WorldWideScience

Sample records for riparian vegetation characterized

  1. Riparian Vegetation Mapping Along the Hanford Reach

    International Nuclear Information System (INIS)

    FOGWELL, T.W.

    2003-01-01

    During the biological survey and inventory of the Hanford Site conducted in the mid-1990s (1995 and 1996), preliminary surveys of the riparian vegetation were conducted along the Hanford Reach. These preliminary data were reported to The Nature Conservancy (TNC), but were not included in any TNC reports to DOE or stakeholders. During the latter part of FY2001, PNNL contracted with SEE Botanical, the parties that performed the original surveys in the mid 1990s, to complete the data summaries and mapping associated with the earlier survey data. Those data sets were delivered to PNNL and the riparian mapping by vegetation type for the Hanford Reach is being digitized during the first quarter of FY2002. These mapping efforts provide the information necessary to create subsequent spatial data layers to describe the riparian zone according to plant functional types (trees, shrubs, grasses, sedges, forbs). Quantification of the riparian zone by vegetation types is important to a number of DOE'S priority issues including modeling contaminant transport and uptake in the near-riverine environment and the determination of ecological risk. This work included the identification of vegetative zones along the Reach by changes in dominant plant species covering the shoreline from just to the north of the 300 Area to China Bar near Vernita. Dominant and indicator species included Agropyron dasytachyudA. smithii, Apocynum cannabinum, Aristida longiseta, Artemisia campestris ssp. borealis var scouleriana, Artemisa dracunculus, Artemisia lindleyana, Artemisia tridentata, Bromus tectorum, Chrysothamnus nauseosus, Coreopsis atkinsoniana. Eleocharis palustris, Elymus cinereus, Equisetum hyemale, Eriogonum compositum, Juniperus trichocarpa, Phalaris arundinacea, Poa compressa. Salk exigua, Scirpus acutus, Solidago occidentalis, Sporobolus asper,and Sporobolus cryptandrus. This letter report documents the data received, the processing by PNNL staff, and additional data gathered in FY2002

  2. Phytostabilization of metals by indigenous riparian vegetation ...

    African Journals Online (AJOL)

    When measured against an ideal hypothetical buffer zone, the buffer zones under investigation varied between intact and severely compromised. Intact riparian zones showed elevated metal concentrations in the soil, yet significantly lower concentrations in the river water compared to areas with insufficient vegetative cover ...

  3. Riparian Vegetation Mapping Along the Hanford Reach

    Energy Technology Data Exchange (ETDEWEB)

    FOGWELL, T.W.

    2003-07-11

    During the biological survey and inventory of the Hanford Site conducted in the mid-1990s (1995 and 1996), preliminary surveys of the riparian vegetation were conducted along the Hanford Reach. These preliminary data were reported to The Nature Conservancy (TNC), but were not included in any TNC reports to DOE or stakeholders. During the latter part of FY2001, PNNL contracted with SEE Botanical, the parties that performed the original surveys in the mid 1990s, to complete the data summaries and mapping associated with the earlier survey data. Those data sets were delivered to PNNL and the riparian mapping by vegetation type for the Hanford Reach is being digitized during the first quarter of FY2002. These mapping efforts provide the information necessary to create subsequent spatial data layers to describe the riparian zone according to plant functional types (trees, shrubs, grasses, sedges, forbs). Quantification of the riparian zone by vegetation types is important to a number of DOE'S priority issues including modeling contaminant transport and uptake in the near-riverine environment and the determination of ecological risk. This work included the identification of vegetative zones along the Reach by changes in dominant plant species covering the shoreline from just to the north of the 300 Area to China Bar near Vernita. Dominant and indicator species included Agropyron dasytachyudA. smithii, Apocynum cannabinum, Aristida longiseta, Artemisia campestris ssp. borealis var scouleriana, Artemisa dracunculus, Artemisia lindleyana, Artemisia tridentata, Bromus tectorum, Chrysothamnus nauseosus, Coreopsis atkinsoniana. Eleocharis palustris, Elymus cinereus, Equisetum hyemale, Eriogonum compositum, Juniperus trichocarpa, Phalaris arundinacea, Poa compressa. Salk exigua, Scirpus acutus, Solidago occidentalis, Sporobolus asper,and Sporobolus cryptandrus. This letter report documents the data received, the processing by PNNL staff, and additional data gathered in FY

  4. DEVELOPMENT OF AN INDEX OF ALIEN SPECIES INVASIVENESS: AN AID TO ASSESSING RIPARIAN VEGETATION CONDITION

    Science.gov (United States)

    Many riparian areas are invaded by alien plant species that negatively affect native species composition, community dynamics and ecosystem properties. We sampled vegetation along reaches of 31 low order streams in eastern Oregon, and characterized species assemblages at patch an...

  5. Advances on Modelling Riparian Vegetation-Hydromorphology Interactions

    NARCIS (Netherlands)

    Solari, L.; Van Oorschot, M.; Belletti, B.; Hendriks, D.; Rinaldi, M.; Vargas-Luna, A.

    2016-01-01

    Riparian vegetation actively interacts with fluvial systems affecting river hydrodynamics, morphodynamics and groundwater. These interactions can be coupled because both vegetation and hydromorphology (i.e. the combined scientific study of hydrology and fluvial geomorphology) involve dynamic

  6. Riparian vegetation structure under desertification scenarios

    Science.gov (United States)

    Rosário Fernandes, M.; Segurado, Pedro; Jauch, Eduardo; Ferreira, M. Teresa

    2015-04-01

    Riparian areas are responsible for many ecological and ecosystems services, including the filtering function, that are considered crucial to the preservation of water quality and social benefits. The main goal of this study is to quantify and understand the riparian variability under desertification scenario(s) and identify the optimal riparian indicators for water scarcity and droughts (WS&D), henceforth improving river basin management. This study was performed in the Iberian Tâmega basin, using riparian woody patches, mapped by visual interpretation on Google Earth imagery, along 130 Sampling Units of 250 m long river stretches. Eight riparian structural indicators, related with lateral dimension, weighted area and shape complexity of riparian patches were calculated using Patch Analyst extension for ArcGis 10. A set of 29 hydrological, climatic, and hydrogeomorphological variables were computed, by a water modelling system (MOHID), using monthly meteorological data between 2008 and 2014. Land-use classes were also calculated, in a 250m-buffer surrounding each sampling unit, using a classification based system on Corine Land Cover. Boosted Regression Trees identified Mean-width (MW) as the optimal riparian indicator for water scarcity and drought, followed by the Weighted Class Area (WCA) (classification accuracy =0.79 and 0.69 respectively). Average Flow and Strahler number were consistently selected, by all boosted models, as the most important explanatory variables. However, a combined effect of hidrogeomorphology and land-use can explain the high variability found in the riparian width mainly in Tâmega tributaries. Riparian patches are larger towards Tâmega river mouth although with lower shape complexity, probably related with more continuous and almost monospecific stands. Climatic, hydrological and land use scenarios, singly and combined, were used to quantify the riparian variability responding to these changes, and to assess the loss of riparian

  7. Effects of riparian vegetation development in a restored lowland stream

    NARCIS (Netherlands)

    Vargas-Luna, A.; Crosato, A.; Hoitink, A.J.F.; Groot, J.; Uijttewaal, W.S.J.

    2016-01-01

    This paper presents the morphodynamic effects of riparian vegetation growth in a lowland restored stream. Hydrological series, high-resolution bathymetric data and aerial photographs are combined in the study. The vegetation root system was found to assert a strong control on soil stabilization,

  8. Theory, methods and tools for determining environmental flows for riparian vegetation: Riparian vegetation-flow response guilds

    Science.gov (United States)

    Merritt, D.M.; Scott, M.L.; Leroy, Poff N.; Auble, G.T.; Lytle, D.A.

    2010-01-01

    Riparian vegetation composition, structure and abundance are governed to a large degree by river flow regime and flow-mediated fluvial processes. Streamflow regime exerts selective pressures on riparian vegetation, resulting in adaptations (trait syndromes) to specific flow attributes. Widespread modification of flow regimes by humans has resulted in extensive alteration of riparian vegetation communities. Some of the negative effects of altered flow regimes on vegetation may be reversed by restoring components of the natural flow regime. 2. Models have been developed that quantitatively relate components of the flow regime to attributes of riparian vegetation at the individual, population and community levels. Predictive models range from simple statistical relationships, to more complex stochastic matrix population models and dynamic simulation models. Of the dozens of predictive models reviewed here, most treat one or a few species, have many simplifying assumptions such as stable channel form, and do not specify the time-scale of response. In many cases, these models are very effective in developing alternative streamflow management plans for specific river reaches or segments but are not directly transferable to other rivers or other regions. 3. A primary goal in riparian ecology is to develop general frameworks for prediction of vegetation response to changing environmental conditions. The development of riparian vegetation-flow response guilds offers a framework for transferring information from rivers where flow standards have been developed to maintain desirable vegetation attributes, to rivers with little or no existing information. 4. We propose to organise riparian plants into non-phylogenetic groupings of species with shared traits that are related to components of hydrologic regime: life history, reproductive strategy, morphology, adaptations to fluvial disturbance and adaptations to water availability. Plants from any river or region may be grouped

  9. Evaluating the quality of riparian forest vegetation: the Riparian Forest Evaluation (RFV index

    Directory of Open Access Journals (Sweden)

    Fernando Magdaleno

    2014-08-01

    Full Text Available Aim of study: This paper presents a novel index, the Riparian Forest Evaluation (RFV index, for assessing the ecological condition of riparian forests. The status of riparian ecosystems has global importance due to the ecological and social benefits and services they provide. The initiation of the European Water Framework Directive (2000/60/CE requires the assessment of the hydromorphological quality of natural channels. The Directive describes riparian forests as one of the fundamental components that determine the structure of riverine areas. The RFV index was developed to meet the aim of the Directive and to complement the existing methodologies for the evaluation of riparian forests.Area of study: The RFV index was applied to a wide range of streams and rivers (170 water bodies inSpain.Materials and methods: The calculation of the RFV index is based on the assessment of both the spatial continuity of the forest (in its three core dimensions: longitudinal, transversal and vertical and the regeneration capacity of the forest, in a sampling area related to the river hydromorphological pattern. This index enables an evaluation of the quality and degree of alteration of riparian forests. In addition, it helps to determine the scenarios that are necessary to improve the status of riparian forests and to develop processes for restoring their structure and composition.Main results: The results were compared with some previous tools for the assessment of riparian vegetation. The RFV index got the highest average scores in the basins of northernSpain, which suffer lower human influence. The forests in central and southern rivers got worse scores. The bigger differences with other tools were found in complex and partially altered streams and rivers.Research highlights: The study showed the index’s applicability under diverse hydromorphological and ecological conditions and the main advantages of its application. The utilization of the index allows a

  10. Sensitivity Analysis of a Riparian Vegetation Growth Model

    Directory of Open Access Journals (Sweden)

    Michael Nones

    2016-11-01

    Full Text Available The paper presents a sensitivity analysis of two main parameters used in a mathematic model able to evaluate the effects of changing hydrology on the growth of riparian vegetation along rivers and its effects on the cross-section width. Due to a lack of data in existing literature, in a past study the schematization proposed here was applied only to two large rivers, assuming steady conditions for the vegetational carrying capacity and coupling the vegetal model with a 1D description of the river morphology. In this paper, the limitation set by steady conditions is overcome, imposing the vegetational evolution dependent upon the initial plant population and the growth rate, which represents the potential growth of the overall vegetation along the watercourse. The sensitivity analysis shows that, regardless of the initial population density, the growth rate can be considered the main parameter defining the development of riparian vegetation, but it results site-specific effects, with significant differences for large and small rivers. Despite the numerous simplifications adopted and the small database analyzed, the comparison between measured and computed river widths shows a quite good capability of the model in representing the typical interactions between riparian vegetation and water flow occurring along watercourses. After a thorough calibration, the relatively simple structure of the code permits further developments and applications to a wide range of alluvial rivers.

  11. Morphodynamic effects of riparian vegetation growth after stream restoration

    NARCIS (Netherlands)

    Vargas-Luna, Andrés; Crosato, Alessandra; Anders, Niels; Hoitink, Antonius J.F.; Keesstra, Saskia D.; Uijttewaal, Wim S.J.

    2018-01-01

    The prediction of the morphological evolution of renaturalized streams is important for the success of restoration projects. Riparian vegetation is a key component of the riverine landscape and is therefore essential for the natural rehabilitation of rivers. This complicates the design of

  12. Vegetative zonation patterns in depression and riparian wetlands of ...

    African Journals Online (AJOL)

    ELO

    2012-01-05

    Jan 5, 2012 ... The vegetation of depressional and riparian wetlands in the Sanjiang ... Three transplanted species showed different effects of biomass ... nutrient concentrations in soil, as well as disturbance, ... (2) to discern underlying environmental variables that .... variance (ANOVA) and the construction of scatter plots.

  13. Influence of microtopography on soil chemistry and understory riparian vegetation

    Science.gov (United States)

    Irene M. Unger; Rose-Marie Muzika

    2008-01-01

    The success of riparian forest restoration efforts depends in part on an understanding of the relationship between soil characteristics and vegetation patterns and how these change with site conditions. To examine these relationships for floodplains in northern Missouri, we chose three unchannelized streams as study areas. A sampling grid was established at two plots...

  14. Woody riparian vegetation response to different alluvial water table regimes

    Science.gov (United States)

    Shafroth, P.B.; Stromberg, J.C.; Patten, D.T.

    2000-01-01

    Woody riparian vegetation in western North American riparian ecosystems is commonly dependent on alluvial groundwater. Various natural and anthropogenic mechanisms can cause groundwater declines that stress riparian vegetation, but little quantitative information exists on the nature of plant response to different magnitudes, rates, and durations of groundwater decline. We observed groundwater dynamics and the response of Populus fremontii, Salix gooddingii, and Tamarix ramosissima saplings at 3 sites between 1995 and 1997 along the Bill Williams River, Arizona. At a site where the lowest observed groundwater level in 1996 (-1.97 m) was 1.11 m lower than that in 1995 (-0.86 m), 92-100% of Populus and Salix saplings died, whereas 0-13% of Tamarix stems died. A site with greater absolute water table depths in 1996 (-2.55 m), but less change from the 1995 condition (0.55 m), showed less Populus and Salix mortality and increased basal area. Excavations of sapling roots suggest that root distribution is related to groundwater history. Therefore, a decline in water table relative to the condition under which roots developed may strand plant roots where they cannot obtain sufficient moisture. Plant response is likely mediated by other factors such as soil texture and stratigraphy, availability of precipitation-derived soil moisture, physiological and morphological adaptations to water stress, and tree age. An understanding of the relationships between water table declines and plant response may enable land and water managers to avoid activities that are likely to stress desirable riparian vegetation.

  15. RELATIONSHIPS AMONG GEOMORPHOLOGY, HYDROLOGY, AND VEGETATION IN RIPARIAN MEADOWS: RESTORATION IMPLICATIONS

    Science.gov (United States)

    Vegetation patterns and dynamics within riparian corridors are controlled largely by geomorphic position, substrate characteristics and hydrologic regimes. Understanding management and restoration options for riparian meadow complexes exhibiting stream incision requires knowledge...

  16. Impact of dam-induced hydrological changes on riparian vegetation

    Science.gov (United States)

    Tealdi, Stefano; Camporeale, Carlo; Ridolfi, Luca

    2010-05-01

    Hydrological disturbances are a key factor for the riparian vegetation, which is a highly dynamic ecosystem prone to external forcing. Random fluctuations of water stages drive in fact the alternation of periods of floods and exposure of the vegetated plots. During flooding, the plots are submerged and vegetation is damaged by burial, uprooting and anoxia, while during exposure periods vegetation grows according to the soil moisture content and the phreatic water table depth. The distribution of vegetation along the riparian transect is then directly connected to the stochasticity of river discharges. River damming can have remarkable impacts on the hydrology of a river and, consequently, on the riparian vegetation. Several field studies show how the river regulation induced by artificial reservoirs can greatly modify the statistical moments and the autocorrelation of the discharge time series. The vegetation responds to these changes reducing its overall heterogeneity, declining - substituted by exotic species - and shifting its starting position nearer or far away from the channel center. These latter processes are known as narrowing and widening, respectively. In our work we explore the effects of dam-induced hydrological changes on the narrowing/widening process and on the total biomass along the transect. To this aim we use an eco-hydrological stochastic model developed by Camporeale and Ridolfi [2006], which is able to give a realistic distribution of the biomass along the transect as a function of a few hydrologic, hydraulic and vegetation parameters. We apply the model to an exemplifying case, by investigating the vegetation response to a set of changes in mean discharge and coefficient of variation. The range of these changes is deduced from the analysis of field data in pre- and post-dam conditions. Firstly, we analyze the narrowing/widening process. In particular, we analyze two percentage differences of the starting transversal position with respect to

  17. Inter-species competition-facilitation in stochastic riparian vegetation dynamics.

    Science.gov (United States)

    Tealdi, Stefano; Camporeale, Carlo; Ridolfi, Luca

    2013-02-07

    Riparian vegetation is a highly dynamic community that lives on river banks and which depends to a great extent on the fluvial hydrology. The stochasticity of the discharge and erosion/deposition processes in fact play a key role in determining the distribution of vegetation along a riparian transect. These abiotic processes interact with biotic competition/facilitation mechanisms, such as plant competition for light, water, and nutrients. In this work, we focus on the dynamics of plants characterized by three components: (1) stochastic forcing due to river discharges, (2) competition for resources, and (3) inter-species facilitation due to the interplay between vegetation and fluid dynamics processes. A minimalist stochastic bio-hydrological model is proposed for the dynamics of the biomass of two vegetation species: one species is assumed dominant and slow-growing, the other is subdominant, but fast-growing. The stochastic model is solved analytically and the probability density function of the plant biomasses is obtained as a function of both the hydrologic and biologic parameters. The impact of the competition/facilitation processes on the distribution of vegetation species along the riparian transect is investigated and remarkable effects are observed. Finally, a good qualitative agreement is found between the model results and field data. Copyright © 2012 Elsevier Ltd. All rights reserved.

  18. Multicriteria analysis to evaluate the energetic reuse of riparian vegetation

    International Nuclear Information System (INIS)

    Recchia, Lucia; Cini, Enrico; Corsi, Stefano

    2010-01-01

    The management of riparian vegetation which includes cutting operations of grass, reeds, bushes and trees, is very important to reduce hydrogeologic risk. In Tuscany, riparian biomass and residues are mainly left shredded along courses or disposed in landfills as special wastes: actually different laws prohibit that tree trunks are abandoned in areas naturally affected by flooding, because they can be moved contributing to increase the water level and to maximize the hydraulic risk of some other nearby areas. In some cases, it is also possible to store the logs in specified sites from where they can be taken and used as a fuel in fireplaces or domestic heating plants. This work studies the possibility of the reuse of riparian vegetation as biomass for energy production and evaluates benefits and drawbacks from the economical, environmental and managerial points of view. Particularly, a specific methodology has been developed for two hydrological districts of Tuscany, with different typologies and densities of vegetation. First, an estimation of biomass distribution on the land and an evaluation of annual wood availability have been carried out; then, different chains concerning harvesting operation, biomass transport, storage conditions and final utilisation, have been defined and compared by a specific multicriteria analysis (MCA); finally, for the most suitable bio-energy chains the Life Cycle Assessment (LCA) has been implemented. Results of the LCA have also permitted to validate some environmental indicators used in the MCA, as mechanisation level of yards, energy efficiency of plants or transport distances. The decision making tool developed allows to compare costs and environmental benefits of the energy use of riparian vegetation, supporting local authorities involved in energy planning: in this way it is possible to confront different alternatives to match the energy demand and meet the energy saving and sustainability issues at the lowest cost for the

  19. Multicriteria analysis to evaluate the energetic reuse of riparian vegetation

    Energy Technology Data Exchange (ETDEWEB)

    Recchia, Lucia; Cini, Enrico [Dipartimento di Ingegneria Agraria e Forestale, Universita di Firenze, Piazzale delle Cascine 15, 50144 Firenze (Italy); Corsi, Stefano [Consorzio di Bonifica per la difesa del suolo e la tutela dell' ambiente della Toscana Centrale, via Verdi 16, 50122 Firenze (Italy)

    2010-01-15

    The management of riparian vegetation which includes cutting operations of grass, reeds, bushes and trees, is very important to reduce hydrogeologic risk. In Tuscany, riparian biomass and residues are mainly left shredded along courses or disposed in landfills as special wastes: actually different laws prohibit that tree trunks are abandoned in areas naturally affected by flooding, because they can be moved contributing to increase the water level and to maximize the hydraulic risk of some other nearby areas. In some cases, it is also possible to store the logs in specified sites from where they can be taken and used as a fuel in fireplaces or domestic heating plants. This work studies the possibility of the reuse of riparian vegetation as biomass for energy production and evaluates benefits and drawbacks from the economical, environmental and managerial points of view. Particularly, a specific methodology has been developed for two hydrological districts of Tuscany, with different typologies and densities of vegetation. First, an estimation of biomass distribution on the land and an evaluation of annual wood availability have been carried out; then, different chains concerning harvesting operation, biomass transport, storage conditions and final utilisation, have been defined and compared by a specific multicriteria analysis (MCA); finally, for the most suitable bio-energy chains the Life Cycle Assessment (LCA) has been implemented. Results of the LCA have also permitted to validate some environmental indicators used in the MCA, as mechanisation level of yards, energy efficiency of plants or transport distances. The decision making tool developed allows to compare costs and environmental benefits of the energy use of riparian vegetation, supporting local authorities involved in energy planning: in this way it is possible to confront different alternatives to match the energy demand and meet the energy saving and sustainability issues at the lowest cost for the

  20. The Role of Riparian Vegetation in Protecting and Improving Chemical Water Quality in Streams

    Science.gov (United States)

    Michael G. Dosskey; Philippe Vidon; Noel P. Gurwick; Craig J. Allan; Tim P. Duval; Richard Lowrance

    2010-01-01

    We review the research literature and summarize the major processes by which riparian vegetation influences chemical water quality in streams, as well as how these processes vary among vegetation types, and discuss how these processes respond to removal and restoration of riparian vegetation and thereby determine the timing and level of response in stream water quality...

  1. Influences of watershed geomorphology on extent and composition of riparian vegetation

    Science.gov (United States)

    Blake M. Engelhardt; Peter J. Weisberg; Jeanne C. Chambers

    2011-01-01

    Watershed (drainage basin) morphometry and geology were derived from digital data sets (DEMs and geologic maps). Riparian corridors were classified into five vegetation types (riparian forest, riparian shrub, wet/mesic meadow, dry meadow and shrub dry meadow) using high-resolution aerial photography. Regression and multivariate analyses were used to relate geomorphic...

  2. Effects of riparian zone buffer widths on vegetation diversity in southern Appalachian headwater catchments

    Science.gov (United States)

    Katherine J. Elliott; James M. Vose

    2016-01-01

    In mountainous areas such as the southern Appalachians USA, riparian zones are difficult to define. Vegetation is a commonly used riparian indicator and plays a key role in protecting water resources, but adequate knowledge of floristic responses to riparian disturbances is lacking. Our objective was to quantify changes in stand-level floristic diversity of...

  3. Scales of form roughness on riverbanks with different riparian vegetation

    Science.gov (United States)

    Konsoer, K. M.; Rhoads, B. L.; Best, J.; Langendoen, E. J.; Ursic, M.; Abad, J. D.; Garcia, M. H.

    2013-12-01

    Riverbanks often include topographic irregularities that occur over a range of scales and that are produced by interactions among erosional processes, vegetation, and the geotechnical properties of the banks and floodplains. Irregularity of the bank surface can increase form drag, affecting the overall flow resistance, near-bank shear stresses, and patterns of sediment transport. Understanding how dominant scales of form roughness influence the near-bank flow structure, and thus the shear stress partitioning, is vital for the development of accurate predictive morphodynamic models. In this paper, the scales of bank roughness are examined for two meander bends of a large alluvial river with differing riparian vegetation on the Wabash River near Grayville, Illinois. Detailed measurements of bank topography were obtained using terrestrial LiDAR during low flow events and a multibeam echo sounder (MBES) during bankfull events. These measurements yielded high spatial resolution maps (~5-10 cm) that were used to analyze scales of roughness at different elevations along the banks during both subaerial and subaqueous conditions. The results of these analyses provide insight into the influence of riparian vegetation on form roughness and patterns of near-bank flow structure as documented using acoustic Doppler current profilers (ADCP).

  4. Assessing Riparian Vegetation Condition and Function in Disturbed Sites of the Arid Northwestern Mexico

    Directory of Open Access Journals (Sweden)

    Lara Cornejo-Denman

    2018-01-01

    Full Text Available Transformation or modification of vegetation distribution and structure in arid riparian ecosystems can lead to the loss of ecological function. Mexico has 101,500,000 ha of arid lands, however there is a general lack of information regarding how arid riparian ecosystems are being modified. To assess these modifications, we use eight sites in the San Miguel River (central Sonora to analyze (1 riparian vegetation composition, structure and distribution using field sampling and remote sensing data from Unmanned Aerial Vehicles (UAV; (2 productivity (proxies, using vegetation indices derived from satellite data; and (3 variability posed by riparian vegetation and vegetation adjacent to riparian habitats. The development of a simple yet informative Anthropogenic-disturbance Index (ADI allowed us to classify and describe each study site. We found sharp differences in vegetation composition and structure between sites due to the absence/presence of obligate-riparian species. We also report significant difference between EVI (Enhanced Vegetation Index values for the dry season among vegetation types that develop near the edges of the river but differ in composition, suggesting that land cover changes form obligate-riparian to facultative-riparian species can lead to a loss in potential productivity. Finally, our tests suggest that sites with higher disturbance present lower photosynthetic activity.

  5. EnviroAtlas - Cleveland, OH - 51m Riparian Buffer Vegetated Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. In this community, vegetated cover is defined as Trees & Forest,...

  6. Protocols for Mapping and Characterizing Land Use/Land Cover in Riparian Zones

    National Research Council Canada - National Science Library

    Johnson, Michaela R; Zelt, Ronald B

    2005-01-01

    .... Characterization of riparian systems is critical to a comprehensive understanding of nutrient enrichment effects on stream ecosystems because riparian functions provide an important ecological...

  7. EnviroAtlas - Portland, ME - 51m Riparian Buffer Vegetated Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the...

  8. RELATIONSHIPS OF ALIEN PLANT SPECIES ABUNDANCE TO RIPARIAN VEGETATION, ENVIRONMENT, AND DISTURBANCE

    Science.gov (United States)

    Riparian ecosystems are often invaded by alien species. We evaluated vegetation, environment, and disturbance conditions and their interrelationships with alien species abundance along reaches of 29 streams in eastern Oregon, USA. Using flexible-BETA clustering, indicator species...

  9. EnviroAtlas - Portland, OR - 15m Riparian Buffer Vegetated Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of a 15-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the...

  10. EnviroAtlas - Phoenix, AZ - 51m Riparian Buffer Vegetated Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the...

  11. EnviroAtlas - Durham, NC - 51m Riparian Buffer Vegetated Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the...

  12. EnviroAtlas - Woodbine, IA - 15m Riparian Buffer Vegetated Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of a 15-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the...

  13. Presence of riparian vegetation increases biotic condition of fish assemblages in two Brazilian reservoirs

    OpenAIRE

    Ferreira, Fabio Cop; Souza, Ursulla Pereira; Petrere Junior2, Miguel

    2015-01-01

    Abstract The riparian vegetation in lakes and reservoirs is source of course wood structures such as trunks and branches and is used as sheltering, spawning and foraging habitats for fishes. The reduction of these submerged structures can thus, affect the composition and structure of fish assemblages in reservoirs. Aim To evaluate the influence of riparian vegetation on the biotic condition of fish assemblage by adapting the Reservoir Fish Assemblage Index (RFAI) to two reservoirs in the Upp...

  14. State-and-transition prototype model of riparian vegetation downstream of Glen Canyon Dam, Arizona

    Science.gov (United States)

    Ralston, Barbara E.; Starfield, Anthony M.; Black, Ronald S.; Van Lonkhuyzen, Robert A.

    2014-01-01

    Facing an altered riparian plant community dominated by nonnative species, resource managers are increasingly interested in understanding how to manage and promote healthy riparian habitats in which native species dominate. For regulated rivers, managing flows is one tool resource managers consider to achieve these goals. Among many factors that can influence riparian community composition, hydrology is a primary forcing variable. Frame-based models, used successfully in grassland systems, provide an opportunity for stakeholders concerned with riparian systems to evaluate potential riparian vegetation responses to alternative flows. Frame-based, state-and-transition models of riparian vegetation for reattachment bars, separation bars, and the channel margin found on the Colorado River downstream of Glen Canyon Dam were constructed using information from the literature. Frame-based models can be simple spreadsheet models (created in Microsoft® Excel) or developed further with programming languages (for example, C-sharp). The models described here include seven community states and five dam operations that cause transitions between states. Each model divides operations into growing (April–September) and non-growing seasons (October–March) and incorporates upper and lower bar models, using stage elevation as a division. The inputs (operations) can be used by stakeholders to evaluate flows that may promote dynamic riparian vegetation states, or identify those flow options that may promote less desirable states (for example, Tamarisk [Tamarix sp.] temporarily flooded shrubland). This prototype model, although simple, can still elicit discussion about operational options and vegetation response.

  15. Compositional stability of boreal understorey vegetation after overstorey harvesting across a riparian ecotone

    Science.gov (United States)

    Rebecca L. MacDonald; Han Y.H. Chen; Samuel F. Bartels; Brian J. Palik; Ellie E. Prepas; Frank Gilliam

    2015-01-01

    Questions: Understanding factors that contribute to the stability of an ecosystem following harvesting is central to predicting responses of boreal ecosystems to increasing human disturbances.While the response of understorey vegetation to harvesting is well understood for upland sites, little is known about compositional stability of riparian understorey vegetation....

  16. Presence of riparian vegetation increases biotic condition of fish assemblages in two Brazilian reservoirs

    Directory of Open Access Journals (Sweden)

    Fabio Cop Ferreira

    2015-09-01

    Full Text Available Abstract The riparian vegetation in lakes and reservoirs is source of course wood structures such as trunks and branches and is used as sheltering, spawning and foraging habitats for fishes. The reduction of these submerged structures can thus, affect the composition and structure of fish assemblages in reservoirs. Aim To evaluate the influence of riparian vegetation on the biotic condition of fish assemblage by adapting the Reservoir Fish Assemblage Index (RFAI to two reservoirs in the Upper Paranapanema river basin, São Paulo State, Brazil. Methods The RFAI was adapted from metrics related to the functional characteristics and composition of fish assemblages through a protocol of metric selection and validation, and to its response to the presence of riparian vegetation. Results The final RFAI was composed by nine metrics, been lower in sites without riparian vegetation as consequence of the predominance of larger individuals and the percent of piscivorous and detritivorous fishes. Conclusions These results suggest that increasing shore habitat complexity in reservoirs by maintaining riparian vegetation increases fish biotic integrity.

  17. The Irrigation Effect: How River Regulation Can Promote Some Riparian Vegetation

    Science.gov (United States)

    Gill, Karen M.; Goater, Lori A.; Braatne, Jeffrey H.; Rood, Stewart B.

    2018-04-01

    River regulation impacts riparian ecosystems by altering the hydrogeomorphic conditions that support streamside vegetation. Obligate riparian plants are often negatively impacted since they are ecological specialists with particular instream flow requirements. Conversely, facultative riparian plants are generalists and may be less vulnerable to river regulation, and could benefit from augmented flows that reduce drought stress during hot and dry periods. To consider this `irrigation effect' we studied the facultative shrub, netleaf hackberry ( Celtis reticulata), the predominant riparian plant along the Hells Canyon corridor of the Snake River, Idaho, USA, where dams produce hydropeaking, diurnal flow variation. Inventories of 235 cross-sectional transects revealed that hackberry was uncommon upstream from the reservoirs, sparse along the reservoir with seasonal draw-down and common along two reservoirs with stabilized water levels. Along the Snake River downstream, hackberry occurred in fairly continuous, dense bands along the high water line. In contrast, hackberry was sparsely scattered along the free-flowing Salmon River, where sandbar willow ( Salix exigua), an obligate riparian shrub, was abundant. Below the confluence of the Snake and Salmon rivers, the abundance and distribution of hackberry were intermediate between the two upstream reaches. Thus, river regulation apparently benefited hackberry along the Snake River through Hells Canyon, probably due to diurnal pulsing that wets the riparian margin. We predict similar benefits for some other facultative riparian plants along other regulated rivers with hydropeaking during warm and dry intervals. To analyze the ecological impacts of hydropeaking we recommend assessing daily maxima, as well as daily mean river flows.

  18. Post-wildfire recovery of riparian vegetation during a period of water scarcity in the southwestern USA

    Science.gov (United States)

    D. Max Smith; Deborah M. Finch; Christian Gunning; Roy Jemison; Jeffrey F. Kelly

    2009-01-01

    Wildland fires occur with increasing frequency in southwestern riparian forests, yet little is known about the effects of fire on populations of native and exotic vegetation. From 2003 to 2006, we monitored recovering woody vegetation in wildfire sites in the bosque (riparian forest) along the Middle Rio Grande of central New Mexico, USA. To examine recovery potential...

  19. Vegetative zonation patterns in depression and riparian wetlands of ...

    African Journals Online (AJOL)

    One hundred and seventy-two (172) sampling plots in depression and riparian wetland was used. Samples were classified in 9 groups at the fourth level using two-way indicator species analysis (TWINSPAN): Four marsh communities, one meadow marsh community, one wet meadow community, two swamp communities ...

  20. Effect of river flow fluctuations on riparian vegetation dynamics: Processes and models

    Science.gov (United States)

    Vesipa, Riccardo; Camporeale, Carlo; Ridolfi, Luca

    2017-12-01

    Several decades of field observations, laboratory experiments and mathematical modelings have demonstrated that the riparian environment is a disturbance-driven ecosystem, and that the main source of disturbance is river flow fluctuations. The focus of the present work has been on the key role that flow fluctuations play in determining the abundance, zonation and species composition of patches of riparian vegetation. To this aim, the scientific literature on the subject, over the last 20 years, has been reviewed. First, the most relevant ecological, morphological and chemical mechanisms induced by river flow fluctuations are described from a process-based perspective. The role of flow variability is discussed for the processes that affect the recruitment of vegetation, the vegetation during its adult life, and the morphological and nutrient dynamics occurring in the riparian habitat. Particular emphasis has been given to studies that were aimed at quantifying the effect of these processes on vegetation, and at linking them to the statistical characteristics of the river hydrology. Second, the advances made, from a modeling point of view, have been considered and discussed. The main models that have been developed to describe the dynamics of riparian vegetation have been presented. Different modeling approaches have been compared, and the corresponding advantages and drawbacks have been pointed out. Finally, attention has been paid to identifying the processes considered by the models, and these processes have been compared with those that have actually been observed or measured in field/laboratory studies.

  1. Effects of drought on birds and riparian vegetation in the Colorado River Delta, Mexico

    Science.gov (United States)

    Hinojosa-Huerta, Osvel; Nagler, Pamela L.; Carrillo-Guererro, Yamilett K.; Glenn, Edward P.

    2013-01-01

    The riparian corridor in the delta of the Colorado River in Mexico supports internationally important bird habitat. The vegetation is maintained by surface flows from the U.S. and Mexico and by a high, non-saline aquifer into which the dominant phreatophytic shrubs and trees are rooted. We studied the effects of a regional drought on riparian vegetation and avian abundance and diversity from 2002 to 2007, during which time surface flows were markedly reduced compared to the period from 1995 to 2002. Reduced surface flows led to a reduction in native tree cover but an increase in shrub cover, mostly due to an increase in Tamarix spp., an introduced halophytic shrub, and a reduction in Populus fremontii and Salix gooddingii trees. However, overall vegetation cover was unchanged at about 70%. Overall bird density and diversity were also unchanged, but riparian-obligate species tended to decrease in abundance, and generalist species increased. Although reduction in surface flows reduced habitat value and negatively impacted riparian-obligate bird species, portions of the riparian zone exhibited resilience. Surface flows are required to reduce soil salt levels and germinate new cohorts of native trees, but the main source of water supporting this ecosystem is the aquifer, derived from underflows from irrigated fields in the U.S. and Mexico. The long-term prospects for delta riparian habitats are uncertain due to expected reduced flows of river water from climate change, and land use practices that will reduce underflows to the riparian aquifer and increase salinity levels. Active restoration programs would be needed if these habitats are to be preserved for the future.

  2. Ecosystem response to removal of exotic riparian shrubs and a transition to upland vegetation

    Science.gov (United States)

    Reynolds, Lindsay V.; Cooper, David J.

    2011-01-01

    Understanding plant community change over time is essential for managing important ecosystems such as riparian areas. This study analyzed historic vegetation using soil seed banks and the effects of riparian shrub removal treatments and channel incision on ecosystem and plant community dynamics in Canyon de Chelly National Monument, Arizona. We focused on how seeds, nutrients, and ground water influence the floristic composition of post-treatment vegetation and addressed three questions: (1) How does pre-treatment soil seed bank composition reflect post-treatment vegetation composition? (2) How does shrub removal affect post-treatment riparian vegetation composition, seed rain inputs, and ground water dynamics? and (3) Is available soil nitrogen increased near dead Russian olive plants following removal and does this influence post-treatment vegetation? We analyzed seed bank composition across the study area, analyzed differences in vegetation, ground water levels, and seed rain between control, cut-stump and whole-plant removal areas, and compared soil nitrogen and vegetation near removed Russian olive to areas lacking Russian olive. The soil seed bank contained more riparian plants, more native and fewer exotic plants than the extant vegetation. Both shrub removal methods decreased exotic plant cover, decreased tamarisk and Russian olive seed inputs, and increased native plant cover after 2 years. Neither method increased ground water levels. Soil near dead Russian olive trees indicated a short-term increase in soil nitrogen following plant removal but did not influence vegetation composition compared to areas without Russian olive. Following tamarisk and Russian olive removal, our study sites were colonized by upland plant species. Many western North American rivers have tamarisk and Russian olive on floodplains abandoned by channel incision, river regulation or both. Our results are widely applicable to sites where drying has occurred and vegetation

  3. Spatial-structural analysis of leafless woody riparian vegetation for hydraulic considerations

    Science.gov (United States)

    Weissteiner, Clemens; Jalonen, Johanna; Järvelä, Juha; Rauch, Hans Peter

    2013-04-01

    Woody riparian vegetation is a vital element of riverine environments. On one hand woody riparian vegetation has to be taken into account from a civil engineering point of view due to boundary shear stress and vegetation drag. On the other hand it has to be considered from a river ecological point of view due to shadowing effects and as a source of organic material for aquatic habitats. In hydrodynamic and hydro-ecological studies the effects of woody riparian vegetation on flow patterns are usually investigated on a very detailed level. On the contrary vegetation elements and their spatial patterns are generally analysed and discussed on the basis of an integral approach measuring for example basal diameters, heights and projected plant areas. For a better understanding of the influence of woody riparian vegetation on turbulent flow and on river ecology, it is essential to record and analyse plant data sets on the same level of quality as for hydrodynamic or hydro-ecologic purposes. As a result of the same scale of the analysis it is possible to incorporate riparian vegetation as a sub-model in the hydraulic analysis. For plant structural components, such as branches on different topological levels it is crucial to record plant geometrical parameters describing the habitus of the plant on branch level. An exact 3D geometrical model of real plants allows for an extraction of various spatial-structural plant parameters. In addition, allometric relationships help to summarize and describe plant traits of riparian vegetation. This paper focuses on the spatial-structural composition of leafless riparia woddy vegetation. Structural and spatial analyses determine detailed geometric properties of the structural components of the plants. Geometrical and topological parameters were recorded with an electro-magnetic scanning device. In total, 23 plants (willows, alders and birches) were analysed in the study. Data were recorded on branch level, which allowed for the

  4. THE INFLUENCE OF CHECK DAMS ON FLUVIAL PROCESSES AND RIPARIAN VEGETATION IN MOUNTAIN REACHES OF TORRENTS

    Directory of Open Access Journals (Sweden)

    Giuseppe Bombino

    2010-09-01

    Full Text Available The complex hydrogeomorphological processes within the active channel of rivers strongly influence riparian vegetation development and organization, particularly in mountain streams where such processes can be remarkably impacted by engineering control works. In four mountain reaches of Calabrian fiumaras we analyze, through previously arranged methods (integrated by a multivariate statistic analysis, the relationships among hydrogeomorphological river characteristics and structure and the development of riparian vegetation within the active channel in transects located in proximity of check dams and in less disturbed sites. The results of this study demonstrate clear and relevant contrasts, due to the presence of check dams, in the physical and vegetation properties of upstream, downstream and intermediate sites around check dams. The multivariate statistical approach through the Principal Component Analysis (PCA highlighted evident relationships in all transects between groups of physical and vegetation properties. The regression analysis performed between the vegetation properties and the width:depth ratio or the specific discharge showed very different relationships between groups of transects, due to evident changes in channel morphology and in flow regime locally induced by check dams. Overall we have shown that check dams have far reaching effects in the extent and development of riparian vegetation of mountain torrent reaches, which extend far beyond physical adjustments to changed morphological, hydraulic and sedimentary conditions.

  5. Estimating riparian and agricultural evapotranspiration by reference crop evapotranspiration and MODIS Enhanced Vegetation Index

    Science.gov (United States)

    Nagler, Pamela L.; Glenn, Edward P.; Nguyen, Uyen; Scott, Russell; Doody, Tania

    2013-01-01

    Dryland river basins frequently support both irrigated agriculture and riparian vegetation and remote sensing methods are needed to monitor water use by both crops and natural vegetation in irrigation districts. We developed an algorithm for estimating actual evapotranspiration (ETa) based on the Enhanced Vegetation Index (EVI) from the Moderate Resolution Imaging Spectrometer (MODIS) sensor on the EOS-1 Terra satellite and locally-derived measurements of reference crop ET (ETo). The algorithm was calibrated with five years of ETa data from three eddy covariance flux towers set in riparian plant associations on the upper San Pedro River, Arizona, supplemented with ETa data for alfalfa and cotton from the literature. The algorithm was based on an equation of the form ETa = ETo [a(1 − e−bEVI) − c], where the term (1 − e−bEVI) is derived from the Beer-Lambert Law to express light absorption by a canopy, with EVI replacing leaf area index as an estimate of the density of light-absorbing units. The resulting algorithm capably predicted ETa across riparian plants and crops (r2 = 0.73). It was then tested against water balance data for five irrigation districts and flux tower data for two riparian zones for which season-long or multi-year ETa data were available. Predictions were within 10% of measured results in each case, with a non-significant (P = 0.89) difference between mean measured and modeled ETa of 5.4% over all validation sites. Validation and calibration data sets were combined to present a final predictive equation for application across crops and riparian plant associations for monitoring individual irrigation districts or for conducting global water use assessments of mixed agricultural and riparian biomes.

  6. Estimating Riparian and Agricultural Actual Evapotranspiration by Reference Evapotranspiration and MODIS Enhanced Vegetation Index

    Directory of Open Access Journals (Sweden)

    Russell L. Scott

    2013-08-01

    Full Text Available Dryland river basins frequently support both irrigated agriculture and riparian vegetation and remote sensing methods are needed to monitor water use by both crops and natural vegetation in irrigation districts. We developed an algorithm for estimating actual evapotranspiration (ETa based on the Enhanced Vegetation Index (EVI from the Moderate Resolution Imaging Spectrometer (MODIS sensor on the EOS-1 Terra satellite and locally-derived measurements of reference crop ET (ETo. The algorithm was calibrated with five years of ETa data from three eddy covariance flux towers set in riparian plant associations on the upper San Pedro River, Arizona, supplemented with ETa data for alfalfa and cotton from the literature. The algorithm was based on an equation of the form ETa = ETo [a(1 − e−bEVI − c], where the term (1 − e−bEVI is derived from the Beer-Lambert Law to express light absorption by a canopy, with EVI replacing leaf area index as an estimate of the density of light-absorbing units. The resulting algorithm capably predicted ETa across riparian plants and crops (r2 = 0.73. It was then tested against water balance data for five irrigation districts and flux tower data for two riparian zones for which season-long or multi-year ETa data were available. Predictions were within 10% of measured results in each case, with a non-significant (P = 0.89 difference between mean measured and modeled ETa of 5.4% over all validation sites. Validation and calibration data sets were combined to present a final predictive equation for application across crops and riparian plant associations for monitoring individual irrigation districts or for conducting global water use assessments of mixed agricultural and riparian biomes.

  7. Expansion of the agricultural frontier on riparian vegetation of Santa Cruz River, Cuba

    Directory of Open Access Journals (Sweden)

    Felipe Carricarte Rodríguez

    2016-12-01

    Full Text Available The work was developed in the Los Amaros, the Santa Cruz river, Artemisa, Cuba. The objective was to evaluate how it influences the expansion of the agricultural frontier on riparian vegetation where the semi-deciduous mesophytic forest (BsdMe predominates. A floristic characterization was performed, identifying the effects of disturbances on the structure and composition of these forests and their relation to human disturbance. A semi-structured interview was applied to all landowners in the study area. Species richness, dominance, basal area, total number of individuals, width of the strip covered by trees and shrubs, and area without vegetation on both banks of the river, respectively were considered as variables. There are differences in the structure and patterns of diversity of the studied forest, as a result of disturbances, with the consequent reduction of species; also anthropogenic disturbances, are the main factors that explain changes in the structure of these forests. They are identified as major species: Cupania macrophylla A. Rich., Roystonea regia HBK O. F. Cook., Guarea guidonia L. Sleumer and Trichilia hirta  L. It is proposed to deepen the effect of the expansion of agriculture into other sectors of the river in interaction with local communities.

  8. Carbon Inputs From Riparian Vegetation Limit Oxidation of Physically Bound Organic Carbon Via Biochemical and Thermodynamic Processes

    Science.gov (United States)

    Graham, Emily B.; Tfaily, Malak M.; Crump, Alex R.; Goldman, Amy E.; Bramer, Lisa M.; Arntzen, Evan; Romero, Elvira; Resch, C. Tom; Kennedy, David W.; Stegen, James C.

    2017-12-01

    In light of increasing terrestrial carbon (C) transport across aquatic boundaries, the mechanisms governing organic carbon (OC) oxidation along terrestrial-aquatic interfaces are crucial to future climate predictions. Here we investigate the biochemistry, metabolic pathways, and thermodynamics corresponding to OC oxidation in the Columbia River corridor using ultrahigh-resolution C characterization. We leverage natural vegetative differences to encompass variation in terrestrial C inputs. Our results suggest that decreases in terrestrial C deposition associated with diminished riparian vegetation induce oxidation of physically bound OC. We also find that contrasting metabolic pathways oxidize OC in the presence and absence of vegetation and—in direct conflict with the "priming" concept—that inputs of water-soluble and thermodynamically favorable terrestrial OC protect bound-OC from oxidation. In both environments, the most thermodynamically favorable compounds appear to be preferentially oxidized regardless of which OC pool microbiomes metabolize. In turn, we suggest that the extent of riparian vegetation causes sediment microbiomes to locally adapt to oxidize a particular pool of OC but that common thermodynamic principles govern the oxidation of each pool (i.e., water-soluble or physically bound). Finally, we propose a mechanistic conceptualization of OC oxidation along terrestrial-aquatic interfaces that can be used to model heterogeneous patterns of OC loss under changing land cover distributions.

  9. Multiscale remote sensing analysis to monitor riparian and upland semiarid vegetation

    Science.gov (United States)

    Nguyen, Uyen

    The health of natural vegetation communities is of concern due to observed changes in the climatic-hydrological regime and land cover changes particularly in arid and semiarid regions. Monitoring vegetation at multi temporal and spatial scales can be the most informative approach for detecting change and inferring causal agents of change and remediation strategies. Riparian communities are tightly linked to annual stream hydrology, ground water elevations and sediment transport. These processes are subject to varying magnitudes of disturbance overtime and are candidates for multi-scale monitoring. My first research objective focused on the response of vegetation in the Upper San Pedro River, Arizona, to reduced base flows and climate change. I addressed the correlation between riparian vegetation and hydro-climate variables during the last three decades in one of the remaining undammed rivers in the southwestern U.S. Its riparian forest is threatened by the diminishing base flows, attributed by different studies either to increases in evapotranspiration (ET) due to conversion of grasslands to mesquite shrublands in the adjacent uplands, or to increased regional groundwater pumping to serve growing populations in surrounding urban areas and or to some interactions of those causes. Landsat 5 imagery was acquired for pre- monsoon period, when riparian trees had leafed out but before the arrival of summer monsoon rains in July. The result has showed Normalized Difference Vegetation Index (NDVI) values from both Landsat and Moderate Resolution Imaging Spectrometer (MODIS) had significant decreases which positively correlated to river flows, which decreased over the study period, and negatively correlated with air temperatures, which have increased by about 1.4°C from 1904 to the present. The predictions from other studies that decreased river flows could negatively impact the riparian forest were supported by this study. The pre-monsoon Normalized Different Vegetation

  10. Distinctive channel geometry and riparian vegetation: A geomorphic classification for arid ephemeral streams

    Science.gov (United States)

    Sutfin, N.; Shaw, J. R.; Wohl, E. E.; Cooper, D.

    2012-12-01

    Interactions between hydrology, channel form, and riparian vegetation along arid ephemeral streams are not thoroughly understood and current stream classifications do not adequately represent variability in channel geometry and associated riparian communities. Relatively infrequent hydrologic disturbances in dryland environments are responsible for creation and maintenance of channel form that supports riparian communities. To investigate the influence of channel characteristics on riparian vegetation in the arid southwestern United States, we develop a geomorphic classification for arid ephemeral streams based on the degree of confinement and the composition of confining material that provide constraints on available moisture. Our conceptual model includes five stream types: 1) bedrock channels entirely confined by exposed bedrock and devoid of persistent alluvium; 2) bedrock with alluvium channels at least partially confined by bedrock but containing enough alluvium to create bedforms that persist through time; 3) incised alluvium channels bound only by unconsolidated alluvial material into which they are incised; 4) braided washes that exhibit multi-thread, braided characteristics regardless of the composition of confining material; and 5) piedmont headwater 0-2nd order streams (Strahler) confined only by unconsolidated alluvium and which initiate as secondary channels on piedmont surfaces. Eighty-six study reaches representing the five stream types were surveyed on the U.S. Army Yuma Proving Ground in the Sonoran Desert of southwestern Arizona. Non-parametric multivariate analysis of variance (PERMANOVA) indicates significant differences between the five stream types with regards to channel geometry (i.e., stream gradient, width-to-depth ratio, the ratio between valley width and channel width (Wv/Wc), shear stress, and unit stream power) and riparian vegetation (i.e., presence and canopy coverage by species, canopy stratum, and life form). Discriminant analysis

  11. Repeatability of riparian vegetation sampling methods: how useful are these techniques for broad-scale, long-term monitoring?

    Science.gov (United States)

    Marc C. Coles-Ritchie; Richard C. Henderson; Eric K. Archer; Caroline Kennedy; Jeffrey L. Kershner

    2004-01-01

    Tests were conducted to evaluate variability among observers for riparian vegetation data collection methods and data reduction techniques. The methods are used as part of a largescale monitoring program designed to detect changes in riparian resource conditions on Federal lands. Methods were evaluated using agreement matrices, the Bray-Curtis dissimilarity metric, the...

