Science.gov (United States)

    This document provides a Quantitative Microbial Risk Assessment (QMRA) primer that organizes QMRA tutorials. The tutorials describe functionality of a QMRA infrastructure, guide the user through software use and assessment options, provide step-by-step instructions for implementi...

  19. [Patient safety in antibiotics administration: Risk assessment].

    Science.gov (United States)

    Maqueda Palau, M; Pérez Juan, E

    To determine the level of risk in the preparation and administration of antibiotics frequently used in the Intensive Care Unit using a risk matrix. A study was conducted using situation analysis and literature review of databases, protocols and good practice guidelines on intravenous therapy, drugs, and their administration routes. The most used antibiotics in the ICU registered in the ENVIN-HELICS program from 1 April to 30 June 2015 were selected. In this period, 257 patients received antimicrobial treatment and 26 antibiotics were evaluated. Variables studied: A risk assessment of each antibiotic using the scale Risk Assessment Tool, of the National Patient Safety Agency, as well as pH, osmolarity, type of catheter recommended for administration, and compatibility and incompatibility with other antibiotics studied. Almost two-thirds (65.3%) of antibiotics had more than 3 risk factors (represented by a yellow stripe), with the remaining 34.7% of antibiotics having between 0 and 2 risk factors (represented by a green stripe). There were no antibiotics with 6 or more risk factors (represented by a red stripe). Most drugs needed reconstitution, additional dilution, and the use of part of the vial to administer the prescribed dose. More than half of the antibiotics studied had a moderate risk level; thus measures should be adopted in order to reduce it. The risk matrix is a useful tool for the assessment and detection of weaknesses associated with the preparation and administration of intravenous antibiotics. Copyright © 2016 SECA. Publicado por Elsevier España, S.L.U. All rights reserved.

  20. Assessing human health risk in the USDA forest service

    Energy Technology Data Exchange (ETDEWEB)

    Hamel, D.R. [Department of Agriculture-Forest Service, Washington, DC (United States)

    1990-12-31

    This paper identifies the kinds of risk assessments being done by or for the US Department of Agriculture (USDA) Forest Service. Summaries of data sources currently in use and the pesticide risk assessments completed by the agency or its contractors are discussed. An overview is provided of the agency`s standard operating procedures for the conduct of toxicological, ecological, environmental fate, and human health risk assessments.

  1. Personalized risk communication for personalized risk assessment: Real world assessment of knowledge and motivation for six mortality risk measures from an online life expectancy calculator.

    Science.gov (United States)

    Manuel, Douglas G; Abdulaziz, Kasim E; Perez, Richard; Beach, Sarah; Bennett, Carol

    2018-01-01

    In the clinical setting, previous studies have shown personalized risk assessment and communication improves risk perception and motivation. We evaluated an online health calculator that estimated and presented six different measures of life expectancy/mortality based on a person's sociodemographic and health behavior profile. Immediately after receiving calculator results, participants were invited to complete an online survey that asked how informative and motivating they found each risk measure, whether they would share their results and whether the calculator provided information they need to make lifestyle changes. Over 80% of the 317 survey respondents found at least one of six healthy living measures highly informative and motivating, but there was moderate heterogeneity regarding which measures respondents found most informative and motivating. Overall, health age was most informative and life expectancy most motivating. Approximately 40% of respondents would share the results with their clinician (44%) or social networks (38%), although the information they would share was often different from what they found informative or motivational. Online personalized risk assessment allows for a more personalized communication compared to historic paper-based risk assessment to maximize knowledge and motivation, and people should be provided a range of risk communication measures that reflect different risk perspectives.

  2. A review of probabilistic risk assessment of contaminated land

    International Nuclear Information System (INIS)

    Oeberg, T.; Bergbaeck, B.

    2005-01-01

    Background, Aims and Scope. The management and decisions concerning restoration of contaminated land often require indepth risk analyses. An environmental risk assessment is generally described as proceeding in four separate steps: hazard identification, dose-response assessment, exposure assessment, and risk characterization. The risk assessment should acknowledge and quantify the uncertainty in risk predictions. This can be achieved by applying probabilistic methods which, although they have been available for many years, are still not generally used. Risk assessment of contaminated land is an area where probabilistic methods have proved particularly useful. Many reports have appeared in the literature, mostly by North American researchers. The aim of this review is to summarize the experience gained so far, provide a number of useful examples, and suggest what may be done to promote probabilistic methods in Europe and the rest of the world. Methods. The available literature has been explored through searches in the major scientific and technical databases, WWW resources, textbooks and direct contacts with active researchers. A calculation example was created using standard simulation software. (orig.)

  3. Assessing reservoir performance risk in CO2 storage projects

    International Nuclear Information System (INIS)

    Bowden, A.R.; Rigg, A.

    2005-01-01

    One of the main issues for researchers involved with geological storage of carbon dioxide (CO 2 ) has been the development of a proper methodology to assess and compare alternative CO 2 injection projects on the basis of risk. Consideration needs to be given to technical aspects, such as the risk of leakage and the effectiveness of the intended reservoir, as well as less tangible aspects such as the value and safety of geological storage of CO 2 , and potential impacts on the community and environment. The Geological Disposal of Carbon Dioxide (GEODISC), was a research program of the Australian Petroleum Cooperative Research Centre which identified 56 potential environmentally sustainable sites for CO 2 injection (ESSCIs) within Australia. Several studies were carried out, involving detailed evaluation of the suitability of 4 selected sites, including Dongara, Petrel, Gippsland and Carnarvon. The GEODISC program included a risk assessment research module which required a complete and quantified risk assessment of CO 2 injection as a storage option. Primary goals were to assess the risk of leakage, to assess the effectiveness of the intended reservoir, and to assess negative consequences to facilitate comparison of alternative sites. This paper discussed the background and risk assessment model. Key performance indicators (KPIs) were also developed to address the purpose of risk assessment. It was concluded that the RISQUE method is an appropriate approach and that potential injection projects can be measured against six KPIs including containment; effectiveness; self-funding potential; wider community benefits; community safety and community amenity. 6 refs., 3 tabs., 3 figs

  4. Model based risk assessment - the CORAS framework

    Energy Technology Data Exchange (ETDEWEB)

    Gran, Bjoern Axel; Fredriksen, Rune; Thunem, Atoosa P-J.

    2004-04-15

    Traditional risk analysis and assessment is based on failure-oriented models of the system. In contrast to this, model-based risk assessment (MBRA) utilizes success-oriented models describing all intended system aspects, including functional, operational and organizational aspects of the target. The target models are then used as input sources for complementary risk analysis and assessment techniques, as well as a basis for the documentation of the assessment results. The EU-funded CORAS project developed a tool-supported methodology for the application of MBRA in security-critical systems. The methodology has been tested with successful outcome through a series of seven trial within the telemedicine and ecommerce areas. The CORAS project in general and the CORAS application of MBRA in particular have contributed positively to the visibility of model-based risk assessment and thus to the disclosure of several potentials for further exploitation of various aspects within this important research field. In that connection, the CORAS methodology's possibilities for further improvement towards utilization in more complex architectures and also in other application domains such as the nuclear field can be addressed. The latter calls for adapting the framework to address nuclear standards such as IEC 60880 and IEC 61513. For this development we recommend applying a trial driven approach within the nuclear field. The tool supported approach for combining risk analysis and system development also fits well with the HRP proposal for developing an Integrated Design Environment (IDE) providing efficient methods and tools to support control room systems design. (Author)

  5. A Single Conjunction Risk Assessment Metric: the F-Value

    Science.gov (United States)

    Frigm, Ryan Clayton; Newman, Lauri K.

    2009-01-01

    The Conjunction Assessment Team at NASA Goddard Space Flight Center provides conjunction risk assessment for many NASA robotic missions. These risk assessments are based on several figures of merit, such as miss distance, probability of collision, and orbit determination solution quality. However, these individual metrics do not singly capture the overall risk associated with a conjunction, making it difficult for someone without this complete understanding to take action, such as an avoidance maneuver. The goal of this analysis is to introduce a single risk index metric that can easily convey the level of risk without all of the technical details. The proposed index is called the conjunction "F-value." This paper presents the concept of the F-value and the tuning of the metric for use in routine Conjunction Assessment operations.