  12. Noise-driven cooperative dynamics between vegetation and topography in riparian zones

    Science.gov (United States)

    Vesipa, Riccardo; Camporeale, Carlo; Ridolfi, Luca

    2016-04-01

    Riparian ecosystems exhibit complex biotic and abiotic dynamics, where the triad vegetation-sediments-stream determines the eco-geomorphological features of the river landscape. Random fluctuations of the water stage are a key trait of this triad, and a number of behaviors of the fluvial environment can be understood only taking into consideration the role of noise. In fact, in a given plot, vegetation biomass can grow (if the stage is below the plot elevation) or decay (if the stage is above the plot elevation). As a result, biomass exhibits significant temporal variations. In this framework, the capability of vegetation to alter the transect topography (namely, the plot elevation) is crucial. Vegetation can increase the plot elevation by a number of mechanisms (trapping of water- and wind-transported sediment particles, production of organic soil, stabilization of the soil surface). The increment of plot elevation induces the reduction of the plot-specific magnitude, frequency and duration of floods. These more favorable plot-specific hydrological conditions, in turn, induce an increment of biomass. Moreover, the higher the vegetation biomass, the higher the plot elevation increment induced by these mechanisms. In order to elucidate how the stochastically varying water stage and the vegetation-induced topographic alteration shape the bio-morphological characteristics of riparian transects, a stochastic model that takes into account the main links between vegetation, sediments and the stream was adopted. In particular, the capability of vegetation to alter the plot topography was emphasized. In modeling such interactions, the minimalistic approach was pursued. The complex vegetation-sediments-stream interactions were modeled by a set of state-depended stochastic eco-hydraulic equations. The probability density function of vegetation biomass was then analytically evaluated in any transect plot. This pdf strongly depends on the vegetation-topography feedback. We

  13. The influence of connectivity in forest patches, and riparian vegetation width on stream macroinvertebrate fauna

    Directory of Open Access Journals (Sweden)

    IC Valle

    Full Text Available We assessed two dimensions of stream connectivity: longitudinal (between forest patches along the stream and lateral (riparian vegetation, using macroinvertebrate assemblages as bioindicators. Sites representing different land-uses were sampled in a lowland basin that holds a mosaic of protected areas. Land-use analysis, forest successional stages and riparian zone widths were calculated by the GIS analysis. Macroinvertebrate fauna was strongly affected by land-use. We observed a continuous decrease in the number of sensitive species, %Shredders and IBE-IOC biotic index from the upstream protected area to highly deforested sites, increasing again where the stream crosses a Biological Reserve. When analysing buffer strips, we found aquatic fauna responding to land-use alterations beyond the 30 m riparian corridor (60 m and 100 m wide. We discussed the longitudinal connectivity between forest patches and the riparian vegetation buffer strips necessary to hold high macroinvertebrate diversity. We recommend actions for the increase/maintenance of biodiversity in this and other lowland basins.

  14. Importance of considering riparian vegetation requirements for the long-term efficiency of environmental flows in aquatic microhabitats

    Directory of Open Access Journals (Sweden)

    R. Rivaes

    2017-11-01

    Full Text Available Environmental flows remain biased toward the traditional biological group of fish species. Consequently, these flows ignore the inter-annual flow variability that rules species with longer lifecycles and therefore disregard the long-term perspective of the riverine ecosystem. We analyzed the importance of considering riparian requirements for the long-term efficiency of environmental flows. For that analysis, we modeled the riparian vegetation development for a decade facing different environmental flows in two case studies. Next, we assessed the corresponding fish habitat availability of three common fish species in each of the resulting riparian landscape scenarios. Modeling results demonstrated that the environmental flows disregarding riparian vegetation requirements promoted riparian degradation, particularly vegetation encroachment. Such circumstance altered the hydraulic characteristics of the river channel where flow depths and velocities underwent local changes of up to 10 cm and 40 cm s−1, respectively. Accordingly, after a decade of this flow regime, the available habitat area for the considered fish species experienced modifications of up to 110 % when compared to the natural habitat. In turn, environmental flows regarding riparian vegetation requirements were able to maintain riparian vegetation near natural standards, thereby preserving the hydraulic characteristics of the river channel and sustaining the fish habitat close to the natural condition. As a result, fish habitat availability never changed more than 17 % from the natural habitat.

  15. Assessment of hydrological regimes for vegetation on riparian wetlands in Han River Basin, Korea

    Directory of Open Access Journals (Sweden)

    Jaewon Kwak

    2017-01-01

    Full Text Available Hydrological regimes are regarded as one of the major determinants for wetland ecosystems, for they influence species composition, succession, productivity, and stability of vegetation communities. Since Korea launched the Four Major River Restoration Project in 2007, the water regimes of many of the riparian wetlands have changed, that is potentially affecting vegetation properties. For ecological conservation and management, it is important to connect hydrological characteristics and vegetation properties. The objective of this study is to investigate the influence of hydrological regimes on vegetation community, and develop a methodology that can connect them. Inundated exceedance probability (IEP and its district concept are suggested to gain insights into hydrological regimes on the Binae wetland that is rehabilitated by the Restoration Project in 2012 and belong to the riparian zone. Results of this study indicate that the areas with P = 0.08 or lower IEPs should have the disturbance for vegetation communities, or could be changed to a hydrophilic vegetation in the study area, and it should be considered in the restoration and rehabilitation project to conserve legally protected or endangered vegetation.

  16. A Modeling Approach for Evaluating the Coupled Riparian Vegetation-Geomorphic Response to Altered Flow Regimes

    Science.gov (United States)

    Manners, R.; Wilcox, A. C.; Merritt, D. M.

    2016-12-01

    The ecogeomorphic response of riparian ecosystems to a change in hydrologic properties is difficult to predict because of the interactions and feedbacks among plants, water, and sediment. Most riparian models of community dynamics assume a static channel, yet geomorphic processes strongly control the establishment and survival of riparian vegetation. Using a combination of approaches that includes empirical relationships and hydrodynamic models, we model the coupled vegetation-topographic response of three cross-sections on the Yampa and Green Rivers in Dinosaur National Monument, to a shift in the flow regime. The locations represent the variable geomorphology and vegetation composition of these canyon-bound rivers. We account for the inundation and hydraulic properties of vegetation plots surveyed over three years within International River Interface Cooperative (iRIC) Fastmech, equipped with a vegetation module that accounts for flexible stems and plant reconfiguration. The presence of functional groupings of plants, or those plants that respond similarly to environmental factors such as water availability and disturbance are determined from flow response curves developed for the Yampa River. Using field measurements of vegetation morphology, distance from the channel centerline, and dominant particle size and modeled inundation properties we develop an empirical relationship between these variables and topographic change. We evaluate vegetation and channel form changes over decadal timescales, allowing for the integration of processes over time. From our analyses, we identify thresholds in the flow regime that alter the distribution of plants and reduce geomorphic complexity, predominately through side-channel and backwater infilling. Simplification of some processes (e.g., empirically-derived sedimentation) and detailed treatment of others (e.g., plant-flow interactions) allows us to model the coupled dynamics of riparian ecosystems and evaluate the impact of

  17. Riparian vegetation in the alpine connectome: Terrestrial-aquatic and terrestrial-terrestrial interactions.

    Science.gov (United States)

    Zaharescu, Dragos G; Palanca-Soler, Antonio; Hooda, Peter S; Tanase, Catalin; Burghelea, Carmen I; Lester, Richard N

    2017-12-01

    Alpine regions are under increased attention worldwide for their critical role in early biogeochemical cycles, their high sensitivity to environmental change, and as repositories of natural resources of high quality. Their riparian ecosystems, at the interface between aquatic and terrestrial environments, play important geochemical functions in the watershed and are biodiversity hotspots, despite a harsh climate and topographic setting. With climate change rapidly affecting the alpine biome, we still lack a comprehensive understanding of the extent of interactions between riparian surface, lake and catchment environments. A total of 189 glacial - origin lakes were surveyed in the Central Pyrenees to test how key elements of the lake and terrestrial environments interact at different scales to shape riparian plant composition. Secondly, we evaluated how underlying ecotope features drive the formation of natural communities potentially sensitive to environmental change and assessed their habitat distribution. At the macroscale, vegetation composition responded to pan-climatic gradients altitude and latitude, which captured in a narrow geographic area the transition between large European climatic zones. Hydrodynamics was the main catchment-scale factor connecting riparian vegetation with major water fluxes, followed by topography and geomorphology. Lake sediment Mg and Pb, and water Mn and Fe contents reflected local influences from mafic bedrock and soil water saturation. Community analysis identified four keystone ecosystems: (i) damp ecotone, (ii) snow bed-silicate bedrock, (iii) wet heath, and (iv) calcareous substrate. These communities and their connections with ecotope elements could be at risk from a number of environmental change factors including warmer seasons, snow line and lowland species advancement, increased nutrient/metal input and water level fluctuations. The results imply important natural terrestrial-aquatic linkages in the riparian environment

  18. EnviroAtlas - Austin, TX - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. Vegetated cover is defined as Trees & Forest and Grass & Herbaceous. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the EnviroAtlas community area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  19. EnviroAtlas - Cleveland, OH - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. In this community, vegetated cover is defined as Trees & Forest, Grass & Herbaceous, Woody Wetlands, and Emergent Wetlands. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the EnviroAtlas community area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas ) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets)

  20. EnviroAtlas - Paterson, NJ - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. EnviroAtlas defines vegetated buffer for this community as trees and forest and grass and herbaceous. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  1. EnviroAtlas - New York, NY - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. In this community, vegetated cover is defined as Trees & Forest and Grass & Herbaceous. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the EnviroAtlas community area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets)

  2. EnviroAtlas - Des Moines, IA - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. Vegetated cover is defined as Trees & Forest and Grass & Herbaceous. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the EnviroAtlas community area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://enviroatlas.epa.gov/EnviroAtlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets)

  3. EnviroAtlas - Minneapolis/St. Paul, MN - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. In this community, vegetated cover is defined as Trees and Forest, Grass and Herbaceous, Woody Wetlands, and Emergent Wetlands. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the EnviroAtlas community area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  4. Hydraulic and Vegetative Models of Historic Environmental Conditions Isolate the Role of Riparian Vegetation in Inducing Channel Change

    Science.gov (United States)

    Manners, R.; Schmidt, J. C.; Wheaton, J. M.

    2011-12-01

    An enduring question in geomorphology is the role of riparian vegetation in inducing or exacerbating channel narrowing. It is typically difficult to isolate the role of vegetation in causing channel narrowing, because narrowing typically occurs where there are changes in stream flow, sediment supply, the invasion of non-native vegetation, and sometimes climate change. Therefore, linkages between changes in vegetation communities and changes in channel form are often difficult to identify. We took a mechanistic approach to isolate the role of the invasive riparian shrub tamarisk (Tamarix spp) in influencing channel narrowing in the Colorado River basin. Detailed geomorphic reconstructions of two sites on the Yampa and Green Rivers, respectively, in Dinosaur National Monument show that channel narrowing has been progressive and that tamarisk encroachment has also occurred; at the same time, dams have been constructed, diversions increased, and spring snowmelt runoff has been occurring earlier in spring. We simulated hydraulic and sediment transport conditions during the two largest floods of record -- 1984 and 2011. Two-dimensional hydraulic models were built to reflect these conditions and allowed us to perform sensitivity tests to determine the dominant determinants of the observed patterns of erosion and deposition. Channel and floodplain topography were constrained through detailed stratigraphic analysis, including precise dating of deposits based on dating of buried tamarisk plants in a series of floodplain trenches and pits. We also used historical air photos to establish past channel topography. To parameterize the influence of riparian vegetation, we developed a model that links detailed terrestrial laser scan (TLS) measurements of stand structure and its corresponding hydraulic roughness at the patch scale to reach-scale riparian vegetation patterns determined from airborne LiDaR (ALS). This model, in conjunction with maps of the ages and establishment

  5. Spatial Characterization of Riparian Buffer Effects on Sediment Loads from Watershed Systems

    Science.gov (United States)

    Understanding all watershed systems and their interactions is a complex, but critical, undertaking when developing practices designed to reduce topsoil loss and chemical/nutrient transport from agricultural fields. The presence of riparian buffer vegetation in agricultural lands...

  6. Riparian vegetation structure and the hunting behavior of adult estuarine crocodiles.

    Directory of Open Access Journals (Sweden)

    Luke J Evans

    Full Text Available Riparian ecosystems are amongst the most biodiverse tropical habitats. They are important, and essential, ecological corridors, linking remnant forest fragments. In this study, we hypothesised that crocodile's actively select nocturnal resting locations based on increased macaque predation potential. We examined the importance of riparian vegetation structure in the maintenance of crocodile hunting behaviours. Using airborne Light Detection and Ranging (LiDAR and GPS telemetry on animal movement, we identified the repeated use of nocturnal resting sites by adult estuarine crocodiles (Crocodylus porosus throughout the fragmented Lower Kinabatangan Wildlife Sanctuary in Sabah, Malaysia. Crocodile resting locations were found to resemble, in terms of habitat characteristics, the sleeping sites of long-tailed macaque; positioned in an attempt to avoid predation by terrestrial predators. We found individual crocodiles were actively selecting overhanging vegetation and that the protrusion of trees from the tree line was key to site selection by crocodiles, as well as influencing both the presence and group size of sleeping macaques. Although these findings are correlational, they have broad management implications, with the suggestion that riparian corridor maintenance and quality can have implications beyond that of terrestrial fauna. We further place our findings in the context of the wider ecosystem and the maintenance of trophic interactions, and discuss how future habitat management has the potential to mitigate human-wildlife conflict.

  7. EnviroAtlas - Durham, NC - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas ) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets ).

  8. EnviroAtlas - Portland, ME - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  9. EnviroAtlas - New Bedford, MA - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  10. EnviroAtlas - Milwaukee, WI - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  11. EnviroAtlas - Phoenix, AZ - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  12. EnviroAtlas - Woodbine, IA - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  13. EnviroAtlas - Green Bay, WI - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets ).

  14. EnviroAtlas - Portland, OR - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (http:/www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  15. EnviroAtlas - Pittsburgh, PA - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  16. EnviroAtlas - Memphis, TN - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. Vegetated cover is defined as Trees & Forest, Grass & Herbaceous, Woody Wetlands, and Emergent Wetlands. There is a potential for decreased water quality in areas where the riparian buffer is less forested. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the EnviroAtlas community area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  17. EnviroAtlas - Fresno, CA - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  18. EnviroAtlas - Tampa, FL - 51m Riparian Buffer Vegetated Cover

    Science.gov (United States)

    This EnviroAtlas dataset describes the percentage of a 51-m riparian buffer that is vegetated. There is a potential for decreased water quality in areas where the riparian buffer is less vegetated. The displayed line represents the center of the analyzed riparian buffer. The water bodies analyzed include hydrologically connected streams, rivers, connectors, reservoirs, lakes/ponds, ice masses, washes, locks, and rapids within the Atlas Area. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).

  19. The influence of flood frequency, riparian vegetation and threshold on long-term river transport capacity

    Science.gov (United States)

    Croissant, Thomas; Lague, Dimitri; Davy, Philippe

    2016-04-01

    Climate fluctuations at geological timescales control the capacity of rivers to transport sediment with consequences on geochemical cycles, sedimentary basins dynamics and sedimentation/tectonics interactions. While the impact of differential friction generated by riparian vegetation has been studied for individual flood events, its impact on the long-term sediment transport capacity of rivers, modulated by the frequency of floods remains unknown. Here, we investigate this effect on a simplified river-floodplain configuration obeying observed hydraulic scaling laws. We numerically integrate the full-frequency magnitude distribution of discharge events and its impact on the transport capacity of bedload and suspended material for various level of vegetation-linked differential friction. We demonstrate that riparian vegetation by acting as a virtual confinement of the flow i) increases significantly the instantaneous transport capacity of the river independently of the transport mode and ii) increases the long term bedload transport rates as a function of discharge variability. Our results expose the dominance of flood frequency rather than riparian vegetation on the long term sediment transport capacity. Therefore, flood frequency has to be considered when evaluating long-term bedload transport capacity while floodplain vegetation is important only in high discharge variability regimes. By comparing the transport capacity of unconfined alluvial rivers and confined bedrock gorges, we demonstrate that the latter always presents the highest long term transport capacity at equivalent width and slope. The loss of confinement at the transition between bedrock and alluvial river must be compensated by a widening or a steepening of the alluvial channel to avoid infinite storage. Because steepening is never observed in natural system, we compute the alluvial widening factor value that varies between 3 to 11 times the width of the bedrock channel depending on riparian

  20. Effect of the riparian vegetation removal on the trophic network of Neotropical stream fish assemblage

    Directory of Open Access Journals (Sweden)

    Pedro Sartori Manoel

    2018-02-01

    Full Text Available The study of the diet of fish is an important tool to assess different levels of environmental degradation, since the availability of food in the environment is a key factor for the fish occurrence. The removal of riparian vegetation usually degrades environmental quality, as this vegetation has an important role in providing energy to the ecosystem. This study investigates the effects of the removal of riparian vegetation on the fish assemblage trophic network. The study was carried out in two stretches of a southeastern Brazilian stream, one in a forest fragment and another in a pasture, during the wet and dry seasons of 2014. We analyzed the items consumed by each fish species using the frequency of occurrence and area of each item, which were combined to calculate the alimentary index, which was used to determine the food niche overlap of the fish and the specialization index of the trophic network. Aquatic Hexapoda, vegetal debris and organic matter dominated the trophic network of the two stretches. We detected higher values of food niche overlap in the forested stretch and more complex trophic networks in the pasture stretch. We found few seasonal variations in the items consumed and calculated indices in both stretches studied. The presence of grass on the banks in the pasture stretch and the importation of food resources from the upstream area may have provided a higher diversity of resources and consequently showed a more complex trophic network when compared to the forested stretch.

  1. A preliminary riparian/wetland vegetation community classification of the Upper and Middle Rio Grande watersheds in New Mexico

    Science.gov (United States)

    Paula Durkin; Esteban Muldavin; Mike Bradley; Stacey E. Carr

    1996-01-01

    The riparian wetland vegetation communities of the upper and middle Rio Grande watersheds in New Mexico were surveyed in 1992 through 1994. The communities are hierarchically classified in terms of species composition and vegetation structure. The resulting Community Types are related to soil conditions, hydrological regime, and temporal dynamics. The classification is...

  2. Effects of local land-use on riparian vegetation, water quality, and the functional organization of macroinvertebrate assemblages.

    Science.gov (United States)

    Fierro, Pablo; Bertrán, Carlos; Tapia, Jaime; Hauenstein, Enrique; Peña-Cortés, Fernando; Vergara, Carolina; Cerna, Cindy; Vargas-Chacoff, Luis

    2017-12-31

    Land-use change is a principal factor affecting riparian vegetation and river biodiversity. In Chile, land-use change has drastically intensified over the last decade, with native forests converted to exotic forest plantations and agricultural land. However, the effects thereof on aquatic ecosystems are not well understood. Closing this knowledge gap first requires understanding how human perturbations affect riparian and stream biota. Identified biological indicators could then be applied to determine the health of fluvial ecosystems. Therefore, this study investigated the effects of land-use change on the health of riparian and aquatic ecosystems by assessing riparian vegetation, water quality, benthic macroinvertebrate assemblages, and functional feeding groups. Twenty-one sites in catchment areas with different land-uses (i.e. pristine forests, native forests, exotic forest plantations, and agricultural land) were selected and sampled during the 2010 to 2012 dry seasons. Riparian vegetation quality was highest in pristine forests. Per the modified Macroinvertebrate Family Biotic Index for Chilean species, the best conditions existed in native forests and the worst in agricultural catchments. Water quality and macroinvertebrate assemblages significantly varied across land-use areas, with forest plantations and agricultural land having high nutrient concentrations, conductivity, suspended solids, and apparent color. Macroinvertebrate assemblage diversity was lowest for agricultural and exotic forest plantation catchments, with notable non-insect representation. Collector-gatherers were the most abundant functional feeding group, suggesting importance independent of land-use. Land-use areas showed no significant differences in functional feeding groups. In conclusion, anthropogenic land-use changes were detectable through riparian quality, water quality, and macroinvertebrate assemblages, but not through functional feeding groups. These data, particularly the

  3. Remote sensing analysis of riparian vegetation response to desert marsh restoration in the Mexican Highlands

    Science.gov (United States)

    Norman, Laura M.; Villarreal, Miguel; Pulliam, H. Ronald; Minckley, Robert L.; Gass, Leila; Tolle, Cindy; Coe, Michelle

    2014-01-01

    Desert marshes, or cienegas, are extremely biodiverse habitats imperiled by anthropogenic demands for water and changing climates. Given their widespread loss and increased recognition, remarkably little is known about restoration techniques. In this study, we examine the effects of gabions (wire baskets filled with rocks used as dams) on vegetation in the Cienega San Bernardino, in the Arizona, Sonora portion of the US-Mexico border, using a remote-sensing analysis coupled with field data. The Normalized Difference Vegetation Index (NDVI), used here as a proxy for plant biomass, is compared at gabion and control sites over a 27-year period during the driest months (May/June). Over this period, green-up occurred at most sites where there were gabions and at a few of the control sites where gabions had not been constructed. When we statistically controlled for differences among sites in source area, stream order, elevation, and interannual winter rainfall, as well as comparisons of before and after the initiation of gabion construction, vegetation increased around gabions yet did not change (or decreased) where there were no gabions. We found that NDVI does not vary with precipitation inputs prior to construction of gabions but demonstrates a strong response to precipitation after the gabions are built. Field data describing plant cover, species richness, and species composition document increases from 2000 to 2012 and corroborate reestablished biomass at gabions. Our findings validate that gabions can be used to restore riparian vegetation and potentially ameliorate drought conditions in a desert cienega.

  4. Long-term decrease in satellite vegetation indices in response to environmental variables in an iconic desert riparian ecosystem: the Upper San Pedro, Arizona, United States

    Science.gov (United States)

    Nguyen, Uyen; Glenn, Edward P.; Nagler, Pamela L.; Scott, Russell L.

    2015-01-01

    The Upper San Pedro River is one of the few remaining undammed rivers that maintain a vibrant riparian ecosystem in the southwest United States. However, its riparian forest is threatened by diminishing groundwater and surface water inputs, due to either changes in watershed characteristics such as changes in riparian and upland vegetation, or human activities such as regional groundwater pumping. We used satellite vegetation indices to quantify the green leaf density of the groundwater-dependent riparian forest from 1984 to 2012. The river was divided into a southern, upstream (mainly perennial flow) reach and a northern, downstream (mainly intermittent and ephemeral flow) reach. Pre-monsoon (June) Landsat normalized difference vegetation index (NDVI) values showed a 20% drop for the northern reach (P  0·05). NDVI and enhanced vegetation index values were positively correlated (P deterioration of the riparian forest in the northern reach.

  5. Effects of increased flooding on riparian vegetation: Field experiments simulating climate change along five European lowland streams.

    Science.gov (United States)

    Garssen, Annemarie G; Baattrup-Pedersen, Annette; Riis, Tenna; Raven, Bart M; Hoffman, Carl Christian; Verhoeven, Jos T A; Soons, Merel B

    2017-08-01

    In many parts of the world, the magnitude and frequency of cold-season precipitation are expected to increase in the near future. This will result in an increased magnitude and duration of winter and spring flooding by rain-fed streams and rivers. Such climate-driven increases in flooding are likely to affect riparian plant communities, but future vegetation changes are hard to predict due to current lack of data. To fill this knowledge gap, we experimentally modified the hydrology of five streams across three countries in north-western Europe during late winter/early spring over a period of 3 years. We assessed the responses in riparian plant species richness, biomass, plant-available nitrogen and phosphorus and seed deposition to increased flooding depth (+18 cm on average at the lowest positions along the riparian gradient) and prolonged flooding duration (6 weeks on average). After 3 years of increased flooding, there was an overall decline in riparian species richness, while riparian plant biomass increased. Extractable soil nitrogen and phosphorus also increased and are likely to have contributed to the increased biomass. Increased flooding resulted in the arrival of more seeds of additional species to the riparian zone, thereby potentially facilitating the shifts in riparian plant species composition we observed. The results of our concerted experimental effort demonstrate that changes in stream riparian plant communities can occur rapidly following increased winter flooding, leading to strong reductions in plant species diversity. © 2017 The Authors. Global Change Biology published by John Wiley & Sons Ltd.

  6. The role of riparian vegetation density, channel orientation and water velocity in determining river temperature dynamics

    Science.gov (United States)

    Garner, Grace; Malcolm, Iain A.; Sadler, Jonathan P.; Hannah, David M.

    2017-10-01

    A simulation experiment was used to understand the importance of riparian vegetation density, channel orientation and flow velocity for stream energy budgets and river temperature dynamics. Water temperature and meteorological observations were obtained in addition to hemispherical photographs along a ∼1 km reach of the Girnock Burn, a tributary of the Aberdeenshire Dee, Scotland. Data from nine hemispherical images (representing different uniform canopy density scenarios) were used to parameterise a deterministic net radiation model and simulate radiative fluxes. For each vegetation scenario, the effects of eight channel orientations were investigated by changing the position of north at 45° intervals in each hemispheric image. Simulated radiative fluxes and observed turbulent fluxes drove a high-resolution water temperature model of the reach. Simulations were performed under low and high water velocity scenarios. Both velocity scenarios yielded decreases in mean (≥1.6 °C) and maximum (≥3.0 °C) temperature as canopy density increased. Slow-flowing water resided longer within the reach, which enhanced heat accumulation and dissipation, and drove higher maximum and lower minimum temperatures. Intermediate levels of shade produced highly variable energy flux and water temperature dynamics depending on the channel orientation and thus the time of day when the channel was shaded. We demonstrate that in many reaches relatively sparse but strategically located vegetation could produce substantial reductions in maximum temperature and suggest that these criteria are used to inform future river management.

  7. Effects of river ice on bank morphology and riparian vegetation along Peace River, Clayhurst to Fort Vermilion

    International Nuclear Information System (INIS)

    Uunila, L.S.

    1997-01-01

    The effects of river ice and related flooding on the bank morphology and riparian vegetation along 655 km of the Peace River from Clayhurst, British Columbia to Fort Vermilion, Alberta were studied. The river has been regulated for hydroelectric power generation since 1968 and has experienced changes in the hydrologic and ice regimes. The rate of channel adjustments under the new hydrologic regime vary longitudinally, and depend greatly on the succession of riparian vegetation. This study was conducted to determine how much of the variation in both channel adjustment and rate of riparian succession is a result of allogenic effects of ice jams. The direct physical effects of ice and the indirect effects of ice jam flooding on the channel margin were investigated. Long term ice jam severity was found to generally peak well downstream of the principal observation point. The morphology of the channel at the severe ice jam locations fit the classical ice jam criteria of confined tight meanders with several mid-channel islands and shoals. Vegetation damage was the most visible impact to the riparian environment along the Peace River. 27 refs., 1 tab., 8 figs

  8. Post-wildfire natural restoration of riparian vegetation under stable hydro-geomorphic conditions: Nahal Grar, Northern Negev Desert, Israel

    Science.gov (United States)

    Egozi, Roey

    2015-04-01

    Wildfires are common to the Mediterranean region due to its defined dry season and long historical anthropogenic activities. Most of post-wildfire studies focus on mountains areas and thus refer to the hill-slope and its physical characteristics, e.g. morphology, length, angles, and aspect; its soil characteristics, e.g. type, infiltration rate, repellency; and its vegetative covers, e.g. planted trees vs. natural forest or native vs. exotic vegetation. In contrary there is very limited literature focusing on ecological and hydro-geomorphic aspects of post-wildfire of riparian vegetation / zone probably because of its negligible burned area relative to the spread of the fire, sometimes, over the whole watershed area. The limited literature on the topic is surprising given the fact that riparian vegetation zone has been acknowledged as a unique and important habitat supporting rich biodiversity. Herein we report on a wildfire event occurred on October 14th 2009 in a river section of Nahal Grar, Northern Negev Desert, Israel. The wildfire although was limited in its area (only 3 hectare) extended over the channel alone from bank to bank and thus provide a unique case study of completely burn down of riparian vegetation, mainly dense stands of Common Red (Australis Phragmites. Therefore a detailed study of this event provides an opportunity to tackle one of the basics questions which is determining the rate of natural restoration process that act at the immediate time after the wildfire event occurred. This type of information is most valuable to professional and stakeholders for better management of post-fire riparian zones. The results of the study suggest that under stable conditions, i.e. no major flood events occurred; disturbance time was short and ranged over 200 days due to, almost, immediate recovery of the riparian vegetation. However the re-growth of the riparian vegetation was not even but rather deferential and more complex then reported in the literature

  9. Multiscale influence of woody riparian vegetation on fluvial topography quantified with ground-based and airborne lidar

    Science.gov (United States)

    Bywater-Reyes, Sharon; Wilcox, Andrew C.; Diehl, Rebecca M.

    2017-06-01

    Coupling between riparian vegetation and river processes can result in the coevolution of plant communities and channel morphology. Quantifying biotic-abiotic interactions remains difficult because of the challenges in making and analyzing appropriately scaled observations. We measure the influence of woody vegetation on channel topography at the patch and reach scales in a sand bed, dryland river system (Santa Maria River, Arizona) with native Populus and invasive Tamarix. At the patch scale, we use ground-based lidar to relate plant morphology to "tail bars" formed in the lee of vegetation. We find vegetation roughness density (λf) to most influence tail-bar shape and size, suggesting coherent flow structures associated with roughness density are responsible for sediment deposition at this scale. Using airborne lidar, we test whether relationships between topography and vegetation morphology observed at the patch scale are persistent at the reach scale. We find that elevation of the channel (relative to the local mean) covaries with a metric of vegetation density, indicating analogous influences of vegetation density on topography across spatial scales. While these results are expected, our approach provides insight regarding interactions between woody riparian vegetation and channel topography at multiple scales, and a means to quantify such interactions for use in other field settings.

  10. Potential effects of four Flaming Gorge Dam hydropower operational scenarios on riparian vegetation of the Green River, Utah and Colorado

    International Nuclear Information System (INIS)

    LaGory, K.E.; Van Lonkhuyzen, R.A.

    1995-06-01

    Four hydropower operational scenarios at Flaming Gorge Dam were evaluated to determine their potential effects on riparian vegetation along the Green River in Utah and Colorado. Data collected in June 1992 indicated that elevation above the river had the largest influence on plant distribution. A lower riparian zone occupied the area between the approximate elevations of 800 and 4,200-cfs flows--the area within the range of hydropower operational releases. The lower zone was dominated by wetland plants such as cattail, common spikerush, coyote willow, juncus, and carex. An upper riparian zone was above the elevation of historical maximum power plant releases from the dam (4,200 cfs), and it generally supported plants adapted to mesic, nonwetland conditions. Common species in the upper zone included box elder, rabbitbrush, grasses, golden aster, and scouring rush. Multispectral aerial videography of the Green River was collected in May and June 1992 to determine the relationship between flow and the areas of water and the riparian zone. From these relationships, it was estimated that the upper zone would decrease in extent by about 5% with year-round high fluctuation, seasonally adjusted high fluctuation, and seasonally adjusted moderate fluctuation, but it would increase by about 8% under seasonally adjusted steady flow. The lower zone would increase by about 13% for both year-round and seasonally adjusted high fluctuation scenarios but would decrease by about 40% and 74% for seasonally adjusted moderate fluctuation and steady flows, respectively. These changes are considered to be relatively minor and would leave pre-dam riparian vegetation unaffected. Occasional high releases above power plant capacity would be needed for long-term maintenance of this relict vegetation

  11. Integrated monitoring of hydrogeomorphic, vegetative, and edaphic conditions in riparian ecosystems of Great Basin National Park, Nevada

    Science.gov (United States)

    Beever, Erik A.; Pyke, D.A.

    2004-01-01

    In semiarid regions such as the Great Basin, riparian areas function as oases of cooler and more stable microclimates, greater relative humidity, greater structural complexity, and a steady flow of water and nutrients relative to upland areas. These qualities make riparian areaʼs attractive not only to resident and migratory wildlife, but also to visitors in recreation areas such as Great Basin National Park in the Snake Range, east-central Nevada. To expand upon the system of ten permanent plots sampled in 1992 (Smith et al. 1994) and 2001 (Beever et al. in press), we established a collection of 31 cross-sectional transects of 50-m width across the mainstems of Strawberry, Lehman, Baker, and Snake creeks. Our aims in this research were threefold: a) map riparian vegetative communities in greater detail than had been done by past efforts; b) provide a monitoring baseline of hydrogeomorphology; structure, composition, and function of upland- and riparianassociated vegetation; and edaphic properties potentially sensitive to management; and c) test whether instream conditions or physiographic variables predicted vegetation patterns across the four target streams.

  12. The long-term legacy of geomorphic and riparian vegetation feedbacks on the dammed Bill Williams River, Arizona, USA

    Science.gov (United States)

    Kui, Li; Stella, John C.; Shafroth, Patrick B.; House, P. Kyle; Wilcox, Andrew C.

    2017-01-01

    On alluvial rivers, fluvial landforms and riparian vegetation communities codevelop as a result of feedbacks between plants and abiotic processes. The influence of vegetation on river channel and floodplain geomorphology can be particularly strong on dammed rivers with altered hydrology and reduced flood disturbance. We used a 56-year series of aerial photos on the dammed Bill Williams River (Arizona, USA) to investigate how (a) different woody riparian vegetation types influence river channel planform and (b) how different fluvial landforms drive the composition of riparian plant communities over time. We mapped vegetation types and geomorphic surfaces and quantified how relations between fluvial and biotic processes covaried over time using linear mixed models. In the decades after the dam was built, woody plant cover within the river's bottomland nearly doubled, narrowing the active channel by 60% and transforming its planform from wide and braided to a single thread and more sinuous channel. Compared with native cottonwood–willow vegetation, nonnative tamarisk locally induced a twofold greater reduction in channel braiding. Vegetation expanded at different rates depending on the type of landform, with tamarisk cover on former high-flow channels increasing 17% faster than cottonwood–willow. Former low-flow channels with frequent inundation supported a greater increase in cottonwood–willow relative to tamarisk. These findings give insight into how feedbacks between abiotic and biotic processes in river channels accelerate and fortify changes triggered by dam construction, creating river systems increasingly distinct from predam ecological communities and landforms, and progressively more resistant to restoration of predam forms and processes.

  13. Cicada emergence in southwestern riparian forest: Influences of wildfire and vegetation composition

    Science.gov (United States)

    D. Max Smith; Jeffrey Kelly; Deborah M. Finch

    2006-01-01

    Annually emerging cicadas are a numerically and ecologically dominant species in Southwestern riparian forests. Humans have altered disturbance regimes that structure these forests such that floods are less common and wildfires occur more frequently than was historically the case. Impacts of these changes on primary consumers such as riparian cicadas are unknown....

  14. The contribution of riparian vegetation to the stability of agricultural channels banks in the Lombardy plane

    Science.gov (United States)

    Spelta, E.; Chiaradia, E. A.; Bischetti, G. B.

    2009-04-01

    limitations, we have modified the model to account for the distribution of root cohesion (cR) within the soil and the non-simultaneous root breaking: ‘N cR = k′k′′ (Trar)i i=1 where Tr is the tensile strength and ar is the Root Area Ratio (RAR) for roots belonging to diameter class i, N is the number of classes considered, k′ is the factor accounting for the decomposition of root tensile strength and k′′ is a factor accounting for the non-simultaneous breaking of roots. In the present work the modified W&W model has been adopted to estimate the root cohesion due to the riparian vegetation, and the bank stability, for six study sites belonging to two small agricultural channel of the Lombardy plane. The study sites consist of very steep banks (45-50˚ ) with the following riparian vegetation, typical of the considered landscape: Sambucus nigra, Acer campestre, Rubus spp., Populus Canadensis. Several samples of roots have been taken at each site, in order to carry out laboratory tensile strength tests and to develop the strength-diameter relationships, which are requested to estimate the tensile strength of the roots of the different size according to their species. Trenches have been excavated into the bank at each site in order to identify all the roots of different size present at each depth, and to estimate RAR distribution with depth. Estimated root cohesion values for each site have been then used into a bank stability model to evaluate the current Factor of Safety values, that have been compared with those resulting from banks without vegetation. Results show that in the selected cases, riparian vegetation is crucial in determining the stability of the banks. Neglecting the estimated values of cohesion, in fact, banks result extremely unstable, according to their soil properties and their steepness.

  15. Monitoring riparian-vegetation composition and cover along the Colorado River downstream of Glen Canyon Dam, Arizona

    Science.gov (United States)

    Palmquist, Emily C.; Ralston, Barbara E.; Sarr, Daniel A.; Johnson, Taylor C.

    2018-06-05

    Vegetation in the riparian zone (the area immediately adjacent to streams, such as stream banks) along the Colorado River downstream of Glen Canyon Dam, Arizona, supports many ecosystem and societal functions. In both Glen Canyon and Grand Canyon, this ecosystem has changed over time in response to flow alterations, invasive species, and recreational use. Riparian-vegetation cover and composition are likely to continue to change as these pressures persist and new ones emerge. Because this system is a valuable resource that is known to change in response to flow regime and other disturbances, a long-term monitoring protocol has been designed with three primary objectives:Annually measure and summarize the status (composition and cover) of native and non-native vascular-plant species within the riparian zone of the Colorado River between Glen Canyon Dam and Lake Mead.At 5-year intervals, assess change in vegetation composition and cover in the riparian zone, as related to geomorphic setting and dam operations, particularly flow regime.Collect data in a manner that can be used by multiple stakeholders, particularly the basinwide monitoring program overseen by the National Park Service’s Northern Colorado Plateau Network Inventory and Monitoring program.A protocol for the long-term monitoring of riparian vegetation is described in detail and standard operating procedures are included herein for all tasks. Visual estimates of foliar and ground covers are collected in conjunction with environmental measurements to assess correlations of foliar cover with abiotic and flow variables. Sample quadrats are stratified by frequency of inundation, geomorphic feature, and by river segment to account for differences in vegetation type. Photographs of sites are also taken to illustrate qualitative characteristics of the site at the time of sampling. Procedures for field preparation, generating random samples, data collection, data management, collecting and managing unknown

  16. Caloric content of leaves of five tree species from the riparian vegetation in a forest fragment from South Brazil

    Directory of Open Access Journals (Sweden)

    Leandro Fabrício Fiori

    2015-09-01

    Full Text Available Abstract Aim: The measurement of the caloric content evidences the amount of energy that remains in the leaf and that can be released to the aquatic trophic chain. We assessed the energy content of leaves from five riparian tree species of a forest fragment in south Brazil and analyzed whether leaf caloric content varied between leaf species and between seasons (dry and wet. The studied sites are located in Northwest of Paraná State, inside a Semi-Deciduous Forest fragment beside two headwater streams. Methods Sampling sites were located along the riparian vegetation of these two water bodies, and due to its proximity and absence of statistical differences of caloric values, analyzed as one compartment. Results Caloric content varied significantly among species and among all pairs of species, with exception of Nectandra cuspidata Ness and Calophyllum brasiliensis Cambess. Two species presented significant differences between seasons, Sloanea guianensis (Aubl. Ben and Calophyllum brasiliensis Cambess. Conclusions The absence of significant seasonal differences of energy content for some species may be due to the characteristics of the tropical forest, in which temperature did not varied dramatically between seasons. However, the energy differed between species and seasons for some species, emphasizing the necessity of a preliminary inspection of energy content, before tracing energy fluxes instead of using a single value to all species from riparian vegetation.

  17. Comparison of water consumption in two riparian vegetation communities along the central Platte River, Nebraska, 2008–09 and 2011

    Science.gov (United States)

    Hall, Brent M.; Rus, David L.

    2013-01-01

    The Platte River is a vital natural resource for the people, plants, and animals of Nebraska. A recent study quantified water use by riparian woodlands along central reaches of the Platte River, Nebraska, finding that water use was mainly regulated below maximum predicted levels. A comparative study was launched through a cooperative partnership between the U.S. Geological Survey, the Central Platte Natural Resources District, the Nebraska Department of Natural Resources, and the Nebraska Environmental Trust to compare water use of a riparian woodland with that of a grazed riparian grassland along the central Platte River. This report describes the results of the 3-year study by the U.S. Geological Survey to measure the evapotranspiration (ET) rates in the two riparian vegetation communities. Evapotranspiration was measured during 2008–09 and 2011 using the eddy-covariance method at a riparian woodland near Odessa, hereinafter referred to as the “woodland site,” and a riparian grassland pasture near Elm Creek, hereinafter referred to as the “grassland site.” Overall, annual ET totals at the grassland site were 90 percent of the annual ET measured at the woodland site, with averages of 653 millimeters (mm) and 726 mm, respectively. Evapotranspiration rates were similar at the grassland site and the woodland site during the spring and fall seasons, but at the woodland site ET rates were higher than those of the grassland site during the peak-growth summer months of June through August. These seasonal differences and the slightly lower ET rates at the grassland site were likely the result of differing plant communities, disturbance effects related to grazing and flooding, and climatic differences between the sites. The annual water balance was calculated for each site and indicated that the predominant factors in the water balance at both sites were ET and precipitation. Annual precipitation for the study period ranged from near to above the normal

  18. Vegetation development following stream/river restoration: more natural fluvial dynamics and morphology, return of aquatic and riparian plant species?

    Science.gov (United States)

    Soons, M. B.

    2012-04-01

    After centuries of human interventions in stream/river dynamics and morphology aimed at optimizing landscapes for agricultural and industrial purposes, new insights have inspired water managers to try and combine stream and river ecosystem functions with the conservation of biodiversity. Around the world, aquatic and riparian species have declined strongly due to pollution, destruction and fragmentation of their habitat, so that biodiversity conservation initiatives primarily focus on habitat restoration. In the past decades many stream and river restoration projects have been carried out and often hydrological dynamics and morphology have been restored to a more natural state. However, the successful restoration of aquatic and riparian habitats very often failed to result in restoration of their biodiversity. This lack of success from a biodiversity conservation perspective is usually attributed to 'dispersal limitation', meaning that the habitat may be restored, but species fail to reach the site and re-colonize it. Especially re-colonization by aquatic and riparian plant species is important, as such species function as ecosystem engineers: their presence alters fluvial dynamics and morphology, generates additional habitat heterogeneity and provides habitat and food for animal species. Following minor disturbances, re-colonization is often possible through locally remaining populations, by seeds in the seed bank or by surviving plant fragments. However, following major disturbances, colonization and establishment from other source populations are necessary. This usually occurs through dispersal of seeds (and in more aquatic species also by dispersal of vegetative fragments) into the restored wetland area. As dispersal occurs predominantly over short distances and source populations of aquatic and riparian species may be lacking in the surroundings, dispersal may be a limiting factor in the development of aquatic and riparian vegetation at a restored site. But

  19. Co-evolution of Riparian Vegetation and Channel Dynamics in an Aggrading Braided River System, Mount Pinatubo, Philippines

    Science.gov (United States)

    Gran, K. B.; Michal, T.

    2014-12-01

    Increased bank stability by riparian vegetation in braided rivers can decrease bed reworking rates and focus the flow. The magnitude of influence and resulting channel morphology are functions of vegetation strength vs. channel dynamics, a concept encapsulated in a dimensionless ratio between timescales for vegetation growth and channel reworking known as T*. We investigate this relationship in an aggrading braided river at Mount Pinatubo, Philippines, and compare results to numerical and physical models. Gradual reductions in post-eruption sediment loads have reduced bed reworking rates, allowing vegetation to persist year-round and impact channel dynamics on the Pasig-Potrero and Sacobia Rivers. From 2009-2011, we collected data detailing vegetation extent, type, density, and root strength. Incorporating these data into RipRoot and BSTEM models shows cohesion due to roots increased from zero in unvegetated conditions to >10.2 kPa in densely-growing grasses. Field-based parameters were incorporated into a cellular model comparing vegetation growth and sediment mobility effects on braided channel dynamics. The model shows that both low sediment mobility and high vegetation strength lead to less active systems, reflecting trends observed in the field. An estimated T* between 0.8 - 2.3 for the Pasig-Potrero River suggests channels were mobile enough to maintain the braidplain width clear of vegetation and even experience slight gains in area through annual removal of existing vegetation. However, persistent vegetation focused flow and thus aggradation over the unvegetated fraction of braidplain, leading to an aggradational imbalance and transition to a more avulsive state. While physical models predict continued narrowing of the active braidplain as T* declines, the future trajectory of channel-vegetation interactions at Pinatubo as sedimentation rates decline appears more complicated due to strong seasonal variability in precipitation and sediment loads. By 2011

  20. RESPONSE OF RIPARIAN VEGETATION IN AUSTRALIA"S LARGEST RIVER BASIN TO INTER AND INTRA-ANNUAL CLIMATE VARIABILITY AND FLOODING AS QUANTIFIED WITH LANDSAT AND MODIS

    Directory of Open Access Journals (Sweden)

    M. Broich

    2016-06-01

    Full Text Available Australia is a continent subject to high rainfall variability, which has major influences on runoff and vegetation dynamics. However, the resulting spatial-temporal pattern of flooding and its influence on riparian vegetation has not been quantified in a spatially explicit way. Here we focused on the floodplains of the entire Murray-Darling Basin (MDB, an area that covers over 1M km2, as a case study. The MDB is the country’s primary agricultural area with scarce water resources subject to competing demands and impacted by climate change and more recently by the Millennium Drought (1999–2009. Riparian vegetation in the MDB floodplain suffered extensive decline providing a dramatic degradation of riparian vegetation. We quantified the spatial-temporal impact of rainfall, temperature and flooding patters on vegetation dynamics at the subcontinental to local scales and across inter to intra-annual time scales based on three decades of Landsat (25k images, Bureau of Meteorology data and one decade of MODIS data. Vegetation response varied in space and time and with vegetation types, densities and location relative to areas frequently flooded. Vegetation degradation trends were observed over riparian forests and woodlands in areas where flooding regimes have changed to less frequent and smaller inundation extents. Conversely, herbaceous vegetation phenology followed primarily a ‘boom’ and ‘bust’ cycle, related to inter-annual rainfall variability. Spatial patters of vegetation degradation changed along the N-S rainfall gradient but flooding regimes and vegetation degradation patterns also varied at finer scale, highlighting the importance of a spatially explicit, internally consistent analysis and setting the stage for investigating further cross-scale relationships. Results are of interest for land and water management decisions. The approach developed here can be applied to other areas globally such as the Nile river basin and

  1. Passive reestablishment of riparian vegetation following removal of invasive knotweed (Polygonum)

    Science.gov (United States)

    Shannon M. Claeson; Peter A. Bisson

    2013-01-01

    Japanese knotweed and congeners are invasive to North America and Europe and spread aggressively along rivers establishing dense monotypic stands, thereby reducing native riparian plant diversity, structure, and function. Noxious weed control programs attempt to eradicate the knotweed with repeated herbicide applications under the assumption that the system will...

  2. Geomorphic controls on Great Basin riparian vegetation at the watershed and process zone scales

    Science.gov (United States)

    Blake Meneken Engelhardt

    2009-01-01

    Riparian ecosystems supply valuable resources in all landscapes, but especially in semiarid regions such as the Great Basin of the western United States. Over half of Great Basin streams are thought to be in poor ecological condition and further deterioration is of significant concern to stakeholders. A thorough understanding of how physical processes acting at...

  3. Explaining linkages (and lack of) between riparian vegetation biodiversity and geomorphic complexity in restored streams of northern Sweden

    Science.gov (United States)

    Polvi, Lina; Maher Hasselquist, Eliza; Nilsson, Christer

    2014-05-01

    Ecological theory suggests that species richness and habitat heterogeneity are positively correlated; therefore stream restoration often relies on increasing geomorphic complexity to promote biodiversity. However, past studies have failed to demonstrate a link between post-restoration biodiversity and geomorphic complexity. These studies have usually relied on only one metric for quantifying complexity, rather than a holistic metric for complexity that represents several aspects of the channel morphology, and have based their observations in catchments with widespread land-use impacts. We use a geomorphic complexity gradient based on five geomorphic aspects (longitudinal, cross-sectional, planform, sediment texture, and instream wood) to determine whether streams with higher levels of complexity also have greater riparian vegetation biodiversity. We also compare biodiversity values with the potential complexity of reaches based on the large-scale controls of valley and channel gradient and the presence of large glacial legacy sediment (boulders). We focus on tributary channels in boreal forests of northern Sweden, where stream modification associated with log-floating from the 1850s to the 1960s created highly simplified channels. Driven by concerns for fish, restoration began in the 1970s by returning large cobbles and boulders into the main channel from the channel edge, and evolved into 'demonstration restoration,' placing very large boulders and trees into the channel, reopening side channels, and constructing fish spawning areas. We evaluate 22 reaches along tributaries of the Vindel River in northern Sweden with four restoration statuses: channelized, restored, demonstration restored, and unimpacted. Detailed morphologic, sediment, and instream wood data allow calculation of 29 metrics of geomorphic complexity, from which a complexity gradient was identified using multivariate statistics. The percent cover of riparian vegetation was identified in 0.5 x 0.5 m

  4. River flow and riparian vegetation dynamics - implications for management of the Yampa River through Dinosaur National Monument

    Science.gov (United States)

    Scott, Michael L; Friedman, Jonathan M.

    2018-01-01

    This report addresses the relation between flow of the Yampa River and occurrence of herbaceous and woody riparian vegetation in Dinosaur National Monument (DINO) with the goal of informing management decisions related to potential future water development. The Yampa River in DINO flows through diverse valley settings, from the relatively broad restricted meanders of Deerlodge Park to narrower canyons, including debris fan-affected reaches in the upper Yampa Canyon and entrenched meanders in Harding Hole and Laddie Park. Analysis of occurrence of all plant species measured in 1470 quadrats by multiple authors over the last 24 years shows that riparian vegetation along the Yampa River is strongly related to valley setting and geomorphic surfaces, defined here as active channel, active floodplain, inactive floodplain, and upland. Principal Coordinates Ordination arrayed quadrats and species along gradients of overall cover and moisture availability, from upland and inactive floodplain quadrats and associated xeric species like western wheat grass (Pascopyrum smithii), cheatgrass (Bromus tectorum), and saltgrass (Distichlis spicata) to active channel and active floodplain quadrats supporting more mesic species including sandbar willow (Salix exigua), wild licorice (Glycyrrhiza lepidota), and cordgrass (Spartina spp.). Indicator species analysis identified plants strongly correlated with geomorphic surfaces. These species indicate state changes in geomorphic surfaces, such as the conversion of active channel to floodplain during channel narrowing. The dominant woody riparian species along the Yampa River are invasive tamarisk (Tamarix ramosissima), and native Fremont cottonwood (Populus deltoides ssp. wislizenii), box elder (Acer negundo L. var. interius), and sandbar willow (Salix exigua). These species differ in tolerance of drought, salinity, inundation, flood disturbance and shade, and in seed size, timing of seed dispersal and ability to form root sprouts. These

  5. Medium Scale Central Valley Riparian Vegetation and Land Use with Aggregated Delta Veg, 2011 [ds724

    Data.gov (United States)

    California Natural Resource Agency — Geodatabase (SDE) feature class containing map of vegetation along mainstem rivers and major tributaries (including ancillary natural and semi-natural vegetation)...

  6. Potential effects of elevated base flow and midsummer spike flow experiments on riparian vegetation along the Green River

    Science.gov (United States)

    Friedman, Jonathan M.

    2018-01-01

    The Upper Colorado River Endangered Fish Recovery Program has requested experimental flow releases from Flaming Gorge Dam for (1) elevated summer base flows to promote larval endangered Colorado pikeminnow, and (2) midsummer spike flows to disadvantage spawning invasive smallmouth bass. This white paper explores the effects of these proposed flow modifications on riparian vegetation and sediment deposition downstream along the Green River. Although modest in magnitude, the elevated base flows and possible associated reductions in magnitude or duration of peak flows would exacerbate a long-term trend of flow stabilization on the Green River that is already leading to proliferation of vegetation including invasive tamarisk along the channel and associated sediment deposition, channel narrowing and channel simplification. Midsummer spike flows could promote establishment of late-flowering plants like tamarisk. Because channel narrowing and simplification threaten persistence and quality of backwater and side channel features needed by endangered fish, the proposed flow modifications could lead to degradation of fish habitat. Channel narrowing and vegetation encroachment could be countered by increases in peak flows or reductions in base flows in some years and by prescription of rapid flow declines following midsummer spike flows. These strategies for reducing vegetation encroachment would need to be balanced with flow

  7. Effects of riparian vegetation on topographic change during a large flood event, Rio Puerco, New Mexico, USA

    Science.gov (United States)

    Perignon, M. C.; Tucker, G. E.; Griffin, E. R.; Friedman, J. M.

    2013-09-01

    The spatial distribution of riparian vegetation can strongly influence the geomorphic evolution of dryland rivers during large floods. We present the results of an airborne lidar differencing study that quantifies the topographic change that occurred along a 12 km reach of the Lower Rio Puerco, New Mexico, during an extreme event in 2006. Extensive erosion of the channel banks took place immediately upstream of the study area, where tamarisk and sandbar willow had been removed. Within the densely vegetated study reach, we measure a net volumetric change of 578,050 ± ˜ 490,000 m3, with 88.3% of the total aggradation occurring along the floodplain and channel and 76.7% of the erosion focusing on the vertical valley walls. The sediment derived from the devegetated reach deposited within the first 3.6 km of the study area, with depth decaying exponentially with distance downstream. Elsewhere, floodplain sediments were primarily sourced from the erosion of valley walls. Superimposed on this pattern are the effects of vegetation and valley morphology on sediment transport. Sediment thickness is seen to be uniform among sandbar willows and highly variable within tamarisk groves. These reach-scale patterns of sedimentation observed in the lidar differencing likely reflect complex interactions of vegetation, flow, and sediment at the scale of patches to individual plants.