  6. A survey of ecological risk assessment at DOE facilities

    International Nuclear Information System (INIS)

    Barnthouse, L.W.; Bascietto, J.; Joseph, T.; Bilyard, G.

    1992-01-01

    The US Department of Energy (DOE) Risk-Based Standards Working Group is studying standard-setting and remedial action based on realistic estimates of human health and ecological risks. Federal and state regulations require DOE to assess ecological risks due to present and past operation of DOE facilities and ecological damage caused by remedial actions. Unfortunately, little technical guidance has been provided by regulatory agencies about how these assessments should be performed or what constitutes an adequate assessment. Active ecological research, environmental characterization, and ecological risk assessment programs are already underway at many locations. Some of these programs were established more than 30 years ago. Because of the strength of its existing programs and the depth of expertise available within the DOE complex, the agency is in a position to lead in developing ecological risk assessment procedures that are fully consistent with the general principles defined by EPA and that will ensure environmentally sound and cost-effective restoration of its sites. As a prelude to guidance development, the working group conducted a survey of ecological risk assessment activities at a subset of major DOE facilities. The survey was intended to (1) identify approaches now being used in ecological risk assessments performed by DOE staff and contractors at each site, (2) record successes and failures of these approaches, (3) identify new technical developments with potential for general application to many DOE facilities, and (4) identify major data needs, data resources, and methodological deficiencies

  7. Reinforcement of qualitative risk assessment proposals from computer science

    International Nuclear Information System (INIS)

    Friedlhuber, T.; Hibti, M.; Rauzy, A.

    2013-01-01

    During the last decade a lot of research has been made to evaluate concepts and methos of quantitative risk assessment in order to predict hazards more precisely. Nevertheless, the occurrence of new catastrophes like the Indonesian Tsunami in 2004, the Deepwater Horizon accident in 2010 or recently the Fukushima accidents in 2011 raise the question whether we may underestimate some natural limits of annotative risk assessment or even mistake its significance. Especially in the case of very unlikely events, in combination with uncertainty and severe consequences, may be we would do better to concentrate more on understanding risk than on calculating probability values. In this paper we apply progresses, made in the field of computer science, to tools and modelling concepts used in risk assessment. Regarding computer science, we point out now concepts, that may improve the quality of risk models and the process of model engineering. The goal is to reinforce the importance of qualitative risk assessment with the help of sophisticated tools and modelling. Qualitative risk assessment aims to understand risk and therefore reflects the initial idea of risk assessment. Risk understanding requires understanding systems and relations of components. It is fundamental to comprehend the meaning of components in fault- and event trees, to retrace all applied modifications and to highlight critical aspects. It is important how PSA models are visualized, documented, navigated, how results are presented and how model maintenance, integration and version control are performed. Also, the conjoint usage of different type of models (for example PSA models together with event sequence diagrams) can contribute to quality assurance. We present new concepts for various kind of problems. (author)

  8. Hazard waste risk assessment

    International Nuclear Information System (INIS)

    Hawley, K.A.; Napier, B.A.

    1986-01-01

    Pacific Northwest Laboratory continued to provide technical assistance to the Department of Energy (DOE) Office of Operational Safety (OOS) in the area of risk assessment for hazardous and radioactive-mixed waste management. The overall objective is to provide technical assistance to OOS in developing cost-effective risk assessment tools and strategies for bringing DOE facilities into compliance with the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA or Superfund) and the Resource Conservation and Recovery Act (RCRA). Major efforts during FY 1985 included (1) completing the modification of the Environmental Protection Agency (EPA) Hazard Ranking System (HRS) and developing training manuals and courses to assist in field office implementation of the modified Hazard Ranking System (mHRS); (2) initiating the development of a system for reviewing field office HRS/mHRS evaluations for appropriate use of data and appropriate application of the methodology; (3) initiating the development of a data base management system to maintain all field office HRS/mHRS scoring sheets and to support the master OOS environmental data base system; (4) developing implementation guidance for Phase I of the DOE CERCLA Program, Installation Assessment; (5) continuing to develop an objective, scientifically based methodology for DOE management to use in establishing priorities for conducting site assessments under Phase II of the DOE CERCLA Program, Confirmation; and (6) participating in developing the DOE response to EPA on the proposed listing of three sites on the National Priorities List

  9. Information security risk assessment, aggregation, and mitigation

    NARCIS (Netherlands)

    Lenstra, A.K.; Voss, T.; Wang, H.; Pieprzyk, J.; Varadharajan, V.

    2004-01-01

    As part of their compliance process with the Basel 2 operational risk management requirements, banks must define how they deal with information security risk management. In this paper we describe work in progress on a new quantitative model to assess and aggregate information security risks that is

  10. Assessment of health risks caused by air pollutants

    International Nuclear Information System (INIS)

    Nilsson, Robert.

    1991-02-01

    This report is a support document to an other report from the Swedish Environmental Protection Agency 'Risk assessment - a research programme aimed at health risks from air pollution in the general environment', report 3890, 1991 and is a survey of the scientific 'state of the art' in the different parts of risk assessment. Furthermore certain proposals are made concerning the scientific content of the future research in this area. (au)

  11. Environmental Risk Assessment System for Phosphogypsum Tailing Dams

    OpenAIRE

    Xin Sun; Ping Ning; Xiaolong Tang; Honghong Yi; Kai Li; Lianbi Zhou; Xianmang Xu

    2013-01-01

    This paper may be of particular interest to the readers as it provides a new environmental risk assessment system for phosphogypsum tailing dams. In this paper, we studied the phosphogypsum tailing dams which include characteristics of the pollution source, environmental risk characteristics and evaluation requirements to identify the applicable environmental risk assessment methods. Two analytical methods, that is, the analytic hierarchy process (AHP) and fuzzy logic, were used to handle the...

  12. Risks, risk assessment and risk competence in toxicology.

    Science.gov (United States)

    Stahlmann, Ralf; Horvath, Aniko

    2015-01-01

    Understanding the toxic effects of xenobiotics requires sound knowledge of physiology and biochemistry. The often described lack of understanding pharmacology/toxicology is therefore primarily caused by the general absence of the necessary fundamental knowledge. Since toxic effects depend on exposure (or dosage) assessing the risks arising from toxic substances also requires quantitative reasoning. Typically public discussions nearly always neglect quantitative aspects and laypersons tend to disregard dose-effect-relationships. One of the main reasons for such disregard is the fact that exposures often occur at extremely low concentrations that can only be perceived intellectually but not by the human senses. However, thresholds in the low exposure range are often scientifically disputed. At the same time, ignorance towards known dangers is wide-spread. Thus, enhancing the risk competence of laypersons will have to be initially restricted to increasing the awareness of existing problems.

  13. Comparative risk assessments for Guadeloupe: earthquakes and storm surge

    OpenAIRE

    Réveillère , Arnaud; Monfort , Daniel; Lecacheux , Sophie; Grisanti , Ludovic; Muller , Héloise; Bertil , Didier; Rohmer , Jérémy; Sedan , Olivier; Douglas , John; Baills , Audrey; Modaressi , Hormoz

    2012-01-01

    In France, risk assessments for natural hazards are usually carried out separately and decision makers lack comprehensive information. Moreover, since the cause of the hazard (e.g. meteorological, geological) and the physical phenomenon that causes damage (e.g. inundation, ground shaking) may be fundamentally different, the quantitative comparison of single risk assessments that were not conducted in a compatible framework is not straightforward. Comprehensive comparative risk assessments exi...