  8. Can riparian vegetation shade mitigate the expected rise in stream temperatures due to climate change during heat waves in a human-impacted pre-alpine river?

    Directory of Open Access Journals (Sweden)

    H. Trimmel

    2018-01-01

    Full Text Available Global warming has already affected European rivers and their aquatic biota, and climate models predict an increase of temperature in central Europe over all seasons. We simulated the influence of expected changes in heat wave intensity during the 21st century on water temperatures of a heavily impacted pre-alpine Austrian river and analysed future mitigating effects of riparian vegetation shade on radiant and turbulent energy fluxes using the deterministic Heat Source model. Modelled stream water temperature increased less than 1.5 °C within the first half of the century. Until 2100, a more significant increase of around 3 °C in minimum, maximum and mean stream temperatures was predicted for a 20-year return period heat event. The result showed clearly that in a highly altered river system riparian vegetation was not able to fully mitigate the predicted temperature rise caused by climate change but would be able to reduce water temperature by 1 to 2 °C. The removal of riparian vegetation amplified stream temperature increases. Maximum stream temperatures could increase by more than 4 °C even in annual heat events. Such a dramatic water temperature shift of some degrees, especially in summer, would indicate a total shift of aquatic biodiversity. The results demonstrate that effective river restoration and mitigation require re-establishing riparian vegetation and emphasize the importance of land–water interfaces and their ecological functioning in aquatic environments.

  9. Influence of Vegetation Structure on Lidar-derived Canopy Height and Fractional Cover in Forested Riparian Buffers During Leaf-Off and Leaf-On Conditions

    Science.gov (United States)

    Wasser, Leah; Day, Rick; Chasmer, Laura; Taylor, Alan

    2013-01-01

    Estimates of canopy height (H) and fractional canopy cover (FC) derived from lidar data collected during leaf-on and leaf-off conditions are compared with field measurements from 80 forested riparian buffer plots. The purpose is to determine if existing lidar data flown in leaf-off conditions for applications such as terrain mapping can effectively estimate forested riparian buffer H and FC within a range of riparian vegetation types. Results illustrate that: 1) leaf-off and leaf-on lidar percentile estimates are similar to measured heights in all plots except those dominated by deciduous compound-leaved trees where lidar underestimates H during leaf off periods; 2) canopy height models (CHMs) underestimate H by a larger margin compared to percentile methods and are influenced by vegetation type (conifer needle, deciduous simple leaf or deciduous compound leaf) and canopy height variability, 3) lidar estimates of FC are within 10% of plot measurements during leaf-on periods, but are underestimated during leaf-off periods except in mixed and conifer plots; and 4) depth of laser pulse penetration lower in the canopy is more variable compared to top of the canopy penetration which may influence within canopy vegetation structure estimates. This study demonstrates that leaf-off lidar data can be used to estimate forested riparian buffer canopy height within diverse vegetation conditions and fractional canopy cover within mixed and conifer forests when leaf-on lidar data are not available. PMID:23382966

  10. Can riparian vegetation shade mitigate the expected rise in stream temperatures due to climate change during heat waves in a human-impacted pre-alpine river?

    Science.gov (United States)

    Trimmel, Heidelinde; Weihs, Philipp; Leidinger, David; Formayer, Herbert; Kalny, Gerda; Melcher, Andreas

    2018-01-01

    Global warming has already affected European rivers and their aquatic biota, and climate models predict an increase of temperature in central Europe over all seasons. We simulated the influence of expected changes in heat wave intensity during the 21st century on water temperatures of a heavily impacted pre-alpine Austrian river and analysed future mitigating effects of riparian vegetation shade on radiant and turbulent energy fluxes using the deterministic Heat Source model. Modelled stream water temperature increased less than 1.5 °C within the first half of the century. Until 2100, a more significant increase of around 3 °C in minimum, maximum and mean stream temperatures was predicted for a 20-year return period heat event. The result showed clearly that in a highly altered river system riparian vegetation was not able to fully mitigate the predicted temperature rise caused by climate change but would be able to reduce water temperature by 1 to 2 °C. The removal of riparian vegetation amplified stream temperature increases. Maximum stream temperatures could increase by more than 4 °C even in annual heat events. Such a dramatic water temperature shift of some degrees, especially in summer, would indicate a total shift of aquatic biodiversity. The results demonstrate that effective river restoration and mitigation require re-establishing riparian vegetation and emphasize the importance of land-water interfaces and their ecological functioning in aquatic environments.

  11. Comparison of sap flux, moisture flux tower and MODIS enhanced vegetation index methods for estimating riparian evapotranspiration

    Science.gov (United States)

    Nagler, Pamela L.; Glenn, Edward P.; Morino, Kiyomi; Neale, Christopher M.U; Cosh, Michael H.

    2010-01-01

    Riparian evapotranspiration (ET) was measured on a salt cedar (Tamarix spp.) dominated river terrace on the Lower Colorado River from 2007 to 2009 using tissue-heat-balance sap flux sensors at six sites representing very dense, medium dense, and sparse stands of plants. Salt cedar ET varied markedly across sites, and sap flux sensors showed that plants were subject to various degrees of stress, detected as mid-day depression of transpiration and stomatal conductance. Sap flux results were scaled from the leaf level of measurement to the stand level by measuring plant-specific leaf area index and fractional ground cover at each site. Results were compared to Bowen ratio moisture tower data available for three of the sites. Sap flux sensors and flux tower results ranked the sites the same and had similar estimates of ET. A regression equation, relating measured ET of salt cedar and other riparian plants and crops on the Lower Colorado River to the Enhanced Vegetation Index from the MODIS sensor on the Terra satellite and reference crop ET measured at meteorological stations, was able to predict actual ET with an accuracy or uncertainty of about 20%, despite between-site differences for salt cedar. Peak summer salt cedar ET averaged about 6 mm d-1 across sites and methods of measurement.

  12. How spatial variation in areal extent and configuration of labile vegetation states affect the riparian bird community in Arctic tundra.

    Directory of Open Access Journals (Sweden)

    John-André Henden

    Full Text Available The Arctic tundra is currently experiencing an unprecedented combination of climate change, change in grazing pressure by large herbivores and growing human activity. Thickets of tall shrubs represent a conspicuous vegetation state in northern and temperate ecosystems, where it serves important ecological functions, including habitat for wildlife. Thickets are however labile, as tall shrubs respond rapidly to both abiotic and biotic environmental drivers. Our aim was to assess how large-scale spatial variation in willow thicket areal extent, configuration and habitat structure affected bird abundance, occupancy rates and species richness so as to provide an empirical basis for predicting the outcome of environmental change for riparian tundra bird communities. Based on a 4-year count data series, obtained through a large-scale study design in low arctic tundra in northern Norway, statistical hierarchical community models were deployed to assess relations between habitat configuration and bird species occupancy and community richness. We found that species abundance, occupancy and richness were greatly affected by willow areal extent and configuration, habitat features likely to be affected by intense ungulate browsing as well as climate warming. In sum, total species richness was maximized in large and tall willow patches of small to intermediate degree of fragmentation. These community effects were mainly driven by responses in the occupancy rates of species depending on tall willows for foraging and breeding, while species favouring other vegetation states were not affected. In light of the predicted climate driven willow shrub encroachment in riparian tundra habitats, our study predicts that many bird species would increase in abundance, and that the bird community as a whole could become enriched. Conversely, in tundra regions where overabundance of large herbivores leads to decreased areal extent, reduced height and increased fragmentation

  13. Survival of Saplings in Recovery of Riparian Vegetation of Pandeiros River (MG)

    OpenAIRE

    Nathalle Cristine Alencar Fagundes; Lílian de Lima Braga; Wesley Alves Silva; Chirley Alves Coutinho; Walter Viana Neves; Ricardo Almeida de Souza; Maria das Dores Magalhães Veloso; Yule Roberta Ferreira Nunes

    2018-01-01

    ABSTRACT This study monitored the survival of saplings planted according to different recovery models in a riparian forest of the Pandeiros river (Januária, MG). The models consisted of planting the saplings in lines of 2 or 4 m with presence (T2S and T4S, respectively) or absence of direct seeding (T2 and T4, respectively). We planted 16,259 saplings of 17 botanical families, 32 genera and 33 species. The saplings, in general, presented a survival rate after one year of 34.4% (±1.8). The spe...

  14. Carbon Inputs From Riparian Vegetation Limit Oxidation of Physically Bound Organic Carbon Via Biochemical and Thermodynamic Processes: OC Oxidation Processes Across Vegetation

    Energy Technology Data Exchange (ETDEWEB)

    Graham, Emily B. [Pacific Northwest National Laboratory, Richland WA USA; Tfaily, Malak M. [Environmental Molecular Sciences Laboratory, Richland WA USA; Crump, Alex R. [Pacific Northwest National Laboratory, Richland WA USA; Goldman, Amy E. [Pacific Northwest National Laboratory, Richland WA USA; Bramer, Lisa M. [Pacific Northwest National Laboratory, Richland WA USA; Arntzen, Evan [Pacific Northwest National Laboratory, Richland WA USA; Romero, Elvira [Pacific Northwest National Laboratory, Richland WA USA; Resch, C. Tom [Pacific Northwest National Laboratory, Richland WA USA; Kennedy, David W. [Pacific Northwest National Laboratory, Richland WA USA; Stegen, James C. [Pacific Northwest National Laboratory, Richland WA USA

    2017-12-01

    In light of increasing terrestrial carbon (C) transport across aquatic boundaries, the mechanisms governing organic carbon (OC) oxidation along terrestrial-aquatic interfaces are crucial to future climate predictions. Here, we investigate biochemistry, metabolic pathways, and thermodynamics corresponding to OC oxidation in the Columbia River corridor. We leverage natural vegetative differences to encompass variation in terrestrial C inputs. Our results suggest that decreases in terrestrial C deposition associated with diminished riparian vegetation induce oxidation of physically-bound (i.e., mineral and microbial) OC at terrestrial-aquatic interfaces. We also find that contrasting metabolic pathways oxidize OC in the presence and absence of vegetation and—in direct conflict with the concept of ‘priming’—that inputs of water-soluble and thermodynamically-favorable terrestrial OC protects bound-OC from oxidation. Based on our results, we propose a mechanistic conceptualization of OC oxidation along terrestrial-aquatic interfaces that can be used to model heterogeneous patterns of OC loss under changing land cover distributions.

  15. Artificial perches as a nucleation technique for restoration of a riparian environment: characterization of the seed rain and of natural regeneration

    Directory of Open Access Journals (Sweden)

    Aline Luiza Tomazi

    2010-09-01

    Full Text Available Riparian habitats are important to the maintenance of ecological processes and environmental services. However, a significant portion of the riparian vegetation in the Brazilian Atlantic forest has been removed in response to increasing human pressure. Therefore, the application of restoration techniques in these habitats becomes essential. In this context, a nucleation model with 18 artificial perches was evaluated for the restoration of a degraded riparian area in Gaspar, Santa Catarina, Brazil, by the characterization of the seed rain and natural regeneration. In two years we collected 21,864 seeds of 51 morphospecies, and recorded 42 colonizing species. Zoochoric seeds belonging to 15 plant families comprised 17% of the seed rain and 19.05% of the spontaneously regenerating plant species. Asteraceae and Poaceae were the most represented families. The artificial perches performed the nucleating function through the increase of zoochoric seed rain. However, possibly due to different barriers that were not evaluated in this study, part of these seeds was not recruited. We recommend the application of this technique for the attraction of dispersers in degraded areas similar to the study site.

  16. Artificial perches as a nucleation technique for restoration of a riparian environment: characterization of the seed rain and of natural regeneration.

    Directory of Open Access Journals (Sweden)

    Aline Luiza Tomazi

    2010-01-01

    Full Text Available Riparian habitats are important to the maintenance of ecological processes and environmental services. However, a significant portion of the riparian vegetation in the Brazilian Atlantic forest has been removed in response to increasing human pressure. Therefore, the application of restoration techniques in these habitats becomes essential. In this context, a nucleation model with 18 artificial perches was evaluated for the restoration of a degraded riparian area in Gaspar, Santa Catarina, Brazil, by the characterization of the seed rain and natural regeneration. In two years we collected 21,864 seeds of 51 morphospecies, and recorded 42 colonizing species. Zoochoric seeds belonging to 15 plant families comprised 17% of the seed rain and 19.05% of the spontaneously regenerating plant species. Asteraceae and Poaceae were the most represented families. The artificial perches performed the nucleating function through the increase of zoochoric seed rain. However, possibly due to different barriers that were not evaluated in this study, part of these seeds was not recruited. We recommend the application of this technique for the attraction of dispersers in degraded areas similar to the study site.

  17. Value of Riparian Vegetation Remnants for Leaf-Litter Ants (Hymenoptera: Formicidae) in a Human-Dominated Landscape in Central Veracruz, Mexico.

    Science.gov (United States)

    García-Martínez, Miguel Á; Escobar-Sarria, Federico; López-Barrera, Fabiola; Castaño-Meneses, Gabriela; Valenzuela-González, Jorge E

    2015-12-01

    Riparian remnants are linear strips of vegetation immediately adjacent to rivers that may act as refuges for biodiversity, depending on their habitat quality. In this study, we evaluated the role of riparian remnants in contributing to the diversity of leaf-litter ants by determining the relationship between ant diversity and several riparian habitat characteristics within a human-dominated landscape in Veracruz, Mexico. Sampling was carried out in 2012 during both dry and rainy seasons at 12 transects 100 m in length, where 10 leaf-litter samples were collected along each transect and processed with Berlese-Tullgren funnels and Winkler sacks. A total of 8,684 individuals belonging to 53 species, 22 genera, and seven subfamilies were collected. The observed mean alpha diversity accounted for 34.4% of the total species recorded and beta diversity for 65.6%. Species richness and composition were significantly related to litter-layer depth and soil compaction, which could limit the distribution of ant species depending on their nesting, feeding, and foraging habits. Riparian remnants can contribute toward the conservation of ant assemblages and likely other invertebrate communities that are threatened by anthropogenic pressures. In human-dominated landscapes where remnants of riparian vegetation give refuge to a diverse array of myrmecofauna, the protection of the few remaining and well-preserved riparian sites is essential for the long-term maintenance of biodiversity. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  18. Survival of Saplings in Recovery of Riparian Vegetation of Pandeiros River (MG

    Directory of Open Access Journals (Sweden)

    Nathalle Cristine Alencar Fagundes

    2018-02-01

    Full Text Available ABSTRACT This study monitored the survival of saplings planted according to different recovery models in a riparian forest of the Pandeiros river (Januária, MG. The models consisted of planting the saplings in lines of 2 or 4 m with presence (T2S and T4S, respectively or absence of direct seeding (T2 and T4, respectively. We planted 16,259 saplings of 17 botanical families, 32 genera and 33 species. The saplings, in general, presented a survival rate after one year of 34.4% (±1.8. The species with highest survival rates were Jacaranda brasiliana, with 85.0% (±13.5 of survival, Anadenanthera colubrina, with 70.1% (±7.0, and Triplaris gardneriana, with 69.3% (±9.1. Survival did not vary between the models tested, probably due to the short evaluation period (12 months.

  19. Characterisation of the impacts of pre- and post- remedial contaminant loads from the Rum Jungle on riparian vegetation and fishes of the Finniss River system

    International Nuclear Information System (INIS)

    Jeffree, R.A.

    2002-01-01

    The status of the riparian vegetation and fish biodiversity in the Finniss River (FR) system is compared before and after remediation at the Rum Jungle (RJ) mine site. Whereas observations recorded during pre-remedial field studies in 1974 indicate no obvious effects of mine effluents on the riparian vegetation in the FR, the impacts in the Eeast Branch were severe. The tolerance to Cu that has been measured in one fish species (Gale et al., submitted) suggests the possibility that the exposure of the fish community to contaminant loadings over more than four decades may have led to the development of tolerance that may also contribute to the ecological recovery that has been observed

  20. Establishing riparian vegetation through use of a self-cleaning siphon system

    Science.gov (United States)

    Mark D. Ankeny; L. Bradford Sumrall; Kuo-Chin Hsu

    1999-01-01

    Storm water or overland flow can be captured and injected into a soil trench or infiltration gallery attached to a siphon and emplaced adjacent to a stream or arroyo bank. This injected soil water can be used by stream side vegetation for wildlife habitat, bank stabilization or other purposes. The siphon system has three hydrologically-distinct flow regimes: (1)...

  1. [Influence of three types of riparian vegetation on fluvial erosion control in Pantanos de Centla, Mexico].

    Science.gov (United States)

    Sepúlveda-Lozada, Alejandra; Geissen, Violette; Ochoa-Gaona, Susana; Jarquín-Sánchez, Aarón; de la Cruz, Simón Hernández; Capetillo, Edward; Zamora-Cornelio, Luis Felipe

    2009-12-01

    Wetlands constitute very important ecological areas. The aim of this study was to quantify the soil losses due to fluvial erosion from 2006 to 2008 in two riverbanks under three types of vegetal coverage dominated by Haematoxylum campechianum, Dalbergia brownei and Brachiaria mutica, in the Pantanos de Centla Biosphere Reserve, SE Mexico. The relationship between the texture, organic matter and pH of soils and soil losses was evaluated. We used erosion sticks to estimate soil losses in 18 plots (three plots per type, three vegetation types, two riverbanks). Soil loss decreased in this order: H. campechianum>B. mutica>D. brownei indicating that D. brownei scrubland has the most potential to retain soil. The higher erosive impact within H. campechianum sites can be related with the low density of these trees in the study areas, as well as the lack of association with other types of vegetation that could reinforce the rooting of the soil profile. Furthermore, soil losses in H. campechianum sites were dependent on soil texture. The soils under this type of vegetal coverage were mainly sandy, which are more vulnerable to the erosive action in comparison with fine textured soils or soils with higher clay content, like the ones found in D. brownei and B. mutica sites. Soil losses of 100 % in the second year (B. mutica plots) can be attributed to the distribution of roots in the upper soil layer and also to livestock management along riverbanks. This study recognizes the importance of D. brownei scrublands in riverbank soil retention. Nevertheless it is necessary to consider the role of an entire vegetal community in future research.

  2. Genetic characterization of two traditional leafy vegetables ...

    African Journals Online (AJOL)

    Genetic characterization of two traditional leafy vegetables (Sesamum radiatum Thonn. ex Hornem and Ceratotheca sesamoides Endl.) of Benin, using flow cytometry and amplified fragment length polymorphism (AFLP) markers. K Adéoti, A Rival, A Dansi, S Santoni, S Brown, T Beule, A Nato, Y Henry, R Vodouhe, L Loko, ...

  3. Heavy metal and trace elements in riparian vegetation and macrophytes associated with lacustrine systems in Northern Patagonia Andean Range.

    Science.gov (United States)

    Juárez, Andrea; Arribére, María A; Arcagni, Marina; Williams, Natalia; Rizzo, Andrea; Ribeiro Guevara, Sergio

    2016-09-01

    Vegetation associated with lacustrine systems in Northern Patagonia was studied for heavy metal and trace element contents, regarding their elemental contribution to these aquatic ecosystems. The research focused on native species and exotic vascular plant Salix spp. potential for absorbing heavy metals and trace elements. The native species studied were riparian Amomyrtus luma, Austrocedrus chilensis, Chusquea culeou, Desfontainia fulgens, Escallonia rubra, Gaultheria mucronata, Lomatia hirsuta, Luma apiculata, Maytenus boaria, Myrceugenia exsucca, Nothofagus antarctica, Nothofagus dombeyi, Schinus patagonicus, and Weinmannia trichosperma, and macrophytes Hydrocotyle chamaemorus, Isöetes chubutiana, Galium sp., Myriophyllum quitense, Nitella sp. (algae), Potamogeton linguatus, Ranunculus sp., and Schoenoplectus californicus. Fresh leaves were analyzed as well as leaves decomposing within the aquatic bodies, collected from lakes Futalaufquen and Rivadavia (Los Alerces National Park), and lakes Moreno and Nahuel Huapi (Nahuel Huapi National Park). The elements studied were heavy metals Ag, As, Cd, Hg, and U, major elements Ca, K, and Fe, and trace elements Ba, Br, Co, Cr, Cs, Hf, Na, Rb, Se, Sr, and Zn. Geochemical tracers La and Sm were also determined to evaluate contamination of the biological tissues by geological particulate (sediment, soil, dust) and to implement concentration corrections.

  4. Scaling of Sediment Dynamics in a Reach-Scale Laboratory Model of a Sand-Bed Stream with Riparian Vegetation

    Science.gov (United States)

    Gorrick, S.; Rodriguez, J. F.

    2011-12-01

    A movable bed physical model was designed in a laboratory flume to simulate both bed and suspended load transport in a mildly sinuous sand-bed stream. Model simulations investigated the impact of different vegetation arrangements along the outer bank to evaluate rehabilitation options. Preserving similitude in the 1:16 laboratory model was very important. In this presentation the scaling approach, as well as the successes and challenges of the strategy are outlined. Firstly a near-bankfull flow event was chosen for laboratory simulation. In nature, bankfull events at the field site deposit new in-channel features but cause only small amounts of bank erosion. Thus the fixed banks in the model were not a drastic simplification. Next, and as in other studies, the flow velocity and turbulence measurements were collected in separate fixed bed experiments. The scaling of flow in these experiments was simply maintained by matching the Froude number and roughness levels. The subsequent movable bed experiments were then conducted under similar hydrodynamic conditions. In nature, the sand-bed stream is fairly typical; in high flows most sediment transport occurs in suspension and migrating dunes cover the bed. To achieve similar dynamics in the model equivalent values of the dimensionless bed shear stress and the particle Reynolds number were important. Close values of the two dimensionless numbers were achieved with lightweight sediments (R=0.3) including coal and apricot pips with a particle size distribution similar to that of the field site. Overall the moveable bed experiments were able to replicate the dominant sediment dynamics present in the stream during a bankfull flow and yielded relevant information for the analysis of the effects of riparian vegetation. There was a potential conflict in the strategy, in that grain roughness was exaggerated with respect to nature. The advantage of this strategy is that although grain roughness is exaggerated, the similarity of

  5. PLANT INVASIONS IN RHODE ISLAND RIPARIAN ZONES

    Science.gov (United States)

    The vegetation in riparian zones provides valuable wildlife habitat while enhancing instream habitat and water quality. Forest fragmentation, sunlit edges, and nutrient additions from adjacent development may be sources of stress on riparian zones. Landscape plants may include no...

  6. Mechanical and Hydrologic Effects of Riparian Vegetation on Critical Conditions for Streambank Stability: Upper Truckee River, California

    Science.gov (United States)

    Simon, A.; Pollen, N. L.; Langendoen, E. J.

    2005-05-01

    The Upper Truckee River is the single largest contributor of sediment to Lake Tahoe with a large proportion of the suspended-sediment load coming from eroding streambanks. Recent advances in quantifying streambank processes highlight the combined effects of hydraulic erosion at the bank toe with geotechnical stability of the upper part of the bank and resulted in the development of a deterministic model of bank-toe erosion and streambank stability (Simon et al., 1999). The use of riparian vegetation in schemes of bank stabilization and stream restoration have become popular but are often implemented on a trial and error basis because of a lack of quantifiable information on the mechanical and hydrologic effects of vegetation on bank stability. This study, conducted along an unstable reach of the Upper Truckee River, combines field data with numerical modeling to quantify (1) hydraulic and geotechnical driving and resisting forces that control bank failures, (2) the mechanical and hydrologic effects of vegetation on shear strength, and (3) the critical conditions for bank stability with and without indigenous riparian species. Tests were conducted using three top-bank treatments: bare (control), Lemmon's willow, and young Lodgepole pine. The susceptibility of the bank toe to erosion by hydraulic forces was quantified by conducting submerged jet tests of in situ material to determine the erodibility coefficient (k) and the critical shear stress of the material. Drained, shear-strength parameters (cohesion and friction angle) of the banks were determined from borehole shear tests at various depths. Pore-water pressure and matric suction were monitored at three depths (30, 100, and 150 cm) with digital tensiometers to calculate changes in apparent cohesion for the period (September 2003 - May 2004) and to differentiate between the hydrologic effects of the two species. Root reinforcement of the two species was quantified by determining the relation between root

  7. Estimates of evapotranspiration for riparian sites (Eucalyptus) in the Lower Murray -Darling Basin using ground validated sap flow and vegetation index scaling techniques

    Science.gov (United States)

    Doody, T.; Nagler, P. L.; Glenn, E. P.

    2014-12-01

    Water accounting is becoming critical globally, and balancing consumptive water demands with environmental water requirements is especially difficult in in arid and semi-arid regions. Within the Murray-Darling Basin (MDB) in Australia, riparian water use has not been assessed across broad scales. This study therefore aimed to apply and validate an existing U.S. riparian ecosystem evapotranspiration (ET) algorithm for the MDB river systems to assist water resource managers to quantify environmental water needs over wide ranges of niche conditions. Ground-based sap flow ET was correlated with remotely sensed predictions of ET, to provide a method to scale annual rates of water consumption by riparian vegetation over entire irrigation districts. Sap flux was measured at nine locations on the Murrumbidgee River between July 2011 and June 2012. Remotely sensed ET was calculated using a combination of local meteorological estimates of potential ET (ETo) and rainfall and MODIS Enhanced Vegetation Index (EVI) from selected 250 m resolution pixels. The sap flow data correlated well with MODIS EVI. Sap flow ranged from 0.81 mm/day to 3.60 mm/day and corresponded to a MODIS-based ET range of 1.43 mm/day to 2.42 mm/day. We found that mean ET across sites could be predicted by EVI-ETo methods with a standard error of about 20% across sites, but that ET at any given site could vary much more due to differences in aquifer and soil properties among sites. Water use was within range of that expected. We conclude that our algorithm developed for US arid land crops and riparian plants is applicable to this region of Australia. Future work includes the development of an adjusted algorithm using these sap flow validated results.

  8. Influence of riparian vegetation on near-bank flow structure and erosion rates on a large meandering river

    Science.gov (United States)

    Konsoer, K. M.; Rhoads, B. L.; Langendoen, E. J.; Johnson, K.; Ursic, M.

    2012-12-01

    Rates of meander migration are dependent upon dynamic interactions between planform geometry, three-dimensional flow structure, sediment transport, and the erodibility and geotechnical properties of the channel banks and floodplains. Riparian vegetation can greatly reduce the rate of migration through root-reinforcement and increased flow resistance near the bank. In particular, forested riverbanks can also provide large woody debris (LWD) to the channel, and if located near the outer bank, can act to amour the bank by disrupting three-dimensional flow patterns and redirecting flow away from the bank-toe, the locus of erosion in meandering rivers. In this paper, three-dimensional flow patterns and migration rates are compared for two meander bends, one forested and one non-forested, on the Wabash River, near Grayville, Illinois. Flow data were obtained using acoustic Doppler current profilers (ADCP) for two large flow events in May and June 2011. LWD was mapped using a terrestrial LiDAR survey, and residence times for the LWD were estimated by comparing the survey data to time-series aerial photography. Rates of migration and planform evolution were determined through time-series analysis of aerial photography from 1938-2011. Results from this study show that near-bank LWD can have a significant influence on flow patterns through a meander bend and can disrupt helical flow near the outer bank, thereby reducing the effect of the high velocity core on the toe of the bank. Additionally, these effects influence migration rates and the planform evolution of meandering rivers.

  9. Riparian Vegetation Response to the March 2008 Short-Duration, High-Flow Experiment-Implications of Timing and Frequency of Flood Disturbance on Nonnative Plant Establishment Along the Colorado River Below Glen Canyon Dam

    Science.gov (United States)

    Ralston, Barbara E.

    2010-01-01

    Riparian plant communities exhibit various levels of diversity and richness. These communities are affected by flooding and are vulnerable to colonization by nonnative species. Since 1996, a series of three high-flow experiments (HFE), or water releases designed to mimic natural seasonal flooding, have been conducted at Glen Canyon Dam, Ariz., primarily to determine the effectiveness of using high flows to conserve sediment, a limited resource. These experiments also provide opportunities to examine the susceptibility of riparian plant communities to nonnative species invasions. The third and most recent HFE was conducted from March 5 to 9, 2008, and scientists with the U.S. Geological Survey's Grand Canyon Monitoring and Research Center examined the effects of high flows on riparian vegetation as part of the overall experiment. Total plant species richness, nonnative species richness, percent plant cover, percent organic matter, and total carbon measured from sediment samples were compared for Grand Canyon riparian vegetation zones immediately following the HFE and 6 months later. These comparisons were used to determine if susceptibility to nonnative species establishment varied among riparian vegetation zones and if the timing of the HFE affected nonnative plant establishment success. The 2008 HFE primarily buried vegetation rather than scouring it. Percent nonnative cover did not differ among riparian vegetation zones; however, in the river corridor affected by Glen Canyon Dam operations, nonnative species richness showed significant variation. For example, species richness was significantly greater immediately after and 6 months following the HFE in the hydrologic zone farthest away from the shoreline, the area that represents the oldest riparian zone within the post-dam riparian area. In areas closer to the river channel, tamarisk (Tamarix ramosissima X chinensis) seedling establishment occurred (tamarisk seed production, or in 1986, a year following several

  10. Development of a high-resolution binational vegetation map of the Santa Cruz River riparian corridor and surrounding watershed, southern Arizona and northern Sonora, Mexico

    Science.gov (United States)

    Wallace, Cynthia S.A.; Villarreal, Miguel L.; Norman, Laura M.

    2011-01-01

    This report summarizes the development of a binational vegetation map developed for the Santa Cruz Watershed, which straddles the southern border of Arizona and the northern border of Sonora, Mexico. The map was created as an environmental input to the Santa Cruz Watershed Ecosystem Portfolio Model (SCWEPM) that is being created by the U.S. Geological Survey for the watershed. The SCWEPM is a map-based multicriteria evaluation tool that allows stakeholders to explore tradeoffs between valued ecosystem services at multiple scales within a participatory decision-making process. Maps related to vegetation type and are needed for use in modeling wildlife habitat and other ecosystem services. Although detailed vegetation maps existed for the U.S. side of the border, there was a lack of consistent data for the Santa Cruz Watershed in Mexico. We produced a binational vegetation classification of the Santa Cruz River riparian habitat and watershed vegetation based on NatureServe Terrestrial Ecological Systems (TES) units using Classification And Regression Tree (CART) modeling. Environmental layers used as predictor data were derived from a seasonal set of Landsat Thematic Mapper (TM) images (spring, summer, and fall) and from a 30-meter digital-elevation-model (DEM) grid. Because both sources of environmental data are seamless across the international border, they are particularly suited to this binational modeling effort. Training data were compiled from existing field data for the riparian corridor and data collected by the NM-GAP (New Mexico Gap Analysis Project) team for the original Southwest Regional Gap Analysis Project (SWReGAP) modeling effort. Additional training data were collected from core areas of the SWReGAP classification itself, allowing the extrapolation of the SWReGAP mapping into the Mexican portion of the watershed without collecting additional training data.

  11. Linking Vegetation Structure and Spider Diversity in Riparian and Adjacent Habitats in Two Rivers of Central Argentina: An Analysis at Two Conceptual Levels.

    Science.gov (United States)

    Griotti, Mariana; Muñoz-Escobar, Christian; Ferretti, Nelson E

    2017-08-01

    The link between vegetation structure and spider diversity has been well explored in the literature. However, few studies have compared spider diversity and its response to vegetation at two conceptual levels: assemblage (species diversity) and ensemble (guild diversity). Because of this, we studied spider diversity in riparian and adjacent habitats of a river system from the Chacoan subregion in central Argentina and evaluated their linkage with vegetation structure at these two levels. To assess vegetation structure, we measured plant species richness and vegetation cover in the herb and shrub - tree layers. We collected spiders for over 6 months by using vacuum netting, sweep netting and pitfall traps. We collected 3,808 spiders belonging to 119 morphospecies, 24 families and 9 guilds. At spider assemblage level, SIMPROF analysis showed significant differences among studied habitats. At spider ensemble level, nevertheless, we found no significant differences among habitats. Concerning the linkage with vegetation structure, BIOENV test showed that spider diversity at either assemblage or ensemble level was not significantly correlated with the vegetation variables assessed. Our results indicated that spider diversity was not affected by vegetation structure. Hence, even though we found a pattern in spider assemblages among habitats, this could not be attributed to vegetation structure. In this study, we show that analyzing a community at two conceptual levels will be useful for recognizing different responses of spider communities to vegetation structure in diverse habitat types. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  12. Changes in soil organic matter compositrion after introduction of riparian vegetation on shores of hydroelectric reservoires (Southeast of Brazil)

    NARCIS (Netherlands)

    Alcantara, de F.A.; Buurman, P.; Curi, N.; Furtini Neto, A.E.; Lagen, van B.; Meijer, E.M.

    2004-01-01

    This work is part of a research program with the general objective of evaluating soil sustainability in areas surrounding hydroelectric reservoirs, which have been planted with riparian forest. The specific aims were: (i) to assess if and how the soil organic matter (SOM) chemical composition has

  13. Downstream effects of stream flow diversion on channel characteristics and riparian vegetation in the Colorado Rocky Mountains, USA

    Science.gov (United States)

    Simeon T. Caskey; Tyanna S. Blaschak; Ellen Wohl; Elizabeth Schnackenberg; David M. Merritt; Kathleen A. Dwire

    2015-01-01

    Flow diversions are widespread and numerous throughout the semi-arid mountains of the western United States. Diversions vary greatly in their structure and ability to divert water, but can alter the magnitude and duration of base and peak flows, depending upon their size and management. Channel geometry and riparian plant communities have adapted to unique hydrologic...

  14. Inorganic matter characterization in vegetable biomass feedstocks

    Energy Technology Data Exchange (ETDEWEB)

    Suarez-Garcia, F.; Martinez-Alonso, A.; Fernandez Llorenta, M.; Tascon, J.M.D. [Instituto Nacional del Carbon, CSIC, Oviedo (Spain)

    2002-06-01

    A combination of techniques was used to characterize the inorganic constituents of four types of vegetable biomass: apple pulp, olive cake, olive tree pruning and thistle. Two methods were used to selectively eliminate organic matter: low-temperature oxidation in an oxygen plasma, and medium-temperature oxidation in air. Inorganic species present in the residues were identified by X-ray diffraction and FT-IR spectroscopy. The combination of these techniques allowed one to detect SiO{sub 2}, CaCO{sub 3} and various other Ca-, Mg-, Na- and K-containing phases as inorganic constituents of the studied biomass residues. It is concluded that the oxygen plasma treatment produces sulphates and nitrates that were not present in the starting material. Medium-temperature oxidation does not produce these artificial species but induces some thermal transformations in the mineral constituents of biomass, so that each technique has its own advantages and disadvantages. 27 refs., 6 figs., 3 tabs.

  15. Ecohydrological consequences of non-native riparian vegetation in the southwestern United States: A review from an ecophysiological perspective

    Science.gov (United States)

    Hultine, K. R.; Bush, S. E.

    2011-07-01

    Protecting water resources for expanding human enterprise while conserving valued natural habitat is among the greatest challenges of the 21st century. Global change processes such as climate change and intensive land use pose significant threats to water resources, particularly in arid regions where potential evapotranspiration far exceeds annual rainfall. Potentially compounding these shortages is the progressive expansion of non-native plant species in riparian areas along streams, canals and rivers in geographically arid regions. This paper sets out to identify when and where non-native riparian plant species are likely to have the highest potential impact on hydrologic fluxes of arid and semiarid river systems. We develop an ecophysiological framework that focuses on two main criteria: (1) examination of the physiological traits that promote non-native species establishment and persistence across environmental gradients, and (2) assessment of where and to what extent hydrologic fluxes are potentially altered by the establishment of introduced species at varying scales from individual plants, to small river reaches, to entire river basins. We highlight three non-native plant species that currently dominate southwestern United States riparian forests. These include tamarisk (Tamarix spp.), Russian olive (Eleagnus angustifolia), and Russian knapweed (Acroptilon repens). As with other recent reviews, we suspect that in many cases the removal of these, and other non-native species will have little or no impact on either streamflow volume or groundwater levels. However, we identify potential exceptions where the expansion of non-native plant species could have significant impact on ecohydrologic processes associated with southwestern United States river systems. Future research needs are outlined that will ultimately assist land managers and policy makers with restoration and conservation priorities to preserve water resources and valued riparian habitat given

  16. Assessment of Vegetation Density and Soil Macrofauna Relationship in Riparian Forest of Karkhe River for the Determination of Rivers Buffer Zone

    Directory of Open Access Journals (Sweden)

    SH. Gholami

    2014-06-01

    Full Text Available The spatial distribution of soil organisms is influenced by the plant cover, thus resulting in a horizontal mosaic of areas subjected to gradients of nutrient availability and microclimatic conditions.This study was conducted to investigate the spatial variability of soil macrofauna in relation to vegetation density in the riparian forest landscape of Karkhe. The vegetation density was determined by calculating the NDVI index. Soil macrofauna were sampled using 200 sampling points along parallel transects (perpendicular to the river. The maximum distance between samples was 0.5 km. Soil macrofauna were extracted from 50 cm×50 cm×25 cm soil monolith by the hand-sorting procedure. Abundance, diversity (Shannon H’ index, richness (Menhinick index and evenness (Sheldon index were calculated. Soil macrofauna and NDVI data were analyzed using geostatistics (variogram in order to describe and quantify the spatial continuity. The variograms were spherical, revealing the presence of spatial autocorrelation. The range of influence was 1724 m for abundance, 1326 m for diversity, 1825 m for richness, 1450 for evenness and 1977 m for NDVI. The kriging maps showed that the NDVI Index and soil macrofauna had spatial variability. The spatial pattern of soil macrofauna abundance and biodiversity were similar to the spatial pattern of vegetation density as shown in the correlation.

  17. META-ANALYSIS OF NITROGEN REMOVAL IN RIPARIAN BUFFERS

    Science.gov (United States)

    Riparian buffer zones, the vegetated region adjacent to streams and wetlands, are thought to be effective at intercepting and controlling nitrogen loads entering water bodies. Riparian buffer width may be positively related to nitrogen removal effectiveness by influencing nitrog...

  18. Assessment of a subtropical riparian forest focusing on botanical, meteorological, ecological characterization and chemical analysis of rainwater

    Directory of Open Access Journals (Sweden)

    Vanessa Graeff

    2018-05-01

    Full Text Available Riparian forests are heterogeneous environments, in which epiphytes find ideal conditions to develop. These plants absorb the necessary nutrients for survival from the atmosphere, and their occurrence and distribution can be influenced by the quality and quantity of precipitation. The objective of this research was to perform an integrated analysis of botanical, meteorological and chemical precipitation parameters so as to compare them in fragments of the riparian forest in the lower (São Leopoldo-SL and upper (Caraá-CA stretches of the Rio dos Sinos Hydrographic Basin (RSHB, RS, Brazil. Rainwater was chemically analyzed, the community structure of epiphytic ferns was surveyed and the ecological characterization was evaluated through the Rapid Habitat Assessment Protocol (RHAP. The results showed that the chemical composition of rainwater is influenced by the environment of each area. In the upper stretch (CA, for instance, the main contribution is that of marine ions, while in the lower stretch (SL, the most impacting aspects are urbanization and industrialization. Similarly, the results depict a reduction of richness and a simplification of the community structure of epiphytic ferns and their environmental quality according to the RHAP categories, towards the base level of the RSHB. The integrated analysis, in which different methods were applied, proved to be an efficient tool to evaluate environmental quality. This analysis considers that a greater number of biotic and abiotic variables may be applied in different scenarios.

  19. Ultrasonic characterization of vegetable oil product

    International Nuclear Information System (INIS)

    Sidek Hj Abd Aziz; Chow Sai Pew; Abdul Halim Shaari; Nor Azizah Shaari

    1992-01-01

    The ultrasonic wave velocity and attenuation of a number vegetable oil products were measured using an ultrasonic pulse echo overlap technique from room temperature up to 90 0 C. Among the liquid samples studied were refined bleach deodorized (RED) palm oil, palm olein, coconut oil, corn oil and soya bean oil. The velocity of sound in vegetable oil products varies from about 1200 to 200 ms-1 and decrease linearly as the temperature increases. The ultrasonic properties of the oil are much dependent on their viscosity, density, relaxation effect and vibrational anharmonicity

  20. Structural characterization of vegetation in the fynbos biome

    CSIR Research Space (South Africa)

    Campbell, BM

    1981-08-01

    Full Text Available A proposed system for the standardization of descriptive terminology for structural characterization of vegetation in the Fynbos Biome is presented in tabular form. Specific applications of the system are described and illustrations of some...

  1. Riparian Inventory

    Data.gov (United States)

    Kansas Data Access and Support Center — This dataset is a digital representation of the 1:24,000 Land Use Riparian Areas Inventory for the state of Kansas. The dataset includes a 100 foot buffer around all...

  2. Reciprocal interactions between fluvial processes and riparian plants at multiple scales: ecogeomorphic feedbacks drive coevolution of floodplain morphology and vegetation communities

    Science.gov (United States)

    Stella, J. C.; Kui, L.; Diehl, R. M.; Bywater-Reyes, S.; Wilcox, A. C.; Shafroth, P. B.; Lightbody, A.

    2017-12-01

    Fluvial forces interact with woody riparian plants in complex ways to influence the coevolution of river morphology and floodplain plant communities. Here, we report on an integrated suite of multi-disciplinary studies that contrast the responses of plants with different morphologies, tamarisk (Tamarix spp.) and cottonwood (Populus fremontii) in terms of (1) differences in vulnerability to scour and burial during floods; (2) interactions and feedbacks between plants and river morphodynamics; and (3) long-term coevolution of river floodplains and riparian communities following flow regulation from dams. The focus of these studies is sand-bed rivers in arid-land regions where invasion by tamarisk has strongly influenced riverine plant communities and geomorphic processes. We complemented a suite of field-scale flume experiments using live seedlings to quantify the initial stages of plant-river interactions with an analysis of long-term vegetation and geomorphic changes along the dammed Bill Williams River (AZ, USA) using time-series air photographs. Vegetation-fluvial interactions varied with plant characteristics, river hydraulics and sediment conditions, across the wide range of scales we investigated. In the flume studies, tamarisk's denser crowns and stiffer stems induced greater sedimentation compared to cottonwood. This resulted in tamarisk's greater mortality from burial as small seedlings under sediment equilibrium conditions but higher relative survival in larger floods under sediment deficit scenarios, in which more cottonwoods were lost to root scour. Sediment deficit conditions, as occurs downstream of dams, induced both greater scour and greater plant loss. With larger size and at higher densities, plants' vulnerability diminished due to greater root anchoring and canopy effects on hydraulics. At the corridor scale, we observed a pattern of plant encroachment during five decades of flow regulation, in which channel narrowing and simplification was more

  3. Stream water responses to timber harvest: Riparian buffer width effectiveness

    Science.gov (United States)

    Barton D. Clinton

    2011-01-01

    Vegetated riparian buffers are critical for protecting aquatic and terrestrial processes and habitats in southern Appalachian ecosystems. In this case study, we examined the effect of riparian buffer width on stream water quality following upland forest management activities in four headwater catchments. Three riparian buffer widths were delineated prior to cutting; 0m...

  4. Restoration of areas degraded by alluvial sand mining: use of soil microbiological activity and plant biomass growth to assess evolution of restored riparian vegetation.

    Science.gov (United States)

    Venson, Graziela R; Marenzi, Rosemeri C; Almeida, Tito César M; Deschamps-Schmidt, Alexandre; Testolin, Renan C; Rörig, Leonardo R; Radetski, Claudemir M

    2017-03-01

    River or alluvial sand mining is causing a variety of environmental problems in the Itajaí-açú river basin in Santa Catarina State (south of Brazil). When this type of commercial activity degrades areas around rivers, environmental restoration programs need to be executed. In this context, the aim of this study was to assess the evolution of a restored riparian forest based on data on the soil microbial activity and plant biomass growth. A reference site and three sites with soil degradation were studied over a 3-year period. Five campaigns were performed to determine the hydrolysis of the soil enzyme fluorescein diacetate (FDA), and the biomass productivity was determined at the end of the studied period. The variation in the enzyme activity for the different campaigns at each site was low, but this parameter did differ significantly according to the site. Well-managed sites showed the highest biomass productivity, and this, in turn, showed a strong positive correlation with soil enzyme activity. In conclusion, soil enzyme activity could form the basis for monitoring and the early prediction of the success of vegetal restoration programs, since responses at the higher level of biological organization take longer, inhibiting the assessment of the project within an acceptable time frame.

  5. Survey of vegetation and its diametric distribution in an area of cerrado sensu stricto and riparian forest fragment at Dois Irmãos stream in the Area of Environmental Protection (APA of Cafuringa, Federal District, Brazil.

    Directory of Open Access Journals (Sweden)

    José Elias de Paula

    2009-09-01

    Full Text Available All individual trees with a diameter at breast height (DBH of over 5cm, as well as the natural succession, were identified in 2,500m2 of the savannah (cerrado sensu stricto area and in 5,000m2 of the “Dois Irmãos” riparian forest vegetation (15º30’19”S and 48º06’18”W. The floristic composition of the cerrado sensu stricto was composed by 100 trees distributed in 25 species, and the riparian forest consisted of 155 trees distributed in 55 species. The natural regeneration was formed with 211 and 287 individuals in the cerrado sensu stricto and riparian forest distributed into 38 and 55 species respectively. The basal areas of the trees occupied 3.40m2.ha-1 in the cerrado sensu stricto and 5.08m2.ha-1 in the riparian forest. The diametric distribution curves for both plant communities, adjusted by the Meyers equation, demonstrated a typical tendency of reversed-J shape with strongly antropic action in the 11 to 17cm diametric classes.

  6. Linking stream flow and groundwater to avian habitat in a desert riparian system.

    Science.gov (United States)

    Merritt, David M; Bateman, Heather L

    2012-10-01

    Increasing human populations have resulted in aggressive water development in arid regions. This development typically results in altered stream flow regimes, reduced annual flow volumes, changes in fluvial disturbance regimes, changes in groundwater levels, and subsequent shifts in ecological patterns and processes. Balancing human demands for water with environmental requirements to maintain functioning ecosystems requires quantitative linkages between water in streams and ecosystem attributes. Streams in the Sonoran Desert provide important habitat for vertebrate species, including resident and migratory birds. Habitat structure, food, and nest-building materials, which are concentrated in riparian areas, are provided directly or indirectly by vegetation. We measured riparian vegetation, groundwater and surface water, habitat structure, and bird occurrence along Cherry Creek, a perennial tributary of the Salt River in central Arizona, USA. The purpose of this work was to develop an integrated model of groundwater-vegetation-habitat structure and bird occurrence by: (1) characterizing structural and provisioning attributes of riparian vegetation through developing a bird habitat index (BHI), (2) validating the utility of our BHI through relating it to measured bird community composition, (3) determining the riparian plant species that best explain the variability in BHI, (4) developing predictive models that link important riparian species to fluvial disturbance and groundwater availability along an arid-land stream, and (5) simulating the effects of changes in flow regime and groundwater levels and determining their consequences for riparian bird communities. Riparian forest and shrubland vegetation cover types were correctly classified in 83% of observations as a function of fluvial disturbance and depth to water table. Groundwater decline and decreased magnitude of fluvial disturbance caused significant shifts in riparian cover types from riparian forest to

  7. Arboreous vegetation of an alluvial riparian forest and their soil relations: Porto Rico island, Paraná river, Brazil

    Directory of Open Access Journals (Sweden)

    Campos João Batista

    2002-01-01

    Full Text Available The dynamics of alluvial deposits in floodplains forms islands and sandbanks. Deposits frequently accumulate at the river margins and on islands with consequent side growths. One of these sandbanks which started to form in 1952 annexed an area of 12.4ha to the Porto Rico island (53masculine15?W and 22masculine45?S. At present a forest fragment of approximately 2.0 ha exists in this place. The structural analysis of arboreous vegetation of this fragment showed a floristic gradient related to the physical and chemical variations of the substratum. High density of pioneer species associated to the absence of recruitment of new individuals of these and other successional categories indicated that the forest was impaired in its succession process. This fact could be associated with constant disturbances caused by cattle in the area.

  8. The Influence of Salmon Recolonization on Riparian Communities in the Cedar River, Washington, USA

    Science.gov (United States)

    Moravek, J.; Clipp, H.; Kiffney, P.

    2016-02-01

    Salmon are a valuable resource throughout the Pacific Northwest, but increasing human activity is degrading coastal ecosystems and threatening local salmon populations. Salmon conservation efforts often focus on habitat restoration, including the re-colonization of salmon into historically obstructed areas such as the Cedar River in Washington, USA. However, to assess the long term implications of salmon re-colonization on a landscape scale, it is critical to consider not only the river ecosystem but also the surrounding riparian habitat. Although prior studies suggest that salmon alter riparian food web dynamics, the riparian community on the Cedar River has not yet been characterized. To investigate possible connections between salmon and the riparian habitat after 12 years of re-colonization, we surveyed riparian spider communities along a gradient of salmon inputs (g/m2). In 10-m transects along the banks of the river, we identified spiders and spider webs, collected prey from webs, and characterized nearby aquatic macroinvertebrate communities. We found that the density of aquatic macroinvertebrates, as well as the density of spider prey, both had significant positive relationships with salmon inputs, supporting the hypothesis that salmon provide energy and nutrients for both aquatic and riparian food webs. We also found that spider diversity significantly decreased with salmon inputs, potentially due to confounding factors such as stream gradient or vegetation structure. Although additional information is needed to fully understand this relationship, the significant connection between salmon inputs and spider diversity is compelling motivation for further studies regarding the link between aquatic and riparian systems on the Cedar River. Understanding the connections between salmon and the riparian community is critical to characterizing the long term, landscape-scale implications of sustainable salmon management in the Pacific Northwest.

  9. Simulated effects of groundwater pumping and artificial recharge on surface-water resources and riparian vegetation in the Verde Valley sub-basin, Central Arizona

    Science.gov (United States)

    Leake, Stanley A.; Pool, Donald R.

    2010-01-01

    In the Verde Valley sub-basin, groundwater use has increased in recent decades. Residents and stakeholders in the area have established several groups to help in planning for sustainability of water and other resources of the area. One of the issues of concern is the effect of groundwater pumping in the sub-basin on surface water and on groundwater-dependent riparian vegetation. The Northern Arizona Regional Groundwater-Flow Model by Pool and others (in press) is the most comprehensive and up-to-date tool available to understand the effects of groundwater pumping in the sub-basin. Using a procedure by Leake and others (2008), this model was modified and used to calculate effects of groundwater pumping on surface-water flow and evapotranspiration for areas in the sub-basin. This report presents results for the upper two model layers for pumping durations of 10 and 50 years. Results are in the form of maps that indicate the fraction of the well pumping rate that can be accounted for as the combined effect of reduced surface-water flow and evapotranspiration. In general, the highest and most rapid responses to pumping were computed to occur near surface-water features simulated in the modified model, but results are not uniform along these features. The results are intended to indicate general patterns of model-computed response over large areas. For site-specific projects, improved results may require detailed studies of the local hydrologic conditions and a refinement of the modified model in the area of interest.

  10. Characterizing meadow vegetation with multitemporal Landsat thematic mapper remote sensing.

    Science.gov (United States)

    Alan A. Ager; Karen E. Owens

    2004-01-01

    Wet meadows are important biological components in the Blue Mountains of eastern Oregon. Many meadows in the Blue Mountains and elsewhere in the Western United States are in a state of change owing to grazing, mining, logging, road development, and other factors. This project evaluated the utility of remotely sensed data to characterize and monitor meadow vegetation...

  11. Methane emissions in Danish riparian wetlands

    DEFF Research Database (Denmark)

    Audet, Joachim; Johansen, Jan Ravn; Andersen, Peter Mejlhede

    2013-01-01

    The present study was conducted to (i) investigate parameters influencing the fluxes of the greenhouse gas methane (CH4) in Danish riparian wetlands with contrasting vegetation characteristics and (ii) develop models relating CH4 emissions to soil and/or vegetation parameters integrating the spat......The present study was conducted to (i) investigate parameters influencing the fluxes of the greenhouse gas methane (CH4) in Danish riparian wetlands with contrasting vegetation characteristics and (ii) develop models relating CH4 emissions to soil and/or vegetation parameters integrating...