  14. WE-B-BRC-00: Concepts in Risk-Based Assessment

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    Prospective quality management techniques, long used by engineering and industry, have become a growing aspect of efforts to improve quality management and safety in healthcare. These techniques are of particular interest to medical physics as scope and complexity of clinical practice continue to grow, thus making the prescriptive methods we have used harder to apply and potentially less effective for our interconnected and highly complex healthcare enterprise, especially in imaging and radiation oncology. An essential part of most prospective methods is the need to assess the various risks associated with problems, failures, errors, and design flaws in our systems. We therefore begin with an overview of risk assessment methodologies used in healthcare and industry and discuss their strengths and weaknesses. The rationale for use of process mapping, failure modes and effects analysis (FMEA) and fault tree analysis (FTA) by TG-100 will be described, as well as suggestions for the way forward. This is followed by discussion of radiation oncology specific risk assessment strategies and issues, including the TG-100 effort to evaluate IMRT and other ways to think about risk in the context of radiotherapy. Incident learning systems, local as well as the ASTRO/AAPM ROILS system, can also be useful in the risk assessment process. Finally, risk in the context of medical imaging will be discussed. Radiation (and other) safety considerations, as well as lack of quality and certainty all contribute to the potential risks associated with suboptimal imaging. The goal of this session is to summarize a wide variety of risk analysis methods and issues to give the medical physicist access to tools which can better define risks (and their importance) which we work to mitigate with both prescriptive and prospective risk-based quality management methods. Learning Objectives: Description of risk assessment methodologies used in healthcare and industry Discussion of radiation oncology

  15. WE-B-BRC-01: Current Methodologies in Risk Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Rath, F. [University of Wisconsin Madison (United States)

    2016-06-15

    Prospective quality management techniques, long used by engineering and industry, have become a growing aspect of efforts to improve quality management and safety in healthcare. These techniques are of particular interest to medical physics as scope and complexity of clinical practice continue to grow, thus making the prescriptive methods we have used harder to apply and potentially less effective for our interconnected and highly complex healthcare enterprise, especially in imaging and radiation oncology. An essential part of most prospective methods is the need to assess the various risks associated with problems, failures, errors, and design flaws in our systems. We therefore begin with an overview of risk assessment methodologies used in healthcare and industry and discuss their strengths and weaknesses. The rationale for use of process mapping, failure modes and effects analysis (FMEA) and fault tree analysis (FTA) by TG-100 will be described, as well as suggestions for the way forward. This is followed by discussion of radiation oncology specific risk assessment strategies and issues, including the TG-100 effort to evaluate IMRT and other ways to think about risk in the context of radiotherapy. Incident learning systems, local as well as the ASTRO/AAPM ROILS system, can also be useful in the risk assessment process. Finally, risk in the context of medical imaging will be discussed. Radiation (and other) safety considerations, as well as lack of quality and certainty all contribute to the potential risks associated with suboptimal imaging. The goal of this session is to summarize a wide variety of risk analysis methods and issues to give the medical physicist access to tools which can better define risks (and their importance) which we work to mitigate with both prescriptive and prospective risk-based quality management methods. Learning Objectives: Description of risk assessment methodologies used in healthcare and industry Discussion of radiation oncology

  16. WE-B-BRC-01: Current Methodologies in Risk Assessment

    International Nuclear Information System (INIS)

    Rath, F.

    2016-01-01

    Prospective quality management techniques, long used by engineering and industry, have become a growing aspect of efforts to improve quality management and safety in healthcare. These techniques are of particular interest to medical physics as scope and complexity of clinical practice continue to grow, thus making the prescriptive methods we have used harder to apply and potentially less effective for our interconnected and highly complex healthcare enterprise, especially in imaging and radiation oncology. An essential part of most prospective methods is the need to assess the various risks associated with problems, failures, errors, and design flaws in our systems. We therefore begin with an overview of risk assessment methodologies used in healthcare and industry and discuss their strengths and weaknesses. The rationale for use of process mapping, failure modes and effects analysis (FMEA) and fault tree analysis (FTA) by TG-100 will be described, as well as suggestions for the way forward. This is followed by discussion of radiation oncology specific risk assessment strategies and issues, including the TG-100 effort to evaluate IMRT and other ways to think about risk in the context of radiotherapy. Incident learning systems, local as well as the ASTRO/AAPM ROILS system, can also be useful in the risk assessment process. Finally, risk in the context of medical imaging will be discussed. Radiation (and other) safety considerations, as well as lack of quality and certainty all contribute to the potential risks associated with suboptimal imaging. The goal of this session is to summarize a wide variety of risk analysis methods and issues to give the medical physicist access to tools which can better define risks (and their importance) which we work to mitigate with both prescriptive and prospective risk-based quality management methods. Learning Objectives: Description of risk assessment methodologies used in healthcare and industry Discussion of radiation oncology

  17. WE-B-BRC-00: Concepts in Risk-Based Assessment

    International Nuclear Information System (INIS)

    2016-01-01

    Prospective quality management techniques, long used by engineering and industry, have become a growing aspect of efforts to improve quality management and safety in healthcare. These techniques are of particular interest to medical physics as scope and complexity of clinical practice continue to grow, thus making the prescriptive methods we have used harder to apply and potentially less effective for our interconnected and highly complex healthcare enterprise, especially in imaging and radiation oncology. An essential part of most prospective methods is the need to assess the various risks associated with problems, failures, errors, and design flaws in our systems. We therefore begin with an overview of risk assessment methodologies used in healthcare and industry and discuss their strengths and weaknesses. The rationale for use of process mapping, failure modes and effects analysis (FMEA) and fault tree analysis (FTA) by TG-100 will be described, as well as suggestions for the way forward. This is followed by discussion of radiation oncology specific risk assessment strategies and issues, including the TG-100 effort to evaluate IMRT and other ways to think about risk in the context of radiotherapy. Incident learning systems, local as well as the ASTRO/AAPM ROILS system, can also be useful in the risk assessment process. Finally, risk in the context of medical imaging will be discussed. Radiation (and other) safety considerations, as well as lack of quality and certainty all contribute to the potential risks associated with suboptimal imaging. The goal of this session is to summarize a wide variety of risk analysis methods and issues to give the medical physicist access to tools which can better define risks (and their importance) which we work to mitigate with both prescriptive and prospective risk-based quality management methods. Learning Objectives: Description of risk assessment methodologies used in healthcare and industry Discussion of radiation oncology

  18. Approaches to risk assessment in food allergy: Report from a workshop ''developing a framework for assessing the risk from allergenic foods"

    NARCIS (Netherlands)

    Madsen, C.B.; Hattersley, S.; Buck, J.; Gendel, S.M.; Houben, G.F.; Hourihane, J.OB.; Mackie, A.; Mills, E.N.C.; Nørhede, P.; Taylor, S.L.; Crevel, R.W.R.

    2009-01-01

    A workshop was organised to investigate whether risk assessment strategies and methodologies used in classical/conventional toxicology may be used for risk assessment of allergenic foods, to discuss the advantages and limitations of different approaches and to determine the research needed to move

  19. Risk assessment methods for life cycle costing in buildings

    Directory of Open Access Journals (Sweden)

    Oduyemi Olufolahan

    2016-01-01

    Originality/value. This paper contributes with new outlooks aimed at assessing the current level of awareness, usage and advocated benefits of risk assessment methods in LCC and adds to the limited empirical studies on risk assessment to corporate occupants and decision makers.

  20. Risk assessment and management approaches on mental health units.

    Science.gov (United States)

    Woods, P

    2013-11-01

    This exploratory and descriptive study took place in one Canadian province. The study aimed to: (1) to identify and describe the nature and extent of current risk assessment and management approaches used in the adult inpatient mental health and forensic units; and (2) to identify good practice and shortfalls in the nature and extent of the approaches currently utilized. Data were collected from 48 participants through nine focus groups. Participants reported that they used a clinical approach to risk assessment. They had also not considered risk assessment and management as a proactive structured process. Education and training was also limited and skills were developed over time through practice. Five keys issues are discussed as important: reliance on clinical judgement alone is not the best choice to make; the need to consider risk as a whole concept; risk management being more reactive than proactive; education and training; and client involvement in risk assessment. © 2012 John Wiley & Sons Ltd.

Some links on this page may take you to non-federal websites. Their policies may differ from this site.