  12. Research/Evaluate Restoration of NE Oregon Streams: Effects of Livestock Exclosures (Corridor Fencing) on Riparian Vegetation, Stream Geomorphic Features and Fish Populations; Final Report 2002.

    Energy Technology Data Exchange (ETDEWEB)

    Kauffman, J. Boone

    2002-09-17

    aquatic habitats and associated riparian functions; (2) a means of determining rates of aquatic habitat improvement; and (3) a basis for projecting future trends of habitat recovery. The proposed research is intended to provide an improved understanding of both the effects and effectiveness of a commonly used habitat enhancement approach in the upper Columbia River Basin. This is the exclusion of domestic livestock from streamside communities and streams via corridor fencing (exclosures). This final report is broken into three separate chapters. The first chapter covers the vegetation change associated with livestock exclusion. The second chapter focuses on the physical geomorphic changes to the streambank and channel. The final chapter covers the response of salmonids and warmwater fishes to livestock exclusion at the spatial scales of exclosures as is commonly constructed today. It is expected that this study will provide an important scientific basis, currently lacking, for understanding the ecological principles of restoration/enhancement of sustainable aquatic habitats for salmonids. Thus, the results of this work are likely to have important ramifications for habitat improvement projects within and beyond the general geographic region of northeastern Oregon.

  13. An Application of BLM's Riparian Inventory Procedure to Rangeland Riparian Resources in the Kern and Kaweah River Watersheds

    Science.gov (United States)

    Patricia Gradek; Lawrence Saslaw; Steven Nelson

    1989-01-01

    The Bakersfield District of the Bureau of Land Management conducted an inventory of rangeland riparian systems using a new method developed by a Bureau-wide task force to inventory, monitor and classify riparian areas. Data on vegetation composition were collected for 65 miles of streams and entered into a hierarchical vegetation classification system. Ratings of...

  14. Associations between fish assemblage and riparian vegetation in the Corumbataí River Basin (SP Associações entre assembléia de peixes e a mata ciliar na bacia do rio Corumbataí (SP

    Directory of Open Access Journals (Sweden)

    M. Cetra

    2007-05-01

    Full Text Available This work intends to examine if there are associations between fish species and the state of conservation of the riparian forest in the Corumbataí River Basin. Four main rivers were chosen for this study with three sites on each. Collections were carried out from March to June and from September to December 2001. Multivariate techniques were applied to determine the correlation between species richness and the order of the rivers, preservation level of the riparian forest, shade level, presence or absence of Eucalyptus, sugar cane and pastures, and surrounding declivity stability of the sites. Species richness was highest at locations with greater vegetation cover and preserved riparian forest.Este trabalho teve o objetivo de examinar se existem associações entre as espécies de peixes e o estado de conservação das matas ciliares na bacia do rio Corumbataí. Foram escolhidos 4 rios principais com 3 pontos de coleta em cada um. Foram realizadas coletas nos períodos de março a junho e de setembro a dezembro de 2001. Técnicas multivariadas foram aplicadas para determinar a correlação entre a riqueza de espécies e a ordem dos rios, estado de preservação da mata ciliar, sombreamento, presença ou ausência de Eucalyptus, cana-de-açúcar e pastagens, e nível de estabilidade do barranco ao redor dos pontos de coleta. A riqueza de espécies foi maior em locais com maior cobertura vegetal e mata ciliar preservada.

  15. Nitrate removal in a restored riparian groundwater system: functioning and importance of individual riparian zones

    Directory of Open Access Journals (Sweden)

    S. Peter

    2012-11-01

    Full Text Available For the design and the assessment of river restoration projects, it is important to know to what extent the elimination of reactive nitrogen (N can be improved in the riparian groundwater. We investigated the effectiveness of different riparian zones, characterized by a riparian vegetation succession, for nitrate (NO3 removal from infiltrating river water in a restored and a still channelized section of the river Thur, Switzerland. Functional genes of denitrification (nirS and nosZ were relatively abundant in groundwater from willow bush and mixed forest dominated zones, where oxygen concentrations remained low compared to the main channel and other riparian zones. After flood events, a substantial decline in NO3 concentration (> 50% was observed in the willow bush zone but not in the other riparian zones closer to the river. In addition, the characteristic enrichment of 15N and 18O in the residual NO3 pool (by up to 22‰ for δ15N and up to 12‰ for δ18O provides qualitative evidence that the willow bush and forest zones were sites of active denitrification and, to a lesser extent, NO3 removal by plant uptake. Particularly in the willow bush zone during a period of water table elevation after a flooding event, substantial input of organic carbon into the groundwater occurred, thereby fostering post-flood denitrification activity that reduced NO3 concentration with a rate of ~21 μmol N l−1 d−1. Nitrogen removal in the forest zone was not sensitive to flood pulses, and overall NO3 removal rates were lower (~6 μmol l−1 d−1. Hence, discharge-modulated vegetation–soil–groundwater coupling was found to be a key driver for riparian NO3 removal. We estimated that

  16. Rocky Mountain Riparian Digest

    Science.gov (United States)

    Deborah M. Finch

    2008-01-01

    The Rocky Mountain Riparian Digest presents the many facets of riparian research at the station. Included are articles about protecting the riparian habitat, the social and economic values of riparian environments, watershed restoration, remote sensing tools, and getting kids interested in the science.

  17. Riparian vegetation interacting with river morphology : modelling long-term ecosystem responses to invasive species, climate change, dams and river restoration

    NARCIS (Netherlands)

    van Oorschot, M.

    2017-01-01

    River systems are amongst the most dynamic and productive ecosystems in the world and provide habitats for numerous fluvial species. River flow and river shape determine the conditions that affect plant growth and survival. In turn, riparian plants can actively influence river flow and sedimentation

  18. Coupling legacy geomorphic surface facies to riparian vegetation: Assessing red cedar invasion along the Missouri River downstream of Gavins Point dam, South Dakota

    Science.gov (United States)

    Greene, Samantha L.; Knox, James C.

    2014-01-01

    Floods increase fluvial complexity by eroding established surfaces and creating new alluvial surfaces. As dams regulate channel flow, fluvial complexity often decreases and the hydro-eco-geomorphology of the riparian habitat changes. Along the Missouri River, flow regulation resulted in channel incision of 1-3 m within the study area and disconnected the pre-dam floodplain from the channel. Evidence of fluvial complexity along the pre-dam Missouri River floodplain can be observed through the diverse depositional environments represented by areas of varying soil texture. This study evaluates the role of flow regulation and depositional environment along the Missouri River in the riparian invasion of red cedar downstream of Gavins Point dam, the final dam on the Missouri River. We determine whether invasion began before or after flow regulation, determine patterns of invasion using Bayesian t-tests, and construct a Bayesian multivariate linear model of invaded surfaces. We surveyed 59 plots from 14 riparian cottonwood stands for tree age, plot composition, plot stem density, and soil texture. Red cedars existed along the floodplain prior to regulation, but at a much lower density than today. We found 2 out of 565 red cedars established prior to regulation. Our interpretation of depositional environments shows that the coarser, sandy soils reflect higher energy depositional pre-dam surfaces that were geomorphically active islands and point bars prior to flow regulation and channel incision. The finer, clayey soils represent lower energy depositional pre-dam surfaces, such as swales or oxbow depressions. When determining patterns of invasion for use in a predictive statistical model, we found that red cedar primarily establishes on the higher energy depositional pre-dam surfaces. In addition, as cottonwood age and density decrease, red cedar density tends to increase. Our findings indicate that flow regulation caused hydrogeomorphic changes within the study area that

  19. Vegetation dielectric characterization using an open-ended coaxial probe

    Science.gov (United States)

    Mavrovic, A.; Roy, A.; Royer, A.; Boone, F.; Pappas, C.; Filali, B.

    2017-12-01

    The detection of freeze/thaw (F/T) physical state of soil is one of the main objectives of the SMAP mission as well as one of the secondary objectives of the SMOS mission. Annual F/T cycles have substantial impacts on surface energy budgets, permafrost conditions, as well as forest water and carbon dynamics. It has been shown that spaceborne L-band passive radiometry is a promising tool to monitor F/T due to the substantial differences between the permittivity of water and ice at these frequencies. However, the decoupling of the signal between soil and vegetation components remains challenging for all microwave remote sensing applications at various spatial scales. Radiative transfer models in the microwave domain are generally poorly parameterized to consider the non-negligible contribution of vegetation. The main objective of this research is to assess the skill of a recently developed Open-Ended Coaxial Probe (OECP) to measure the complex microwave permittivity of vegetation and soils and to derive a relation between the impact of vegetation on the microwave signal and the vegetation permittivity that could serve as a validation tool for soil models especially in frozen state. Results show that the OECP is a suitable tool to infer the radial profile of the complex permittivity in L-band of trees. A clear distinction can be made between the dielectric characterization of the sapwood where the permittivity is high because of the high permittivity of water but decrease with depth, and the heartwood where the permittivity is low and relatively constant. The seasonal cycle of the F/T state of the vegetation can also be observed since it is strongly correlated with the permittivity of the wood. The permittivity of a tree over the winter season is very low and homogenous since the permittivity of ice is significantly lower than water and the sap flow is negligible. The fluctuation of the frozen and thawed permittivity for different tree species was evaluated, focusing

  20. Climate change and wildfire effects in aridland riparian ecosystems: An examination of current and future conditions

    Science.gov (United States)

    D. Max Smith; Deborah M. Finch

    2017-01-01

    Aridland riparian ecosystems are limited, the climate is changing, and further hydrological change is likely in the American Southwest. To protect riparian ecosystems and organisms, we need to understand how they are affected by disturbance processes and stressors such as fire, drought, and non-native plant invasions. Riparian vegetation is critically important as...

  1. Soil water nitrate concentrations in giant cane and forest riparian buffer zones

    Science.gov (United States)

    Jon E. Schoonover; Karl W. J. Williard; James J. Zaczek; Jean C. Mangun; Andrew D. Carver

    2003-01-01

    Soil water nitrate concentrations in giant cane and forest riparian buffer zones along Cypress Creek in southern Illinois were compared to determine if the riparian zones were sources or sinks for nitrogen in the rooting zone. Suction lysimeters were used to collect soil water samples from the lower rooting zone in each of the two vegetation types. The cane riparian...

  2. Understanding the Science Behind Riparian Forest Buffers: Effects on Plant and Animal Communities

    OpenAIRE

    Klapproth, Julia C.; Johnson, James E. (James Eric), 1952-

    2009-01-01

    Discusses riparian forests' ability to support many species of wildlife and explains that the importance of a particular riparian area for wildlife will depend on the size of the area, adjoining land uses, riparian vegetation, features inside the area, and the wildlife species of interest.

  3. Assessing Anthropogenic Influence and Edge Effect Influence on Forested Riparian Buffer Spatial Configuration and Structure: An Example Using Lidar Remote Sensing Methods

    Science.gov (United States)

    Wasser, L. A.; Chasmer, L. E.

    2012-12-01

    Forested riparian buffers (FRB) perform numerous critical ecosystem services. However, globally, FRB spatial configuration and structure have been modified by anthropogenic development resulting in widespread ecological degradation as seen in the Gulf of Mexico and the Chesapeake Bay. Riparian corridors within developed areas are particularly vulnerable to disturbance given two edges - the naturally occurring stream edge and the matrix edge. Increased edge length predisposes riparian vegetation to "edge effects", characterized by modified physical and environmental conditions at the interface between the forested buffer and the adjacent landuse, or matrix and forest fragment degradation. The magnitude and distance of edge influence may be further influenced by adjacent landuse type and the width of the buffer corridor at any given location. There is a need to quantify riparian buffer spatial configuration and structure over broad geographic extents and within multiple riparian systems in support of ecologically sound management and landuse decisions. This study thus assesses the influence of varying landuse types (agriculture, suburban development and undeveloped) on forested riparian buffer 3-dimensional structure and spatial configuration using high resolution Light Detection and Ranging (LiDAR) data collected within a headwater watershed. Few studies have assessed riparian buffer structure and width contiguously for an entire watershed, an integral component of watershed planning and restoration efforts such as those conducted throughout the Chesapeake Bay. The objectives of the study are to 1) quantify differences in vegetation structure at the stream and matrix influenced riparian buffer edges, compared to the forested interior and 2) assess continuous patterns of changes in vegetation structure throughout the buffer corridor beginning at the matrix edge and ending at the stream within buffers a) of varying width and b) that are adjacent to varying landuse

  4. Evaluation of the riparian forest state program in Pitangueiras county, Parana

    OpenAIRE

    Peres, Marli Candalaft Alcantara Parra; Universidade Estadual de Londrina/UEL; Ralisch, Ricardo; Universidade Estadual de Londrina/UEL; Ripol, Cristovon Videira; Instituto Paranaense de Assistência Técnica e Extensão Rural do Paraná/EMATER

    2009-01-01

    Riparian forest restoration is fundamental for maintenance of vegetable, animal and human life. The objective of this study was to evaluate the efficiency of a Riparian Forest state program in the enlargement of the riparian forests in Pitangueiras county, state of Paraná, in the period of 2004 to 2006. Concerning the riparian reforestation, it was ansewered the reasons that convinced the farmers to join the program, the main difficulties found in its execution, and their views on environment...

  5. RESEARCH SHOWS IMPORTANCE OF RIPARIAN BUFFERS FOR AQUATIC HEALTH

    Science.gov (United States)

    Issue: Excess nitrogen from fertilizer, septic tanks, animal feedlots, and runoff from pavement can threaten aquatic ecosystem health. Riparian buffers -- the vegetated region adjacent to streams and wetlands -- are thought to be effective at intercepting and controlling excess ...

  6. Oldman river dam mitigation program downstream vegetation project report, Volume II: The potential effects of an operating plan for the Oldman River dam on Riparian cottonwood forests

    Energy Technology Data Exchange (ETDEWEB)

    Mahoney, J.M.

    1993-01-01

    Extensive cottonwood (poplar) forests exist in the Oldman River valley downstream of the Oldman River dam. Studies of similar forests in nearby river valleys and elsewhere on the western prairies have found significant declines of some riparian forests following river damming. This investigation was initiated to determine the causes of cottonwood forest decline downstream from existing dams in southern Alberta; inventory the existing river valley forests in the Oldman Basin; establish study sites in the Oldman River forests to monitor changes in forest status following commissioning of the Oldman River dam, and evaluate the probable impact of proposed operating plans for the Oldman River dam and associated water control structures on downstream forests. This report summarizes the progress made in the analyses of the probable effects on the survival of the forests, including a discussion of the hydrological conditions essential for cottonwood forest regeneration and an explanation of the effects of altering these characteristics on riparian forests; the hydrological alterations expected along various river reaches in the Oldman Basin with the implementation of the proposed OD05 Oldman Dam operating plan; and preliminary analyses of the problem impacts of the OD05 operating plan on the cottonwood forests along these reaches.

  7. Mapping and characterizing the vegetation types of the Democratic Republic of Congo using SPOT VEGETATION time series

    Science.gov (United States)

    Vancutsem, C.; Pekel, J.-F.; Evrard, C.; Malaisse, F.; Defourny, P.

    2009-02-01

    The need for quantitative and accurate information to characterize the state and evolution of vegetation types at a national scale is widely recognized. This type of information is crucial for the Democratic Republic of Congo, which contains the majority of the tropical forest cover of Central Africa and a large diversity of habitats. In spite of recent progress in earth observation capabilities, vegetation mapping and seasonality analysis in equatorial areas still represent an outstanding challenge owing to high cloud coverage and the extent and limited accessibility of the territory. On one hand, the use of coarse-resolution optical data is constrained by performance in the presence of cloud screening and by noise arising from the compositing process, which limits the spatial consistency of the composite and the temporal resolution. On the other hand, the use of high-resolution data suffers from heterogeneity of acquisition dates, images and interpretation from one scene to another. The objective of the present study was to propose and demonstrate a semi-automatic processing method for vegetation mapping and seasonality characterization based on temporal and spectral information from SPOT VEGETATION time series. A land cover map with 18 vegetation classes was produced using the proposed method that was fed by ecological knowledge gathered from botanists and reference documents. The floristic composition and physiognomy of each vegetation type are described using the Land Cover Classification System developed by the FAO. Moreover, the seasonality of each class is characterized on a monthly basis and the variation in different vegetation indicators is discussed from a phenological point of view. This mapping exercise delivers the first area estimates of seven different forest types, five different savannas characterized by specific seasonality behavior and two aquatic vegetation types. Finally, the result is compared to two recent land cover maps derived from

  8. Variable Width Riparian Model Enhances Landscape and Watershed Condition

    Science.gov (United States)

    Abood, S. A.; Spencer, L.

    2017-12-01

    Riparian areas are ecotones that represent about 1% of USFS administered landscape and contribute to numerous valuable ecosystem functions such as wildlife habitat, stream water quality and flows, bank stability and protection against erosion, and values related to diversity, aesthetics and recreation. Riparian zones capture the transitional area between terrestrial and aquatic ecosystems with specific vegetation and soil characteristics which provide critical values/functions and are very responsive to changes in land management activities and uses. Two staff areas at the US Forest Service have coordinated on a two phase project to support the National Forests in their planning revision efforts and to address rangeland riparian business needs at the Forest Plan and Allotment Management Plan levels. The first part of the project will include a national fine scale (USGS HUC-12 digits watersheds) inventory of riparian areas on National Forest Service lands in western United States with riparian land cover, utilizing GIS capabilities and open source geospatial data. The second part of the project will include the application of riparian land cover change and assessment based on selected indicators to assess and monitor riparian areas on annual/5-year cycle basis.This approach recognizes the dynamic and transitional nature of riparian areas by accounting for hydrologic, geomorphic and vegetation data as inputs into the delineation process. The results suggest that incorporating functional variable width riparian mapping within watershed management planning can improve riparian protection and restoration. The application of Riparian Buffer Delineation Model (RBDM) approach can provide the agency Watershed Condition Framework (WCF) with observed riparian area condition on an annual basis and on multiple scales. The use of this model to map moderate to low gradient systems of sufficient width in conjunction with an understanding of the influence of distinctive landscape

  9. The remote characterization of vegetation using Unmanned Aerial Vehicle photography

    Science.gov (United States)

    Rango, A.; Laliberte, A.; Winters, C.; Maxwell, C.; Steele, C.

    2008-12-01

    Unmanned Aerial Vehicles (UAVs) can fly in place of piloted aircraft to gather remote sensing information on vegetation characteristics. The type of sensors flown depends on the instrument payload capacity available, so that, depending on the specific UAV, it is possible to obtain video, aerial photographic, multispectral and hyperspectral radiometric, LIDAR, and radar data. The characteristics of several small UAVs less than 55lbs (25kg)) along with some payload instruments will be reviewed. Common types of remote sensing coverage available from a small, limited-payload UAV are video and hyperspatial, digital photography. From evaluation of these simple types of remote sensing data, we conclude that UAVs can play an important role in measuring and monitoring vegetation health and structure of the vegetation/soil complex in rangelands. If we fly our MLB Bat-3 at an altitude of 700ft (213m), we can obtain a digital photographic resolution of 6cm. The digital images acquired cover an area of approximately 29,350sq m. Video imaging is usually only useful for monitoring the flight path of the UAV in real time. In our experiments with the 6cm resolution data, we have been able to measure vegetation patch size, crown width, gap sizes between vegetation, percent vegetation and bare soil cover, and type of vegetation. The UAV system is also being tested to acquire height of the vegetation canopy using shadow measurements and a digital elevation model obtained with stereo images. Evaluation of combining the UAV digital photography with LIDAR data of the Jornada Experimental Range in south central New Mexico is ongoing. The use of UAVs is increasing and is becoming a very promising tool for vegetation assessment and change, but there are several operational components to flying UAVs that users need to consider. These include cost, a whole set of, as yet, undefined regulations regarding flying in the National Air Space(NAS), procedures to gain approval for flying in the NAS

  10. Metal concentrations in urban riparian sediments along an urbanization gradient

    Science.gov (United States)

    Daniel J. Bain; Ian D. Yesilonis; Richard V. Pouyat

    2012-01-01

    Urbanization impacts fluvial systems via a combination of changes in sediment chemistry and basin hydrology. While chemical changes in urban soils have been well characterized, similar surveys of riparian sediments in urbanized areas are rare. Metal concentrations were measured in sediments collected from riparian areas across the urbanization gradient in Baltimore, MD...

  11. REMM: The Riparian Ecosystem Management Model

    Energy Technology Data Exchange (ETDEWEB)

    Lowrance, R.; Altier, L.S.; Williams, R.G.; Inamdar, S.P.; Sheridan, J.M.; Bosch, D.D.; Hubbard, R.K.; Thomas, D.L.

    2000-03-01

    Riparian buffer zones are effective in mitigating nonpoint source pollution and have been recommended as a best management practice (BMP). The Riparian Ecosystem Management Model (REMM) has been developed for researchers and natural resource agencies as a modeling tool that can help quantify the water quality benefits of riparian buffers under varying site conditions. Processes simulated in REMM include surface and subsurface hydrology; sediment transport and deposition; carbon, nitrogen, and phosphorus transport, removal, and cycling; and vegetation growth. Management options, such as vegetation type, size of the buffer zone, and biomass harvesting also can be simulated. REMM can be used in conjunction with upland models, empirical data, or estimated loadings to examine scenarios of buffer zone design for a hillslope. Evaluation of REMM simulations with field observations shows generally good agreement between simulated and observed data for groundwater nitrate concentrations and water table depths in a mature riparian forest buffer. Sensitivity analysis showed that changes that influenced the water balance or soil moisture storage affected the streamflow output. Parameter changes that influence either hydrology or rates of nutrient cycling affected total N transport and plant N uptake.

  12. The remote characterization of vegetation using Unmanned Aerial Vehicle photography

    Science.gov (United States)

    Unmanned Aerial Vehicles (UAVs) can fly in place of piloted aircraft to gather remote sensing information on vegetation characteristics. The type of sensors flown depends on the instrument payload capacity available, so that, depending on the specific UAV, it is possible to obtain video, aerial phot...

  13. Characterization of Heavy Metals in Vegetables Using Inductive ...

    African Journals Online (AJOL)

    Journal of Applied Sciences and Environmental Management ... Cauliflower and Onion showed high amount of Pb. On the other hand, Cucumber and Cauliflower registered maximum content of Zn. The heavy metal concentration in vegetables was within the prescribed safety limits except Fe owing to iron-rich soil of the ...

  14. Phenological Characterization of Desert Sky Island Vegetation Communities with Remotely Sensed and Climate Time Series Data

    Directory of Open Access Journals (Sweden)

    Stuart E. Marsh

    2010-01-01

    Full Text Available Climate change and variability are expected to impact the synchronicity and interactions between the Sonoran Desert and the forested sky islands which represent steep biological and environmental gradients. The main objectives were to examine how well satellite greenness time series data and derived phenological metrics (e.g., season start, peak greenness can characterize specific vegetation communities across an elevation gradient, and to examine the interactions between climate and phenological metrics for each vegetation community. We found that representative vegetation types (11, varying between desert scrub, mesquite, grassland, mixed oak, juniper and pine, often had unique seasonal and interannual phenological trajectories and spatial patterns. Satellite derived land surface phenometrics (11 for each of the vegetation communities along the cline showed numerous distinct significant relationships in response to temperature (4 and precipitation (7 metrics. Satellite-derived sky island vegetation phenology can help assess and monitor vegetation dynamics and provide unique indicators of climate variability and patterns of change.

  15. On the characterization of vegetation recovery after fire disturbance using Fisher-Shannon analysis and SPOT/VEGETATION Normalized Difference Vegetation Index (NDVI) time series

    Science.gov (United States)

    Lasaponara, Rosa; Lanorte, Antonio; Lovallo, Michele; Telesca, Luciano

    2015-04-01

    Time series can fruitfully support fire monitoring and management from statistical analysis of fire occurrence (Tuia et al. 2008) to danger estimation (lasaponara 2005), damage evaluation (Lanorte et al 2014) and post fire recovery (Lanorte et al. 2014). In this paper, the time dynamics of SPOT-VEGETATION Normalized Difference Vegetation Index (NDVI) time series are analyzed by using the statistical approach of the Fisher-Shannon (FS) information plane to assess and monitor vegetation recovery after fire disturbance. Fisher-Shannon information plane analysis allows us to gain insight into the complex structure of a time series to quantify its degree of organization and order. The analysis was carried out using 10-day Maximum Value Composites of NDVI (MVC-NDVI) with a 1 km × 1 km spatial resolution. The investigation was performed on two test sites located in Galizia (North Spain) and Peloponnese (South Greece), selected for the vast fires which occurred during the summer of 2006 and 2007 and for their different vegetation covers made up mainly of low shrubland in Galizia test site and evergreen forest in Peloponnese. Time series of MVC-NDVI have been analyzed before and after the occurrence of the fire events. Results obtained for both the investigated areas clearly pointed out that the dynamics of the pixel time series before the occurrence of the fire is characterized by a larger degree of disorder and uncertainty; while the pixel time series after the occurrence of the fire are featured by a higher degree of organization and order. In particular, regarding the Peloponneso fire, such discrimination is more evident than in the Galizia fire. This suggests a clear possibility to discriminate the different post-fire behaviors and dynamics exhibited by the different vegetation covers. Reference Lanorte A, R Lasaponara, M Lovallo, L Telesca 2014 Fisher-Shannon information plane analysis of SPOT/VEGETATION Normalized Difference Vegetation Index (NDVI) time series to

  16. Vegetation

    DEFF Research Database (Denmark)

    Epstein, H.E.; Walker, D.A.; Bhatt, U.S.

    2012-01-01

    increased 20-26%. • Increasing shrub growth and range extension throughout the Low Arctic are related to winter and early growing season temperature increases. Growth of other tundra plant types, including graminoids and forbs, is increasing, while growth of mosses and lichens is decreasing. • Increases...... in vegetation (including shrub tundra expansion) and thunderstorm activity, each a result of Arctic warming, have created conditions that favor a more active Arctic fire regime....

  17. Origin vegetation as a parameter for characterization antimicrobial of propolis

    Directory of Open Access Journals (Sweden)

    Sosa-López Ángela Antonia

    2016-05-01

    Full Text Available The propolises are resinous complex sustances produced by bees. Their chemical composition is variable in according to the vegetal source. This study was realized with samples from northeast of Argentina. The aim of work were to check the fungicide and bactericide effects of etanolic solutions of propolis from different sites in Misiones province, on plant pathogens, considering the predominant vegetation in the original areas on the oxidation indexandfenolic compositions. As results in three studied areas the vegetation has been modified anthropically in different form, and the products are corresponding with the introduced flora characteristics, composed of 7 different plant species in El Soberbio, 7 species in El Dorado and 10 species in Apostoles. The physic and chemical proprieties and therapeutic action in propolis from the three collection areas in the Misiones province were similar. The oxidation rate was different in the three study areas (7.37, 1.30 y 18.4, while the phenolic content showed no significant difference. Their antimicrobial activity to probed concentrations (2, 4, 6, 8 y 10 %, don’t were effectives for control on the fungical strains but it is positive by the bacterial control of genus Bacillus.

  18. Evapotranspiration Rates of Riparian Forests, Platte River, Nebraska, 2002-06

    Science.gov (United States)

    Landon, Matthew K.; Rus, David L.; Dietsch, Benjamin J.; Johnson, Michaela R.; Eggemeyer, Kathleen D.

    2009-01-01

    Evapotranspiration (ET) in riparian areas is a poorly understood component of the regional water balance in the Platte River Basin, where competing demands have resulted in water shortages in the ground-water/surface-water system. From April 2002 through March 2006, the U.S. Geological Survey, Nebraska Platte River Cooperative Hydrology Study Group, and Central Platte Natural Resources District conducted a micrometeorological study of water and energy balances at two sites in central Nebraska near Odessa and Gothenburg to improve understanding of ET rates and factors affecting them in Platte River riparian forests. A secondary objective of the study was to constrain estimates of ground-water use by riparian vegetation to satisfy ET consumptive demands, a useful input to regional ground-water flow models. Both study sites are located on large islands within the Platte River characterized by a cottonwood-dominated forest canopy on primarily sandy alluvium. Although both sites are typical of riparian forests along the Platte River in Nebraska, the Odessa understory is dominated by deciduous shrubs, whereas the Gothenburg understory is dominated by eastern redcedars. Additionally, seasonal ground-water levels fluctuated more at Odessa than at Gothenburg. The study period of April 2002 through March 2006 encompassed precipitation conditions ranging from dry to wet. This study characterized the components of the water balance in the riparian zone of each site. ET was evaluated from eddy-covariance sensors installed on towers above the forest canopy at a height of 26.1 meters. Precipitation was measured both above and below the forest canopy. A series of sensors measured soil-moisture availability within the unsaturated zone in two different vertical profiles at each site. Changes in ground-water altitude were evaluated from piezometers. The areal footprint represented in the water balance extended up to 800 meters from each tower. During the study, ET was less variable

  19. Insects of the riparian

    Science.gov (United States)

    Terrence J. Rogers

    1996-01-01

    This paper describes life histories, defoliation problems and other activities of insects associated with forest tree species growing along high elevation streams and river banks. In addition, examples of insects and diseases associated with lower elevation riparian areas are given.

  20. Characterization of subarctic vegetation using ground based remote sensing methods

    Science.gov (United States)

    Finnell, D.; Garnello, A.; Palace, M. W.; Sullivan, F.; Herrick, C.; Anderson, S. M.; Crill, P. M.; Varner, R. K.

    2014-12-01

    Stordalen mire is located at 68°21'N and 19°02'E in the Swedish subarctic. Climate monitoring has revealed a warming trend spanning the past 150 years affecting the mires ability to hold stable palsa/hummock mounds. The micro-topography of the landscape has begun to degrade into thaw ponds changing the vegetation cover from ombrothrophic to minerotrophic. Hummocks are ecologically important due to their ability to act as a carbon sinks. Thaw ponds and sphagnum rich transitional zones have been documented as sources of atmospheric CH4. An objective of this project is to determine if a high resolution three band camera (RGB) and a RGNIR camera could detect differences in vegetation over five different site types. Species composition was collected for 50 plots with ten repetitions for each site type: palsa/hummock, tall shrub, semi-wet, tall graminoid, and wet. Sites were differentiated based on dominating species and features consisting of open water presence, sphagnum spp. cover, graminoid spp. cover, or the presence of dry raised plateaus/mounds. A pole based camera mount was used to collect images at a height of ~2.44m from the ground. The images were cropped in post-processing to fit a one-square meter quadrat. Texture analysis was performed on all images, including entropy, lacunarity, and angular second momentum. Preliminary results suggested that site type influences the number of species present. The p-values for the ability to predict site type using a t-test range from use of a stepwise regression of texture variables, actual vs. predicted percent of vegetation coverage provided R squared values of 0.73, 0.71, 0.67, and 0.89 for C. bigelowii, R. chamaemorus, Sphagnum spp., and open water respectively. These data have provided some support to the notion that texture analyses can be used for classification of mire site types. Future work will involve scaling up from the 50 plots through the use of data collected from two unmanned aerial systems (UAS), as

  1. Using a conceptual model to assess the role of flow regulation in the hydromorphological evolution of riparian corridors

    Science.gov (United States)

    Martínez-Fernández, Vanesa; Gonzalez del Tánago, Marta; García de Jalón, diego

    2017-04-01

    Riparian corridors result from active vegetation-fluvial interactions, which are highly dependent on flow regime conditions and sediment dynamics. Colonization, establishment and survival of species are constrained by fluvial processes which vary according to topographic and sedimentological complexity of the corridor. In order to manage these dynamic and complex riparian systems there is a need for practical tools based on conceptual models. The objective of this study was to apply the conceptual model of riparian corridors lateral zonation in response to the dominant fluvial processes established by Gurnell et al. (2015) and verify its usefulness as a tool for assessing the effect of flow regulation. Two gravel rivers have been selected for this purpose from the north of Spain, the Porma River regulated by Boñar large dam and the unregulated Curueño River. The historical series of flows and the aerial photographs of 1956 and 2011 on which the river corridor has been delimited have been analyzed and identified the permanent inundated zone (1) and four areas of riparian vegetation dominated respectively by fluvial disturbance with coarse sediment erosion and deposition (zone 2), fluvial disturbance with finer sediment deposition (zone 3), inundation (zone 4) and soil moisture regime (zone 5). Likewise, a two-dimensional hydraulic simulation was performed with avenues of different return periods and calculated the prevailing hydraulic conditions (depths, velocities and drag forces) to characterize each of the vegetation zones mentioned in both rivers. The results show that the most active zone 2 (fluvial disturbance dominated showing coarse sediment erosion and deposition) disappears due to the regulation of flows and vegetation encroachment, while the riparian corridor is dominated by the less active zone where the vegetation is maintained by the humidity of sporadic floods and underground runoff. Moreover, by means of the hydraulic simulation we have found a

  2. Biogeomorphic feedbacks within riparian corridors: the role of positive interactions between riparian plants

    Science.gov (United States)

    Corenblit, Dov; Steiger, Johannes; Till-Bottraud, Irène

    2017-04-01

    Riparian vegetation affects hydrogeomorphic processes and leads to the construction of wooded fluvial landforms within riparian corridors. Multiple plants form dense multi- and mono-specific stands that enhance plant resistance as grouped plants are less prone to be uprooted than free-standing individuals. Riparian plants which grow in dense stands also enhance their role as ecosystem engineers through the trapping of sediment, organic matter and nutrients. The wooded biogeomorphic landforms which originate from the effect of vegetation on geomorphology lead in return to an improved capacity of the plants to survive, exploit resources, and reach sexual maturity in the intervals between destructive floods. Thus, these vegetated biogeomorphic landforms likely represent a positive niche construction of riparian plants. The nature and intensity of biotic interactions between riparian plants of different species (inter-specific) or the same species (intra-specific) which form dense stands and construct together the niche remain unclear. We strongly suspect that indirect inter-specific positive interactions (facilitation) occur between plants but that more direct intra-specific interactions, such as cooperation and altruism, also operate during the niche construction process. Our aim is to propose an original theoretical framework of inter and intra-specific positive interactions between riparian plants. We suggest that positive interactions between riparian plants are maximized in river reaches with an intermediate level of hydrogeomorphic disturbance. During establishment, plants that grow within dense stands improve their survival and growth because individuals protect each other from shear stress. In addition to the improved capacity to trap mineral and organic matter, individuals which constitute the dense stand can cooperate to mutually support a mycorrhizal fungi network that will connect plants, soil and ground water and influence nutrient transfer, cycling and

  3. Imidacloprid sorption and transport in cropland, grass buffer and riparian buffer soils

    Science.gov (United States)

    Satkowski, Laura E.; Goyne, Keith W.; Anderson, Stephen H.; Lerch, Robert N.; Allen, Craig R.; Snow, Daniel D.

    2018-01-01

    An understanding of neonicotinoid sorption and transport in soil is critical for determining and mitigating environmental risk associated with the most widely used class of insecticides. The objective of this study was to evaluate mobility and transport of the neonicotinoid imidacloprid (ICD) in soils collected from cropland, grass vegetative buffer strip (VBS), and riparian VBS soils. Soils were collected at six randomly chosen sites within grids that encompassed all three land uses. Single-point equilibrium batch sorption experiments were conducted using radio-labeled (14C) ICD to determine solid–solution partition coefficients (Kd). Column experiments were conducted using soils collected from the three vegetation treatments at one site by packing soil into glass columns. Water flow was characterized by applying Br− as a nonreactive tracer. A single pulse of 14C-ICD was then applied, and ICD leaching was monitored for up to 45 d. Bromide and ICD breakthrough curves for each column were simulated using CXTFIT and HYDRUS-1D models. Sorption results indicated that ICD sorbs more strongly to riparian VBS (Kd = 22.6 L kg−1) than crop (Kd = 11.3 L kg−1) soils. Soil organic C was the strongest predictor of ICD sorption (p < 0.0001). The column transport study found mean peak concentrations of ICD at 5.83, 10.84, and 23.8 pore volumes for crop, grass VBS, and riparian VBS soils, respectively. HYDRUS-1D results indicated that the two-site, one-rate linear reversible model best described results of the breakthrough curves, indicating the complexity of ICD sorption and demonstrating its mobility in soil. Greater sorption and longer retention by the grass and riparian VBS soils than the cropland soil suggests that VBS may be a viable means to mitigate ICD loss from agroecosystems, thereby preventing ICD transport into surface water, groundwater, or drinking water resources.

  4. Characterization of antibiotic resistant and pathogenic Escherichia coli in irrigation water and vegetables in household farms.

    Science.gov (United States)

    Araújo, Susana; A T Silva, Isabel; Tacão, Marta; Patinha, Carla; Alves, Artur; Henriques, Isabel

    2017-09-18

    This study aimed to characterize Escherichia coli present in irrigation water and vegetables from 16 household farms. Isolates were obtained from 50% of water (n=210 isolates) and 38% of vegetable samples (n=239). Phylogroups B1 (56% of isolates) and A (22%) were the most prevalent both in water and vegetables. Diarrheagenic strains were detected in vegetables. Irrespective of the source (i.e. water or vegetables), the most common antibiotic resistance was against streptomycin (89% resistant isolates) and tetracycline (24%). Common acquired genes (e.g. bla TEM , tetA, tetB) were found in isolates from both sources. Class I integrons were detected in water (arrays dfrA1-aadA1 and dfr16-blaP1b-aadA2-ereA) and vegetables (unknown arrays). intI2 was detected in water (dfrA1-sat2-aadA1). Plasmids were detected in 14 isolates (IncFIC, IncFIB, IncFrep, IncI1 in both samples; IncY in vegetables). Plasmids from seven isolates were transferrable by conjugation, conferring resistance to antibiotics to the recipient strain. Multidrug-resistant (MDR) strains were isolated from water (12% of the unique isolates) and vegetables (21%). Predominant sequence types (STs) among MDR isolates were ST10, ST297 and ST2522. In some cases, the same STs and identical clones (as showed by rep-PCR typing) were detected in water and vegetables, suggesting cross-contamination. This study identified several risk factors in E. coli isolates from vegetables and irrigation water, raising health concerns. Also, results suggest that irrigation groundwater constitutes a source of E. coli that may enter the food chain through vegetables ingestion. Copyright © 2017. Published by Elsevier B.V.

  5. Detection and Characterization of Stress Symptoms in Forest Vegetation

    Science.gov (United States)

    Heller, R. C.

    1971-01-01

    Techniques used at the Pacific Southwest Forest and Range Experiment Station to detect advanced and previsual symptoms of vegetative stress are discussed. Stresses caused by bark beetles in coniferous stands of timber are emphasized because beetles induce stress more rapidly than most other destructive agents. Bark beetles are also the most damaging forest insects in the United States. In the work on stress symptoms, there are two primary objectives: (1) to learn the best combination of films, scales, and filters to detect and locate injured trees from aircraft and spacecraft, and (2) to learn if stressed trees can be detected before visual symptoms of decline occur. Equipment and techniques used in a study of the epidemic of the Black Hills bark beetle are described.

  6. Characterization of vertical mixing in oscillatory vegetated flows

    Science.gov (United States)

    Abdolahpour, M.; Ghisalberti, M.; Lavery, P.; McMahon, K.

    2016-02-01

    Seagrass meadows are primary producers that provide important ecosystem services, such as improved water quality, sediment stabilisation and trapping and recycling of nutrients. Most of these ecological services are strongly influenced by the vertical exchange of water across the canopy-water interface. That is, vertical mixing is the main hydrodynamic process governing the large-scale ecological and environmental impact of seagrass meadows. The majority of studies into mixing in vegetated flows have focused on steady flow environments whereas many coastal canopies are subjected to oscillatory flows driven by surface waves. It is known that the rate of mass transfer will vary greatly between unidirectional and oscillatory flows, necessitating a specific investigation of mixing in oscillatory canopy flows. In this study, we conducted an extensive laboratory investigation to characterise the rate of vertical mixing through a vertical turbulent diffusivity (Dt,z). This has been done through gauging the evolution of vertical profiles of concentration (C) of a dye sheet injected into a wave-canopy flow. Instantaneous measurement of the variance of the vertical concentration distribution ( allowed the estimation of a vertical turbulent diffusivity (). Two types of model canopies, rigid and flexible, with identical heights and frontal areas, were subjected to a wide and realistic range of wave height and period. The results showed two important mechanisms that dominate vertical mixing under different conditions: a shear layer that forms at the top of the canopy and wake turbulence generated by the stems. By allowing a coupled contribution of wake and shear layer mixing, we present a relationship that can be used to predict the rate of vertical mixing in coastal canopies. The results further showed that the rate of vertical mixing within flexible vegetation was always lower than the corresponding rigid canopy, confirming the impact of plant flexibility on canopy

  7. [Floristic composition and distribution of the Andean subtropical riparian forests of Lules River, Tucuman, Argentina].

    Science.gov (United States)

    Sirombra, Martín G; Mesa, Leticia M

    2010-03-01

    We studied the floristic composition and distribution of the riparian forest of two hydrographical systems in a subtropical Andean region. Using uni and multivariate techniques, we tested the hypotheses that a differentiable riparian forest exists, composed by native vegetation typical of the Yungas phytogeographical province, and that the distribution of vegetation varied significantly with geomorphologic characteristics. Parallel transects along the water courses were used to collect presence-absence data of vegetation in eleven sites. Detrended Correspondence Analysis defined a group of common riparian species for the studied area (Solanum riparium, Phenax laevigatus, Tipuana tipu, Cestrum parqui, Carica quercifolia, Acacia macracantha, Celtis iguanaea, Juglans australis, Pisoniella arborescens, Baccharis salicifolia, Cinnamomum porphyrium and Eugenia uniflora) and identified two reference sites. The distribution of the riparian vegetation varied significantly with the geomorphic characteristics along the studied sites. Riparian habitats were composed by native and exotic species. A distinct riparian flora, different in structure and function from adjacent terrestrial vegetation, could not be identified. Riparian species were similar to the adjacent terrestrial strata. These species would not be limited by the proximity to the river. Anthropogenic impacts were important factors regulating the introduction and increase of exotic vegetation. The lack of regulation of some activities in the zone could cause serious problems in the integrity of this ecosystem.

  8. Plant biomass and species composition along an environmental gradient in montane riparian meadows

    Science.gov (United States)

    Kathleen A. Dwire; J. Boone Kauffman; E. N. Jack Brookshire; John E. Baham

    2004-01-01

    In riparian meadows, narrow zonation of the dominant vegetation frequently occurs along the elevational gradient from the stream edge to the floodplain terrace. We measured plant species composition and above- and belowground biomass in three riparian plant communities - a priori defined as wet, moist, and dry meadow - along short streamside topographic gradients in...

  9. Flora of the San Pedro Riparian National Conservation Area, Cochise County, Arizona

    Science.gov (United States)

    Elizabeth Makings

    2005-01-01

    The flora of the San Pedro Riparian National Conservation Area (SPRNCA) consists of 618 taxa from 92 families, including a new species of Eriogonum and four new State records. The vegetation communities include Chihuahuan Desertscrub, cottonwood-willow riparian corridors, mesquite terraces, sacaton grasslands, rocky outcrops, and cienegas. Species...

  10. Initial riparian down wood dynamics in relation to thinning and buffer width

    Science.gov (United States)

    Paul D. Anderson; Deanna H. Olson; Adrian. Ares

    2013-01-01

    Down wood plays many functional roles in aquatic and riparian ecosystems. Simplifi cation of forest structure and low abundance of down wood in stream channels and riparian areas is a common legacy of historical management in headwater forests west of the Cascade Range in the US northwest. Contemporary management practices emphasize the implementation of vegetation...

  11. Characterization of Free, Conjugated, and Bound Phenolic Acids in Seven Commonly Consumed Vegetables.

    Science.gov (United States)

    Gao, Yuan; Ma, Shuai; Wang, Meng; Feng, Xiao-Yuan

    2017-11-01

    Phenolic acids are thought to be beneficial for human health and responsible for vegetables' health-promoting properties. Free, conjugated, and bound phenolic acids of seven commonly consumed vegetables, including kidney bean, cow pea, snow pea, hyacinth bean, green soy bean, soybean sprouts and daylily, from the regions of Beijing, Hangzhou, and Guangzhou, were identified and quantified by ultra-performance liquid chromatography-tandem mass spectrometry (UPLC-MS/MS). Three vegetables, namely green soy bean, soybean sprouts, and daylily ( Hemerocallis fulva L.), from the Beijing region contained higher concentrations of total phenolic acids than those from the Hangzhou and Guangzhou regions. The results indicated that the phenolic acid content in the seven vegetables appeared to be species-dependent. The highest content of phenolic acids was found in daylily, followed by green soy bean, while the least amounts were identified in kidney bean and hyacinth bean. Typically, phenolic acids are predominantly found in conjugated forms. Principle component analysis (PCA) revealed some key compounds that differentiated the seven vegetables. Green soy bean, compared to the other six vegetables, was characterized by higher levels of syringic acid, ferulic acid, vanillic acid, and sinapic acid. Other compounds, particularly p -coumaric acid, neochlorogenic acid, and caffeic acid, exhibited significantly higher concentrations in daylily. In addition, p -coumaric acid was the characteristic substance in cow pea. Results from this study can contribute to the development of vegetables with specific phytochemicals and health benefits.

  12. Areas of residential development in the southern Appalachian Mountains are characterized by low riparian zone nitrogen cycling and no increase in soil greenhouse gas emissions

    Science.gov (United States)

    Peter Baas; Jennifer D. Knoepp; Daniel Markewitz; Jacqueline E. Mohan

    2017-01-01

    The critical role streamside riparian zones play in mitigating the movement of nitrogen (N) and other elements from terrestrial to aquatic ecosystems could be threatened by residential development in the southern Appalachian Mountains. Many studies have investigated the influence of agriculture on N loading to streams but less is known about the impacts of residential...

  13. Characterization of Free, Conjugated, and Bound Phenolic Acids in Seven Commonly Consumed Vegetables

    Directory of Open Access Journals (Sweden)

    Yuan Gao

    2017-11-01

    Full Text Available Phenolic acids are thought to be beneficial for human health and responsible for vegetables’ health-promoting properties. Free, conjugated, and bound phenolic acids of seven commonly consumed vegetables, including kidney bean, cow pea, snow pea, hyacinth bean, green soy bean, soybean sprouts and daylily, from the regions of Beijing, Hangzhou, and Guangzhou, were identified and quantified by ultra-performance liquid chromatography-tandem mass spectrometry (UPLC-MS/MS. Three vegetables, namely green soy bean, soybean sprouts, and daylily (Hemerocallis fulva L., from the Beijing region contained higher concentrations of total phenolic acids than those from the Hangzhou and Guangzhou regions. The results indicated that the phenolic acid content in the seven vegetables appeared to be species-dependent. The highest content of phenolic acids was found in daylily, followed by green soy bean, while the least amounts were identified in kidney bean and hyacinth bean. Typically, phenolic acids are predominantly found in conjugated forms. Principle component analysis (PCA revealed some key compounds that differentiated the seven vegetables. Green soy bean, compared to the other six vegetables, was characterized by higher levels of syringic acid, ferulic acid, vanillic acid, and sinapic acid. Other compounds, particularly p-coumaric acid, neochlorogenic acid, and caffeic acid, exhibited significantly higher concentrations in daylily. In addition, p-coumaric acid was the characteristic substance in cow pea. Results from this study can contribute to the development of vegetables with specific phytochemicals and health benefits.

  14. Structure and Composition of Old-Growth and Unmanaged Second-Growth Riparian Forests at Redwood National Park, USA

    Directory of Open Access Journals (Sweden)

    Christopher R. Keyes

    2014-02-01

    Full Text Available Restoration of second-growth riparian stands has become an important issue for managers of redwood (Sequoia sempervirens [D. Don] Endl. forest reserves. Identifying differences between old-growth and second-growth forest vegetation is a necessary step in evaluating restoration needs and targets. The objective of this study was to characterize and contrast vegetation structure and composition in old-growth and unmanaged second-growth riparian forests in adjacent, geomorphologically similar watersheds at Redwood National Park. In the old-growth, redwood was the dominant overstory species in terms of stem density, basal area, and importance values. Second-growth was dominated by red alder (Alnus rubra Bong., Douglas-fir (Pseudotsuga menziesii [Mirbel] Franco, and redwood. Understory species were similar in both forests, with several key differences: Oxalis oregana Nutt. and Trillium ovatum Pursh had greater importance values in the old-growth, and Vaccinium parvifolium Sm., Dryopteris spp. and sedges Carex spp. had greater importance values in the second-growth. Notable differences in structure and composition suggest that restoration practices such as thinning could expedite the acquisition of old-growth characteristics in second-growth riparian forests.

  15. Lidar Remote Sensing for Characterizing Forest Vegetation - Special Issue. Foreword

    Science.gov (United States)

    Popescu, Sorin C.; Nelson, Ross F.

    2011-01-01

    The Silvilaser 2009 conference held in College Station, Texas, USA, was the ninth conference in the Silvilaser series, which started in 2002 with the international workshop on using lidar (Light Detection and Ranging) for analyzing forest structure, held in Victoria, British Columbia, Canada. Following the Canadian workshop, subsequent forestry-lidar conferences took place in Australia, Sweden, Germany, USA, Japan, Finland, and the United Kingdom (UK). By the time this Silvilaser 2009 special issue of PE&RS is published, the 10th international conference will have been held in Freiburg, Germany, and planning will be ongoing for the 11th meeting to take place in Tasmania, Australia, in October 2011. Papers presented at the 2005 conference held in Blacksburg, Virginia, USA, were assembled in a special issue of PE&RS published in December 2006. Other special issues resulting from previous conferences were published in journals such as the Canadian Journal of Remote Sensing (2003), the Scandinavian Journal of Forest Research (2004), and Japan s Journal of Forest Planning (2008). Given the conference history and the much longer record of publications on lidar applications for estimating forest biophysical parameters, which dates back to the early 1980s, we may consider lidar an established remote sensing technology for characterizing forest canopy structure and estimating forest biophysical parameters. Randy Wynne, a professor at Virginia Tech and the final keynote speaker at Silvilaser 2009, made the case that it was time to push 30 years of research into operations, along the lines of what has already been done to good effect in the Scandinavian countries. In Randy s words, it s time to "Just do it!" This special issue includes a selection of papers presented during the 2009 Silvilaser conference, which consisted of eight sections as follows: (1) biomass and carbon stock estimates, (2) tree species and forest type classification, (3) data fusion and integration, (4, 5

  16. Phytostabilization of metals by indigenous riparian vegetation

    African Journals Online (AJOL)

    2017-04-02

    Apr 2, 2017 ... means that plants stabilize or immobilize the metals in the soil, ... previously recorded to take up various heavy metals (Batty et al., 2000; Deng et al., ... were taken from the immediate root zone of each plant sample. Biomass ...

  17. Recovery of the Chaparral Riparian Zone After Wildfire

    Science.gov (United States)

    Frank W. Davis; Edward A. Keller; Anuja Parikh; Joan Florsheim

    1989-01-01

    After the Wheeler Fire in southern California in July 1985, we monitored sediment deposition and vegetation recovery in a section of the severely burned chaparral riparian zone of the North Fork of Matilija Creek, near Ojai, California. Increased runoff was accompanied by low magnitude debris flows and fluvial transport of gravel, most of which was added to the channel...

  18. A baseline classification of riparian woodland plant communities in ...

    African Journals Online (AJOL)

    The plots were placed along a gradient from the main water body to the drier fringe of the riparian zone. Plant species present in each plot were recorded with their estimated percentage cover using the Braun–Blanquet cover abundance scale. Hierarchical cluster analysis was used to determine vegetation communities.

  19. Sex and the single Salix: considerations for riparian restoration

    Science.gov (United States)

    Thomas D. Landis; David R. Dreesen; R. Kasten Dumroese

    2003-01-01

    Most restoration projects strive to create a sustain able plant community but exclusive use of vegetatively propagated material may be preventing this goal. The dioecious willows and cottonwoods of the Salicaceae are widely used in riparian restoration projects. Hardwood cuttings have traditionally been used to propagate these species in nurseries, and live stakes,...

  20. Radioisotope method for characterization of vegetable tannins, extracted from waste of forestry production in Cuba

    International Nuclear Information System (INIS)

    Santana Romero, J.L.; Martinez Luzardo, F.; Codorniu Hernandez, E.; Vargas Guerra, L.; Melo Cala, P.; Garcia Guillen, M.; Isaac Olive, K.; Estevez, P.; Roque Cordoba, A.; Benitez, M.

    2002-01-01

    Vegetable tannins are polyphenolic plants secondary metabolites, widely distributed in all parts of trees and herbs. The role of these substances in many metabolic processes is very important. Vegetable tannins have been implicated as probable antinutritional factors, decreasing the assimilation of diet protein assimilation by cattle. On the other hand, protective antioxidant and antimutagenic properties have been ascribed for these compounds. Characterization of vegetable tannins is important in order to find new sources of natural raw materials with medical and pharmaceutical applications. Protein precipitation capacity as a function of pH, competitive protein and ADN binding assays and the determination of tannins concentration are described. Radioisotope labeled protein and tannins were used in all of the determinations. (author)

  1. Do riparian plant community characteristics differ between Tamarix (L.) invaded and non-invaded sites on the upper Verde River, Arizona?

    Science.gov (United States)

    Tyler D. Johnson; Thomas E. Kolb; Alvin L. Medina

    2009-01-01

    Invasion by Tamarix (L.) can severely alter riparian areas of the western U.S., which are globally rare ecosystems. The upper Verde River, Arizona, is a relatively free-flowing river and has abundant native riparian vegetation. Tamarix is present on the upper Verde but is a minor component of the vegetation (8% of stems). This...

  2. Bat activity following restoration prescribed burning in the central Appalachian Upland and riparian habitats

    Science.gov (United States)

    Austin, Lauren V.; Silvis, Alexander; Ford, W. Mark; Muthersbaugh, Michael; Powers, Karen E.

    2018-01-01

    After decades of fire suppression in eastern North America, land managers now are prioritizing prescribed fire as a management tool to restore or maintain fire-adapted vegetation communities. However, in long—fire-suppressed landscapes, such as the central and southern Appalachians, it is unknown how bats will respond to prescribed fire in both riparian and upland forest habitats. To address these concerns, we conducted zero-crossing acoustic surveys of bat activity in burned, unburned, riparian, and non-riparian areas in the central Appalachians, Virginia, USA. Burn and riparian variables had model support (ΔAICc fire differently between upland and riparian forest habitats, but overall, large landscape-level prescribed fire has a slightly positive to neutral impact on all bats species identified at our study site post—fire application.

  3. Effects of changes in the riparian forest on the butterfly community (Insecta: Lepidoptera in Cerrado areas

    Directory of Open Access Journals (Sweden)

    Helena S.R. Cabette

    Full Text Available ABSTRACT Preserved riparian vegetation usually has greater environmental complexity than the riparian vegetation modified by human actions. These systems may have a greater availability and diversity of food resources for the species. Our objective was to evaluate the effect of changes on the structure of the riparian forest on species richness, beta diversity and composition of butterfly species in the Cerrado of Mato Grosso. We tested the hypotheses that: (i higher species richness and (ii beta diversity would be recorded in more preserved environments; and (iii species composition would be more homogeneous in disturbed habitats. For hypothesis testing, the riparian vegetation of eight streams were sampled in four periods of the year in a fixed transect of 100 m along the shores. The richness of butterfly species is lower in disturbed than in preserved areas. However, species richness is not affected by habitat integrity. Beta diversity differed among sites, such that preserved sites have greater beta diversity, showing greater variation in species composition. In addition, beta diversity was positively affected by environmental heterogeneity. A total of 23 of the 84 species sampled occurred only in the changed environment, 42 were exclusive to preserved sites and 19 occurred in both environments. The environmental change caused by riparian forest removal drastically affects the butterfly community. Therefore, riparian vegetation is extremely important for butterfly preservation in the Cerrado and may be a true biodiversity oasis, especially during the dry periods, when the biome undergoes water stress and resource supply is more limited.

  4. Denitrification controls in urban riparian soils: implications for reducing urban nonpoint source nitrogen pollution.

    Science.gov (United States)

    Li, Yangjie; Chen, Zhenlou; Lou, Huanjie; Wang, Dongqi; Deng, Huanguang; Wang, Chu

    2014-09-01

    The purpose of this research was to thoroughly analyze the influences of environmental factors on denitrification processes in urban riparian soils. Besides, the study was also carried out to identify whether the denitrification processes in urban riparian soils could control nonpoint source nitrogen pollution in urban areas. The denitrification rates (DR) over 1 year were measured using an acetylene inhibition technique during the incubation of intact soil cores from six urban riparian sites, which could be divided into three types according to their vegetation. The soil samples were analyzed to determine the soil organic carbon (SOC), soil total nitrogen (STN), C/N ratio, extractable NO3 (-)-N and NH4 (+)-N, pH value, soil water content (SWC), and the soil nitrification potential to evaluate which of these factors determined the final outcome of denitrification. A nitrate amendment experiment further indicated that the riparian DR was responsive to added nitrate. Although the DRs were very low (0.099 ~ 33.23 ng N2O-N g(-1) h(-1)) due to the small amount of nitrogen moving into the urban riparian zone, the spatial and temporal patterns of denitrification differed significantly. The extractable NO3 (-)-N proved to be the dominant factor influencing the spatial distribution of denitrification, whereas the soil temperature was a determinant of the seasonal DR variation. The six riparian sites could also be divided into two types (a nitrate-abundant and a nitrate-stressed riparian system) according to the soil NO3 (-)-N concentration. The DR in nitrate-abundant riparian systems was significantly higher than that in the nitrate-stressed riparian systems. The DR in riparian zones that were covered with bushes and had adjacent cropland was higher than in grass-covered riparian sites. Furthermore, the riparian DR decreased with soil depth, which was mainly attributed to the concentrated nitrate in surface soils. The DR was not associated with the SOC, STN, C/N ratio, and

  5. Carbon isotope characterization of vegetation and soil organic matter in subtropical forests in Luquillo, Puerto Rico

    International Nuclear Information System (INIS)

    Fischer, J.C. von; Tieszen, L.L.

    1995-01-01

    We examined natural abundances of 13 C in vegetation and soil organic maner (SOM) of subtropical wet and rain forests to characterize the isotopic enrichment through decomposition that has been reported for temperate forests. Soil cores and vegetative samples from the decomposition continuum (leaves, new litter, old liner, wood, and roots) were taken from each of four forest types in the Luquillo Experimental Forest, Puerto Rico. SOM δ 13 C was enriched 1.60/00 relative to aboveground litter. We found no further enrichment within the soil profile. The carbon isotope ratios of vegetation varied among forests, ranging from -28.20/00 in the Colorado forest to -26.90/00 in the Palm forest. Isotope ratios of SOM differed between forests primarily in the top 20 em where the Colorado forest was again most negative at -28.00/00, and the Palm forest was most positive at -26.50/00. The isotopic differences between forests are likely attributable to differences in light regimes due to canopy density variation, soil moisture regimes, and/or recycling of CO 2 . Our data suggest that recalcitrant SOM is not derived directly from plant lignin since plant lignin is even more 13 C depleted than the bulk vegetation. We hypothesize that the anthropogenic isotopic depletion of atmospheric CO 2 , (ca 1.50/00 in the last 150 years) accounts for some of the enrichment observed in the SOM relative to the more modern vegetation in this study and others. This study also supports other observations that under wet or anaerobic soil environments there is no isotopic enrichment during decomposition or with depth in the active profile. (author)

  6. Carbon isotope characterization of vegetation and soil organic matter in subtropical forests in Luquillo, Puerto Rico

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, J.C. von [Cornell University, Ithaca, NY (United States); Tieszen, L. L.

    1995-06-15

    We examined natural abundances of {sup 13}C in vegetation and soil organic maner (SOM) of subtropical wet and rain forests to characterize the isotopic enrichment through decomposition that has been reported for temperate forests. Soil cores and vegetative samples from the decomposition continuum (leaves, new litter, old liner, wood, and roots) were taken from each of four forest types in the Luquillo Experimental Forest, Puerto Rico. SOM δ{sup 13}C was enriched 1.60/00 relative to aboveground litter. We found no further enrichment within the soil profile. The carbon isotope ratios of vegetation varied among forests, ranging from -28.20/00 in the Colorado forest to -26.90/00 in the Palm forest. Isotope ratios of SOM differed between forests primarily in the top 20 em where the Colorado forest was again most negative at -28.00/00, and the Palm forest was most positive at -26.50/00. The isotopic differences between forests are likely attributable to differences in light regimes due to canopy density variation, soil moisture regimes, and/or recycling of CO{sub 2}. Our data suggest that recalcitrant SOM is not derived directly from plant lignin since plant lignin is even more {sup 13}C depleted than the bulk vegetation. We hypothesize that the anthropogenic isotopic depletion of atmospheric CO{sub 2}, (ca 1.50/00 in the last 150 years) accounts for some of the enrichment observed in the SOM relative to the more modern vegetation in this study and others. This study also supports other observations that under wet or anaerobic soil environments there is no isotopic enrichment during decomposition or with depth in the active profile. (author)

  7. Levantamento florístico do componente arbustivo-arbóreo da vegetação ciliar na bacia do rio Taperoá, PB, Brasil Floristic survey of components of shrub-tree riparian vegetation in the Taperoá river basin, Paraíba State, Brasil

    Directory of Open Access Journals (Sweden)

    Alecksandra Vieira de Lacerda

    2005-09-01

    Full Text Available Considerando o papel relevante e o nível de degradação presente nas áreas ciliares, a pesquisa objetivou estudar a composição florística do componente arbustivo-arbóreo da vegetação ciliar em diferentes ambientes hídricos do semi-árido paraibano na bacia do rio Taperoá. O levantamento florístico foi realizado no período de junho/2002 a fevereiro/2003 e abrangeu nove pontos distribuídos ao longo de rios, riachos, lagoa e açude. A definição das atividades apoiou-se em análise de cartas e mapas da vegetação em escala de 1:100.000 e caminhadas aleatórias que permitiram a realização de coleta de material vegetal, utilizado para identificação por meio de consultas a especialistas e de morfologia comparada, usando bibliografia especializada e análise das exsicatas depositadas no herbário Lauro Pires Xavier - JPB (UFPB, João Pessoa, PB. A vegetação arbustivo-arbórea da mata ciliar nos nove pontos amostrados foi representada por 43 espécies, das quais 41 são pertencentes a 19 famílias, e duas espécies permaneceram indeterminadas. As famílias que apresentaram o maior número de espécies foram Mimosaceae (sete, Caesalpiniaceae (cinco e Euphorbiaceae (cinco. Os resultados da análise de agrupamento indicaram que as áreas ciliares apresentaram certa particularização em termos de composição florística, o que se refletiu nos baixos índices de similaridades entre o conjunto de áreas amostradas.Considering the relevant role and the current level of degradation of riparian areas, this work aimed to study the floristic composition of shrub-tree riparian vegetation at different hydric environments in the Taperoá river basin, in the semi-arid region of the Paraíba State, Northeast Brazil. The survey was performed from June 2002 to February 2003. Nine sampling sites were distributed along rivers and streams, and around lagoon, and dam. The definition of activities was based on the analysis of charts and vegetation maps

  8. The StreamCat Dataset: Accumulated Attributes for NHDPlusV2 Catchments Riparian Buffer (Version 2.1) for the Conterminous United States: Non-agricultural Introduced Managed Vegetation

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset represents the percent of non-agriculatural, non-native vegetation based on LANDFIRE existing vegetation type (EVT) for a 30-m grid cell within...

  9. Características sedimentares fluviais associadas ao grau de reservação da mata Ciliar - Rio Urumajó, Nordeste Paraense Fluvial sedimentology associated with the degree of preservation of the riparian vegetation, Urumajó River, PA / Brazil

    Directory of Open Access Journals (Sweden)

    Roney Nonato Reis de Brito

    2009-03-01

    sedimentology of the Urumajó River (Pará, Brazil in relation to the preservation state of riparian vegetation. Sediment samples were collected at five sites (A to E, including a five-sample transversal profile at each site. The sites were distributed from the source to the estuarine area. The characteristics and preservation state of the riparian vegetation were analyzed at each site as well. The collected sediments were submitted to grain size analysis, where mean grain size, median, asymmetry, selection and kurtosis were obtained. The results made it possible to recognize the regular characteristics (sites A and C, which included median sand as the main sediment class and well-sorted and approximate symmetric grain size distribution, directly related to the well-preserved riparian vegetation at sites A and C. On the other hand, sites B, D and E showed substantial differences in relation to the regular pattern. This fact could be associated to the vegetation degradation at those sites, resulting in margin erosion. Furthermore, at site E, reflexes of tide influence on the sediment characteristics could be observed, subsidizing the estuary delimitation.

  10. Assessing riparian zone impacts on water and sediment movement: A new approach

    NARCIS (Netherlands)

    Keesstra, S.D.; Kondrlova, E.; Czaika, A.; Seeger, K.M.; Maroulis, J.

    2012-01-01

    The state of river channels and their riparian zones in terms of geomorphology and vegetation has a significant effect on water and sediment transport in headwater catchments. High roughness in natural rivers due to vegetation and geomorphological attributes generate drag on flowing water. This drag

  11. Review of Invasive Riparian Trees that Impact USACE Ecosystem Restoration Projects

    Science.gov (United States)

    2016-08-01

    often release seeds in periods of stress , including periods when exposed to herbicides or mechanical disturbances. Such characteristics make this...Approved for public release ; distribution is unlimited. ERDC TN-EMRRP-SI-36 August 2016 Review of Invasive Riparian Trees that Impact USACE...various spatial control methods for woody invasive plant removal in densely vegetated riparian habitats. The USACE ecosystem restoration mission has

  12. Molecular characterization of diarrheagenic Escherichia coli isolated from vegetables in Argentina.

    Science.gov (United States)

    González, Juliana; Cadona, Jimena S; Sanz, Marcelo; Bustamante, Ana V; Sanso, A Mariel

    2017-11-16

    The aim of this study was to investigate the prevalence of diarrheagenic E. coli strains in vegetables from the humid Pampa region, Argentina, and to determine the occurrence of serotypes and virulence genes in the isolates. A total of 373 fresh vegetable samples obtained from 41 different geographical points were examined. E. coli was detected in 38.6% of the samples. Ten isolates could be obtained from 14 samples presumptively positive for diarrheagenic E. coli: 8 were identified as atypical Enteropathogenic E. coli (aEPEC) and 2 as Verocytotoxigenic E. coli (VTEC). Lettuce and beet were the vegetables most frequently contaminated with pathogenic E. coli. The isolates belonged to serotypes O1:H7, O28:H19, O39:H40, O86:H31, O132:H8, O139:H20, O178:H7 and O178:H19, some of which reportedly have caused human illness, and one isolate resulted non typeable. Taking into account the distribution of 16 nle genes, 7 profiles were detected. On the other hand, all tested isolates harbored the gene encoding for the adhesin HcpA. Other adhesion related genes were also identified: ecpA and elfA were detected in 90%, lpfA 0113 in 60%, and ehaA in 50% of the isolates meanwhile ihaA was only observed in O178:H19 isolate. This VTEC isolate harbored, also, Cdt-V toxin and megaplasmid encoding genes such as espP, subA and epeA and exhibited a strong cytotoxic effect. These data is the first molecular E. coli report that confirms the presence of E. coli pathotypes circulating among vegetables in Argentina. Genetic characterization showed that in addition to eae or vtx genes, isolates obtained from vegetables harbored genes encoding other toxins, adhesins, and components related to the type III secretion system that could contribute to their virulence. In conclusion, this research shows that vegetables in Argentina may be the source of VTEC and EPEC infections in the community and therefore, they should be considered as vehicles for transmission of these potentially pathogenic

  13. Determination Of Adsorption And Paraffin Characterization Of Treatment To Adsorb Vegetable Oil

    International Nuclear Information System (INIS)

    Aminah, Neneng Siti; Mulijani, Sri; Sudirman; Ridwan

    2004-01-01

    Using vegetable oil repeatedly, beside affect on quality decline of food and the oil itself, it is harmful to human health. Some poisoning and carcinogenic symptom were founded with experiment using animals. According to that fact, the aim of the research is using paraffin and candle to adsorb used vegetable oil and to convert into solid sample, so it can be easily wasted. At first, 2 g of sample was poured into the heated oil, with gently stirrer until it turned cold and harden. Each sample and standard before and after treatment was characterized with Ftir, XRD, and DSc. The result shows that paraffins adsorbs 40 ml used vegetable oil with 2 g sample in proportion. That proportion is lower than the standard which can adsorb 66.67 ml vegetable oil in the same weight sample. The difference of paraffin and standard is caused by physical properties within that two materials, and it can be explained by Ftir, X-Ray Diffraction (XRD) and differential scanning calorimetry (DSc). Based on result of Ftir analysis, standard consented of saturated hydrocarbon compound (alkanes) whereas paraffin consisted of unsaturated hydrocarbon compound (alkenes). Infrared spectrum after treatment showed the changes of compound, O-H and esters group were formed and it shows characterised the adsorption process. The result of DSc analysis showed that crystalline the melting point of standard is 75,3 o C and paraffin is 54,17 o C. The result of analysis XRD, described that standard and paraffin before treatment are crystalline whereas after treatment are am orf

  14. Riparian Habitat - Product of 2 riparian habitat workshops

    Data.gov (United States)

    California Natural Resource Agency — In two riparian habitat workshops held between 2001 and 2002, scientists and managers identified the need for determining the scope of a consistent and acceptable...

  15. Revegetation of the riparian zone of the Three Gorges Dam Reservoir leads to increased soil bacterial diversity.

    Science.gov (United States)

    Ren, Qingshui; Li, Changxiao; Yang, Wenhang; Song, Hong; Ma, Peng; Wang, Chaoying; Schneider, Rebecca L; Morreale, Stephen J

    2018-06-06

    As one of the most active components in soil, bacteria can affect soil physicochemical properties, its biological characteristics, and even its quality and health. We characterized dynamics of the soil bacterial diversity in planted (with Taxodium distichum) and unplanted soil in the riparian zone of the Three Gorges Dam Reservoir (TGDR), in southwestern China, in order to accurately quantify the changes in long-term soil bacterial community structure after revegetation. Measurements were taken annually in situ in the TGDR over the course of 5 years, from 2012 to 2016. Soil chemical properties and bacterial diversity were analyzed in both the planted and unplanted soil. After revegetation, the soil chemical properties in planted soil were significantly different than in unplanted soil. The effects of treatment, time, and the interaction of both time and treatment had significant impacts on most diversity indices. Specifically, the bacterial community diversity indices in planted soil were significantly higher and more stable than that in unplanted soil. The correlation analyses indicated that the diversity indices correlated with the pH value, organic matter, and soil available nutrients. After revegetation in the riparian zone of the TGDR, the soil quality and health is closely related to the observed bacterial diversity, and a higher bacterial diversity avails the maintenance of soil functionality. Thus, more reforestation should be carried out in the riparian zone of the TGDR, so as to effectively mitigate the negative ecological impacts of the dam. Vegetating the reservoir banks with Taxodium distichum proved successful, but planting mixed stands of native tree species could promote even higher riparian soil biodiversity and improved levels of ecosystem functioning within the TGDR.

  16. Influence of Soils, Riparian Zones, and Hydrology on Nutrients, Herbicides, and Biological Relations in Midwestern Agricultural Streams

    Science.gov (United States)

    Porter, S.

    2001-12-01

    Chemical, biological, and habitat conditions were characterized in 70 streams in the upper Mississippi River basin during August 1997, as part of the U.S. Geological Survey's National Water-Quality Assessment (NAWQA) Program. The study was designed to evaluate algal and macroinvertebrate responses to high agricultural intensity in relation to nonpoint sources of nutrients and herbicides, characteristics of basin soils, wooded-riparian vegetation, and hydrology. Concentrations and forms of nutrients, herbicides and their metabolites, and seston constituents varied significantly with regional differences in soil properties, ground and surface water relations, density of riparian trees, and precedent rainfall-runoff conditions. Dissolved nitrate concentrations were relatively low in streams with high algal productivity; however, nitrate concentrations increased with basin water yield, which was associated with the regional distribution of rainfall during the month prior to the study. Stream productivity and respiration were positively correlated with seston (phytoplankton) chlorophyll concentrations, which were significantly larger in streams in areas with poorly drained soils and low riparian-tree density. Concentrations of dissolved phosphorus were low in streams where periphyton biomass was high. Periphyton biomass was relatively larger in streams with clear water and low abundance of macroinvertebrates that consume algae. Periphyton biomass decreased rapidly with modest increases in the abundance of scrapers such as snails and certain mayfly taxa. Differences in dissolved oxygen, organic carbon, stream velocity, and precedent hydrologic conditions explained much of the variance in macroinvertebrate community structure. The overall number of macroinvertebrate species and number of mayfly, caddisfly, and stonefly (EPT) taxa that are sensitive to organic enrichment were largest in streams with moderate periphyton biomass, in areas with moderately-well drained soils

  17. Arthropod prey for riparian associated birds in headwater forests of the Oregon Coast Range

    Science.gov (United States)

    Hagar, Joan C.; Li, Judith; Sobota, Janel; Jenkins, Stephanie

    2012-01-01

    Headwater riparian areas occupy a large proportion of the land base in Pacific Northwest forests, and thus are ecologically and economically important. Although a primary goal of management along small headwater streams is the protection of aquatic resources, streamside habitat also is important for many terrestrial wildlife species. However, mechanisms underlying the riparian associations of some terrestrial species have not been well studied, particularly for headwater drainages. We investigated the diets of and food availability for four bird species associated with riparian habitats in montane coastal forests of western Oregon, USA. We examined variation in the availability of arthropod prey as a function of distance from stream. Specifically, we tested the hypotheses that (1) emergent aquatic insects were a food source for insectivorous birds in headwater riparian areas, and (2) the abundances of aquatic and terrestrial arthropod prey did not differ between streamside and upland areas during the bird breeding season. We found that although adult aquatic insects were available for consumption throughout the study period, they represented a relatively small proportion of available prey abundance and biomass and were present in only 1% of the diet samples from only one of the four riparian-associated bird species. Nonetheless, arthropod prey, comprised primarily of insects of terrestrial origin, was more abundant in streamside than upland samples. We conclude that food resources for birds in headwater riparian areas are primarily associated with terrestrial vegetation, and that bird distributions along the gradient from streamside to upland may be related to variation in arthropod prey availability. Because distinct vegetation may distinguish riparian from upland habitats for riparian-associated birds and their terrestrial arthropod prey, we suggest that understory communities be considered when defining management zones for riparian habitat.

  18. Riparian Habitat - San Joaquin River

    Data.gov (United States)

    California Natural Resource Agency — The immediate focus of this study is to identify, describe and map the extent and diversity of riparian habitats found along the main stem of the San Joaquin River,...

  19. GIS applications in riparian management

    Science.gov (United States)

    Carrie Christman; Douglas W. Shaw; Charles L. Spann; Penny Luehring

    1996-01-01

    GIS was used to prioritize watersheds for treatment needs across the USDA Forest Service Southwestern Region. Factors in this analysis included soil condition, riparian habitat, population centers and mining sites.

  20. Riparian planning in Yogyakarta City

    Science.gov (United States)

    Rachmawati, R.; Prakoso, E.; Sadali, M. I.; Yusuf, M. G.

    2018-04-01

    Riparian is a potential for slums in urban areas. The city of Yogyakarta is passed by three rivers namely Code, Gajahwong, and Winongo, crossing the city. Riparian in the three rivers are potential for slum if the area is not well managed. This paper is based on the survey results of the structured interview with the people living in the riparian area in Yogyakarta City. They were 75 respondents from the three riparian. The result shows that several reasons why people prefer to remain living in the area are limited spaces and high land price in the city as well as inherited from their parents. The facts that there are still several problems related to the condition of settlement environment in the riparian, i.e., The condition of densely-populated areas, limited availability of land, and limited public spaces. Efforts that can be done to solve problems related to the riparian planning are anticipating disasters like flood and landslide, paying attention to densely-populated and unwell-planned areas, and handling garbage that has been abandoned into the river. The program expected by those living along both riversides is intended to give priorities on providing some aid for those whose houses are not in good condition, controlling buildings without a permit, and building a dike along the river. Efficiency can be made by making use of the space adequately between the one for settlement and the other one for open-green space for both aesthetic and economic purposes.

  1. Isolation and Characterization of Cellulose from Different Fruit and Vegetable Pomaces

    Directory of Open Access Journals (Sweden)

    Monika Szymańska-Chargot

    2017-10-01

    Full Text Available A new fractionation process was developed to achieve valorization of fruit and vegetable pomaces. The importance of the residues from fruits and vegetables is still growing; therefore; the study presents the novel route of a fractioning process for the conversion of agro-industrial biomasses, such as pomaces, into useful feedstocks with potential application in the fields of fuels, chemicals, and polymers. Hence, the biorefinery process is expected to convert them into various by-products offering a great diversity of low-cost materials. The final product of the process is the cellulose of the biofuel importance. The study presents the novel route of the fractioning process for the conversion of agro-industrial biomasses, such as pomaces, into useful feedstocks with a potential application in the fields of fuels, chemicals, and polymers. Therefore the aim of this paper was to present the novel route of the pomaces fraction and the characterization of residuals. Pomaces from apple, cucumber, carrot, and tomato were treated sequentially with water, acidic solution, alkali solution, and oxidative reagent in order to obtain fractions reach in sugars, pectic polysaccharides, hemicellulose, cellulose, and lignin. Pomaces were characterized by dry matter content, neutral detergent solubles, hemicellulose, cellulose, and lignin. Obtained fractions were characterized by the content of pectins expressed as galacturonic acid equivalent and hemicelluloses expressed as a xyloglucan equivalent. The last fraction and residue was cellulose characterized by crystallinity degree by X-ray diffractometer (XRD, microfibril diameter by atomic force microscope (AFM, and overall morphology by scanning electron microscope (SEM. The hemicelluloses content was similar in all pomaces. Moreover, all the materials were characterized by the high pectins level in extracts evaluated as galacturonic acid content. The lignins content compared with other plant biomasses was on a

  2. Nitrogen loss from anaerobic ammonium oxidation coupled to Iron(III) reduction in a riparian zone.

    Science.gov (United States)

    Ding, Bangjing; Li, Zhengkui; Qin, Yunbin

    2017-12-01

    Anaerobic ammonium oxidation coupled to iron(III) reduction (termed Feammox) is a recently discovered pathway of nitrogen cycling. However, little is known about the pathways of N transformation via Feammox process in riparian zones. In this study, evidence for Feammox in riparian zones with or without vegetation cover was demonstrated using isotope tracing technique and high-throughput sequencing technology. The results showed that Feammox could occur in riparian zones, and demonstrated that N 2 directly from Feammox was dominant Feammox pathway. The Feammox rates in vegetated soil samples was 0.32-0.37 mg N kg -1 d -1 , which is higher than that in un-vegetated soil samples (0.20 mg N kg -1 d -1 ). Moreover, the growth of vegetation led to a 4.99-6.41% increase in the abundance of iron reducing bacteria (Anaeromyxobacter, Pseudomonas and Geobacter) and iron reducing bacteria play an essential role in Feammox process. An estimated loss of 23.7-43.9 kg N ha -1 year -1 was associated with Feammox in the examined riparian zone. Overall, the co-occurrence of ammonium oxidation and iron reduction suggest that Feammox can play an essential role in the pathway of nitrogen removal in riparian zones. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Niche construction within riparian corridors. Part I: Exploring biogeomorphic feedback windows of three pioneer riparian species (Allier River, France)

    Science.gov (United States)

    Hortobágyi, Borbála; Corenblit, Dov; Steiger, Johannes; Peiry, Jean-Luc

    2018-03-01

    Within riparian corridors, biotic-abiotic feedback mechanisms occur between woody vegetation strongly influenced by hydrogeomorphic constraints (e.g., sediment transport and deposition, shear stress, hydrological variability), fluvial landforms, and morphodynamics, which in turn are modulated by the established vegetation. During field investigations in spring 2015, we studied 16 alluvial bars (e.g., point and lateral bars) within the dynamic riparian corridor of the Allier River (France) to assess the aptitude of three pioneer riparian Salicaceae species (Populus nigra L., Salix purpurea L., and Salix alba L.) to establish and act as ecosystem engineers by trapping sediment and constructing fluvial landforms. Our aim is to empirically identify the preferential establishment area (EA; i.e., the local areas where species become established) and the preferential biogeomorphic feedback window (BFW; i.e., where and to what extent the species and geomorphology interact) of these three species on alluvial bars within a 20-km-long river reach. Our results show that the EA and BFW of all three species vary significantly along the longitudinal profile, i.e., upstream-downstream exposure on the alluvial bars, as well as transversally, i.e., the main hydrological connectivity gradient from the river channel toward the floodplain. In the present-day context of the Allier River, P. nigra is the most abundant species, appearing to act as the main engineer species affecting landform dynamics at the bar scale; S. purpurea is established and acts as an ecosystem engineer at locations on alluvial bars that are most exposed to hydrosedimentary flow dynamics, while S. alba is established on the bar tail close to secondary channels and affects the geomorphology in mixed patches along with P. nigra. Our study highlights the role of functional trait diversity of riparian engineer species in controlling the extent of fluvial landform construction along geomorphic gradients within riparian

  4. Assessing the Three-North Shelter Forest Program in China by a novel framework for characterizing vegetation changes

    Science.gov (United States)

    Qiu, Bingwen; Chen, Gong; Tang, Zhenghong; Lu, Difei; Wang, Zhuangzhuang; Chen, Chongchen

    2017-11-01

    The Three-North Shelter Forest Program (TNSFP) in China has been intensely invested for approximately 40 years. However, the efficacy of the TNSFP has been debatable due to the spatiotemporal complexity of vegetation changes. A novel framework was proposed for characterizing vegetation changes in the TNSFP region through Combining Trend and Temporal Similarity trajectory (COTTS). This framework could automatically and continuously address the fundamental questions on where, what, how and when vegetation changes have occurred. Vegetation trend was measured by a non-parametric method. The temporal similarity trajectory was tracked by the Jeffries-Matusita (JM) distance of the inter-annual vegetation indices temporal profiles and modeled using the logistic function. The COTTS approach was applied to examine the afforestation efforts of the TNSFP using 500 m 8-day composites MODIS datasets from 2001 to 2015. Accuracy assessment from the 1109 reference sites reveals that the COTTS is capable of automatically determining vegetation dynamic patterns, with an overall accuracy of 90.08% and a kappa coefficient of 0.8688. The efficacy of the TNSFP was evaluated through comprehensive considerations of vegetation, soil and wetness. Around 45.78% areas obtained increasing vegetation trend, 2.96% areas achieved bare soil decline and 4.50% areas exhibited increasing surface wetness. There were 4.49% areas under vegetation degradation & desertification. Spatiotemporal heterogeneity of efficacy of the TNSFP was revealed: great vegetation gain through the abrupt dynamic pattern in the semi-humid and humid regions, bare soil decline & potential efficacy in the semi-arid region and remarkable efficacy in functional region of Eastern Ordos.

  5. Characterizing phenological vegetation dynamics amidst extreme climate variability in Australia with MODIS VI data

    Science.gov (United States)

    Broich, M.; Huete, A. R.; Xuanlon, M.; Davies, K.; Restrepo-Coupe, N.; Ratana, P.

    2012-12-01

    Australia's climate is extremely variable with inter-annual rainfall at any given site varying by 5- or 6-fold or more, across the continent. In addition to such inter-annual variability, there can be significant intra-annual variability, especially in monsoonal Australia (e.g. the wet tropical savannas) and Mediterranean climates in SW Australia where prolonged dry seasons occur each year. This presents unique challenges to the characterization of seasonal dynamics with satellite datasets. In contrast to annual reoccurring temperature-driven phenology of northern hemisphere mid-latitudes, vegetation dynamics of the vast and dry Australian interior are poorly quantified by existing remote sensing products. For example, in the current global-based MODIS phenology product, central Australia is covered by ~30% fill values for any given year. Two challenges are specific to Australian landscapes: first, the difficulty of characterizing seasonality of rainfall-driven ecosystems in interior Australia where duration and magnitude of green-up and brown down cycles show high inter annual variability; second, modeling two phenologic layers, the trees and the grass in savannas were the trees are evergreen but the herbaceous understory varies with rainfall. Savannas cover >50% of Australia. Australia's vegetation and climate are different from other continents. A MODIS phenology product capable of characterizing vegetation dynamics across the continent is being developed in this research as part of the AusCover national expert network aiming to provide Australian biophysical remote sensing data time-series and continental-scale map products. These products aim to support the Terrestrial Ecosystem Research Network (TERN) serving ecosystem research in Australia. The MODIS land surface product for Australia first searches the entire time series of each Climate Modeling Grid pixel for low-high-low extreme point sequences. A double logistic function is then fit to each of these

  6. Principles for Establishing Ecologically Successful Riparian Corridors

    Science.gov (United States)

    Principles for establishing riparian areas. Riparian areas are three‐dimensional ecotones of interaction that include terrestrial and aquatic ecosystems, that extend down into the groundwater, up above the canopy, outward across the floodplain.

  7. Buffer Strips for Riparian Zone Management

    National Research Council Canada - National Science Library

    1991-01-01

    This study provides a review of technical literature concerning the width of riparian buffer strips needed to protect water quality and maintain other important values provided by riparian ecosystem...

  8. Development and Characterization of Edible Films Based on Fruit and Vegetable Residues.

    Science.gov (United States)

    Andrade, Roberta M S; Ferreira, Mariana S L; Gonçalves, Édira C B A

    2016-02-01

    Edible films were developed from the solid residue of the processing of whole fruits and vegetables. The solid residue, processed into flour (FVR flour) was chemically and structurally characterized by microstructure, elemental composition, structural links, and moisture sorption isotherm. Films were prepared by casting using aqueous extracts of 8% and 10% of flour (w/w) and characterized in terms of thickness, water solubility, mechanical properties, water vapor permeability, and Fourier transform infrared (FTIR). The analysis of microstructure and elemental composition, performed on flour (mean particle size 350 μm), showed an essentially granular aspect, with the presence of fibrous particles having potassium as one of the most abundant elements. FTIR results showed similarity between the characteristic bands of other raw materials used in edible films. The sorption isotherm of FVR flour showed a typical profile of foods rich in soluble components, such as sugars. Dried films presented an average thickness of 0.263 ± 0.003 mm, a homogenous aspect, bright yellow color, pronounced fruit flavor, and high water solubility. The FTIR spectra of the edible films revealed that addition of potato skin flour did not change the molecular conformation. Moreover, the films presented low tensile strength at break when compared with fruit starch-based films. © 2016 Institute of Food Technologists®

  9. Quantifying the contribution of riparian soils to the provision of ecosystem services.

    Science.gov (United States)

    de Sosa, Laura L; Glanville, Helen C; Marshall, Miles R; Prysor Williams, A; Jones, Davey L

    2018-05-15

    Riparian areas, the interface between land and freshwater ecosystems, are considered to play a pivotal role in the supply of regulating, provisioning, cultural and supporting services. Most previous studies, however, have tended to focus on intensive agricultural systems and only on a single ecosystem function. Here, we present the first study which attempts to assess a wide range of ecological processes involved in the provision of the ecosystem service of water quality regulation across a diverse range of riparian typologies. Specifically, we focus on 1) evaluating the spatial variation in riparian soils properties with respect to distance with the river and soil depth in contrasting habitat types; 2) gaining further insights into the underlying mechanisms of pollutant removal (i.e. pesticide sorption/degradation, denitrification, etc.) by riparian soils; and 3) quantify and evaluate how riparian vegetation across different habitat types contribute to the provision of watercourse shading. All the habitats were present within a single large catchment and included: (i) improved grassland, (ii) unimproved (semi-natural) grassland, (iii) broadleaf woodland, (iv) coniferous woodland, and (iv) mountain, heath and bog. Taking all the data together, the riparian soils could be statistically separated by habitat type, providing evidence that they deliver ecosystem services to differing extents. Overall, however, our findings seem to contradict the general assumption that soils in riparian area are different from neighbouring (non-riparian) areas and that they possess extra functionality in terms of ecosystem service provision. Watercourse shading was highly habitat specific and was maximal in forests (ca. 52% shade cover) in comparison to the other habitat types (7-17%). Our data suggest that the functioning of riparian areas in less intensive agricultural areas, such as those studied here, may be broadly predicted from the surrounding land use, however, further research

  10. Down by the riverside: urban riparian ecology

    Science.gov (United States)

    Peter M. Groffman; Daniel J. Bain; Lawrence E. Band; Kenneth T. Belt; Grace S. Brush; J. Morgan Grove; Richard V. Pouyat; Ian C. Yesilonis; Wayne C. Zipperer

    2003-01-01

    Riparian areas are hotspots of interactions between plants, soil, water, microbes, and people. While urban land use change has been shown to have dramatic effects on watershed hydrology, there has been surprisingly little analysis of its effects on riparian areas. Here we examine the ecology of urban riparian zones, focusing on work done in the Baltimore Ecosystem...

  11. Use of nuclear techniques for characterization of vegetable tannins, extracted from waste of forestry production in Cuba

    International Nuclear Information System (INIS)

    Santana Romero, J. L.; Martinez Luzardo, F.; Vargas Guerra, L.; Melo Cala, P.; Garcia Guillen, M.; Isaac Olive, K.; Codorniu Hernandez, E.; Estevez, P.; Roque, Cordoba A.; Benitez, M.

    1999-01-01

    Vegetable Tannins are polyphenolic plant secondary metabolites, widely distributed in all parts of trees and herbs.The role of these substances in many metabolic processes is very important. Vegetable tannins have probably implication as anti nutritional factors, decreasing up-take of diet protein assimilation by cattle. On the other hand, protective antioxidant and antimutagenic properties has been describes for these compounds. Characterization of vegetable tannins is an important task in order to find new sources of natural raw materials with several applications. Analytical determination of tannins and their characterization is still a problem at present days in order to qualify the food quality for ruminants. Protein precipitation capacity as function of pH, competitive protein and ADN binding assays , and determination of tannins concentration are describes.Radioisotopic labelling of protein and tannins were used in order to carried out all the determinations

  12. Characterization of free nitrogen fixing bacteria of the genus Azotobacter in organic vegetable-grown Colombian soils

    NARCIS (Netherlands)

    Jiménez Avella, Diego; Montaña, José Salvador; Martínez, María Mercedes

    With the purpose of isolating and characterizing free nitrogen fixing bacteria (FNFB) of the genus Azotobacter, soil samples were collected randomly from different vegetable organic cultures with neutral pH in different zones of Boyacá-Colombia. Isolations were done in selective free nitrogen

  13. Riparian buffer zones as pesticide filters of no-till crops.

    Science.gov (United States)

    Aguiar, Terencio R; Bortolozo, F R; Hansel, F A; Rasera, K; Ferreira, M T

    2015-07-01

    Several studies have pointed to the potential benefits of riparian vegetation as buffer zones for agricultural and industrial pollutants harmful to aquatic ecosystems. However, other studies have called into question its use as an ecological filter, questioning the widths and conditions for which they are effective as a filter. In this work, we have investigated the buffering capacity of the riparian one to retain pesticides in the water-saturated zone, on 27 sites composed by riparian buffer zones with different vegetation structure (woody, shrubs, or grass vegetation) and width (12, 36, and 60 m). Five pesticides were analyzed. The effectiveness of the filtering was largely influenced by the width and vegetation type of the buffer zone. In general, decreasing pesticide removal followed in this order wood > shrubs > grass. The 60 m woody buffer zone was the most effective in the removal of all the pesticides. Only atrazine was detected in this case (0.3 μg L(-1)). Furthermore, a linear correlation (R (2) > 0.97) was observed in their removal for all compounds and buffer zones studied. Thus, preserving the woody vegetation in the riparian zone is important for watershed management and groundwater quality in the no-tillage system in temperate climate.

  14. 2011 Los Alamos National Laboratory Riparian Inventory Results

    Energy Technology Data Exchange (ETDEWEB)

    Norris, Elizabeth J. [Los Alamos National Laboratory; Hansen, Leslie A. [Los Alamos National Laboratory; Hathcock, Charles D. [Los Alamos National Laboratory; Keller, David C. [Los Alamos National Laboratory; Zemlick, Catherine M. [Los Alamos National Laboratory

    2012-03-29

    A total length of 36.7 kilometers of riparian habitat were inventoried within LANL boundaries between 2007 and 2011. The following canyons and lengths of riparian habitat were surveyed and inventoried between 2007 and 2011. Water Canyon (9,669 m), Los Alamos Canyon (7,131 m), Pajarito Canyon (6,009 m), Mortandad Canyon (3,110 m), Two-Mile Canyon (2,680 m), Sandia Canyon (2,181 m), Three-Mile Canyon (1,883 m), Canyon de Valle (1,835 m), Ancho Canyon (1,143 m), Canada del Buey (700 m), Sandia Canyon (221 m), DP Canyon (159 m) and Chaquehui Canyon (50 m). Effluent Canyon, Fence Canyon and Potrillo Canyon were surveyed but no areas of riparian habitat were found. Stretches of inventoried riparian habitat were classified for prioritization of treatment, if any was recommended. High priority sites included stretches of Mortandad Canyon, LA Canyon, Pajarito Canyon, Two-Mile Canyon, Sandia Canyon and Water Canyon. Recommended treatment for high priority sites includes placement of objects into the stream channel to encourage sediment deposition, elimination of channel incision, and to expand and slow water flow across the floodplain. Additional stretches were classified as lower priority, and, for other sites it was recommended that feral cattle and exotic plants be removed to aid in riparian habitat recovery. In June 2011 the Las Conchas Wildfire burned over 150,000 acres of land in the Jemez Mountains and surrounding areas. The watersheds above LA Canyon, Water Canyon and Pajarito Canyon were burned in the Las Conchas Wildfire and flooding and habitat alteration were observed in these canyon bottoms (Wright 2011). Post fire status of lower priority areas may change to higher priority for some of the sites surveyed prior to the Las Conchas Wildfire, due to changes in vegetation cover in the adjacent upland watershed.

  15. Effects of Construction of the Digital Multipurpose Range Complex (DMPRC) on Riparian and Stream Ecosystems at Fort Benning, Georgia. Addendum

    Science.gov (United States)

    2009-06-01

    root dynamics in riparian forests. Soil Science Society of America 69(3):729-737. Houser, J. N., P. J. Mulholland, and K. O. Maloney. 2006. Upland...Forested Wetlands, D. M. Amatya and J. Nettles (eds). New Bern, NC. American Society of Agricultural and Biological Engineers, St. Joseph, MI...primary productivity, vegetation composition, structure, and fine root dynamics in riparian forests. Kelly O. Maloney, Ph.D. in Biological Sciences

  16. Model Analytical Development for Physical, Chemical, and Biological Characterization of Momordica charantia Vegetable Drug

    Science.gov (United States)

    Guimarães, Geovani Pereira; Santos, Ravely Lucena; Júnior, Fernando José de Lima Ramos; da Silva, Karla Monik Alves; de Souza, Fabio Santos

    2016-01-01

    Momordica charantia is a species cultivated throughout the world and widely used in folk medicine, and its medicinal benefits are well documented, especially its pharmacological properties, including antimicrobial activities. Analytical methods have been used to aid in the characterization of compounds derived from plant drug extracts and their products. This paper developed a methodological model to evaluate the integrity of the vegetable drug M. charantia in different particle sizes, using different analytical methods. M. charantia was collected in the semiarid region of Paraíba, Brazil. The herbal medicine raw material derived from the leaves and fruits in different particle sizes was analyzed using thermoanalytical techniques as thermogravimetry (TG) and differential thermal analysis (DTA), pyrolysis coupled to gas chromatography/mass spectrometry (PYR-GC/MS), and nuclear magnetic resonance (1H NMR), in addition to the determination of antimicrobial activity. The different particle surface area among the samples was differentiated by the techniques. DTA and TG were used for assessing thermal and kinetic parameters and PYR-GC/MS was used for degradation products chromatographic identification through the pyrograms. The infusions obtained from the fruit and leaves of Momordica charantia presented antimicrobial activity. PMID:27579215

  17. [Distribution pattern of rare plants along riparian zone and its implication for conservation in Shennongjia area].

    Science.gov (United States)

    Jiang, Mingxi; Deng, Hongbing; Cai, Qinghua

    2002-11-01

    Due to the importance of riparian zone in maintaining and protecting regional biodiversity, more and more ecologists paid their attentions to riparian zone, and had been aware of the important effects of riparian zone in basic study and practical management. In this study, forty sampling belts (10 m x 100 m) parallel to the bank of Xiangxi River at different elevations in Shennongjia area were selected to investigate the riparian vegetation and rare plants. Fourteen species of rare plants were found in riparian zone, accounting for 42.4% of total rare plant species in Shennongjia area. The main distribution range of the fourteen rare plant species was the mixed evergreen and deciduous broadleaved forest at elevation of 1200-1800 m, where species diversity of plant community was the maximum at the moderate elevation. Fourteen rare plant species could be divided into three groups against the elevation, namely low elevation species group, moderate elevation species group, and high elevation group. In the paper, the authors discussed the reasons forming the distribution pattern of rare plant species, and pointed out the important function of riparian zone on rare plant species protection.

  18. Activities and Ecological Role of Adult Aquatic Insects in the Riparian Zone of Streams

    Science.gov (United States)

    John K. Jackson; Vincent H. Resh

    1989-01-01

    Most adult aquatic insects that emerge from streams live briefly in the nearby riparian zone. Adult activities, such as mating, dispersal, and feeding, influence their distribution in the terrestrial habitat. A study at Big Sulphur Creek, California, has shown that both numbers and biomass of adult aquatic insects are greatest in the near-stream vegetation; however,...

  19. Effects of temperature, moisture and soil type on seedling emergence and mortality of riparian plant species

    NARCIS (Netherlands)

    ter Heerdt, Gerard N. J.; Veen, Ciska G.F.; van der Putten, Wim H.; Bakker, Jan P.

    Restoration of riparian plant communities on bare soil requires germination of seeds and establishment of seedlings. However, species that are present in the soil seed bank do not always establish in the vegetation. Temperature, moisture conditions and soil type could play a major role in the

  20. Structure, composition and regeneration of riparian forest along an altitudinal gradient in northern Iran

    Science.gov (United States)

    Mohammad Naghi Adel; Hassan Pourbabaei; Ali Salehi; Seyed Jalil Alavi; Daniel C. Dey

    2017-01-01

    In order to protect and understand the regeneration of riparian forests, it is important to understand the environmental conditions that lead to their vegetation differentiation. We evaluated the structure, composition, density and regeneration of woody species in forests along the river Safaroud in Ramsar forest in northern Iran in relation to elevation, soil...

  1. Effects of temperature, moisture and soil type on seedling emergence and mortality of riparian plant species

    NARCIS (Netherlands)

    Heerdt, ter Gerard N.J.; Veen, Ciska G.F.; Putten, van der Wim H.; Bakker, Jan P.

    2017-01-01

    Restoration of riparian plant communities on bare soil requires germination of seeds and establishment of seedlings. However, species that are present in the soil seed bank do not always establish in the vegetation. Temperature, moisture conditions and soil type could play a major role in the

  2. Effects of temperature, moisture and soil type on seedling emergence and mortality of riparian plant species

    NARCIS (Netherlands)

    Ter Heerdt, Gerard N.J.; Veen, G.F.; Van der Putten, Wim H.; Bakker, Jan P.

    Abstract Restoration of riparian plant communities on bare soil requires germination of seeds and establishment of seedlings. However, species that are present in the soil seed bank do not always establish in the vegetation. Temperature, moisture conditions and soil type could play a major role in

  3. Butterfly Assemblages Associated with Invasive Tamarisk (Tamarix spp.) Sites: Comparisons with Tamarisk Control and Native Vegetation Reference Sites

    OpenAIRE

    S. Mark Nelson; Rick Wydoski

    2013-01-01

    We studied butterfly assemblages at six types of riparian landscapes in five different watersheds in the southwestern United States (n=34 sites). Sites included exotic-invasive Tamarix ramosissima (tamarisk) dominated sites; sites where tamarisk was controlled, but not actively revegetated; sites revegetated with upland plants; sites where control was followed with riparian plant revegetation; native riparian vegetation sites; and sites that were a mixture of native and tamarisk vegetations. ...

  4. Novel characterization of landscape-level variability in historical vegetation structure

    Science.gov (United States)

    Brandon M. Collins; Jamie M. Lydersen; Richard G. Everett; Danny L. Fry; Scott L. Stephens

    2015-01-01

    We analyzed historical timber inventory data collected systematically across a large mixed-conifer-dominated landscape to gain insight into the interaction between disturbances and vegetation structure and composition prior to 20th century land management practices. Using records from over 20 000 trees, we quantified historical vegetation structure and composition for...

  5. Prevalence and characterization of ESBL- and AmpC-producing Enterobacteriaceae on retail vegetables

    NARCIS (Netherlands)

    van Hoek, Angela H A M; Veenman, Christiaan; van Overbeek, Wendy M; Lynch, Gretta; de Roda Husman, Ana Maria; Blaak, Hetty

    2015-01-01

    In total 1216 vegetables obtained from Dutch stores during 2012 and 2013 were analysed to determine the prevalence of 3rd-generation cephalosporin (3GC) resistant bacteria on soil-grown fresh produce possibly consumed raw. Vegetables grown conventionally and organically, from Dutch as well as

  6. Shelter Index and a simple wind speed parameter to characterize vegetation control of sand transport threshold and Flu

    Science.gov (United States)

    Gillies, J. A.; Nield, J. M.; Nickling, W. G.; Furtak-Cole, E.

    2014-12-01

    Wind erosion and dust emissions occur in many dryland environments from a range of surfaces with different types and amounts of vegetation. Understanding how vegetation modulates these processes remains a research challenge. Here we present results from a study that examines the relationship between an index of shelter (SI=distance from a point to the nearest upwind vegetation/vegetation height) and particle threshold expressed as the ratio of wind speed measured at 0.45 times the mean plant height divided by the wind speed at 17 m when saltation commences, and saltation flux. The results are used to evaluate SI as a parameter to characterize the influence of vegetation on local winds and sediment transport conditions. Wind speed, wind direction, saltation activity and point saltation flux were measured at 35 locations in defined test areas (~13,000 m2) in two vegetation communities: mature streets of mesquite covered nebkhas and incipient nebkhas dominated by low mesquite plants. Measurement positions represent the most open areas, and hence those places most susceptible to wind erosion among the vegetation elements. Shelter index was calculated for each measurement position for each 10° wind direction bin using digital elevation models for each site acquired using terrestrial laser scanning. SI can show the susceptibility to wind erosion at different time scales, i.e., event, seasonal, or annual, but in a supply-limited system it can fail to define actual flux amounts due to a lack of knowledge of the distribution of sediment across the surface of interest with respect to the patterns of SI.

  7. Riparian ecotone: A functional definition and delineation for resource assessment

    Science.gov (United States)

    E. S Verry; C. A Dolloff; M. E. Manning

    2004-01-01

    We propose a geomorphic basis for defining riparian areas using the term: riparian ecotone, discuss how past definitions fall short, and illustrate how a linked sequence of definition, delineation, and riparian sampling are used to accurately assess riparian resources on the ground. Our riparian ecotone is based on the width of the valley (its floodprone area width)...

  8. Assessing the extent and diversity of riparian ecosystems in Sonora, Mexico

    Science.gov (United States)

    Scott, M.L.; Nagler, P.L.; Glenn, E.P.; Valdes-Casillas, C.; Erker, J.A.; Reynolds, E.W.; Shafroth, P.B.; Gomez-Limon, E.; Jones, C.L.

    2009-01-01

    Conservation of forested riparian ecosystems is of international concern. Relatively little is known of the structure, composition, diversity, and extent of riparian ecosystems in Mexico. We used high- and low-resolution satellite imagery from 2000 to 2006, and ground-based sampling in 2006, to assess the spatial pattern, extent, and woody plant composition of riparian forests across a range of spatial scales for the state of Sonora, Mexico. For all 3rd and higher order streams, river bottomlands with riparian forests occupied a total area of 2,301 km2. Where forested bottomlands remained, on average, 34% of the area had been converted to agriculture while 39% remained forested. We estimated that the total area of riparian forest along the principal streams was 897 km2. Including fencerow trees, the total forested riparian area was 944 km2, or 0.5% of the total land area of Sonora. Ground-based sampling of woody riparian vegetation consisted of 92, 50 m radius circular plots. About 79 woody plant species were noted. The most important tree species, based on cover and frequency, were willow species Salix spp. (primarily S. goodingii and S. bonplandiana), mesquite species Prosopis spp. (primarily P. velutina), and Fremont cottonwood Populus fremontii. Woody riparian taxa at the reach scale showed a trend of increasing diversity from north to south within Sonora. Species richness was greatest in the willow-bald cypress Taxodium distichum var. mexicanum-Mexican cottonwood P. mexicana subsp. dimorphia ecosystem. The non-native tamarisk Tamarix spp. was rare, occurring at just three study reaches. Relatively natural stream flow patterns and fluvial disturbance regimes likely limit its establishment and spread. ?? 2008 Springer Science + Business Media BV.

  9. Monitoring and mapping selected riparian habitat along the lower Snake River

    Energy Technology Data Exchange (ETDEWEB)

    Downs, J. L; Tiller, B. L [Pacific Northwest Lab., Richland, WA (United States); Witter, M. [Shannon and Wilson, Inc., Seattle, WA (United States). Geotechnical and Environmental Consultants, Seattle, Washington (United States); Mazaika, R. [Corps of Engineers, Portland, OR (United States)

    1996-01-01

    Studies in this document were initiated to establish baseline information on riparian and wetland habitat conditions at the areas studied under the current reservoir operations on the lower Snake River. Two approaches were used to assess habitat at 28 study sites selected on the four pools on the lower Snake River. These areas all contribute significant riparian habitat along the river, and several of these areas are designated habitat management units. At 14 of the 28 sites, we monitored riparian habitat on three dates during the growing season to quantify vegetation abundance and composition along three transects: soil nutrients, moisture, and pH and water level and pH. A second approach involved identifying any differences in the extent and amount of riparian/wetland habitat currently found at the study areas from that previously documented. We used both ground and boat surveys to map and classify the changes in vegetative cover along the shoreline at the 14 monitoring sites and at 14 additional sites along the lower Snake selected to represent various riparian/wetland habitat conditions. Results of these mapping efforts are compared with maps of cover types previously generated using aerial photography taken in 1987.

  10. Historical land-cover/use in different slope and riparian buffer zones in watersheds of the state of São Paulo, Brazil Cobertura vegetal em diferentes usos do solo e declividades do terreno em bacias hidrográficas do estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Alexandre Marco da Silva

    2007-08-01

    Full Text Available Information about the land cover of a region it is a key information for several purposes. This paper aimed to elaborate land-cover maps using digital satellite images obtained in 1997 from seven watersheds (Piracicaba, Moji-Guaçu, Alto Paranapanema, Turvo Aguapeí, Peixe, and São José dos Dourados located in the State of São Paulo, southeastern Brazil. Additionaly, this study evaluated the relationship between land-cover and slopes of the terrain of the seven watersheds. A third objective was to estimate the percentage of riparian vegetation currently remaining along the streams in a 30-meter width buffer zone. Three research questions were posed: i What is the dominant land-cover of these watersheds? ii Is the riparian vegetation well preserved in the 30m width buffer zone? If not, iii what is the dominant land-cover in these areas and what would be the cost of recovering such areas? Pasture was the predominant land-cover, occurring in approximately 50% of the entire study area, while sugar cane (Saccharum officinarum (14% constituted the second most frequent land-cover. Approximately 50% of the area of the seven basins is considered flat (40% or smoothly rolling (10%. The terrain only becomes hillier in the Piracicaba and Alto Paranapanema basins, where a little less than 50% have slopes higher than 8%. The total riparian buffer strip zone occupied an area equivalent to approximately 6,200 km². From this total, only 25% is preserved. Pasture is the main land-cover of the riparian buffer strip zone.Informações sobre mudanças no uso e cobertura do solo são fundamentais para vários propósitos sociais, econômicos e ambientais. O principal objetivo deste estudo foi elaborar mapas de cobertura do solo usando imagens digitais obtidas por satélite no ano de 1997 nas seguintes bacias hidrográficas do Estado de São Paulo: Piracicaba, Moji-Guaçu, Alto Paranapanema, Turvo Aguapeí, Peixe, and São José dos Dourados. Adicionalmente, a

  11. Spatial and temporal analysis of the land cover in riparian buffer zones (Areas for Permanent Preservation in Sorocaba City, SP, Brazil

    Directory of Open Access Journals (Sweden)

    Sergio Henrique Alves

    2009-08-01

    Full Text Available Considering the fundamental role that the riparian vegetation plays in relation to maintenance of the environmental health of a watershed and the necessity of restoring sectors of the buffer zone without natural vegetation, in this paper we investigated what land cover classes occur along the riparian buffer stripes considered Area for Permanent Preservation (APP in the Sorocaba municipality, SP in three periods: 1988, 1995 and 2003. Based on GIS technology and using the drainage network map, the APP stripes (riparian buffer zones map was generated, and this map was overlaid to the land cover map (1988, 1995 and 2003 to provide a land cover map specifically of the riparian buffer zones. The results show that 58.43% of the APPs have no land cover of native vegetation and therefore, need to be reforested, representing 5,400 hectares to be restored.

  12. Trace element content of vegetables grown in the victorian goldfields: characterization of a potential hazard

    International Nuclear Information System (INIS)

    Harvey, G.; Dowling, K.; Waldron, H.; Garnett, D.

    2003-01-01

    Plants take-up trace elements essential to healthy growth, but if metal accumulation is excessive, harmful effects are noted in the plant and potentially in the organisms that feed on them. Central Victoria has a rich gold mining heritage, and as such, much of the landscape has been disturbed by the addition of mine waste material, providing an abundant source of metals in a mobile environment. A biogeochemical survey was conducted to evaluate the trace element content of backyard vegetable gardens in the gold field region and the trace element accumulation in commonly grown vegetables. Vegetable (n150) and soil (n59) samples were analysed by instrumental neutron activation analysis. Results indicate that vegetables grown in the central Victorian goldfields have only slightly elevated trace element content. Some exceptions exist, specifically for silverbeet, but the hazard potential is minimal

  13. Prevalence and characterization of ESBL- and AmpC-producing Enterobacteriaceae on retail vegetables.

    Science.gov (United States)

    van Hoek, Angela H A M; Veenman, Christiaan; van Overbeek, Wendy M; Lynch, Gretta; de Roda Husman, Ana Maria; Blaak, Hetty

    2015-07-02

    In total 1216 vegetables obtained from Dutch stores during 2012 and 2013 were analysed to determine the prevalence of 3rd-generation cephalosporin (3GC) resistant bacteria on soil-grown fresh produce possibly consumed raw. Vegetables grown conventionally and organically, from Dutch as well as foreign origin were compared. Included were the following vegetable types; blanched celery (n=192), bunched carrots (n=190), butterhead lettuce (n=137), chicory (n=96), endive (n=188), iceberg lettuce (n=193) and radish (n=120). Overall, 3GC-resistant Enterobacteriaceae were detected on 5.2% of vegetables. Based on primary habitat and mechanism of 3GC-resistance, these bacteria could be divided into four groups: ESBL-producing faecal species (Escherichia coli, Enterobacter spp.), AmpC-producing faecal species (Citrobacter freundii, Enterobacter spp.), ESBL-producing environmental species (Pantoea spp., Rahnella aquatilis, Serratia fonticola), and AmpC-producing environmental species (Cedecca spp., Hafnia alvei, Pantoea spp., Serratia plymuthica), which were detected on 0.8%, 1.2%, 2.6% and 0.4% of the vegetables analysed, respectively. Contamination with faecal 3GC-resistant bacteria was most frequently observed in root and bulb vegetables (average prevalence 4.4%), and less frequently in stem vegetables (prevalence 1.6%) and leafy greens (average prevalence 0.6%). In Dutch stores, only four of the included vegetable types (blanched celery, bunched carrots, endive, iceberg lettuce) were available in all four possible variants: Dutch/conventional, Dutch/organic, foreign/conventional, foreign/organic. With respect to these vegetable types, no statistically significant difference was observed in prevalence of 3GC-resistant Enterobacteriaceae between country of origin or cultivation type (5.2%, 5.7%, 5.7% and 3.3%, respectively). Vegetables consumed raw may be a source of dissemination of 3GC-resistant Enterobacteriaceae and their resistance genes to humans. The magnitude of the

  14. Occurrence and genetic characterization of Listeria spp. in minimally processed vegetables commercialized in Porto Alegre, Brazil

    OpenAIRE

    Verdin, Sylvia Elisa Frizzo; Silva, Silvia Regina Pavan da; Pereira, Dariane Castro; Schatkoski, Aline Modelski; Corção, Gertrudes

    2007-01-01

    Minimally processed vegetables go through many steps before they are refrigerated, selection, washing, peeling, cutting, disinfection and finally packaging. However, if no care is taken at the origin of the raw materials and in the processing stages, there is a chance of finding pathogenic bacteria, such as Listeria monocytogenes, which are able to grow at low temperatures. The aim of this research was to verify the occurrence of Listeria sp. in minimally processed vegetables sold in Porto Al...

  15. Quantifying Forested Riparian Buffer Ability to Ameliorate Stream Temperature in a Missouri Ozark Border Stream of the Central U.S

    Science.gov (United States)

    Bulliner, E. A.; Hubbart, J. A.

    2009-12-01

    Riparian buffers play an important role in modulating stream water quality, including temperature. There is a need to better understand riparian form and function to validate and improve contemporary management practices. Further studies are warranted to characterize energy attenuation by forested riparian canopy layers that normally buffer stream temperature, particularly in the central hardwood forest regions of the United States where relationships between canopy density and stream temperature are unknown. To quantify these complex processes, two intensively instrumented hydroclimate stations were installed along two stream reaches of a riparian stream in central Missouri, USA in the winter of 2008. Hydroclimate stations are located along stream reaches oriented in both cardinal directions, which will allow interpolation of results to other orientations. Each station consists of an array of instrumentation that senses the flux of water and energy into and out of the riparian zone. Reference data are supplied from a nearby flux tower (US DOE) located on top of a forested ridge. The study sites are located within a University of Missouri preserved wildland area on the border of the southern Missouri’s Ozark region, an ecologically distinct region in the central United States. Limestone underlies the study area, resulting in a distinct semi-Karst hydrologic system. Vegetation forms a complex, multi-layered canopy extending from the stream edge through the riparian zone and into surrounding hills. Climate is classified as humid continental, with approximate average annual temperature and precipitation of 13.2°C and 970mm, respectively. Preliminary results (summer 2009 data) indicate incoming short-wave radiation is 24.9% higher at the N-S oriented stream reach relative to the E-W oriented reach. Maximum incoming short wave radiation during the period was 64.5% lower at the N-S reach relative to E-W reach. Average air temperature for the E-W reach was 0.3°C lower

  16. Temporal profiles of vegetation indices for characterizing grazing intensity on natural grasslands in Pampa biome

    Directory of Open Access Journals (Sweden)

    Amanda Heemann Junges

    2016-08-01

    Full Text Available ABSTRACT The Pampa biome is an important ecosystem in Brazil that is highly relevant to livestock production. The objective of this study was to analyze the potential use of vegetation indices to discriminate grazing intensities on natural grasslands in the Pampa biome. Moderate Resolution Imaging Spectroradiometer (MODIS Normalized Difference Vegetation Index (NDVI and Enhanced Vegetation Index (EVI images from Jan to Dec, 2000 to 2013 series, were analyzed for natural grassland experimental units managed under high (forage allowance of 5 ± 2 % live weight – LW, moderate (13 ± 5 % LW and low grazing intensity (19 ± 7 % LW. Regardless of intensity, the temporal profiles showed lower NDVI and EVI during winter, increased values in spring because of summer species regrowth, slightly decreased values in summer, especially in years when there is a water deficit, and increased values in the fall associated with the beginning of winter forage development. The average temporal profiles of moderate grazing intensity exhibited greater vegetation index values compared with low and high grazing intensities. The temporal profiles of less vegetation index were associated with lower green biomass accumulation caused by the negative impact of stocking rates on the leaf area index under high grazing intensity and a floristic composition with a predominance of tussocks under low grazing intensity. Vegetation indices can be used for distinguishing moderate grazing intensity from low and high intensities. The average EVI values can discriminate moderate grazing intensity during any season, and the NDVI values can discriminate moderate grazing intensity during spring and winter.

  17. Simulation of Soil Quality with Riparian Forests and Cultivated with Sugarcane

    Science.gov (United States)

    da Silva, Luiz Gabriel; Colato, Alexandre; Casagrande, José Carlos; Soares, Marcio Roberto; Perissatto Meneghin, Silvana

    2013-04-01

    Riparian forests are entrusted with important hydrological functions, such as riparian zone protection, filtering sediments and nutrients and mitigation of the amount of nutrients and xenobiotic molecules from the surrounding agro ecosystems. The soil was sampled in the depths of 0-0,2 and 0.2-0.4 m and its chemical (nutrient content and organic matter, cationic exchange capacity - CEC, sum of bases-SB, bases saturation, V%, and aluminum saturation, m%); physical (particle size distribution, density and porosity) and microbiological attributes (basal respiration and microbial biomass) were determined. This work aimed to study the liner method of combining data, figures of merit (FoM), weighing process and the scoring functions developed by Wymore and asses the quality of the soil (SQI) by means of chemical, physical and microbiological soil attributes, employing the additive pondered model for two areas of riparian forest at different stages of ecological succession and an adjacent area cultivated with sugar cane, located on the dam shores of Sugar Mill Saint Lucia-Araras/SP. Some hierarchical functions containing FoMs and their parameters were constructed, and from them weights were assigned to each FoM and parameter, in a way that cluster of structures with the same FoMs and parameters with different weights were formed. These clusters were used to calculate the SQI for all vegetal formations considering two types of soil (Oxisol and Podzol), in that way, the SQI was calculated for each combination of vegetation and soil. The SQIs values were usually higher in the oldest riparian forest, while the recent riparian forest showed the smallest SQI values, for both types of soil. The variation of values within a combination vegetation/soil was also different between all combinations, being that the set of values from the oldest riparian forest presented the lowest amplitude. It was also observed that the Oxisols, regardless of the vegetation, presented higher SQIs

  18. The evaluation of the establishment and growth of indigenous trees to restore deforested riparian areas in the Mapungubwe National Park, South Africa / Theo Scholtz

    OpenAIRE

    Scholtz, Theo

    2007-01-01

    The deforestation of riparian areas is a major concern in southern Africa. These areas are characterized as fragile ecosystems which contribute largely to the regional and global biodiversity of the world. It is therefore important to restore these degraded areas along the natural rivers of South Africa to ensure the sustainability and biodiversity of riparian corridors. Riparian areas inside the National Parks of South Africa, and especially in Mapungubwe National Park, have a high esthetica...

  19. PHYTOCOENOSES OF URBAN RIPARIAN FORESTS ON THE EXAMPLE OF THE LAS OSOBOWICKI FOREST (WROCŁAW

    Directory of Open Access Journals (Sweden)

    Ewa Stefańska-Krzaczek

    2014-10-01

    Full Text Available The Las Osobowicki forest is remnant riparian woodland of the Odra valley. Floristic data were collected from circular 100m2 plots (with a radius of 5.64m which were systematically chosen in forest communities. Four plant communities were determined within data set. They were represented Fagetalia order and Querco-Fagetea class. Flood prevention caused disappearance of riparian forest species, expansion of common hornbeam and Norway maple expansion and a decrease of species richness. However, spatial distribution of phytocoenoses proves the river influence on the vegetation.

  20. Riparian bird density decline in response to biocontrol of Tamarix from riparian ecosystems along the Dolores River in SW Colorado, USA

    Science.gov (United States)

    Darrah, Abigail J.; van Riper, Charles

    2018-01-01

    Biocontrol of invasive tamarisk (Tamarix spp.) in the arid Southwest using the introduced tamarisk beetle (Diorhabda elongata) has been hypothesized to negatively affect some breeding bird species, but no studies to date have documented the effects of beetle-induced defoliation on riparian bird abundance. We assessed the effects of tamarisk defoliation by monitoring defoliation rates, changes in vegetation composition, and changes in density of six obligate riparian breeding bird species at two sites along the Dolores River in Colorado following the arrival of tamarisk beetles. We conducted bird point counts from 2010 to 2014 and modeled bird density as a function of native vegetation density and extent of defoliation using hierarchical distance sampling. Maximum annual defoliation decreased throughout the study period, peaking at 32–37% in 2009–2010 and dropping to 0.5–15% from 2011–2014. Stem density of both tamarisk and native plants declined throughout the study period until 2014. Density of all bird species declined throughout most of the study, with Song Sparrow disappearing from the study sites after 2011. Blue Grosbeak, Yellow-breasted Chat, and Yellow Warbler densities were negatively related to defoliation in the previous year, while Lazuli Bunting exhibited a positive relationship with defoliation. These findings corroborate earlier predictions of species expected to be sensitive to defoliation as a result of nest site selection. Tamarisk defoliation thus had short-term negative impacts on riparian bird species; active restoration may be needed to encourage the regrowth of native riparian vegetation, which in the longer-term may result in increased riparian bird density.

  1. Do invasive riparian Tamarix alter hydrology of riparian areas of arid and semi-arid regions under climate change scenarios?

    Science.gov (United States)

    Bhattarai, M. P.; Acharya, K.; Chen, L.

    2012-12-01

    Competitiveness of riparian invasive species, Tamarix, in arid and semi-arid riparian areas of the southwestern United States under climate change scenario (SRES A2) was investigated. Tamarix has been replacing native vegetation along the riparian corridors of these areas for the past several decades and is thought to alter water balance. Changes in depth to groundwater, soil moisture distribution and flood frequency are critical in survival and growth of a facultative phreatophyte such as Tamarix. In this study, a fully coupled 2d surface flow and 3d subsurface flow hydrologic model, HydroGeoSphere, was used to simulate surface-subsurface hydrology of the lower Virgin River basin (4500 sq. km), located in Nevada, Utah and Arizona. The hydrologic model results, depth to groundwater and soil saturation, were then applied to the species distribution model, Maxent, along with other bioclimatic parameters to asses future Tamarix distribution probability. Simulations were made for the climate scenarios of the end of 21st centry conditions. Depth to groundwater is found to be the most important predictor variable to the Maxent model. Future Tamarix distribution range is not uniform across the basin. It is likely to decrease at lower elevations and increase in some higher elevation areas.

  2. Groundwater management institutions to protect riparian habitat

    Science.gov (United States)

    Orr, Patricia; Colby, Bonnie

    2004-12-01

    Groundwater pumping affects riparian habitat when it causes the water table to drop beyond the reach of riparian plants. Riparian habitat provides services that are not directly traded in markets, as is the case with many environmental amenities. There is no direct market where one may buy or sell the mix of services provided by a riparian corridor. The objective of this article is to review groundwater management mechanisms and assess their strengths and weaknesses for preserving the ecological integrity of riparian areas threatened by groundwater pumping. Policy instruments available to those concerned with the effects of groundwater pumping on riparian areas fall into three broad categories: (1) command and control (CAC), (2) incentive-based economic instruments, and (3) cooperative/suasive strategies. The case of the San Pedro River illustrates multiple and overlapping strategies applied in an ongoing attempt to reverse accumulating damage to a riparian ecosystem. Policy makers in the United States can choose among a broad menu of policy options to protect riparian habitat from groundwater pumping. They can capitalize on the clarity of command-and-control strategies, the flexibility and less obtrusive nature of incentive-based economic strategies, and the benefits that collaborative efforts can bring in the form of mutual consideration. While collaborative problem solving and market-based instruments are important policy tools, experience indicates that a well-formulated regulatory structure to limit regional groundwater pumping is an essential component of an effective riparian protection strategy.

  3. Modeling the evolution of riparian woodlands facing climate change in three European rivers with contrasting flow regimes.

    Directory of Open Access Journals (Sweden)

    Rui P Rivaes

    Full Text Available Global circulation models forecasts indicate a future temperature and rainfall pattern modification worldwide. Such phenomena will become particularly evident in Europe where climate modifications could be more severe than the average change at the global level. As such, river flow regimes are expected to change, with resultant impacts on aquatic and riparian ecosystems. Riparian woodlands are among the most endangered ecosystems on earth and provide vital services to interconnected ecosystems and human societies. However, they have not been the object of many studies designed to spatially and temporally quantify how these ecosystems will react to climate change-induced flow regimes. Our goal was to assess the effects of climate-changed flow regimes on the existing riparian vegetation of three different European flow regimes. Cases studies were selected in the light of the most common watershed alimentation modes occurring across European regions, with the objective of appraising expected alterations in the riparian elements of fluvial systems due to climate change. Riparian vegetation modeling was performed using the CASiMiR-vegetation model, which bases its computation on the fluvial disturbance of the riparian patch mosaic. Modeling results show that riparian woodlands may undergo not only at least moderate changes for all flow regimes, but also some dramatic adjustments in specific areas of particular vegetation development stages. There are circumstances in which complete annihilation is feasible. Pluvial flow regimes, like the ones in southern European rivers, are those likely to experience more pronounced changes. Furthermore, regardless of the flow regime, younger and more water-dependent individuals are expected to be the most affected by climate change.

  4. Modeling the Effects of Hydrogeomorphology and Climactic Factors on Nitrogen, Phosphorus, and Greenhouse Gas Dynamics in Riparian Zones.

    Science.gov (United States)

    Hassanzadeh, Y.; Vidon, P.; Gold, A.; Pradhanang, S. M.; Addy, K.

    2017-12-01

    Vegetated riparian zones are often considered for use as best management practices to mitigate the impacts of agriculture on water quality. However, riparian zones can also be a source of greenhouse gases and their influence on water quality varies depending on landscape hydrogeomorphic characteristics and climate. Methods used to evaluate riparian zone functions include conceptual models, and spatially explicit and process based models (REMM), but very few attempts have been made to connect riparian zone characteristics with function using easily accessible landscape scale data. Here, we present comprehensive statistical models that can be used to assess riparian zone functions with easily obtainable landscape-scale hydrogeomorphic attributes and climate data. Models were developed from a database spanning 88 years and 36 sites. Statistical methods including principal component analysis and stepwise regression were used to reduced data dimensionality and identify significant predictors. Models were validated using additional data collected from scientific literature. The 8 models developed connect landscape characteristics to nitrogen and phosphorus concentration and removal (1-4), greenhouse gas emissions (5-7), and water table depth (8). Results show the range of influence that various climate and landscape characteristics have on riparian zone functions, and the tradeoffs that exist with regards to nitrogen, phosphorous, and greenhouse gases. These models will help reduce the need for extensive field measurements and help scientists and land managers make more informed decisions regarding the use of riparian zones for water quality management.

  5. Impacts of hydroelectric dams on alluvial riparian plant communities in Eastern Brazilian Amazonian.

    Science.gov (United States)

    Ferreira, Leandro Valle; Cunha, Denise A; Chaves, Priscilla P; Matos, Darley C L; Parolin, Pia

    2013-09-01

    The major rivers of the Amazon River basin and their biota are threatened by the planned construction of large hydroelectric dams that are expected to have strong impacts on floodplain plant communities. The present study presents forest inventories from three floodplain sites colonized by alluvial riparian vegetation in the Tapajós, Xingu and Tocantins River basins in eastern Amazonian. Results indicate that tree species of the highly specialized alluvial riparian vegetation are clearly distinct among the three river basins, although they are not very distinct from each other and environmental constraints are very similar. With only 6 of 74 species occurring in all three inventories, most tree and shrub species are restricted to only one of the rivers, indicating a high degree of local distribution. Different species occupy similar environmental niches, making these fragile riparian formations highly valuable. Conservation plans must consider species complementarily when decisions are made on where to place floodplain forest conservation units to avoid the irreversible loss of unique alluvial riparian vegetation biodiversity.

  6. Impacts of hydroelectric dams on alluvial riparian plant communities in eastern Brazilian Amazonian

    Directory of Open Access Journals (Sweden)

    LEANDRO VALLE FERREIRA

    2013-09-01

    Full Text Available The major rivers of the Amazon River basin and their biota are threatened by the planned construction of large hydroelectric dams that are expected to have strong impacts on floodplain plant communities. The present study presents forest inventories from three floodplain sites colonized by alluvial riparian vegetation in the Tapajós, Xingu and Tocantins River basins in eastern Amazonian. Results indicate that tree species of the highly specialized alluvial riparian vegetation are clearly distinct among the three river basins, although they are not very distinct from each other and environmental constraints are very similar. With only 6 of 74 species occurring in all three inventories, most tree and shrub species are restricted to only one of the rivers, indicating a high degree of local distribution. Different species occupy similar environmental niches, making these fragile riparian formations highly valuable. Conservation plans must consider species complementarily when decisions are made on where to place floodplain forest conservation units to avoid the irreversible loss of unique alluvial riparian vegetation biodiversity.

  7. Characterization and classification of vegetation canopy structure and distribution within the Great Smoky Mountains National Park using LiDAR

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Jitendra [ORNL; HargroveJr., William Walter [United States Department of Agriculture (USDA), United States Forest Service (USFS); Norman, Steven P [United States Department of Agriculture (USDA), United States Forest Service (USFS); Hoffman, Forrest M [ORNL; Newcomb, Doug [U.S. Fish and Wildlife Service

    2015-01-01

    Vegetation canopy structure is a critically important habit characteristic for many threatened and endangered birds and other animal species, and it is key information needed by forest and wildlife managers for monitoring and managing forest resources, conservation planning and fostering biodiversity. Advances in Light Detection and Ranging (LiDAR) technologies have enabled remote sensing-based studies of vegetation canopies by capturing three-dimensional structures, yielding information not available in two-dimensional images of the landscape pro- vided by traditional multi-spectral remote sensing platforms. However, the large volume data sets produced by airborne LiDAR instruments pose a significant computational challenge, requiring algorithms to identify and analyze patterns of interest buried within LiDAR point clouds in a computationally efficient manner, utilizing state-of-art computing infrastructure. We developed and applied a computationally efficient approach to analyze a large volume of LiDAR data and to characterize and map the vegetation canopy structures for 139,859 hectares (540 sq. miles) in the Great Smoky Mountains National Park. This study helps improve our understanding of the distribution of vegetation and animal habitats in this extremely diverse ecosystem.

  8. Vegetable processing wastes addition to improve swine manure anaerobic digestion: Evaluation in terms of methane yield and SEM characterization

    International Nuclear Information System (INIS)

    Molinuevo-Salces, Beatriz; González-Fernández, Cristina; Gómez, Xiomar; García-González, María Cruz; Morán, Antonio

    2012-01-01

    Highlights: ► Vegetable waste as co-substrate for swine manure anaerobic digestion. ► Two hydraulic retention times of 25 and 15 d, respectively. ► SEM characterization of anaerobic sludges to observe microbial composition. ► Vegetable waste as co-substrate increases methane yields up to three times. ► Microbial composition changes after 120 d of digestion. -- Abstract: The effect of adding vegetable waste as a co-substrate in the anaerobic digestion of swine manure was investigated. The study was carried out at laboratory scale using semi-continuous stirred tank reactors working at 37 °C. Organic loading rates (OLRs) of 0.4 and 0.6 g VS L −1 d −1 were evaluated, corresponding to hydraulic retention times (HRTs) of 25 and 15 d, respectively. The addition of vegetable wastes (50% dw/dw) resulted in an improvement of 3 and 1.4-fold in methane yields at HRTs of 25 and 15 d, respectively. Changes on microbial morphotypes were studied by Scanning Electron Microscopy (SEM). Samples analyzed were sludge used as inoculum and digestate obtained from swine manure anaerobic reactors. SEM pictures demonstrated that lignocellulosic material was not completely degraded. Additionally, microbial composition was found to change to cocci and rods morphotypes after 120 d of anaerobic digestion.

  9. Riparian Habitat Management for Mammals on Corps of Engineers Projects

    National Research Council Canada - National Science Library

    Martin, Chester

    2002-01-01

    .... This note provides an overview of the importance of riparian ecosystems to mammals, discusses regional variation in mammal communities characteristic of riparian zones, identifies potential impacts...

  10. Multiscale Geophysical Characterization of Weathering Fronts Along a Climate and Vegetation Gradient in Chile

    Science.gov (United States)

    Dal Bo, I.; Klotzsche, A.; Schaller, M.; Ehlers, T. A.; Vereecken, H.; Van Der Kruk, J.

    2017-12-01

    more vegetated south-facing hillslopes, which could be correlated with increased signal penetration and reflection depths in the GPR profiles. Soil depths and their interaction with biota in soil-mantled landscapes will be better characterized by combining geophysics with more environmental parameters within the interdisciplinary EarthShape project.

  11. [Retaining and transformation of incoming soil N from highland to adjacent terrestrial water body in riparian buffer zone].

    Science.gov (United States)

    Wang, Qing-cheng; Yu, Hong-li; Yao, Qin; Han, Zhuang-xing; Qiao, Shu-liang

    2007-11-01

    Highland soil nitrogen can enter adjacent water body via erosion and leaching, being one of the important pollutants in terrestrial water bodies. Riparian buffer zone is a transitional zone between highland and its adjacent water body, and a healthy riparian buffer zone can retain and transform the incoming soil N through physical, biological, and biochemical processes. In this paper, the major pathways through which soil nitrogen enters terrestrial water body and the mechanisms the nitrogen was retained and transformed in riparian buffer zone were introduced systematically, and the factors governing the nitrogen retaining and transformation were analyzed from the aspects of hydrological processes, soil characters, vegetation features, and human activities. The problems existing in riparian buffer zone study were discussed, and some suggestions for the further study in China were presented.

  12. Seasonal estimates of riparian evapotranspiration using remote and in situ measurements

    Science.gov (United States)

    Goodrich, D.C.; Scott, R.; Qi, J.; Goff, B.; Unkrich, C.L.; Moran, M.S.; Williams, D.; Schaeffer, S.; Snyder, K.; MacNish, R.; Maddock, T.; Pool, D.; Chehbouni, A.; Cooper, D.I.; Eichinger, W.E.; Shuttleworth, W.J.; Kerr, Y.; Marsett, R.; Ni, W.

    2000-01-01

    In many semi-arid basins during extended periods when surface snowmelt or storm runoff is absent, groundwater constitutes the primary water source for human habitation, agriculture and riparian ecosystems. Utilizing regional groundwater models in the management of these water resources requires accurate estimates of basin boundary conditions. A critical groundwater boundary condition that is closely coupled to atmospheric processes and is typically known with little certainty is seasonal riparian evapotranspiration ET). This quantity can often be a significant factor in the basin water balance in semi-arid regions yet is very difficult to estimate over a large area. Better understanding and quantification of seasonal, large-area riparian ET is a primary objective of the Semi-Arid Land-Surface-Atmosphere (SALSA) Program. To address this objective, a series of interdisciplinary experimental Campaigns were conducted in 1997 in the San Pedro Basin in southeastern Arizona. The riparian system in this basin is primarily made up of three vegetation communities: mesquite (Prosopis velutina), sacaton grasses (Sporobolus wrightii), and a cottonwood (Populus fremontii)/willow (Salix goodingii) forest gallery. Micrometeorological measurement techniques were used to estimate ET from the mesquite and grasses. These techniques could not be utilized to estimate fluxes from the cottonwood/willow (C/W) forest gallery due to the height (20-30 m) and non-uniform linear nature of the forest gallery. Short-term (2-4 days) sap flux measurements were made to estimate canopy transpiration over several periods of the riparian growing season. Simultaneous remote sensing measurements were used to spatially extrapolate tree and stand measurements. Scaled C/W stand level sap flux estimates were utilized to calibrate a Penman-Monteith model to enable temporal extrapolation between Synoptic measurement periods. With this model and set of measurements, seasonal riparian vegetation water use

  13. Floristic composition of the riparian forest in the lower Gramame river, Paraíba, Brazil

    Directory of Open Access Journals (Sweden)

    Hermes de Oliveira Machado Filho

    2015-09-01

    Full Text Available Riparian forest has a key ecological and economic significance to productive chains associated with it. This study aimed to conduct a floristic survey of riparian forest stretches in the Gramame river, state of Paraíba, Brazilian Northeast region, and analyze the floristic similarity with Brazilian riparian vegetation fragments. We found 136 species belonging to 106 genera and 43 families. The most representative families were: Fabaceae (19 spp., Cyperaceae (16 spp., and Rubiaceae (11 spp.. The predominant habit was herbaceous and the best represented biological spectrum was camephyte. Regarding the geographic distribution, there was a predominance of widely distributed species associated with the Neotropical province. The distribution patterns have shown a low similarity between areas, and largely distributed species stand out. Similarity analysis pointed out that the area was floristically related to other two coastal areas in the Brazilian Northeast and Southeast regions. Only species typically related to estuarine environments might explain the floristic connections detected.

  14. Riparian spiders as sentinels of polychlorinated biphenyl contamination across heterogeneous aquatic ecosystems

    Science.gov (United States)

    Kraus, Johanna M.; Gibson, Polly P.; Walters, David M.; Mills, Marc A.

    2017-01-01

    Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems.However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the hypothesis that riparian spiders may be effectively used to track spatial patterns of sediment pollution by polychlorinated biphenyls (PCBs) in aquatic ecosystems with high habitat heterogeneity. The spatial pattern of ΣPCB concentrations in 2 common families of riparian spiders sampled in 2011 to 2013 generally tracked spatial variation in sediment ΣPCBs across all sites within the Manistique River Great Lakes Area of Concern (AOC), a rivermouth ecosystem located on the south shore of the Upper Peninsula, Manistique (MI,USA) that includes harbor, river, backwater, and lake habitats. Sediment ΣPCB concentrations normalized for total organic carbon explained 41% of the variation in lipid-normalized spider ΣPCB concentrations across 11 sites. Furthermore, 2 common riparian spider taxa (Araneidae and Tetragnathidae) were highly correlated (r2> 0.78) and had similar mean ΣPCB concentrations when averaged acrossall years. The results indicate that riparian spiders may be useful sentinels of relative PCB availability to aquatic and riparian food webs in heterogeneous aquatic ecosystems like rivermouths where habitat and contaminant variability may make the use of aquatic taxa lesseffective. Furthermore, the present approach appears robust to heterogeneity in shoreline development and riparian vegetation that support different families of large web-building spiders. Environ Toxicol Chem 2016;9999:1–9. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in the public domain in the United States of America.

  15. Riparian spiders as sentinels of polychlorinated biphenyl contamination across heterogeneous aquatic ecosystems.

    Science.gov (United States)

    Kraus, Johanna M; Gibson, Polly P; Walters, David M; Mills, Marc A

    2017-05-01

    Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the hypothesis that riparian spiders may be effectively used to track spatial patterns of sediment pollution by polychlorinated biphenyls (PCBs) in aquatic ecosystems with high habitat heterogeneity. The spatial pattern of ΣPCB concentrations in 2 common families of riparian spiders sampled in 2011 to 2013 generally tracked spatial variation in sediment ΣPCBs across all sites within the Manistique River Great Lakes Area of Concern (AOC), a rivermouth ecosystem located on the south shore of the Upper Peninsula, Manistique (MI, USA) that includes harbor, river, backwater, and lake habitats. Sediment ΣPCB concentrations normalized for total organic carbon explained 41% of the variation in lipid-normalized spider ΣPCB concentrations across 11 sites. Furthermore, 2 common riparian spider taxa (Araneidae and Tetragnathidae) were highly correlated (r 2  > 0.78) and had similar mean ΣPCB concentrations when averaged across all years. The results indicate that riparian spiders may be useful sentinels of relative PCB availability to aquatic and riparian food webs in heterogeneous aquatic ecosystems like rivermouths where habitat and contaminant variability may make the use of aquatic taxa less effective. Furthermore, the present approach appears robust to heterogeneity in shoreline development and riparian vegetation that support different families of large web-building spiders. Environ Toxicol Chem 2017;36:1278-1286. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in the public domain in the United States of America. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in

  16. Indirect effects of biocontrol of an invasive riparian plant (Tamarix) alters habitat and reduces herpetofauna abundance

    Science.gov (United States)

    Bateman, H.L.; Merritt, D.M.; Glenn, E.P.; Nagler, P.L.

    2014-01-01

    The biological control agent (tamarisk leaf beetle, Diorhabda spp.) is actively being used to defoliate exotic saltcedar or tamarisk (Tamarix spp.) in riparian ecosystems in western USA. The Virgin River in Arizona and Nevada is a system where tamarisk leaf beetle populations are spreading. Saltcedar biocontrol, like other control methods, has the potential to affect non-target species. Because amphibians and reptiles respond to vegetation changes in habitat and forage in areas where beetles are active, herpetofauna are model taxa to investigate potential impacts of biocontrol defoliation. Our objectives related herpetofauna abundance to vegetation cover and indices (normalized difference vegetation index, NDVI; enhanced vegetation index, EVI) and timing of biocontrol defoliation. We captured herpetofauna and ground-dwelling arthropods in trap arrays and measured vegetation using remotely sensed images and on-the-ground measurements at 16–21 sites 2 years before (2009–2010) and 2 years following (2011–2012) biocontrol defoliation. Following defoliation, riparian stands (including stands mixed with native and exotic trees and stands of monotypic exotic saltcedar) had significantly lower NDVI and EVI values and fewer captures of marked lizards. Total captures of herpetofauna (toads, lizards, and snakes) were related to higher vegetation cover and sites with a lower proportion of saltcedar. Our results suggest that effects of biocontrol defoliation are likely to be site-specific and depend upon the proportion of native riparian trees established prior to biocontrol introduction and defoliation. The mechanisms by which habitat structure, microclimate, and ultimately vertebrate species are affected by exotic plant biocontrol riparian areas should be a focus of natural-resource managers.

  17. Microbiological characterization of vegetables and their rhizosphere soil in Eastern Poland.

    Science.gov (United States)

    Kłapeć, Teresa; Wójcik-Fatla, Angelina; Cholewa, Alicja; Cholewa, Grażyna; Dutkiewicz, Jacek

    2016-12-23

    The aim of this study was to investigate the bacteriological quality of 5 kinds of vegetables (lettuce, dill, radish, beetroot, carrot) and their rhizosphere soil, originating from conventional farms located in the Lublin Province of Eastern Poland. A total number of 35 samples of fresh vegetables (FV) taken immediately from soil, 35 samples of soil from rhizosphere of these vegetables (SR) and 35 samples of vegetables sold at retail in the markets in Lublin (VR) were examined. The samples were analysed for the content of: aerobic mesophilic bacteria (AMB) grown at 30°C and 37°C, Gram-negative bacteria of Enterobacteriaceae family, faecal coliform (FC) bacteria, Salmonella spp., and Clostridium perfringens. Median AMB values determined at 30°C for FV, SR and VR were 5.27, 5.00, and 5.00 log 10 CFU g -1 , respectively, being significantly greater compared to those recorded at 37°C. The exceeding of the threshold value of 6.0 log 10 CFU g -1 proposed by Gelosa (1998) was noted only in 5 FV samples grown at 30°C (14.3%), and in 3 FV samples grown at 37°C (8.6%). The threshold value was never exceeded in SR and VR samples. Median concentrations of Enterobacteriaceae determined for FV, SR and VR were 4.03, 3.87, and 3.04 log 10 CFU g -1 , respectively. Eleven species of Enterobacteriaceae were identified in the FV, SR and VR samples. The percent of samples containing Escherichia coli was greatest for VR (22.9%), smaller for FV (17.1%) and smallest for SR (5.7%). The median concentrations of the faecal coliform bacteria (FC), determined by culture at 44°C, were low, amounting to 1.000 log 10 CFU g -1 for FV and SR and 0.00 for VR. All examined vegetable and soil samples tested negative for the presence of Salmonella. The median concentrations of Clostridium perfringens were low, amounting to 0.00 log 10 CFU g -1 for all categories of samples. This bacterium was relatively common in soil samples with the prevalence of 40.0%, but very rare in vegetable samples

  18. Microbiological characterization of vegetables and their rhizosphere soil in Eastern Poland

    Directory of Open Access Journals (Sweden)

    Teresa Kłapeć

    2016-09-01

    Full Text Available The aim of this study was to investigate the bacteriological quality of 5 kinds of vegetables (lettuce, dill, radish, beetroot, carrot and their rhizosphere soil, originating from conventional farms located in the Lublin Province of Eastern Poland. A total number of 35 samples of fresh vegetables (FV taken immediately from soil, 35 samples of soil from rhizosphere of these vegetables (SR and 35 samples of vegetables sold at retail in the markets in Lublin (VR were examined. The samples were analysed for the content of: aerobic mesophilic bacteria (AMB grown at 30°C and 37°C, Gram-negative bacteria of Enterobacteriaceae family, faecal coliform (FC bacteria, Salmonella spp., and Clostridium perfringens. Median AMB values determined at 30°C for FV, SR and VR were 5.27, 5.00, and 5.00 log 10 CFU g -1 , respectively, being significantly greater compared to those recorded at 37°C. The exceeding of the threshold value of 6.0 log 10 CFU g -1 proposed by Gelosa (1998 was noted only in 5 FV samples grown at 30°C (14.3%, and in 3 FV samples grown at 37°C (8.6%. The threshold value was never exceeded in SR and VR samples. Median concentrations of Enterobacteriaceae determined for FV, SR and VR were 4.03, 3.87, and 3.04 log 10 CFU g -1 , respectively. Eleven species of Enterobacteriaceae were identified in the FV, SR and VR samples. The percent of samples containing Escherichia coli was greatest for VR (22.9%, smaller for FV (17.1% and smallest for SR (5.7%. The median concentrations of the faecal coliform bacteria (FC, determined by culture at 44°C, were low, amounting to 1.000 log 10 CFU g -1 for FV and SR and 0.00 for VR. All examined vegetable and soil samples tested negative for the presence of Salmonella. The median concentrations of Clostridium perfringens were low, amounting to 0.00 log 10 CFU g -1 for all categories of samples. This bacterium was relatively common in soil samples with the prevalence of 40.0%, but very rare in vegetable

  19. Ecological assessment of riparian forests in Benin

    NARCIS (Netherlands)

    Natta, A.K.

    2003-01-01

    The present research deals with the flora, phytosociology and ecology of riparian forests. The overall objective of this research is to contribute to a better knowledge of the flora, diversity and ecology of riparian forests in

  20. RESEARCH NEEDS IN RIPARIAN BUFFER RESTORATION

    Science.gov (United States)

    Riparian buffer restorations are used as management tools to produce favorable water quality impacts; moreover, the basis for riparian buffers as an instrument of water quality restoration rests on a relatively firm foundation. However, the extent to which buffers can restore rip...

  1. Tamarisk coalition - native riparian plant materials program

    Science.gov (United States)

    Stacy Kolegas

    2012-01-01

    The Tamarisk Coalition (TC), a nonprofit organization dedicated to riparian restoration in the western United States, has created a Native Plant Materials Program to address the identified need for native riparian plant species for use in revegetation efforts on the Colorado Plateau. The specific components of the Native Plant Materials Program include: 1) provide seed...

  2. The Riparianness of a Desert Herpetofauna

    Science.gov (United States)

    Charles H. Lowe

    1989-01-01

    Within the Mojave, Sonoran, and Chihuahuan Desert subdivisions of the North American Desert in the U.S., more than half of 143 total amphibian and reptilian species perform as riparian and/or wetland taxa. For the reptiles, but not the amphibians, there is a significant inverse relationship between riparianness (obligate through preferential and facultative to...

  3. Long-term Water Table Monitoring of Rio Grande Riparian Ecosystems for Restoration Potential Amid Hydroclimatic Challenges

    Science.gov (United States)

    Thibault, James R.; Cleverly, James R.; Dahm, Clifford N.

    2017-12-01

    Hydrological processes drive the ecological functioning and sustainability of cottonwood-dominated riparian ecosystems in the arid southwestern USA. Snowmelt runoff elevates groundwater levels and inundates floodplains, which promotes cottonwood germination. Once established, these phreatophytes rely on accessible water tables (WTs). In New Mexico's Middle Rio Grande corridor diminished flooding and deepening WTs threaten native riparian communities. We monitored surface flows and riparian WTs for up to 14 years, which revealed that WTs and surface flows, including peak snowmelt discharge, respond to basin climate conditions and resource management. WT hydrographs influence the composition of riparian communities and can be used to assess if potential restoration sites meet native vegetation tolerances for WT depths, rates of recession, and variability throughout their life stages. WTs were highly variable in some sites, which can preclude native vegetation less adapted to deep drawdowns during extended droughts. Rates of WT recession varied between sites and should be assessed in regard to recruitment potential. Locations with relatively shallow WTs and limited variability are likely to be more viable for successful restoration. Suitable sites have diminished greatly as the once meandering Rio Grande has been constrained and depleted. Increasing demands on water and the presence of invasive vegetation better adapted to the altered hydrologic regime further impact native riparian communities. Long-term monitoring over a range of sites and hydroclimatic extremes reveals attributes that can be evaluated for restoration potential.

  4. Flood-controlled excess-air formation favors aerobic respiration and limits denitrification activity in riparian groundwater

    Directory of Open Access Journals (Sweden)

    Simone ePeter

    2015-11-01

    the riparian aquifer characterized by pronounced changes in the flow regime and by spatial heterogeneity of the vegetation. Measuring excess-air formation helped identifying and explaining the low denitrification activity in a zone with high organic carbon turnover and to quantify organic carbon sources.

  5. Wildlife Response to Riparian Restoration on the Sacramento River

    Directory of Open Access Journals (Sweden)

    Gregory H Golet

    2008-06-01

    Full Text Available Studies that assess the success of riparian restoration projects seldom focus on wildlife. More generally, vegetation characteristics are studied, with the assumption that animal populations will recover once adequate habitats are established. On the Sacramento River, millions of dollars have been spent on habitat restoration, yet few studies of wildlife response have been published. Here we present the major findings of a suite of studies that assessed responses of four taxonomic groups (insects, birds, bats, and rodents. Study designs fell primarily into two broad categories: comparisons of restoration sites of different ages, and comparisons of restoration sites with agricultural and remnant riparian sites. Older restoration sites showed increased abundances of many species of landbirds and bats relative to younger sites, and the same trend was observed for the Valley elderberry longhorn beetle (Desmocerus californicus dimorphus, a federally threatened species. Species richness of landbirds and ground-dwelling beetles appeared to increase as restoration sites matured. Young restoration sites provided benefits to species that utilize early successional riparian habitats, and after about 10 years, the sites appeared to provide many of the complex structural habitat elements that are characteristic of remnant forest patches. Eleven-year old sites were occupied by both cavity-nesting birds and special-status crevice-roosting bats. Restored sites also supported a wide diversity of bee species, and had richness similar to remnant sites. Remnant sites had species compositions of beetles and rodents more similar to older sites than to younger sites. Because study durations were short for all but landbirds, results should be viewed as preliminary. Nonetheless, in aggregate, they provide convincing evidence that restoration along the Sacramento River has been successful in restoring riparian habitats for a broad suite of faunal species. Not only did

  6. Biomass and carbon pools of disturbed riparian forests

    Science.gov (United States)

    Laura A. B. Giese; W. M. Aust; Randall K. Kolka; Carl C. Trettin

    2003-01-01

    Quantification of carbon pools as affected by forest age/development can facilitate riparian restoration and increase awareness of the potential for forests to sequester global carbon. Riparian forest biomass and carbon pools were quantified for four riparian forests representing different seral stages in the South Carolina Upper Coastal Plain. Three of the riparian...

  7. Development and characterization of an innovative synbiotic fermented beverage based on vegetable soybean

    Directory of Open Access Journals (Sweden)

    Carolina Battistini

    Full Text Available Abstract Soymilk was produced from vegetable soybean and fermented by probiotics (Lactobacillus acidophilus La-5, Bifidobacterium animalis Bb-12 in co-culture with Streptococcus thermophilus. The composition of the fermented beverage and oligosaccharides content were determined. The effect of fructooligosaccharides and inulin on the fermentation time and viability of probiotic microorganisms throughout 28 days of storage at 5 °C were evaluated. The soymilk from vegetable soybeans was fermented in just 3.2 h, when pH reached 4.8. Fermentation reduced the contents of stachyose and raffinose in soymilk. Prebiotics had no effect on acidification rate and on viability of B. animalis and S. thermophilus in the fermented beverage. The viable counts of B. animalis Bb-12 remained above 108 CFU mL-1 in the fermented soymilk during 28 days of storage at 5 °C while L. acidophilus La-5 was decreased by 1 log CFU mL-1. The fermented soymilk from vegetable soybeans showed to be a good food matrix to deliver probiotic bacteria, as well as a soy product with a lower content of non-digestible oligosaccharides.

  8. Mechanisms of vegetation-induced channel narrowing of an unregulated canyon river: Results from a natural field-scale experiment

    Science.gov (United States)

    Manners, Rebecca B.; Schmidt, John C.; Scott, Michael L.

    2014-04-01

    The lower Yampa River in Yampa Canyon, western Colorado serves as a natural, field-scale experiment, initiated when the invasive riparian plant, tamarisk (Tamarix spp.), colonized an unregulated river. In response to tamarisk's rapid invasion, the channel narrowed by 6% in the widest reaches since 1961. Taking advantage of this unique setting, we reconstructed the geomorphic and vegetation history in order to identify the key mechanisms for which, in the absence of other environmental perturbations, vegetation alters fluvial processes that result in a narrower channel. From our reconstruction, we identified a distinct similarity in the timing and magnitude of tamarisk encroachment and channel change, albeit with a lag in the channel response, thus suggesting tamarisk as the driving force. Within a decade of establishment, tamarisk effectively trapped sediment and, as a result, increased floodplain construction rates. Increasing tamarisk coverage over time also reduced the occurrence of floodplain stripping. Tamarisk recruitment was driven by both hydrologic and hydraulic variables, and the majority of tamarisk plants (84%) established below the stage of the 2-year flood. Thus, upon establishment nearly all plants regularly interact with the flow and sediment transport field. Our analyses were predicated on the hypothesis that the flow regime of the Yampa River was stationary, and that only the riparian vegetation community had changed. While not heavily impacted by water development, we determined that some aspects of the flow regime have shifted. However, this shift, which involved the clustering in time of extremely wet and dry years, did not influence fluvial processes directly. Instead these changes directly impacted riparian vegetation and changes in vegetation cover, in turn, altered fluvial processes. Today, the rate of channel change and new tamarisk recruitment is small. We believe that the rapid expansion of tamarisk and related floodplain construction

  9. An Ecohydrological Approach to Riparian Restoration Planning in the American Southwest

    Science.gov (United States)

    Leverich, G. T.; Orr, B.; Diggory, Z.; Dudley, T.; Hatten, J.; Hultine, K. R.; Johnson, M. P.; Orr, D.

    2014-12-01

    Riparian systems across the American southwest region are under threat from a growing and intertwined cast of natural and anthropogenic stressors, including flooding, drought, invasion by non-native plants, wildfire, urban encroachment, and land- and water-use practices. In relatively remote and unregulated systems like the upper Gila River in Arizona, riparian habitat value has persisted reasonably well despite much of it being densely infested with non-native tamarisk (salt cedar). A new concern in the watershed, however, is the eventual arrival of the tamarisk leaf beetle that is expected to soon colonize the tamarisk-infested riparian corridor as the beetle continues to spread across the southwest region. While there are numerous potential benefits to tamarisk suppression (e.g., groundwater conservation, riparian habitat recovery, fire-risk reduction), short-term negative consequences are also possible, such as altered channel hydraulics and canopy defoliation during bird nesting season (e.g., the endangered southwestern willow flycatcher). In preparation for anticipated impacts following beetle colonization, we developed a holistic restoration framework to promote recovery of native riparian habitat and subsequent local increases in avian population. Pivotal to this process was an ecohydrological assessment that identified sustainable restoration sites based on consideration of natural and anthropogenic factors that, together, influence restoration opportunities—flood-scour dynamics, vegetation community structure and resilience, surface- and groundwater availability, soil texture and salinity, wildfire potential, and land-use activities. Data collected included high-resolution remote-sensing products, GIS-based delineation of geomorphic activity, and vegetation field mapping. These data along with other information generated, including pre-biocontrol vegetation monitoring and flycatcher-habitat modeling, were synthesized to produce a comprehensive

  10. Vegetation Description, Rare Plant Inventory, and Vegetation Monitoring for Craig Mountain, Idaho.

    Energy Technology Data Exchange (ETDEWEB)

    Mancuso, Michael; Moseley, Robert

    1994-12-01

    The Craig Mountain Wildlife Mitigation Area was purchased by Bonneville Power Administration (BPA) as partial mitigation for wildlife losses incurred with the inundation of Dworshak Reservoir on the North Fork Clearwater River. Upon completion of the National Environmental Protection Act (NEPA) process, it is proposed that title to mitigation lands will be given to the Idaho Department of Fish and Game (IDFG). Craig Mountain is located at the northern end of the Hells Canyon Ecosystem. It encompasses the plateau and steep canyon slopes extending from the confluence of the Snake and Salmon rivers, northward to near Waha, south of Lewiston, Idaho. The forested summit of Craig Mountain is characterized by gently rolling terrain. The highlands dramatically break into the canyons of the Snake and Salmon rivers at approximately the 4,700 foot contour. The highly dissected canyons are dominated by grassland slopes containing a mosaic of shrubfield, riparian, and woodland habitats. During the 1993 and 1994 field seasons, wildlife, habitat/vegetation, timber, and other resources were systematically inventoried at Craig Mountain to provide Fish and Game managers with information needed to draft an ecologically-based management plan. The results of the habitat/vegetation portion of the inventory are contained in this report. The responsibilities for the Craig Mountain project included: (1) vegetation data collection, and vegetation classification, to help produce a GIS-generated Craig Mountain vegetation map, (2) to determine the distribution and abundance of rare plants populations and make recommendations concerning their management, and (3) to establish a vegetation monitoring program to evaluate the effects of Fish and Game management actions, and to assess progress towards meeting habitat mitigation goals.

  11. Vegetation description, rare plant inventory, and vegetation monitoring for Craig Mountain, Idaho

    International Nuclear Information System (INIS)

    Mancuso, M.; Moseley, R.

    1994-12-01

    The Craig Mountain Wildlife Mitigation Area was purchased by Bonneville Power Administration (BPA) as partial mitigation for wildlife losses incurred with the inundation of Dworshak Reservoir on the North Fork Clearwater River. Upon completion of the National Environmental Protection Act (NEPA) process, it is proposed that title to mitigation lands will be given to the Idaho Department of Fish and Game (IDFG). Craig Mountain is located at the northern end of the Hells Canyon Ecosystem. It encompasses the plateau and steep canyon slopes extending from the confluence of the Snake and Salmon rivers, northward to near Waha, south of Lewiston, Idaho. The forested summit of Craig Mountain is characterized by gently rolling terrain. The highlands dramatically break into the canyons of the Snake and Salmon rivers at approximately the 4,700 foot contour. The highly dissected canyons are dominated by grassland slopes containing a mosaic of shrubfield, riparian, and woodland habitats. During the 1993 and 1994 field seasons, wildlife, habitat/vegetation, timber, and other resources were systematically inventoried at Craig Mountain to provide Fish and Game managers with information needed to draft an ecologically-based management plan. The results of the habitat/vegetation portion of the inventory are contained in this report. The responsibilities for the Craig Mountain project included: (1) vegetation data collection, and vegetation classification, to help produce a GIS-generated Craig Mountain vegetation map, (2) to determine the distribution and abundance of rare plants populations and make recommendations concerning their management, and (3) to establish a vegetation monitoring program to evaluate the effects of Fish and Game management actions, and to assess progress towards meeting habitat mitigation goals

  12. Seasonal change detection of riparian zones with remote sensing images and genetic programming in a semi-arid watershed.

    Science.gov (United States)

    Makkeasorn, Ammarin; Chang, Ni-Bin; Li, Jiahong

    2009-02-01

    Riparian zones are deemed significant due to their interception capability of non-point source impacts and the maintenance of ecosystem integrity region wide. To improve classification and change detection of riparian buffers, this paper developed an evolutionary computational, supervised classification method--the RIparian Classification Algorithm (RICAL)--to conduct the seasonal change detection of riparian zones in a vast semi-arid watershed, South Texas. RICAL uniquely demonstrates an integrative effort to incorporate both vegetation indices and soil moisture images derived from LANDSAT 5 TM and RADARSAT-1 satellite images, respectively. First, an estimation of soil moisture based on RADARSAT-1 Synthetic Aperture Radar (SAR) images was conducted via the first-stage genetic programming (GP) practice. Second, for the statistical analyses and image classification, eight vegetation indices were prepared based on reflectance factors that were calculated as the response of the instrument on LANDSAT. These spectral vegetation indices were then independently used for discriminate analysis along with soil moisture images to classify the riparian zones via the second-stage GP practice. The practical implementation was assessed by a case study in the Choke Canyon Reservoir Watershed (CCRW), South Texas, which is mostly agricultural and range land in a semi-arid coastal environment. To enhance the application potential, a combination of Iterative Self-Organizing Data Analysis Techniques (ISODATA) and maximum likelihood supervised classification was also performed for spectral discrimination and classification of riparian varieties comparatively. Research findings show that the RICAL algorithm may yield around 90% accuracy based on the unseen ground data. But using different vegetation indices would not significantly improve the final quality of the spectral discrimination and classification. Such practices may lead to the formulation of more effective management strategies

  13. Estrutura e síndromes de dispersão de espécies arbóreas em um trecho de mata ciliar, Sirinhaém, Pernambuco, Brasil Structure and dispersal syndromes of tree species in a stretch of riparian vegetation, Sirinhaém, Pernambuco State, Brazil

    Directory of Open Access Journals (Sweden)

    Roseane Karla Soares da Silva

    2012-03-01

    Full Text Available

    Este trabalho teve por objetivo conhecer a fitossociologia do componente arboreo em uma mata ciliar de um corrego que desagua no Rio Sirinhaem, localizado no Engenho Buranhem, Sirinhaem, PE e identificar as sindromes de dispersao das especies. O corrego esta situado em um fragmento de Floresta Ombrofila Densa de Terras Baixas, com 272 ha. Utilizou-se como area amostral um hectare (40 unidades amostrais, 10 m x 25 m onde foram registrados 1.307 individuos arboreos com circunferencia a altura do peito (CAP ≥ 15 cm. Foram identificadas 118 especies, pertencentes a 40 familias botanicas. Protium heptaphyllum e Pouteria sp.1 foram as especies mais abundantes. Em termos de valor de importancia (VI, as especies Protium heptaphyllum, Pouteria sp.1 e Virola gardneri estao entre as mais importantes ecologicamente. As sindromes de dispersao predominantes foram: zoocoria (72,8%, autocoria (13,6% e anemocoria (4,8%. Nao foi possivel determinar a sindrome de dispersao de 8,8% das especies estudadas.

     

    doi: 10.4336/2012.pfb.32.69.01

    This study aimed to know the phytosociology of the tree component of riparian vegetation in a stream that flows into the Sirinhaem River in Engenho Buranhem, Sirinhaem, Pernambuco State, and identify the species dispersal syndromes. The stream is located in a fragment of dense rain forest of the lowlands, with 272 ha. It was sempled used one hectare (40 sampling units of 10 m x 25 m each. It was registered 1,307 trees with circumference at breast height (CAP . 15 cm. We identified 118 species belonging to 40 botanical families. Protium heptaphyllum and Pouteria sp.1 were the most abundant species. In terms of importance value (IV, Protium heptaphyllum, Pouteria sp.1 and Virola gardneri are among the most important ecologically species. The predominant dispersal syndromes were zoocory (72.8%, autocory (13.6% and anemochory (4.8%. It was not possible to determine the type of dispersal of 8.8% of the

  14. Population and Habitat Objectives for Avian Conservation in California's Central Valley Riparian Ecosystems

    Directory of Open Access Journals (Sweden)

    Kristen E. Dybala

    2017-03-01

    Full Text Available https://doi.org/10.15447/sfews.2017v15iss1art5Riparian ecosystems provide important ecosystem services and recreational opportunities for people, and habitat for wildlife. In California’s Central Valley, government agencies and private organizations are working together to protect and restore riparian ecosystems, and the Central Valley Joint Venture provides leadership in the formulation of goals and objectives for avian conservation in riparian ecosystems. We defined a long-term conservation goal as the establishment of riparian ecosystems that provide sufficient habitat to support genetically robust, self-sustaining, and resilient bird populations. To achieve this goal, we selected a suite of 12 breeding riparian landbird focal species as indicators of the state of riparian ecosystems in each of four major Central Valley planning regions. Using recent bird survey data, we estimated that over half of the regional focal species populations are currently small (< 10,000 and may be vulnerable to extirpation, and two species have steeply declining population trends. For each focal species in each region, we defined long-term (100-year population objectives that are intended to be conservation endpoints that we expect to meet the goal of genetically robust, self-sustaining, and resilient populations. We then estimated the long-term species density and riparian restoration objectives required to achieve the long-term population objectives. To track progress toward the long-term objectives, we propose short-term (10- year objectives, including the addition of 12,919 ha (31,923 ac of riparian vegetation in the Central Valley (by planning region: 3,390 ha in Sacramento, 2,390 ha in Yolo–Delta, 3,386 ha in San Joaquin, and 3,753 ha in Tulare. We expect that reaching these population, density, and habitat objectives through threat abatement, habitat restoration, and habitat enhancement will result in improvements to riparian ecosystem function and

  15. NMR characterization of lignins isolated from fruit and vegetable insoluble dietary fiber.

    Science.gov (United States)

    Bunzel, Mirko; Ralph, John

    2006-10-18

    Compositional information for lignins in food is rare and concentrated on cereal grains and brans. As lignins are suspected to have important health roles in the dietary fiber complex, the confusing current information derived from nonspecific lignin determination methods needs to be augmented by diagnostic structural studies. For this study, lignin fractions were isolated from kiwi, pear, rhubarb, and, for comparison, wheat bran insoluble dietary fiber. Clean pear and kiwi lignin isolates allowed for substantive structural profiling, but it is suggested that the significance of lignin in wheat has been overestimated by reliance on nonspecific analytical methods. Volume integration of NMR contours in two-dimensional (13)C-(1)H correlation spectra shows that pear and wheat lignins have comparable guaiacyl and syringyl contributions and that kiwi lignins are particularly guaiacyl-rich (approximately 94% guaiacyl) and suggest that rhubarb lignins, which could not be isolated from contaminating materials, are as syringyl-rich (approximately 96% syringyl) as lignins from any known natural or transgenic fiber source. Typical lignin structures, including those newly NMR-validated (glycerols, spirodienones, and dibenzodioxocins), and resinols implicated as possible mammalian lignan precursors in the gut are demonstrated via their NMR correlation spectra in the fruit and vegetable samples. A novel putative benzodioxane structure appears to be associated with the kiwi lignin. It is concluded that the fruits and vegetables examined contain authentic lignins and that the detailed structural analysis exposes limitations of currently accepted analytical methods.

  16. Chemical and spectroscopic characterization of a vegetable oil used as dielectric coolant in distribution transformers

    Energy Technology Data Exchange (ETDEWEB)

    Gomez, Neffer A.; Abonia, Rodrigo, E-mail: rodrigo.abonia@correounivalle.edu.co [Departamento de Quimica, Escuela de Ingenieria Electrica, Universidad del Valle, Cali (Colombia); Cadavid, Hector [Grupo GRALTA, Escuela de Ingenieria Electrica, Universidad del Valle, Cali (Colombia); Vargas, Ines H. [Area de Ingenieria de Distribucion, Empresas Publicas de Medellin (EPM), Medellin (Colombia)

    2011-09-15

    In this work, a complete UV-Vis, IR and (1H, 13C and DEPT) NMR spectroscopic analysis was performed for a FR3 vegetable oil sample used as dielectric coolant in an experimental distribution transformer. The same spectroscopic analysis was performed for three used FR3 oil samples (i.e., 4 months in use, 8 months in use and 7 years in use), removed from several operating distribution transformers. Comparison of the data indicated that no significant spectroscopic changes, and hence, no structural changes occurred to the oils by the use. Chemical transformations like catalytic hydrogenation (hardening) and hydrolysis were performed to the FR3 oil sample and the obtained products were analyzed by spectroscopic methods in order to collect further structural information about the FR3 oil. Accelerated aging tests in laboratory were also performed for three FR3 oil samples affording interesting information about the structure of the degradation products. These findings would be valuable to search for a spectroscopy-based technique for monitoring the lifetime and performance of this insulating vegetable oil. (author)

  17. Nesting ecology of Greater Sandhill Cranes (Grus canadensis tabida) in riparian and palustrine wetlands of eastern Idaho

    Science.gov (United States)

    McWethy, D.B.; Austin, J.E.

    2009-01-01

    Little information exists on breeding Greater Sandhill Cranes (Grus canadensis tabida) in riparian wetlands of the Intermountain West. We examined the nesting ecology of Sandhill Cranes associated with riparian and palustrine wetlands in the Henry's Fork Watershed in eastern Idaho in 2003. We located 36 active crane nests, 19 in riparian wetlands and 17 in palustrine wetlands. Nesting sites were dominated by rushes (Juncus spp.), sedges (Carex spp.), Broad-leaved Cattail (Typha latifolia) and willow (Salix spp.), and adjacent foraging areas were primarily composed of sagebrush (Artemisia spp.), cinquefoil (Potentilla spp.),Rabbitbrush (Ericameria bloomeri) bunch grasses, upland forbs, Quaking Aspen (Populus tremuloides) and cottonwood (Populus spp.). Mean water depth surrounding nests was 23 cm (SD = 22). A majority of nests (61%) were surrounded by vegetation between 3060 cm, 23% by vegetation 60 cm in height. We were able to determine the fate of 29 nests, of which 20 were successful (69%). Daily nest survival was 0.986 (95% LCI 0.963, UCI 0.995), equivalent to a Mayfield nest success of 0.654 (95% LCI 0.324, UCI 0.853). Model selection favored models with the covariates vegetation type, vegetation height, and water depth. Nest survival increased with increasing water depth surrounding nest sites. Mean water depth was higher around successful nests (30 cm, SD = 21) than unsuccessful nests (15 cm, SD 22). Further research is needed to evaluate the relative contribution of cranes nesting in palustrine and riparian wetlands distributed widely across the Intermountain West.

  18. Riparian Cottonwood Ecosystems and Regulated Flows in Kootenai and Yakima Sub-Basins : Volume II Yakima (Overview, Report, Appendices).

    Energy Technology Data Exchange (ETDEWEB)

    Jamieson, Bob; Braatne, Jeffrey H.

    2001-10-01

    Riparian vegetation and especially cottonwood and willow plant communities are dependent on normative flows and especially, spring freshette, to provide conditions for recruitment. These plant communities therefore share much in common with a range of fish species that require natural flow conditions to stimulate reproduction. We applied tools and techniques developed in other areas to assess riparian vegetation in two very different sub-basins within the Columbia Basin. Our objectives were to: Document the historic impact of human activity on alluvial floodplain areas in both sub-basins; Provide an analysis of the impacts of flow regulation on riparian vegetation in two systems with very different flow regulation systems; Demonstrate that altered spring flows will, in fact, result in recruitment to cottonwood stands, given other land uses impacts on each river and the limitations imposed by other flow requirements; and Assess the applicability of remote sensing tools for documenting the distribution and health of cottonwood stands and riparian vegetation that can be used in other sub-basins.

  19. Influence of flooding and landform properties on riparian plant communities in an old-growth northern hardwood watershed

    Science.gov (United States)

    P. Charles Goebel; Kurt S. Pregitzer; Brian J. Palik

    2012-01-01

    In most forested landscapes, the organization of plant communities across stream valleys is thought to be regulated by a complex set of interactions including flooding, landform properties, and vegetation. However, few studies have directly examined the relative influence of frequent and infrequent flooding, as well as landform properties, on riparian plant community...

  20. Riparian Cottonwood Ecosystems and Regulated Flows in Kootenai and Yakima Sub-Basins : Volume III (Overview and Tools).

    Energy Technology Data Exchange (ETDEWEB)

    Jamieson, Bob; Braatne, Jeffrey H.

    2001-10-01

    Riparian vegetation and especially cottonwood and willow plant communities are dependent on normative flows and especially, spring freshette, to provide conditions for recruitment. These plant communities therefore share much in common with a range of fish species that require natural flow conditions to stimulate reproduction. We applied tools and techniques developed in other areas to assess riparian vegetation in two very different sub-basins within the Columbia Basin. Our objectives were to: Document the historic impact of human activity on alluvial floodplain areas in both sub-basins; Provide an analysis of the impacts of flow regulation on riparian vegetation in two systems with very different flow regulation systems; Demonstrate that altered spring flows will, in fact, result in recruitment to cottonwood stands, given other land uses impacts on each river and the limitations imposed by other flow requirements; and Assess the applicability of remote sensing tools for documenting the distribution and health of cottonwood stands and riparian vegetation that can be used in other sub-basins.

  1. Trends in landscape and vegetation change and implications for the Santa Cruz Watershed

    Science.gov (United States)

    Villarreal, Miguel; Norman, Laura M.; Webb, Robert H.; Turner, Raymond M.

    2013-01-01

    Monitoring and characterizing the interactive effects of land use and climate on land surface processes is a primary focus of land change science, and of particular concern in arid Wells Distribution in Shallow Groundwater Areas Pumping Trends Increase Streamflow Extent Declines 27 environments where both landscapes and livelihoods can be impacted by short-term climate variability. Using a multi-observational approach to land-change analysis that included landownership data as a proxy for land-use practices, multitemporal land-cover maps, and repeat photography dating to the late 19th century, we examine changing spatial and temporal distributions of two vegetation types with high conservation value in the southwestern United States: grasslands and riparian vegetation. Our study area is the bi-national Santa Cruz Watershed, a topographically complex watershed that straddles the Sonoran Desert and the Madrean Archipelago Ecoregions. In this presentation we focus on historical changes in vegetation and land use in grasslands and riparian areas of the Madrean Ecoregion (San Raphael Valley, Cienega Creek, Sonoita), and compare changes in these areas to changes in the warmer and drier Sonoran Ecoregion. Analysis of historical photography confirms major 20th century vegetation shifts documented in other research: woody plant encroachment, desertification of grasslands, and changing riparian and xeroriparian vegetation occurred in both ecoregions following human settlement. However, vegetation changes over the past decade appear to be more subtle and some of the past trajectories appear to be reversing; most notable are recent mesquite declines in xeroriparian and upland areas, and changes from shrubland to grassland area in the Madrean ecoregion. Land cover changes were temporally variable, reflecting broad climate changes. The most dynamic cover changes occurred during the period from 1989 to 1999, a period with two intense droughts. The degree of vegetation change

  2. Characterization of free nitrogen fixing bacteria of the genus Azotobacter in organic vegetable-grown Colombian soils

    Directory of Open Access Journals (Sweden)

    Diego Javier Jiménez

    2011-09-01

    Full Text Available With the purpose of isolating and characterizing free nitrogen fixing bacteria (FNFB of the genus Azotobacter, soil samples were collected randomly from different vegetable organic cultures with neutral pH in different zones of Boyacá-Colombia. Isolations were done in selective free nitrogen Ashby-Sucrose agar obtaining a recovery of 40%. Twenty four isolates were evaluated for colony and cellular morphology, pigment production and metabolic activities. Molecular characterization was carried out using amplified ribosomal DNA restriction analysis (ARDRA. After digestion of 16S rDNA Y1-Y3 PCR products (1487pb with AluI, HpaII and RsaI endonucleases, a polymorphism of 16% was obtained. Cluster analysis showed three main groups based on DNA fingerprints. Comparison between ribotypes generated by isolates and in silico restriction of 16S rDNA partial sequences with same restriction enzymes was done with Gen Workbench v.2.2.4 software. Nevertheless, Y1-Y2 PCR products were analysed using BLASTn. Isolate C5T from tomato (Lycopersicon esculentum grown soils presented the same in silico restriction patterns with A. chroococcum (AY353708 and 99% of similarity with the same sequence. Isolate C5CO from cauliflower (Brassica oleracea var. botrytis grown soils showed black pigmentation in Ashby-Benzoate agar and high similarity (91% with A. nigricans (AB175651 sequence. In this work we demonstrated the utility of molecular techniques and bioinformatics tools as a support to conventional techniques in characterization of the genus Azotobacter from vegetable-grown soils.

  3. Legal Mechanisms for Protecting Riparian Resource Values

    Science.gov (United States)

    Lamb, Berton L.; Lord, Eric

    1992-04-01

    Riparian resources include the borders of rivers, lakes, ponds, and potholes. These border areas are very important for a number of reasons, including stream channel maintenance, flood control, aesthetics, erosion control, fish and wildlife habitat, recreation, and water quality maintenance. These diverse functions are not well protected by law or policy. We reviewed law and policies regarding endangered species habitat designation, land use planning, grazing management, water allocation, takings, and federal permits and licenses, along with the roles of federal, state, and local governments. We discuss the politics of implementing these policies, focusing on the difficulties in changing entrenched water and land use practices. Our review indicates a lack of direct attention to riparian ecosystem issues in almost all environmental and land use programs at every level of government. Protection of riparian resource values requires a means to integrate existing programs to focus on riparian zones.

  4. Transesterification of Vegetable Oils with Ethanol and Characterization of the Key Fuel Properties of Ethyl Esters

    Directory of Open Access Journals (Sweden)

    Stamoulis Stournas

    2009-06-01

    Full Text Available The transesterification reactions of four different vegetable oils (sunflower, rapeseed, olive oil and used frying oil with ethanol, using sodium hydroxide as catalyst, were studied. The ester preparation involved a two-step transesterification reaction, followed by purification. The effects of the mass ratio of catalyst to oil (0.25 – 1.5%, the molar ratio of ethanol to oil (6:1 – 12:1, and the reaction temperature (35 – 90 °C were studied for the conversion of sunflower oil to optimize the reaction conditions in both stages. The rest of the vegetable oils were converted to ethyl esters under optimum reaction parameters. The optimal conditions for first stage transesterification were an ethanol/oil molar ratio of 12:1, NaOH amount (1% wt/wt, and 80 °C temperature, whereas the maximum yield of ethyl esters reached 81.4% wt/wt. In the second stage, the yield of ethyl esters was improved by 16% in relation with the one-stage transesterification, which was obtained under the following optimal conditions: catalyst concentration 0.75% and ethanol/oil molar ratio 6:1. The fuel properties of the esters were measured according to EN test methods. Based on the experimental results one can see that the ethyl esters do not differ significantly from methyl esters. Moreover, the results showed that the values of density, viscosity, and higher heating value of ethyl esters were similar to those of automotive and heavy duty engine diesel fuel. However, the CFPP values were higher, which may contribute to potential difficulties in cold starts. On the other hand, the flash points, which were higher than those of diesel fuel constituted a safety guarantee from the point of view of handling and storage.

  5. Identification and characterization of probiotic lactic acid bacteria isolated from traditional persian pickled vegetables

    Directory of Open Access Journals (Sweden)

    Soltan Dallal, M.M.

    2017-09-01

    Full Text Available Background: The pickle, a traditional fermented product, is popular among Iranians. Much research has been conducted worldwide on this food group. Due to a lack of related data in Iran, this study was conducted to isolate and identify dominant lactic acid bacteria (LAB in pickles and salted pickles.Materials and methods: Seventy samples were collected from different regions of Iran. The isolated bacteria were identified as LAB by Gram staining and catalase by using MRS agar. Then, those strains were identified at the species level by physiological tests (e.g., gas production from glucose, arginine hydrolysis, CO production from glucose in MRS broth, carbohydrate fermentation and growth at temperatures of 15°C, 30°C, and 45°C in MRS broth for 3 days. The probiotic characteristics of these bacteria were studied using acid and bile tolerance. The corresponding results were verified using PCR analyses of the 16S rDNA region. Results: 114 presumptive lactic acid bacteria (LAB with Gram-positive and catalase-negative properties were obtained from the samples. The results revealed that all isolated bacteria were identfied as ,, , , and. The predominant LAB in these pickles was which was isolated from most of the samples. Among the 114 LAB, 7 isolated species have probiotic potential. Six out of seven were recognized as and one remained unidentifiable by biochemical testing. PCR analysis and sequencing of the 16S rDNA region using 27f and 1522r primers showed that all of the probiotic strains were .Conclusion: The results of this study showed that the dominant LAB in traditional Persian pickled vegetables are , , , and . Moreover, was recognized as a probiotic species in pickled vegetables. The raw data obtained from this study can be used in the pickling industry to improve the nutritional value of products.

  6. Characterization of high molecular weight cadmium species in contaminated vegetable food

    Energy Technology Data Exchange (ETDEWEB)

    Guenther, K.; Kastenholz, B. [Forschungszentrum Juelich GmbH (Germany). Inst. fuer Chemie und Dynamik der Geosphaere 7: Angewandte Physikalische Chemie; Ji, G. [Bonn Univ. (Germany). Lehrstuhl fuer Lebensmittelwissenschaft und Lebensmittelchemie

    2000-10-01

    Spinach and radish grown from seeds were each contaminated with 4 different amounts of cadmium. After a cell breakdown of the eatable parts and centrifugation of the resulting homogenates all supernatants (cytosols) were separated by gel permeation chromatography (GPC). The size-range of the GPC method used was about 20-8000 kDa for globular proteins. The high molecular weight (HMW-Cd-SP, 150-700 kDa) and the low molecular weight Cd species (LMW-Cd-SP, < 150 kDa) in all plant cytosols eluted at about the same retention volume by GPC. The most important Cd binding form in the cytosols of all plants was found to be HMW-Cd-SP. The Cd elution maxima were detected in the range of about 200 kDa. The Cd determinations were performed with ET-AAS by means of matrix modifier. By incubating chosen cytosols with a proteinase before the GPC it was verified that the HMW-Cd-SP in both vegetables are Cd proteins. The molar proportions protein/Cd were about 2-6 in the respective GPC fractions of the HMW-Cd-SP of the highest contaminated plants. The GPC fractions of the HMW-Cd-SP of spinach and radish were further separated by a preparative, native and continuous polyacrylamide gel electrophoresis (PAGE) method. At pH 8 the species were negatively charged, had only a small UV-absorption at 280 nm and showed a very similar elution behavior in all analyzed cytosols. Therefore, we suppose that the HMW-Cd-SP of these two different vegetable foodstuffs have a very similar chemical structure. (orig.)

  7. Riparian vegetation response to altered disturbance and stress regimes

    Science.gov (United States)

    Shafroth, P.B.; Stromberg, J.C.; Patten, D.T.

    2002-01-01

    Management of terrestrial carbon fluxes is being proposed as a means of increasing the amount of carbon sequestered in the terrestrial biosphere. This approach is generally viewed only as an interim strategy for the coming decades while other longer-term strategies are developed and implemented — the most important being the direct reduction of carbon emissions. We are concerned that the potential for rapid, disturbance-induced losses may be much greater than is currently appreciated, especially by the decision-making community. Here we wish to: (1) highlight the complex and threshold-like nature of disturbances — such as fire and drought, as well as the erosion associated with each — that could lead to carbon losses; (2) note the global extent of ecosystems that are at risk of such disturbance-induced carbon losses; and (3) call for increased consideration of and research on the mechanisms by which large, rapid disturbance-induced losses of terrestrial carbon could occur. Our lack of ability as a scientific community to predict such ecosystem dynamics is precluding the effective consideration of these processes into strategies and policies related to carbon management and sequestration. Consequently, scientists need to do more to improve quantification of these potential losses and to integrate them into sound, sustainable policy options.

  8. Favorable fragmentation: river reservoirs can impede downstream expansion of riparian weeds.

    Science.gov (United States)

    Rood, Stewart B; Braatne, Jeffrey H; Goater, Lori A

    2010-09-01

    River valleys represent biologically rich corridors characterized by natural disturbances that create moist and barren sites suitable for colonization by native riparian plants, and also by weeds. Dams and reservoirs interrupt the longitudinal corridors and we hypothesized that this could restrict downstream weed expansion. To consider this "reservoir impediment" hypothesis we assessed the occurrences and abundances of weeds along a 315-km river valley corridor that commenced with an unimpounded reach of the Snake River and extended through Brownlee, Oxbow, and Hells Canyon reservoirs and dams, and downstream along the Snake River. Sampling along 206 belt transects with 3610 quadrats revealed 16 noxious and four invasive weed species. Ten weeds were upland plants, with Canada thistle (Cirsium arvense) restricted to the upstream reaches, where field morning glory (Convolvulus arvensis) was also more common. In contrast, St. John's wort (Hypericum perforatum) was more abundant below the dams, and medusahead wildrye (Taeniatherum caput-medusae) occurred primarily along the reservoirs. All seven riparian species were abundant in the upstream zones but sparse or absent below the dams. This pattern was observed for the facultative riparian species, poison hemlock (Conium maculatum) and perennial pepperweed (Lepidium latifolium), the obligate riparian, yellow nut sedge (Cyperus esculentus), the invasive perennial, reed canary grass (Phalaris arundinacea), and three invasive riparian trees, Russian olive (Elaeagnus angustifolia), false indigo (Amorpha fruticosa), and tamarisk (Tamarix spp.). The hydrophyte purple loosestrife (Lythrum salicaria) was also restricted to the upstream zone. These longitudinal patterns indicate that the reservoirs have impeded the downstream expansion of riparian weeds, and this may especially result from the repetitive draw-down and refilling of Brownlee Reservoir that imposes a lethal combination of drought and flood stress. The dams and

  9. Use of Vegetable Waste Extracts for Controlling Microstructure of CuO Nanoparticles: Green Synthesis, Characterization, and Photocatalytic Applications

    Directory of Open Access Journals (Sweden)

    Hameed Ullah

    2017-01-01

    Full Text Available Chemical syntheses involve either hazardous reactants or byproducts which adversely affect the environment. It is, therefore, desirable to develop synthesis processes which either do not involve hazardous reactants or consume all the reactants giving no byproducts. We have synthesized CuO nanoparticles (NPs adhering to some of the principles of green chemistry. The CuO NPs have been synthesized exploiting extracts of vegetable wastes, that is, Cauliflower waste and Potatoes and Peas peels. The extracts were aimed to work as capping agents to get control over the microstructure and morphology of the resulting CuO NPs. The green synthesized CuO NPs were characterized to explore the microstructure, morphology, optical bandgaps, and photocatalytic performances. XRD revealed that the CuO NPs of all the samples crystallized in a single crystal system, that is, monoclinic. However, the morphologies and the optical bandgaps energies varied as a function of the extract of vegetable waste. Similarly, the CuO NPs obtained through different extracts have shown different photocatalytic activities. The CuO NPs produced with extract of Cauliflower have shown high degradation of MB (96.28% compared to obtained with Potatoes peels (87.37% and Peas peels (79.11%.

  10. Landscape-scale processes influence riparian plant composition along a regulated river

    Science.gov (United States)

    Palmquist, Emily C.; Ralston, Barbara; Merritt, David M.; Shafroth, Patrick B.

    2018-01-01

    Hierarchical frameworks are useful constructs when exploring landscape- and local-scale factors affecting patterns of vegetation in riparian areas. In drylands, which have steep environmental gradients and high habitat heterogeneity, landscape-scale variables, such as climate, can change rapidly along a river's course, affecting the relative influence of environmental variables at different scales. To assess how landscape-scale factors change the structure of riparian vegetation, we measured riparian vegetation composition along the Colorado River through Grand Canyon, determined which factors best explain observed changes, identified how richness and functional diversity vary, and described the implications of our results for river management. Cluster analysis identified three divergent floristic groups that are distributed longitudinally along the river. These groups were distributed along gradients of elevation, temperature and seasonal precipitation, but were not associated with annual precipitation or local-scale factors. Species richness and functional diversity decreased as a function of distance downstream showing that changing landscape-scale factors result in changes to ecosystem characteristics. Species composition and distribution remain closely linked to seasonal precipitation and temperature. These patterns in floristic composition in a semiarid system inform management and provide insights into potential future changes as a result of shifts in climate and changes in flow management.

  11. Floodplain forest succession reveals fluvial processes: A hydrogeomorphic model for temperate riparian woodlands.

    Science.gov (United States)

    Egger, Gregory; Politti, Emilio; Lautsch, Erwin; Benjankar, Rohan; Gill, Karen M; Rood, Stewart B

    2015-09-15

    River valley floodplains are physically-dynamic environments where fluvial processes determine habitat gradients for riparian vegetation. These zones support trees and shrubs whose life stages are adapted to specific habitat types and consequently forest composition and successional stage reflect the underlying hydrogeomorphic processes and history. In this study we investigated woodland vegetation composition, successional stage and habitat properties, and compared these with physically-based indicators of hydraulic processes. We thus sought to develop a hydrogeomorphic model to evaluate riparian woodland condition based on the spatial mosaic of successional phases of the floodplain forest. The study investigated free-flowing and dam-impacted reaches of the Kootenai and Flathead Rivers, in Idaho and Montana, USA and British Columbia, Canada. The analyses revealed strong correspondence between vegetation assessments and metrics of fluvial processes indicating morphodynamics (erosion and shear stress), inundation and depth to groundwater. The results indicated that common successional stages generally occupied similar hydraulic environments along the different river segments. Comparison of the spatial patterns between the free-flowing and regulated reaches revealed greater deviation from the natural condition for the braided channel segment than for the meandering segment. This demonstrates the utility of the hydrogeomorphic approach and suggests that riparian woodlands along braided channels could have lower resilience than those along meandering channels and might be more vulnerable to influences such as from river damming or climate change. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Flow Hydrodynamics across Open Channel Flows with Riparian Zones: Implications for Riverbank Stability

    Directory of Open Access Journals (Sweden)

    Da Liu

    2017-09-01

    Full Text Available Riverbank vegetation is of high importance both for preserving the form (morphology and function (ecology of natural river systems. Revegetation of riverbanks is commonly used as a means of stream rehabilitation and management of bank instability and erosion. In this experimental study, the effect of different riverbank vegetation densities on flow hydrodynamics across the channel, including the riparian zone, are reported and discussed. The configuration of vegetation elements follows either linear or staggered arrangements as vegetation density is progressively increased, within a representative range of vegetation densities found in nature. Hydrodynamic measurements including mean streamwise velocity and turbulent intensity flow profiles are recorded via acoustic Doppler velocimetry (ADV—both at the main channel and within the riverbank. These results show that for the main channel and the toe of riverbank, turbulence intensity for the low densities (λ ≈ 0 to 0.12 m−1 can increase up to 40% compared the case of high densities (λ = 0.94 to 1.9 m−1. Further analysis of these data allowed the estimation of bed-shear stresses, demonstrating 86% and 71% increase at the main channel and near the toe region, for increasing densities (λ = 0 to 1.9 m−1. Quantifying these hydrodynamic effects is important for assessing the contribution of physically representative ranges of riparian vegetation densities on hydrogeomorphologic feedback.

  13. Unravelling long-term vegetation change patterns in a binational watershed using multitemporal land cover data and historical photography

    Science.gov (United States)

    Villarreal, Miguel L.; Norman, Laura M.; Webb, Robert H.; Boyer, Diane E.; Turner, Raymond M.

    2011-01-01

    A significant amount of research conducted in the Sonoran Desert of North America has documented, both anecdotally and empirically, major vegetation changes over the past century due to human land use activities. However, many studies lack coincidental landscape-scale data characterizing the spatial and temporal manifestation of these changes. Vegetation changes in a binational (USA and Mexico) watershed were documented using a series of four land cover maps (1979-2009) derived from multispectral satellite imagery. Cover changes are compared to georeferenced, repeat oblique photographs dating from the late 19th century to present. Results indicate the expansion of grassland over the past 20 years following nearly a century of decline. Historical repeat photography documents early-mid 20th century mesquite invasions, but recent land cover data and rephotography demonstrate declines in xeroriparian/riparian mesquite communities in recent decades. These vegetation changes are variable over the landscape and influenced by topography and land management.

  14. Novel plant communities limit the effects of a managed flood to restore riparian forests along a large regulated river

    Science.gov (United States)

    Cooper, D.J.; Andersen, D.C.

    2012-01-01

    Dam releases used to create downstream flows that mimic historic floods in timing, peak magnitude and recession rate are touted as key tools for restoring riparian vegetation on large regulated rivers. We analysed a flood on the 5th-order Green River below Flaming Gorge Dam, Colorado, in a broad alluvial valley where Fremont cottonwood riparian forests have senesced and little recruitment has occurred since dam completion in 1962. The stable post dam flow regime triggered the development of novel riparian communities with dense herbaceous plant cover. We monitored cottonwood recruitment on landforms inundated by a managed flood equal in magnitude and timing to the average pre-dam flood. To understand the potential for using managed floods as a riparian restoration tool, we implemented a controlled and replicated experiment to test the effects of artificially modified ground layer vegetation on cottonwood seedling establishment. Treatments to remove herbaceous vegetation and create bare ground included herbicide application (H), ploughing (P), and herbicide plus ploughing (H+P). Treatment improved seedling establishment. Initial seedling densities on treated areas were as much as 1200% higher than on neighbouring control (C) areas, but varied over three orders of magnitude among the five locations where manipulations were replicated. Only two replicates showed the expected seedling density rank of (H+P)>P>H>C. Few seedlings established in control plots and none survived 1 year. Seedling density was strongly affected by seed rain density. Herbivory affected growth and survivorship of recruits, and few survived nine growing seasons. Our results suggest that the novel plant communities are ecologically and geomorphically resistant to change. Managed flooding alone, using flows equal to the pre-dam mean annual peak flood, is an ineffective riparian restoration tool where such ecosystem states are present and floods cannot create new habitat for seedling establishment

  15. Potential Investigation of Linking PROSAIL with the Ross-Li BRDF Model for Vegetation Characterization

    Directory of Open Access Journals (Sweden)

    Xiaoning Zhang

    2018-03-01

    Full Text Available Methods that link different models for investigating the retrieval of canopy biophysical/structural variables have been substantially adopted in the remote sensing community. To retrieve global biophysical parameters from multiangle data, the kernel-driven bidirectional reflectance distribution function (BRDF model has been widely applied to satellite multiangle observations to model (interpolate/extrapolate the bidirectional reflectance factor (BRF in an arbitrary direction of viewing and solar geometries. Such modeled BRFs, as an essential information source, are then input into an inversion procedure that is devised through a large number of simulation analyses from some widely used physical models that can generalize such an inversion relationship between the BRFs (or their simple algebraic composite and the biophysical/structural parameter. Therefore, evaluation of such a link between physical models and kernel-driven models contributes to the development of such inversion procedures to accurately retrieve vegetation properties, particularly based on the operational global BRDF parameters derived from satellite multiangle observations (e.g., MODIS. In this study, the main objective is to investigate the potential for linking a popular physical model (PROSAIL with the widely used kernel-driven Ross-Li models. To do this, the BRFs and albedo are generated by the physical PROSAIL in a forward model, and then the simulated BRFs are input into the kernel-driven BRDF model for retrieval of the BRFs and albedo in the same viewing and solar geometries. To further strengthen such an investigation, a variety of field-measured multiangle reflectances have also been used to investigate the potential for linking these two models. For simulated BRFs generated by the PROSAIL model at 659 and 865 nm, the two models are generally comparable to each other, and the resultant root mean square errors (RMSEs are 0.0092 and 0.0355, respectively, although some

  16. Chemical characterization of soil organic matter in a Chesapeake Bay salt marsh: analyzing microbial and vegetation inputs to SOM

    Science.gov (United States)

    Bye, E.; Schreiner, K. M.; Abdulla, H. A.; Minor, E. C.; Guntenspergen, G. R.

    2017-12-01

    Coastal wetlands play a critical role in the global carbon cycle. These ecosystems sequester and store carbon, known as "blue carbon," at a rate two or three orders of magnitude larger than other terrestrial ecosystems, such as temperate, tropical, and boreal forests. Anthropogenic changes to the climate are threatening blue carbon stores in coastal wetland ecosystems. To understand and predict how these important carbon stores will be affected by anthropogenic climate changes, it is necessary to understand the formation and preservation of soil organic matter (SOM) in these ecosystems. This study will present organic geochemical data from two sediment cores collected from the Smithsonian Environmental Research Center site on a salt marsh in Maryland along the Chesapeake Bay. One core is from a location that recently transitioned from a C4 to C3 plant regime, currently dominated by the sedge Shoenplectis americanus. The second core is from a C4 plant (Spartina patens) dominated location in the marsh. The organic geochemistry of these 100 cm deep sediment cores was studied through multiple bulk analyses including stable isotopes, elemental ratios, Fourier-transform infrared spectroscopy (FTIR), solid-state magic-angle-spinning Nuclear Magnetic Resonance (NMR), and compound specific lignin-phenol analysis. By using comprehensive chemical characterization techniques, this study aims to discern between vegetation- and microbially-derived inputs to SOM in blue carbon ecosystems. The results show a general increase in the aromatic content with a concomitant decrease of carbohydrates with depth in both cores. However, substantial differences between the two cores, indicates differing inputs and/or stabilization mechanisms within SOM formed from different vegetation regimes. Further compound specific work will help to elucidate the specific source of compounds within each compound class, in surface and deep SOM, and additionally can help provide evidence for different

  17. Spectroscopic characterization of digestates obtained from sludge mixed to increasing amounts of fruit and vegetable wastes

    Science.gov (United States)

    Provenzano, Maria Rosaria; Cavallo, Ornella; Malerba, Anna Daniela; Di Maria, Francesco; Ricci, Anna; Gigliotti, Giovanni

    2015-04-01

    Anaerobic digestion (AD) represents an efficient waste-treatment technology during which microorganisms break down biodegradable material in absence of oxygen yielding a biogas containing methane. The aim of this work was to investigate the transformations occurring in the organic matter during the co-digestion of waste mixed sludge (WMS) with an increasing amount of fruit and vegetable wastes (FVW) in a pilot scale apparatus reproducing a full-scale digester in an existing wastewater treatment plant. Samples comprised: sludge, FVW, sludge mixed with 10-20-30-40% FVW. Ingestates and digestates were analyzed by means of emission fluorescence spectroscopy and FTIR associated to Fourier self deconvolution (FSD) of spectra. With increasing the amount of FVW from 10% to 20% at which percentage biogas production reached the maximum value, FTIR spectra and FSD traces of digestates exhibited a decrease of intensity of peaks assigned to polysaccharides and aliphatics and an increase of peak assigned to aromatics as a result of the biodegradation of rapidly degradable materials and concentration of aromatic recalcitrant compounds. Digestates with 30 and 40% FVW exhibited a relative increase of intensity of peaks assigned to aliphatics likely as a result of the increasing amount of rapidly degradable materials and the consequent reduction of the hydraulic retention time. This may cause inhibition of methanogenesis and accumulation of volatile fatty acids. The highest emission fluorescence intensity was observed for the digestate with 20% FVW confirming the concentration of aromatic recalcitrant compounds in the substrate obtained at the highest biogas production.

  18. Microbial community structure across a wastewater-impacted riparian buffer zone in the southeastern coastal plain.

    Science.gov (United States)

    Ducey, T F; Johnson, P R; Shriner, A D; Matheny, T A; Hunt, P G

    2013-01-01

    Riparian buffer zones are important for both natural and developed ecosystems throughout the world because of their ability to retain nutrients, prevent soil erosion, protect aquatic environments from excessive sedimentation, and filter pollutants. Despite their importance, the microbial community structures of riparian buffer zones remains poorly defined. Our objectives for this study were twofold: first, to characterize the microbial populations found in riparian buffer zone soils; and second, to determine if microbial community structure could be linked to denitrification enzyme activity (DEA). To achieve these objectives, we investigated the microbial populations of a riparian buffer zone located downslope of a pasture irrigated with swine lagoon effluent, utilizing DNA sequencing of the 16S rDNA, DEA, and quantitative PCR (qPCR) of the denitrification genes nirK, nirS, and nosZ. Clone libraries of the 16S rDNA gene were generated from each of twelve sites across the riparian buffer with a total of 986 partial sequences grouped into 654 operational taxonomic units (OTUs). The Proteobacteria were the dominant group (49.8% of all OTUs), with the Acidobacteria also well represented (19.57% of all OTUs). Analysis of qPCR results identified spatial relationships between soil series, site location, and gene abundance, which could be used to infer both incomplete and total DEA rates.

  19. Characterization and potential application of pataua vegetable oil in apatite flotation

    International Nuclear Information System (INIS)

    Oliveira, P.S. de; Mansur, H.S.; Peres, A.E.C.

    2016-01-01

    The present research characterizes the Pataua palm (Oenocarpus bataua) oil regarding to its fatty acids profile and acidity index, and evaluates its use for apatite flotation. The Pataua oil evaluated is unsaturated e predominantly composed of cis-9-octadecenoic acid (oleic acid). The mineral sample characterization revealed a material composed by a fluoroapatite deficient in fluorine, a possibly result of isomorphic substitution, and with quartz and monazite inclusions. The analysis of the mineral after reagent conditioning, by Fourier Transform Infrared Spectroscopy (FTIR), pointed to the presence of characteristic bands of carbon chains and carboxylate group, suggesting the collector adsorption through the mechanisms of chemisorption and insoluble calcium salts precipitation. Thus, it is proposed the Pataua oil potential use in flotation systems aiming apatite recovery. (author)

  20. Effect of emergent aquatic insects on bat foraging in a riparian forest.

    Science.gov (United States)

    Fukui, Dai; Murakami, Masashi; Nakano, Shigeru; Aoi, Toshiki

    2006-11-01

    1. Riparian zones serve several ecological functions for bats. They provide a source of prey and likely provide favourable structural habitats and shelter from predators. Many studies have shown that bats use the space above streams, ponds or riparian vegetation as feeding habitat. These studies, however, have never distinguished between the effects of habitat structure and prey availability on the foraging activities of bats. Such effects can only be distinguished by an experimental approach. We predicted that bat activity along a stream is influenced by the number of emerged aquatic insects. 2. We evaluated the response of terrestrial consumers, insectivorous bats, to changes in the abundance of emergent aquatic insects by conducting a manipulative field experiment. In a deciduous riparian forest in Japan, aquatic insect flux from the stream to the riparian zone was controlled with an insect-proof cover over a 1.2 km stream reach. 3. We estimated the abundance of emergent aquatic and flying terrestrial arthropods near the treatment and control reaches using Malaise traps. The foraging activity of bats was evaluated in both treatment and control reaches using ultrasonic detectors. 4. The insect-proof cover effectively reduced the flux of emergent aquatic insects to the riparian zone adjacent to the treatment reach. Adjacent to the control reach, adult aquatic insect biomass was highest in spring, and then decreased gradually. Terrestrial insect biomass increased gradually during the summer at both treatment and control reaches. 5. Foraging activity of bats was correlated with insect abundance. In spring, foraging activity of bats at the control reach was significantly greater than at the treatment reach, and increased at both sites with increasing terrestrial insect abundance. 6. Our result suggests that the flux of aquatic insects emerging from streams is one of the most important factors affecting the distribution of riparian-foraging bats. As is the case with

  1. High temporal resolution photography for observing riparian area use and grazing behavior

    Science.gov (United States)

    In 2014, a 2.4 hectare site within the Apache-Sitgreaves National Forest in northeastern Arizona, USA was selected to characterize temporal and spatial patterns of riparian area use. Three consecutive 30, 8, and 46 day time periods representing 1) unrestricted access, 2) prescribed cattle use, and 3...

  2. A Robust Gold Deconvolution Approach for LiDAR Waveform Data Processing to Characterize Vegetation Structure

    Science.gov (United States)

    Zhou, T.; Popescu, S. C.; Krause, K.; Sheridan, R.; Ku, N. W.

    2014-12-01

    Increasing attention has been paid in the remote sensing community to the next generation Light Detection and Ranging (lidar) waveform data systems for extracting information on topography and the vertical structure of vegetation. However, processing waveform lidar data raises some challenges compared to analyzing discrete return data. The overall goal of this study was to present a robust de-convolution algorithm- Gold algorithm used to de-convolve waveforms in a lidar dataset acquired within a 60 x 60m study area located in the Harvard Forest in Massachusetts. The waveform lidar data was collected by the National Ecological Observatory Network (NEON). Specific objectives were to: (1) explore advantages and limitations of various waveform processing techniques to derive topography and canopy height information; (2) develop and implement a novel de-convolution algorithm, the Gold algorithm, to extract elevation and canopy metrics; and (3) compare results and assess accuracy. We modeled lidar waveforms with a mixture of Gaussian functions using the Non-least squares (NLS) algorithm implemented in R and derived a Digital Terrain Model (DTM) and canopy height. We compared our waveform-derived topography and canopy height measurements using the Gold de-convolution algorithm to results using the Richardson-Lucy algorithm. Our findings show that the Gold algorithm performed better than the Richardson-Lucy algorithm in terms of recovering the hidden echoes and detecting false echoes for generating a DTM, which indicates that the Gold algorithm could potentially be applied to processing of waveform lidar data to derive information on terrain elevation and canopy characteristics.

  3. Pilot scale production, characterization, and optimization of epoxidized vegetable oil-based resins

    Science.gov (United States)

    Monono, Ewumbua Menyoli

    Novel epoxidized sucrose soyate (ESS) resins perform much better than other vegetable oil-based resins; thus, they are of current interest for commercial scale production and for a wide range of applications in coatings and polymeric materials. However, no work has been published that successfully scaled-up the reaction above a 1 kg batch size. To achieve this goal, canola oil was first epoxidized at a 300 g scale to study the epoxidation rate and thermal profile at different hydrogen peroxide (H2O2) addition rates, bath temperatures, and reaction times. At least 83% conversion of double bonds to oxirane was achieved by 2.5 h, and the reaction temperature was 8-15 °C higher than the water bath temperature within the first 30-40 min of epoxidation. A 38 L stainless steel kettle was modified as a reactor to produce 10 kg of ESS. Twenty 7-10 kg batches of ESS were produced with an overall 87.5% resin yield and > 98% conversion after batch three. The conversion and resin quality were consistent across the batches due to the modifications on the reaction that improved mixing and reaction temperature control within 55-65 oC. The total production time was reduced from 8 to 4 days due to the fabrication of a 40 L separatory funnel for both washing and filtration. A math model was developed to optimize the epoxidation process. This was done by using the Box-Behnken design to model the conversion at various acetic acid, H2O2, and Amberlite ratios and at various reaction temperatures and times. The model had an adjusted R2 of 97.6% and predicted R2 of 96.8%. The model showed that reagent amounts and time can be reduced by 18% without compromising the desired conversion value and quality.

  4. Characterizing the dependence of vegetation model parameters on crop structure, incidence angle, and polarization at L-band

    DEFF Research Database (Denmark)

    Wigneron, J-P.; Pardé, M.; Waldteufel, P.

    2004-01-01

    To retrieve soil moisture over vegetation-covered areas from microwave radiometry, it is necessary to account for vegetation effects. At L-band, many retrieval approaches are based on a simple model that relies on two vegetation parameters: the optical depth (tau) and the single-scattering albedo......, wheat, grass, and alfalfa) based on L-band experimental datasets. The results should be useful for developing more accurate forward modeling and retrieval methods over mixed pixels including a variety of vegetation types....

  5. Vegetative and structural characteristics of agricultural drainages in the Mississippi Delta landscapes

    International Nuclear Information System (INIS)

    Bouldin, J.L.; Farris, J.L.; Moore, M.T.; Cooper, C.M.

    2004-01-01

    Agricultural drainage ditches in the Mississippi Alluvial Delta landscape vary from edge-of-field waterways to sizeable drainages. Ditch attributes vary with size, location and maintenance and may aid in mitigation of contaminants from agricultural fields. The goal of this study was to better understand how vegetative characteristics affect water quality in conveyance structures in the context of ditch class and surrounding land use. Characterization of 36 agricultural ditches included presence of riparian buffer strips, water depth, surrounding land use, vegetative cover, and associated aqueous physicochemical parameters. Vegetation was assessed quantitatively, obtaining stem counts in a sub-sample of ditch sites, using random quadrat method. Physical features varied with ditch size and vegetative diversity was higher in larger structures. Polygonum sp. was the dominant bed vegetation and was ubiquitous among site sizes. Macrophytes varied from aquatic to upland species, and included Leersia sp. and upland grasses (Poaceae family) in all drainage size classes. Percent cover of bed and bank varied from 0 to 100% and 70 to 100%, respectively, and highest nutrient values were measured in sites with no buffer strips. These conveyance structures and surrounding buffer zones are being ranked for their ability to reduce excess nutrients, suspended solids, and pesticides associated with runoff. - Capsule: Vegetated buffer areas provide effective mitigation for non-point source pollution from agriculture

  6. Riparian Raptors on USACE Projects: Bald Eagle (Haliaeetus leucocephalus)

    National Research Council Canada - National Science Library

    Mitchell, Wilma

    2000-01-01

    ...) reservoir operations. For management purposes, these raptors are considered riparian generalists because they inhabit the riparian zones surrounding streams and lakes of Corps projects but may seasonally use adjacent...

  7. Riparian Raptors on USACE Projects: Osprey (Pandion haliaetus)

    National Research Council Canada - National Science Library

    Mitchell, Wilma A; Wolters, M. S

    2000-01-01

    ...) reservoir operations. For management purposes, these raptors are considered riparian generalists because they inhabit riparian zones surrounding streams and lakes on Corps project lands but may seasonally use adjacent...

  8. Tribal experiences and lessons learned in riparian ecosystem restoration

    Science.gov (United States)

    Ronald K. Miller; James E. Enote; Cameron L. Martinez

    1996-01-01

    Riparian ecosystems have been part of the culture of land use of native peoples in the Southwest United States for thousands of years. The experiences of tribal riparian initiatives to incorporate modern elements of environment and development with cultural needs are relatively few. This paper describes tribal case examples and approaches in riparian management which...

  9. Controls on denitrification potential in nitrate-rich waterways and riparian zones of an irrigated agricultural setting.

    Science.gov (United States)

    Webster, Alex J; Groffman, Peter M; Cadenasso, Mary L

    2018-02-21

    Denitrification, the microbial conversion of NO 3 - to N gases, is an important process contributing to whether lotic and riparian ecosystems act as sinks for excess NO 3 - from agricultural activities. Though agricultural waterways and riparian zones have been a focus of denitrification research for decades, almost none of this research has occurred in the irrigated agricultural settings of arid and semi-arid climates. In this study, we conducted a broad survey of denitrification potential in riparian soils and channel sediment from 79 waterway reaches in the irrigated agricultural landscape of California's Central Valley. With this approach, we sought to capture the wide range of variation that arose from diverse waterway management and fluctuating flow conditions, and use this variation to identify promising management interventions. We explored associations of denitrification potentials with surface water NO 3 - -N, organic matter, flow conditions, vegetation cover, near-channel riparian bank slope, and channel geomorphic features using generalized linear mixed models. We found strong associations of sediment denitrification potentials with reach flow conditions, which we hypothesize was the result of variation in microbial communities' tolerance to dry-wet cycles. Denitrification potentials in riparian soils, in contrast, did not appear affected by flow conditions, but instead were associated with organic matter, vegetation cover, and bank slope in the riparian zone. These results suggest a strong need for further work on how denitrification responds to varying flow conditions and dry-wet cycles in non-perennial lotic ecosystems. Our findings also demonstrate that denitrifier communities respond to key features of waterway management, which can therefore be leveraged to control denitrification through a variety of management actions. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  10. Optical characterization of pure vegetable oils and their biodiesels using Raman spectroscopy

    Science.gov (United States)

    Firdous, S.; Anwar, S.; Waheed, A.; Maraj, M.

    2016-04-01

    Great concern regarding energy resources and environmental polution has increased interest in the study of alternative sources of energy. Biodiesels as an alternative fuel provide a suitable diesel oil substitute for internal combustion engines. The Raman spectra of pure biodiesels of soybean oil, olive oil, coconut oil, animal fats, and petroleum diesel are optically characterized for quality and biofuel as an alternative fuel. The most significant spectral differences are observed in the frequency range around 1457 cm-1 for pure petroleum diesel, 1427 for fats biodiesel, 1670 cm-1 for pure soybean oil, 1461 cm-1 for soybean oil based biodiesel, 1670 cm-1 for pure olive oil, 1666 cm-1 for olive oil based biodiesel, 1461 cm-1 for pure coconut oil, and 1460 cm-1 for coconut oil based biodiesel, which is used for the analysis of the phase composition of oils. A diode pump solid-state laser with a 532 nm wavelength is used as an illuminating light. It is demonstrated that the peak positions and relative intensities of the vibrations of the oils can be used to identify the biodiesel quality for being used as biofuel.

  11. Optical characterization of pure vegetable oils and their biodiesels using Raman spectroscopy

    International Nuclear Information System (INIS)

    Firdous, S; Anwar, S; Waheed, A; Maraj, M

    2016-01-01

    Great concern regarding energy resources and environmental polution has increased interest in the study of alternative sources of energy. Biodiesels as an alternative fuel provide a suitable diesel oil substitute for internal combustion engines. The Raman spectra of pure biodiesels of soybean oil, olive oil, coconut oil, animal fats, and petroleum diesel are optically characterized for quality and biofuel as an alternative fuel. The most significant spectral differences are observed in the frequency range around 1457 cm −1 for pure petroleum diesel, 1427 for fats biodiesel, 1670 cm −1 for pure soybean oil, 1461 cm −1 for soybean oil based biodiesel, 1670 cm −1 for pure olive oil, 1666 cm −1 for olive oil based biodiesel, 1461 cm −1 for pure coconut oil, and 1460 cm −1 for coconut oil based biodiesel, which is used for the analysis of the phase composition of oils. A diode pump solid-state laser with a 532 nm wavelength is used as an illuminating light. It is demonstrated that the peak positions and relative intensities of the vibrations of the oils can be used to identify the biodiesel quality for being used as biofuel. (paper)

  12. Environmental tolerance of an invasive riparian tree and its potential for continued spread in the southwestern US

    Science.gov (United States)

    Reynolds, L.V.; Cooper, D.J.

    2010-01-01

    Questions: Exotic plant invasion may be aided by facilitation and broad tolerance of environmental conditions, yet these processes are poorly understood in species-rich ecosystems such as riparian zones. In the southwestern United States (US) two plant species have invaded riparian zones: tamarisk (Tamarix ramosissima, T. chinensis, and their hybrids) and Russian olive (Elaeagnus angustifolia). We addressed the following questions: (1) is Russian olive able to tolerate drier and shadier conditions than cottonwood and tamarisk? (2) Can tamarisk and cottonwood facilitate Russian olive invasion? Location: Arid riparian zones, southwestern US. Methods: We analyzed riparian tree seedling requirements in a controlled experiment, performed empirical field studies, and analyzed stable oxygen isotopes to determine the water sources used by Russian olive. Results: Russian olive survival was significantly higher in dense shade and low moisture conditions than tamarisk and cottonwood. Field observations indicated Russian olive established where flooding cannot occur, and under dense canopies of tamarisk, cottonwood, and Russian olive. Tamarisk and native riparian plant species seedlings cannot establish in these dry, shaded habitats. Russian olive can rely on upper soil water until 15 years of age, before utilizing groundwater. Conclusions: We demonstrate that even though there is little evidence of facilitation by cottonwood and tamarisk, Russian olive is able to tolerate dense shade and low moisture conditions better than tamarisk and cottonwood. There is great potential for continued spread of Russian olive throughout the southwestern US because large areas of suitable habitat exist that are not yet inhabited by this species. ?? 2010 International Association for Vegetation Science.

  13. River food web response to large-scale riparian zone manipulations.

    Directory of Open Access Journals (Sweden)

    J Timothy Wootton

    Full Text Available Conservation programs often focus on select species, leading to management plans based on the autecology of the focal species, but multiple ecosystem components can be affected both by the environmental factors impacting, and the management targeting, focal species. These broader effects can have indirect impacts on target species through the web of interactions within ecosystems. For example, human activity can strongly alter riparian vegetation, potentially impacting both economically-important salmonids and their associated river food web. In an Olympic Peninsula river, Washington state, USA, replicated large-scale riparian vegetation manipulations implemented with the long-term (>40 yr goal of improving salmon habitat did not affect water temperature, nutrient limitation or habitat characteristics, but reduced canopy cover, causing reduced energy input via leaf litter, increased incident solar radiation (UV and PAR and increased algal production compared to controls. In response, benthic algae, most insect taxa, and juvenile salmonids increased in manipulated areas. Stable isotope analysis revealed a predominant contribution of algal-derived energy to salmonid diets in manipulated reaches. The experiment demonstrates that riparian management targeting salmonids strongly affects river food webs via changes in the energy base, illustrates how species-based management strategies can have unanticipated indirect effects on the target species via the associated food web, and supports ecosystem-based management approaches for restoring depleted salmonid stocks.

  14. From microbes to water districts: Linking observations across scales to uncover the implications of riparian and channel management on water quality in an irrigated agricultural landscape

    Science.gov (United States)

    Webster, A.; Cadenasso, M. L.

    2016-12-01

    Interactions among runoff, riparian and stream ecosystems, and water quality remain uncertain in many settings, particularly those heavily impacted by human activities. For example, waterways in the irrigated agricultural landscape of California's Central Valley are seasonally disconnected from groundwater tables and are extensively modified by infrastructure and management. These conditions make the impact of riparian and channel management difficult to predict across scales, which hinders efforts to promote best management practices to improve water quality. We seek to link observations across catchment, reach, and patch scales to understand patterns of nitrate and turbidity in waterways draining irrigated cropland. Data was collected on 80 reaches spanning two water management districts. At the catchment scale, water districts implemented waterway and riparian management differently: one water district had a decentralized approach, allowing individual land owners to manage their waterway channels and banks, while the other had a centralized approach, in which land owners defer management to a district-run program. At the reach scale, riparian and waterway vegetation, geomorphic complexity, and flow conditions were quantified. Reach-scale management such as riparian planting projects and channel dredging frequency were also considered. At the patch scale, denitrification potential and organic matter were measured in riparian toe-slope soils and channel sediments, along with associated vegetation and geomorphic features. All factors were tested for their ability to predict water quality using generalized linear mixed effects models and the consistency of predictors within and across scales was evaluated. A hierarchy of predictors emerges: catchment-scale management regimes predict reach-scale geomorphic and vegetation complexity, which in turn predicts sediment denitrification potential - the patch-scale factor most associated with low nitrate. Similarly

  15. Purification and characterization of plantaricin 163, a novel bacteriocin produced by Lactobacillus plantarum 163 isolated from traditional Chinese fermented vegetables.

    Science.gov (United States)

    Hu, Meizhong; Zhao, Haizhen; Zhang, Chong; Yu, Jiansheng; Lu, Zhaoxin

    2013-11-27

    Presumptive lactic acid bacteria (LAB) strains isolated from traditional Chinese fermented vegetables were screened for bacteriocin production. A novel bacteriocin-producing strain, Lactobacillus plantarum 163, was identified on the basis of its physiobiochemical characteristics and characterized by 16S rDNA sequencing. The novel bacteriocin, plantaricin 163, produced by Lb. plantarum 163 was purified by salt precipitation, gel filtration, and reverse-phase high-performance liquid chromatography (RP-HPLC). Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) analysis of plantaricin 163 revealed the molecular weight to be 3553.2 Da. The complete amino acid sequence showed VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK, and no similarity to known bacteriocins was found. Plantaricin 163 was highly thermostable (20 min, 121 °C), active in the presence of acidic pH (3-5), sensitive to protease, and exhibited broad-spectrum antimicrobial activity against LAB and other tested Gram-positive and Gram-negative bacteria. The results suggest that plantaricin 163 may be employed as a biopreservative in the food industry.

  16. Methods for evaluating riparian habitats with applications to management

    Science.gov (United States)

    Platts, William S.; Armour, C.L.; Booth, G.D.; Bryant, M.; Bufford, J.L.; Cuplin, P.; Jensen, S.; Lienkaemper, G.W.; Minshall, G.W.; Monsen, S.T.; Nelson, R.L.; Sedell, J.R.; Tuhy, J.S.

    1987-01-01

    Riparian area planning and management is a major national issues today--something that should have been the case a century ago. A century of additive effects of land use has resulted in major impacts on many riparian stream habitats and their fisheries, wildlife, and domestic livestock use. Before scientists can evaluate the influences of various land and water uses on riparian environments, they must first understand these environments. This means being able to detect and measure with confidence the natural and artificial variation and instantaneous conditions of the riparian habitat. These conditions must then be related to the production capability of riparian habitat and any extraneous factors affecting this production potential.

  17. Effects of flow regulation and fragmentation by dams on riparian flora in boreal rivers

    International Nuclear Information System (INIS)

    Jansson, Roland

    2000-01-01

    The object of this thesis is to evaluate the effects of river regulation on riparian flora in boreal rivers, and to increase the understanding of the processes causing patterns in species diversity. Comparisons of free-flowing and regulated rivers showed that regulated rivers have fewer plant species and less plant cover per 200-m-stretch of river margin. Regulated river-margins were less species-rich compared to free-flowing rivers irrespective of the type of regulated water level regime, except for unimpounded reaches downstream of dams. Species with good dispersal capacity (wind-dispersed or long-floating species) were least affected by regulation, showing that the ability to recolonize after local extinction is an important character. The temporal development of river-margin vegetation in regulated rivers was studied by investigating differently-old reservoirs and impoundments. Plant-species richness along storage reservoirs increased during the first 30-40 years following damming, but declined thereafter. Both species richness and plant cover remained impoverished compared to free-flowing rivers about 70 years after regulation. Along run-of-river impoundments, plant species richness and cover peaked after 10-20 years. In the long run, riparian species richness was lower, but riparian species density did not differ, compared to free-flowing rivers. Dams fragment the riparian flora. Adjacent run-of-river impoundments developed different riparian floras, probably because dams are barriers to the dispersal of species with poor floating ability. This shows that dams disrupt the ecological continuity not only for the river channel, but also for the adjoining riparian corridor. The number of species and genera were similar between river margins along boreal free-flowing rivers in Europe and North America. The riparian floras shared few species but many genera and families. The regional species pools were similar-sized and composed of species with similar traits, and

  18. The negative influences of the new brazilian forest code on the conservation of riparian forests

    Directory of Open Access Journals (Sweden)

    Silva Normandes Matos da

    2017-12-01

    Full Text Available More than one million hectares of riparian forests were degraded or altered in Mato Grosso State (Brazil up to 2009. The aim of the research is to set a comparative scenario to show differences in the quantification of environmental liabilities in riparian forest areas resulting from the change in native vegetation protection rules due to the transition between Laws 4771/65 and 12651/2012. Data collection took place in a marginal stretch of Vermelho River in Rondonópolis County, Mato Grosso State. The following data set was taken into consideration: aerial images derived from unmanned aerial vehicle, Rapid Eye satellite images and orbital images hosted at Google Earth. The spatial resolution of those images was compared. The aerial photos composed a mosaic that was photo-interpreted to generate land use and occupation classes. The riparian forest areas of a rural property were used as parameter, and their environmental situation was compared in 05 meter and 100 meter strips. Thus, by taking into consideration the current rules, 23,501 m2 of area ceased to be an environmental liability within the riparian forest and became a consolidated rural area. According to the previous Forest Code, in a different scenario, that is, in a set of rural properties, the public authority would receive USD 68,600.00 in fines. The new Brazilian Forestry Code of 2012, which replaces the previous one made in 1965, exempts those responsible for rural property from regenerating previously deforested native vegetation - an obligation established by older Forest Code. We have shown that the new Forest Code has diminished the legal responsibility of the rural owners in relation to the maintenance of forest fragments in their properties.

  19. Best management practices for riparian areas

    Science.gov (United States)

    Michael J. Phillips; Lloyd W. Swift; Charles R. Blinn

    2000-01-01

    Forest streams, lakes, and other water bodies create unique conditions along their margins that control and influence transfers of energy, nutrients, and sediments between aquatic and terrestrial systems. These riparian areas are among the most critical features of the landscape because they contain a rich diversity of plants and animals and help to maintain water...

  20. Developing management strategies for riparian areas.

    Science.gov (United States)

    D.E. Hibbs; S. Chan

    2001-01-01

    This talk outlines four principles that are critical to successful management of a riparian area. First, given problems both with defining historic conditions and with returning to them, attaining management goals based on restoration of ecological processes and functions will be far more successful. Second, the management goals for any stream reach must be placed in a...

  1. Viscosity changes of riparian water controls diurnal fluctuations of stream-flow and DOC concentration

    Science.gov (United States)

    Schwab, Michael; Klaus, Julian; Pfister, Laurent; Weiler, Markus

    2015-04-01

    Diurnal fluctuations in stream-flow are commonly explained as being triggered by the daily evapotranspiration cycle in the riparian zone, leading to stream flow minima in the afternoon. While this trigger effect must necessarily be constrained by the extent of the growing season of vegetation, we here show evidence of daily stream flow maxima in the afternoon in a small headwater stream during the dormant season. We hypothesize that the afternoon maxima in stream flow are induced by viscosity changes of riparian water that is caused by diurnal temperature variations of the near surface groundwater in the riparian zone. The patterns were observed in the Weierbach headwater catchment in Luxembourg. The catchment is covering an area of 0.45 km2, is entirely covered by forest and is dominated by a schistous substratum. DOC concentration at the outlet of the catchment was measured with the field deployable UV-Vis spectrometer spectro::lyser (scan Messtechnik GmbH) with a high frequency of 15 minutes over several months. Discharge was measured with an ISCO 4120 Flow Logger. During the growing season, stream flow shows a frequently observed diurnal pattern with discharge minima in the afternoon. During the dormant season, a long dry period with daily air temperature amplitudes of around 10 ° C occurred in March and April 2014, with discharge maxima in the afternoon. The daily air temperature amplitude led to diurnal variations in the water temperature of the upper 10 cm of the riparian zone. Higher riparian water temperatures cause a decrease in water viscosity and according to the Hagen-Poiseuille equation, the volumetric flow rate is inversely proportional to viscosity. Based on the Hagen-Poiseuille equation and the viscosity changes of water, we calculated higher flow rates of near surface groundwater through the riparian zone into the stream in the afternoon which explains the stream flow maxima in the afternoon. With the start of the growing season, the viscosity

  2. Riparian Cottonwood Ecosystems and Regulated Flows in Kootenai and Yakima Sub-Basins : Volume I Kootenai River (Overview, Report and Appendices).

    Energy Technology Data Exchange (ETDEWEB)

    Jamieson, Bob; Braatne, Jeffrey H.

    2001-10-01

    Riparian vegetation and especially cottonwood and willow plant communities are dependent on normative flows and especially, spring freshette, to provide conditions for recruitment. These plant communities therefore share much in common with a range of fish species that require natural flow conditions to stimulate reproduction. We applied tools and techniques developed in other areas to assess riparian vegetation in two very different sub-basins within the Columbia Basin. Our objectives were to: Document the historic impact of human activity on alluvial floodplain areas in both sub-basins; Provide an analysis of the impacts of flow regulation on riparian vegetation in two systems with very different flow regulation systems; Demonstrate that altered spring flows will, in fact, result in recruitment to cottonwood stands, given other land uses impacts on each river and the limitations imposed by other flow requirements; and Assess the applicability of remote sensing tools for documenting the distribution and health of cottonwood stands and riparian vegetation that can be used in other sub-basins.

  3. Detecting changes in riparian habitat conditions based on patterns of greenness change: a case study from the upper San Pedro River Basin, USA

    Science.gov (United States)

    K. Bruce Jones; Curtis E. Edmonds; E. Terrance Slonecker; James D. Wickham; Anne C. Neale; Timothy G. Wade; Kurt H. Riitters; William G. Kepner

    2008-01-01

    Healthy riparian ecosystems in arid and semi-arid regions exhibit shifting patterns of vegetation in response to periodic flooding. Their conditions also depend upon the amount of grazing and other human uses. Taking advantage of these system properties, we developed and tested an approach that utilizes historical Landsat data to track changes in the patterns...

  4. Black-chinned hummingbird nest-site selection and nest survival in response to fuel reduction in a southwestern riparian forest

    Science.gov (United States)

    D. Max Smith; Deborah M. Finch; David L. Hawksworth

    2009-01-01

    Despite widespread efforts to avert wildfire by reducing the density of flammable vegetation, little is known about the effects of this practice on the reproductive biology of forest birds. We examined nest-site selection and nest survival of the Black-chinned Hummingbird (Archilochus alexandri) in New Mexico riparian forests treated or not for fuel...

  5. Delineation of the riparian zone in data-scarce regions using fuzzy membership functions: An evaluation based on the case of the Naryn River in Kyrgyzstan

    Science.gov (United States)

    Betz, Florian; Lauermann, Magdalena; Cyffka, Bernd

    2018-04-01

    Riparian zones contain important ecosystems with a high biodiversity and relevant ecosystem services. From a process point of view, riparian zones are characterized by the interaction of hydrological, geomorphological and ecological processes. Consequently, their boundary is dynamic and blurred as it depends on not only the local valley morphology but also the hydrological regime. This makes a delineation of riparian zones from digital elevation data a challenging task as it should represent this blurred nature of riparian zone boundaries. While the application of high resolution topography from LIDAR and hydraulic models have become standard in many developed countries, studies and applications in remote areas still commonly rely on the freely available coarse resolution digital elevation models. In this article, we present the delineation of riparian zones from the SRTM-1 elevation model and fuzzy membership functions for the Naryn River in Kyrgyzstan having a length of approximately 700 km. We evaluate the extraction of the underlying channel network as well as the different indicator variables. The maximum user's accuracy for the delineation of riparian zones along the entire Naryn River is 82.14% reflecting the uncertainty arising from the heterogeneity of the riverscape as well as from the quality of the underlying elevation data. Despite the uncertainty, the fuzzy membership approach is considered as an appropriate method for riparian zone delineation as it reflects their dynamic, transitional character and can be used as indicator of connectivity within a riverscape.

  6. Caracterización de una biograsa de aceite vegetal de Jatropha curcas L y jabón de litio//Characterization of biogrease based on Jatropha curcas L vegetable oil and Lithium Soap Thickener

    Directory of Open Access Journals (Sweden)

    Juliano Chitue de Assunção Nascimento

    2013-05-01

    Full Text Available Los aceites vegetales poseen un gran potencial como fluido base y como sustituto de los aceites minerales para la formulación de grasas lubricantes, estos aceites son biodegradables y renovables. En el trabajo se determinaron las propiedades  fisicoquímicas, antidesgaste y de extrema presión de una biograsa de aceite vegetal de Jatropha curcas L y jabón de litio empleando los métodos de pruebas estándar para las grasas lubricantes. La biograsa posee un color amarillo claro, una textura suave y homogénea,  un grado de penetración NLGI 1, una temperatura de goteo de 145 oC, magnitudes adecuadas del contenido de álcalis libre y corrosión al cobre; así como  propiedades antidesgaste y de extrema presión similares a otras grasas minerales y biograsas formuladas con diferentes aceites vegetales. Palabras claves: biograsa, aceite de Jatropha curcas L, jabón de litio, propiedades fisicoquímicas, propiedades antidesgaste, propiedades de extrema presión. Characterization of biogrease based on Jatropha curcas L vegetable oil and Lithium Soap Thickener. Abstract Vegetable oils have a great potential as a base fluid and a substitute for mineral oil in grease formulation, these oils are biodegradable and renewable. In this paper were determined the  physicochemical, antiwear and extreme pressure properties of a biogrease based on Jatropha curcas L vegetable oil and lithium soap thickener using the lubricanting greases standard test methods. The biogrease have a light yellow color, soft and homogeneous texture, a penetration grade NLGI 1, a drop point of 145 oC, appropriate magnitudes of free alkalis and copper corrosion; as well as antiwear and extreme pressure properties similar to the other mineral lubricating grease and formulated biogreases with differents vegetable oils. Key words: biogrease, Jatropha curcas L vegetable oil, lithium soap thickener, physicochemical properties, antiwear properties, extreme pressure properties.

  7. Measurement and modelling of evapotranspiration in three fynbos vegetation types

    CSIR Research Space (South Africa)

    Dzikiti, Sebinasi

    2014-04-01

    Full Text Available sites. In this study we determined water use by 3 fynbos vegetation types growing at 4 different sites, namely: (i) lowland Atlantis Sand Plain fynbos growing on deep sandy soils, (ii) Kogelberg Sandstone fynbos growing in a riparian zone on deep...

  8. Characterization and potential application of pataua vegetable oil in apatite flotation; Caracterizacao e potencial aplicacao do oleo vegetal de pataua na floracao de apatita

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, P.S. de; Mansur, H.S.; Peres, A.E.C., E-mail: eng.priscila.oliveira@gmail.com [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2016-07-01

    The present research characterizes the Pataua palm (Oenocarpus bataua) oil regarding to its fatty acids profile and acidity index, and evaluates its use for apatite flotation. The Pataua oil evaluated is unsaturated e predominantly composed of cis-9-octadecenoic acid (oleic acid). The mineral sample characterization revealed a material composed by a fluoroapatite deficient in fluorine, a possibly result of isomorphic substitution, and with quartz and monazite inclusions. The analysis of the mineral after reagent conditioning, by Fourier Transform Infrared Spectroscopy (FTIR), pointed to the presence of characteristic bands of carbon chains and carboxylate group, suggesting the collector adsorption through the mechanisms of chemisorption and insoluble calcium salts precipitation. Thus, it is proposed the Pataua oil potential use in flotation systems aiming apatite recovery. (author)

  9. Tamarix as habitat for birds: Implications for riparian restoration in the Southwestern United States

    Science.gov (United States)

    Sogge, M.K.; Sferra, S.J.; Paxton, E.H.

    2008-01-01

    Exotic vegetation has become a major habitat component in many ecosystems around the world, sometimes dramatically changing the vegetation community structure and composition. In the southwestern United States, riparian ecosystems are undergoing major changes in part due to the establishment and spread of the exotic Tamarix (saltcedar, tamarisk). There are concerns about the suitability of Tamarix as habitat for birds. Although Tamarix habitats tend to support fewer species and individuals than native habitats, Arizona Breeding Bird Atlas data and Birds of North America accounts show that 49 species use Tamarix as breeding habitat. Importantly, the relative use of Tamarix and its quality as habitat vary substantially by geographic location and bird species. Few studies have examined how breeding in Tamarix actually affects bird survivorship and productivity; recent research on Southwestern Willow Flycatchers has found no negative effects from breeding in Tamarix habitats. Therefore, the ecological benefits and costs of Tamarix control are difficult to predict and are likely to be species specific and site specific. Given the likelihood that high-quality native riparian vegetation will not develop at all Tamarix control sites, restoration projects that remove Tamarix but do not assure replacement by high-quality native habitat have the potential to reduce the net riparian habitat value for some local or regional bird populations. Therefore, an assessment of potential negative impacts is important in deciding if exotic control should be conducted. In addition, measurable project objectives, appropriate control and restoration techniques, and robust monitoring are all critical to effective restoration planning and execution. ?? 2008 Society for Ecological Restoration International.

  10. Effects of metals and arsenic on riparian communities in southwest Montana.

    Science.gov (United States)

    Lejeune, K; Galbraith, H; Lipton, J; Kapustka, L A

    1996-10-01

    : Concentrations of metals and arsenic in floodplain soils of Silver Bow Creek and the upper Clark Fork River in southwest Montana were related to phytotoxic responses by individual plants in laboratory experiments, vegetative community structure and composition in the field and wildlife habitat. Samples collected from barren or very sparsely vegetated mixed mine tailings and alluvium deposits (slickens) in the floodplains along Silver Bow Creek and the Clark Fork River had concentrations of As, Cd, Cu, Pb and Zn that were significantly elevated relative to reference sites. Laboratory phytotoxicity tests demonstrated severe and rapid effects of the elevated concentrations of metals and As on hybrid poplar and standard test species (alfalfa, lettuce and wheat): growth inhibition of hybrid poplars was nearly 100% and of standard test species ≥75%. Vegetation community measurements revealed that slickens have replaced riparian forest, shrub, hay fields and pasture land; in doing so, the slickens have reduced both the compositional and structural heterogeneity of the riparian habitat. This reduction in habitat complexity has reduced the capacity of the area to provide a diversity of suitable wildlife habitat.

  11. Regeneration of Salicaceae riparian forests in the Northern Hemisphere: A new framework and management tool.

    Science.gov (United States)

    González, Eduardo; Martínez-Fernández, Vanesa; Shafroth, Patrick B; Sher, Anna A; Henry, Annie L; Garófano-Gómez, Virginia; Corenblit, Dov

    2018-04-25

    Human activities on floodplains have severely disrupted the regeneration of foundation riparian shrub and tree species of the Salicaceae family (Populus and Salix spp.) throughout the Northern Hemisphere. Restoration ecologists initially tackled this problem from a terrestrial perspective that emphasized planting. More recently, floodplain restoration activities have embraced an aquatic perspective, inspired by the expanding practice of managing river flows to improve river health (environmental flows). However, riparian Salicaceae species occupy floodplain and riparian areas, which lie at the interface of both terrestrial and aquatic ecosystems along watercourses. Thus, their regeneration depends on a complex interaction of hydrologic and geomorphic processes that have shaped key life-cycle requirements for seedling establishment. Ultimately, restoration needs to integrate these concepts to succeed. However, while regeneration of Salicaceae is now reasonably well-understood, the literature reporting restoration actions on Salicaceae regeneration is sparse, and a specific theoretical framework is still missing. Here, we have reviewed 105 peer-reviewed published experiences in restoration of Salicaceae forests, including 91 projects in 10 world regions, to construct a decision tree to inform restoration planning through explicit links between the well-studied biophysical requirements of Salicaceae regeneration and 17 specific restoration actions, the most popular being planting (in 55% of the projects), land contouring (30%), removal of competing vegetation (30%), site selection (26%), and irrigation (24%). We also identified research gaps related to Salicaceae forest restoration and discuss alternative, innovative and feasible approaches that incorporate the human component. Copyright © 2018 Elsevier Ltd. All rights reserved.

  12. Floristic composition of the riparian forest in the lower Gramame river, Paraíba, Brazil

    Directory of Open Access Journals (Sweden)

    Thiago da Silva Farias

    2015-04-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2015v28n3p23 Riparian forest has a key ecological and economic significance to productive chains associated with it. This study aimed to conduct a floristic survey of riparian forest stretches in the Gramame river, state of Paraíba, Brazilian Northeast region, and analyze the floristic similarity with Brazilian riparian vegetation fragments. We found 136 species belonging to 106 genera and 43 families. The most representative families were: Fabaceae (19 spp., Cyperaceae (16 spp., and Rubiaceae (11 spp.. The predominant habit was herbaceous and the best represented biological spectrum was camephyte. Regarding the geographic distribution, there was a predominance of widely distributed species associated with the Neotropical province. The distribution patterns have shown a low similarity between areas, and largely distributed species stand out. Similarity analysis pointed out that the area was floristically related to other two coastal areas in the Brazilian Northeast and Southeast regions. Only species typically related to estuarine environments might explain the floristic connections detected.

  13. Litter Controls Earthworm-Mediated Carbon and Nitrogen Transformations in Soil from Temperate Riparian Buffers

    Directory of Open Access Journals (Sweden)

    Maria Kernecker

    2014-01-01

    Full Text Available Nutrient cycling in riparian buffers is partly influenced by decomposition of crop, grass, and native tree species litter. Nonnative earthworms in riparian soils in southern Quebec are expected to speed the processes of litter decomposition and nitrogen (N mineralization, increasing carbon (C and N losses in gaseous forms or via leachate. A 5-month microcosm experiment evaluated the effect of Aporrectodea turgida on the decomposition of 3 litter types (deciduous leaves, reed canarygrass, and soybean stem residue. Earthworms increased CO2 and N2O losses from microcosms with soybean residue, by 112% and 670%, respectively, but reduced CO2 and N2O fluxes from microcosms with reed canarygrass by 120% and 220%, respectively. Litter type controlled the CO2 flux (soybean ≥ deciduous-mix litter = reed canarygrass > no litter and the N2O flux (soybean ≥ no litter ≥ reed canarygrass > deciduous-mix litter. However, in the presence of earthworms, there was a slight increase in C and N gaseous losses of C and N relative to their losses via leachate, across litter treatments. We conclude that litter type determines the earthworm-mediated decomposition effect, highlighting the importance of vegetation management in controlling C and N losses from riparian buffers to the environment.

  14. Influence of Gully Erosion Control on Amphibian and Reptile Communities within Riparian Zones of Channelized Streams

    Science.gov (United States)

    Riparian zones of streams in northwestern Mississippi have been impacted by agriculture, channelization, channel incision, and gully erosion. Riparian gully formation has resulted in the fragmentation of remnant riparian zones within agricultural watersheds. One widely used conservation practice for...

  15. Flow and transport in Riparian Zones

    DEFF Research Database (Denmark)

    Jensen, Jannick Kolbjørn

    scenarios with changing conditions for flow (steady state with no flooding or transient with flooding), hydrogeology, denitrification rate, and extent of flooding it is demonstrated how flow paths, residence times, and nitrate removal are affected. With this previous conceptual models on the hydrology......The PhD study presents research results from two re-established Danish riparian zones, Brynemade and Skallebanke, located along Odense River on the island Funen, Denmark. The overall objectives of the PhD study have been to improve the understanding of flow and transport in riparian zones....... The methodology focuses on; construction of field sites along Odense River, understanding flow and transport, and performing numerical/analytical model assessments of flow and transport. An initial 2D simulation study was performed with a conceptual setup based on the Brynemade site. Through a series of 2D model...

  16. Prevalence and characterization of extended-spectrum-β-lactamase-producing Escherichia coli and Klebsiella pneumoniae in ready-to-eat vegetables.

    Science.gov (United States)

    Kim, Hong-Seok; Chon, Jung-Whan; Kim, Young-Ji; Kim, Dong-Hyeon; Kim, Mu-sang; Seo, Kun-Ho

    2015-08-17

    The objective of this investigation was to determine the prevalence and characteristics of extended-spectrum-β-lactamase (ESBL)-producing Escherichia coli and Klebsiella pneumoniae in ready-to-eat (RTE) vegetables. A total of 189 RTE vegetable samples (91 sprouts and 98 mixed salads) were collected in a retail market in South Korea from October 2012 to February 2013. The prevalence of ESBL-producing E. coli and K. pneumoniae was 10.1%. Of these, 94.7% were from the sprout samples. All isolates were resistant to cefotaxime, and many of the ESBL producers were also resistant to non-β-lactam antibiotics, including gentamicin, trimethoprim/sulfamethoxazole, and ciprofloxacin (73.7%, 63.2%, and 26.3% respectively). TEM-1, SHV-1, -2, -11, -12, -27, -28 and -61, and CTX-M-14, -15 and -55 β-lactamases were detected alone or in combination. The genetic platforms of all CTX-M producing isolates were ISEcp1-blaCTX-M-orf477 and ISEcp1-blaCTX-M-IS903 in CTX-M groups 1 and 9, respectively. To our knowledge, this is the first report of the prevalence and characterization of ESBL-producing E. coli and K. pneumoniae isolated from RTE vegetables. The results of this study indicate that RTE vegetables, sprouts, in particular, may play a role in spreading antimicrobial resistant bacteria and ESBL genes to humans. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Function, Design, and Establishment of Riparian Forest Buffers: A Review

    OpenAIRE

    Klapproth, Julia Caldwell

    1999-01-01

    Through the interaction of their soils, hydrology, and biotic communities, riparian forests protect and improve water quality, provide habitat for plants and animals, support aquatic communities, and provide many benefits to humans. Virginia, along with other states in the Chesapeake Bay region, has recognized the importance of riparian forests by implementing a plan to restore forested buffers along streams, rivers, and lakes. This project reviews selected literature on riparian forest bu...

  18. Water body and riparian buffer strip characteristics in a vineyard area to support aquatic pesticide exposure assessment.

    Science.gov (United States)

    Ohliger, Renja; Schulz, Ralf

    2010-10-15

    The implementation of a geodata-based probabilistic pesticide exposure assessment for surface waters in Germany offers the opportunity to base the exposure estimation on more differentiated assumptions including detailed landscape characteristics. Since these characteristics can only be estimated using field surveys, water body width and depth, hydrology, riparian buffer strip width, ground vegetation cover, existence of concentrated flow paths, and riparian vegetation were characterised at 104 water body segments in the vineyard region Palatinate (south-west Germany). Water body segments classified as permanent (n=43) had median values of water body width and depth of 0.9m and 0.06m, respectively, and the determined median width:depth ratio was 15. Thus, the deterministic water body model (width=1m; depth=0.3m) assumed in regulatory exposure assessment seems unsuitable for small water bodies in the study area. Only 25% of investigated buffer strips had a dense vegetation cover (>70%) and allow a laminar sheet flow as required to include them as an effective pesticide runoff reduction landscape characteristic. At 77 buffer strips, bordering field paths and erosion rills leading into the water body were present, concentrating pesticide runoff and consequently decreasing buffer strip efficiency. The vegetation type shrubbery (height>1.5m) was present at 57 (29%) investigated riparian buffer strips. According to their median optical vegetation density of 75%, shrubberies may provide a spray drift reduction of 72±29%. Implementing detailed knowledge in an overall assessment revealed that exposure via drift might be 2.4 and via runoff up to 1.6 fold higher than assumed by the deterministic approach. Furthermore, considering vegetated buffer strips only by their width leads to an underestimation of exposure by a factor of as much as four. Our data highlight that the deterministic model assumptions neither represent worst-case nor median values and therefore cannot

  19. Decoupling of dissolved organic matter patterns between stream and riparian groundwater in a headwater forested catchment

    Science.gov (United States)

    Bernal, Susana; Lupon, Anna; Catalán, Núria; Castelar, Sara; Martí, Eugènia

    2018-03-01

    Streams are important sources of carbon to the atmosphere, though knowing whether they merely outgas terrestrially derived carbon dioxide or mineralize terrestrial inputs of dissolved organic matter (DOM) is still a big challenge in ecology. The objective of this study was to investigate the influence of riparian groundwater (GW) and in-stream processes on the temporal pattern of stream DOM concentrations and quality in a forested headwater stream, and whether this influence differed between the leaf litter fall (LLF) period and the remaining part of the year (non-LLF). The spectroscopic indexes (fluorescence index, biological index, humification index, and parallel factor analysis components) indicated that DOM had an eminently protein-like character and was most likely originated from microbial sources and recent biological activity in both stream water and riparian GW. However, paired samples of stream water and riparian GW showed that dissolved organic carbon (DOC) and nitrogen (DON) concentrations as well as the spectroscopic character of DOM differed between the two compartments throughout the year. A simple mass balance approach indicated that in-stream processes along the reach contributed to reducing DOC and DON fluxes by 50 and 30 %, respectively. Further, in-stream DOC and DON uptakes were unrelated to each other, suggesting that these two compounds underwent different biogeochemical pathways. During the LLF period, stream DOC and DOC : DON ratios were higher than during the non-LLF period, and spectroscopic indexes suggested a major influence of terrestrial vegetation on stream DOM. Our study highlights that stream DOM is not merely a reflection of riparian GW entering the stream and that headwater streams have the capacity to internally produce, transform, and consume DOM.

  20. Revisiting restored river reaches - Assessing change of aquatic and riparian communities after five years.

    Science.gov (United States)

    Lorenz, Armin W; Haase, Peter; Januschke, Kathrin; Sundermann, Andrea; Hering, Daniel

    2018-02-01

    Hydromorphological restructuring of river sections, i.e. river restoration measures, often has little effects on aquatic biota, even in case of strong habitat alterations. It is often supposed that the biotic response is simply delayed as species require additional time to recolonize the newly generated habitats and to establish populations. To identify and specify the supposed lag time between restoration and biotic response, we investigated 19 restored river reaches twice in a five-year interval. The sites were restored one to ten years prior to the first sampling. We sampled three aquatic (fish, benthic invertebrates, macrophytes) and two riparian organism groups (ground beetles and riparian vegetation) and analyzed changes in assemblage composition and biotic metrics. With the exception of ground beetle assemblages, we observed no significant changes in richness and abundance metrics or metrics used for biological assessment. However, indicator taxa for near-natural habitat conditions in the riparian zone (indicators for regular inundation in plants and river bank specialists in beetles) improved significantly in the five-year interval. Contrary to general expectations in river restoration planning, we neither observed a distinct succession of aquatic communities nor a general trend towards "good ecological status" over time. Furthermore, multiple linear regression models revealed that neither the time since restoration nor the morphological status had a significant effect on the biological metrics and the assessment results. Thus, the stability of aquatic assemblages is strong, slowing down restoration effects in the aquatic zone, while riparian assemblages improve more rapidly. When defining restoration targets, the different timelines for ecological recovery after restoration should be taken into account. Furthermore, restoration measures should not solely focus on local habitat conditions but also target stressors acting on larger spatial scales and take

  1. Effects of dams and geomorphic context on riparian forests of the Elwha River, Washington

    Science.gov (United States)

    Shafroth, Patrick B.; Perry, Laura G; Rose, Chanoane A; Braatne, Jeffrey H

    2016-01-01

    Understanding how dams affect the shifting habitat mosaic of river bottomlands is key for protecting the many ecological functions and related goods and services that riparian forests provide and for informing approaches to riparian ecosystem restoration. We examined the downstream effects of two large dams on patterns of forest composition, structure, and dynamics within different geomorphic contexts and compared them to upstream reference conditions along the Elwha River, Washington, USA. Patterns of riparian vegetation in river segments downstream of the dams were driven largely by channel and bottomland geomorphic responses to a dramatically reduced sediment supply. The river segment upstream of both dams was the most geomorphically dynamic, whereas the segment between the dams was the least dynamic due to substantial channel armoring, and the segment downstream of both dams was intermediate due to some local sediment supply. These geomorphic differences were linked to altered characteristics of the shifting habitat mosaic, including older forest age structure and fewer young Populus balsamifera subsp. trichocarpa stands in the relatively static segment between the dams compared to more extensive early-successional forests (dominated by Alnus rubra and Salix spp.) and pioneer seedling recruitment upstream of the dams. Species composition of later-successional forest communities varied among river segments as well, with greater Pseudotsuga menziesii and Tsuga heterophylla abundance upstream of both dams, Acer spp. abundance between the dams, and P. balsamifera subsp. trichocarpa and Thuja plicata abundance below both dams. Riparian forest responses to the recent removal of the two dams on the Elwha River will depend largely on channel and geomorphic adjustments to the release, transport, and deposition of the large volume of sediment formerly stored in the reservoirs, together with changes in large wood dynamics.

  2. Effectiveness monitoring for the aquatic and riparian component of the Northwest Forest Plan: conceptual framework and options.

    Science.gov (United States)

    Gordon H. Reeves; David B. Hohler; David P. Larsen; David E. Busch; Kim Kratz; Keith Reynolds; Karl F. Stein; Thomas Atzet; Polly Hays; Michael. Tehan

    2004-01-01

    An Aquatic and Riparian Effectiveness Monitoring Plan (AREMP) for the Northwest Forest Plan is intended to characterize the ecological condition of watersheds and aquatic ecosystems. So to determine the effectiveness of the Northwest Forest Plan to meet relevant objectives, this report presents the conceptual foundation of options for use in pilot testing and...

  3. SHRUBBY TREE COMPONENT OF RIPARIAN CORRIDORS IN RESTORATION AND NATURAL REMAINING AREAS OF MATRIX FORESTRY, RIO NEGRINHO, SC STATE

    Directory of Open Access Journals (Sweden)

    Eliziane Carla Scariot

    2014-06-01

    Full Text Available http://dx.doi.org/10.5902/1980509814578The aim of this study was to analyze the shrubby tree component in riparian corridors in restoration process and natural remainders in a matrix forestry. We identified the richness, diversity, dispersal and pollination syndromes of the individuals and estimate the floristic similarity. The study was conducted at the producing farm of Pinus spp. wood Santa Alice, located in Rio Negrinho city, Santa Catarina state, Brazil. We adopted the center-quarter method for survey the shrubby tree component in four sample groups: CA (advanced stage of riparian corridors vegetation, CR (riparian corridors in restoration, MA (advanced stage of natural remaining, MI (intermediate stage of natural remaining. We found the highest richness and diversity index in MA and CR. Regarding the number of individuals, the dispersal and pollination syndromes predominant in all sample groups were zoochory and zoophilia. CR and CA had the highest percentage of floristic similarity while MA and MI did not form clusters. The sample group CR has composition, richness and diversity more similar to CA. This indicates that the restoration of riparian zones has conditions to rescue the components and the interactions of an ecological community.

  4. Denitrification potential of riparian soils in relation to multiscale spatial environmental factors: a case study of a typical watershed, China.

    Science.gov (United States)

    Wei, Jianbing; Feng, Hao; Cheng, Quanguo; Gao, Shiqian; Liu, Haiyan

    2017-02-01

    The objective of this study was to test the hypothesis that environmental regulators of riparian zone soil denitrification potential differ according to spatial scale within a watershed; consequently, a second objective was to provide spatial strategies for conserving and restoring the purification function of runoff in riparian ecosystems. The results show that soil denitrification in riparian zones was more heterogeneous at the profile scale than at the cross-section and landscape scales. At the profile scale, biogeochemical factors (including soil total organic carbon, total nitrogen, and nitrate-nitrogen) were the major direct regulators of the spatial distribution of soil denitrification enzyme activity (DEA). At the cross-section scale, factors included distance from river bank and vegetation density, while landscape-scale factors, including topographic index, elevation, and land use types, indirectly regulated the spatial distribution of DEA. At the profile scale, soil DEA was greatest in the upper soil layers. At the cross-section scale, maximum soil DEA occurred in the mid-part of the riparian zone. At the landscape scale, soil DEA showed an increasing trend towards downstream sites, except for those in urbanized areas.

  5. Use of novel DNA fingerprinting techniques for the detection and characterization of genetic variation in vegetatively propagated crops. Proceedings of a final research co-ordination meeting

    International Nuclear Information System (INIS)

    1998-10-01

    Vegetative propagated crops, such as banana and platain, sweet potato, yam, sugarcane and cassava, represent important sources of food in the developing countries. Although some of these crops may produce seeds, they must for practical purposes be propagated vegetatively. As normal plant breeding strategies based on genetic hybridization are of limited value or not applicable to such crops, it is necessary to assess the genetic diversity already existing in these crops and to design breeding strategies accordingly. If the existing genetic variation is shown to be too narrow for breeding purposes, one promising possibility for the introduction of genetic variability is the use of mutations induced by radiation or chemical mutagens. This CRP focused on: the detection of genetic diversity induced by mutagenic treatment or in vitro culture; the development of crop-specific markers; and increasing co-operation between molecular biologists in advanced laboratories and plant breeders and molecular biologists in the developing countries. The success of this CRP is evidenced by the introduction and application of new molecular methods by laboratories in developing countries, specially for the analysis of local crop genetic diversity. These exciting preliminary results show the potential for applications in crop improvement but much work remains to be done. Many of the vegetatively propagated species are ''orphan crops'', under-investigated on the international level. The development of new uses of transgenesis for the development of edible vaccines should not be overlooked. The challenge that remains is in the application of these new tools for practical end-user oriented improvements in vegetatively propagated crops. The present publication summarizes the third and final Research Co-ordination Meeting on the Use of Novel DNA Fingerprinting Techniques for the Detection and Characterization of Genetic Variation in Vegetatively Propagated Crops

  6. Use of novel DNA fingerprinting techniques for the detection and characterization of genetic variation in vegetatively propagated crops. Proceedings of a final research co-ordination meeting

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-10-01

    Vegetative propagated crops, such as banana and platain, sweet potato, yam, sugarcane and cassava, represent important sources of food in the developing countries. Although some of these crops may produce seeds, they must for practical purposes be propagated vegetatively. As normal plant breeding strategies based on genetic hybridization are of limited value or not applicable to such crops, it is necessary to assess the genetic diversity already existing in these crops and to design breeding strategies accordingly. If the existing genetic variation is shown to be too narrow for breeding purposes, one promising possibility for the introduction of genetic variability is the use of mutations induced by radiation or chemical mutagens. This CRP focused on: the detection of genetic diversity induced by mutagenic treatment or in vitro culture; the development of crop-specific markers; and increasing co-operation between molecular biologists in advanced laboratories and plant breeders and molecular biologists in the developing countries. The success of this CRP is evidenced by the introduction and application of new molecular methods by laboratories in developing countries, specially for the analysis of local crop genetic diversity. These exciting preliminary results show the potential for applications in crop improvement but much work remains to be done. Many of the vegetatively propagated species are ``orphan crops``, under-investigated on the international level. The development of new uses of transgenesis for the development of edible vaccines should not be overlooked. The challenge that remains is in the application of these new tools for practical end-user oriented improvements in vegetatively propagated crops. The present publication summarizes the third and final Research Co-ordination Meeting on the Use of Novel DNA Fingerprinting Techniques for the Detection and Characterization of Genetic Variation in Vegetatively Propagated Crops Refs, figs, tabs

  7. Vegetation and soils

    Science.gov (United States)

    Burke, M.K.; King, S.L.; Eisenbies, M.H.; Gartner, D.

    2000-01-01

    Intro paragraph: Characterization of bottomland hardwood vegetation in relatively undisturbed forests can provide critical information for developing effective wetland creation and restoration techniques and for assessing the impacts of management and development. Classification is a useful technique in characterizing vegetation because it summarizes complex data sets, assists in hypothesis generation about factors influencing community variation, and helps refine models of community structure. Hierarchical classification of communities is particularly useful for showing relationships among samples (Gauche 1982).

  8. Characterization and classification of vegetation canopy structure and distribution within the Great Smoky Mountains National Park using LiDAR

    Science.gov (United States)

    Jitendra Kumar; Jon Weiner; William W. Hargrove; Steve Norman; Forrest M. Hoffman; Doug Newcomb

    2016-01-01

    Vegetation canopy structure is a critically important habitat characteristic for many threatened and endangered birds and other animal species, and it is key information needed by forest and wildlife managers for monitoring and managing forest resources, conservation planning and fostering biodiversity. Advances in Light Detection and Ranging (LiDAR) technologies have...

  9. Occurrence and characterization of food-borne pathogens isolated from fruit, vegetables and sprouts retailed in the Czech Republic.

    Science.gov (United States)

    Vojkovská, Hana; Myšková, Petra; Gelbíčová, Tereza; Skočková, Alena; Koláčková, Ivana; Karpíšková, Renáta

    2017-05-01

    Food of non-animal origin is a major component of the human diet and has been considered to pose a low risk from the point of view of bacteriological safety. However, an increase in the number of outbreaks of illness caused by such pathogens and linked to the consumption of fresh fruit and vegetables have been reported from around the world recently. Salmonella spp., STEC (Shiga toxin producing Escherichia coli) and Listeria monocytogenes are among the most frequently identified agents. Additionally, the transmission of antibiotic resistant strains including also the methicillin resistant S. aureus (MRSA) to humans via the food chain is one of the greatest public health problems being confronted today. Therefore, we focused on the bacterial safety of fruit, vegetables and sprouts on sale in the Czech Republic. One strain (0.3%) of Salmonella Enteritidis phage type PT8, one strain (0.3%) of MRSA and 17 strains (5.0%) of L. monocytogenes were isolated from a total of 339 collected samples. The most problematic commodities were frozen fruit and vegetables (packed and unpacked) and fresh-cut vegetables. Our findings indicate deficiencies in hygiene practices during harvesting, processing and distribution of these commodities. Although sprouts and berries are the most likely to be contaminated by human pathogens, only two samples were positive for the presence of L. monocytogenes. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Phosphorus retention in riparian buffers: review of their efficiency.

    Science.gov (United States)

    Hoffmann, Carl Christian; Kjaergaard, Charlotte; Uusi-Kämppä, Jaana; Hansen, Hans Christian Bruun; Kronvang, Brian

    2009-01-01

    Ground water and surface water interactions are of fundamental importance for the biogeochemical processes governing phosphorus (P) dynamics in riparian buffers. The four most important conceptual hydrological pathways for P losses from and P retention in riparian buffers are reviewed in this paper: (i) The diffuse flow path with ground water flow through the riparian aquifer, (ii) the overland flow path across the riparian buffer with water coming from adjacent agricultural fields, (iii) irrigation of the riparian buffer with tile drainage water from agricultural fields where disconnected tile drains irrigate the riparian buffer, and (iv) inundation of the riparian buffer (floodplain) with river water during short or longer periods. We have examined how the different flow paths in the riparian buffer influence P retention mechanisms theoretically and from empirical evidence. The different hydrological flow paths determine where and how water-borne P compounds meet and interact with iron and aluminum oxides or other minerals in the geochemical cycling of P in the complex and dynamic environment that constitutes a riparian buffer. The main physical process in the riparian buffer-sedimentation-is active along several flow paths and may account for P retention rates of up to 128 kg P ha(-1) yr(-1), while plant uptake may temporarily immobilize up to 15 kg P ha(-1) yr(-1). Retention of dissolved P in riparian buffers is not as pronounced as retention of particulate P and is often below 0.5 kg P ha(-1) yr(-1). Several studies show significant release of dissolved P (i.e., up to 8 kg P ha(-1) yr(-1)).

  11. Water table monitoring in a mined riparian zone

    Directory of Open Access Journals (Sweden)

    Thomaz Marques Cordeiro Andrade

    2010-04-01

    Full Text Available The objective of this study was to test an easily fabricated tool that assist in the manual installation of piezometers, as well as water table monitor in the research site, located at the Gualaxo do Norte River Watershed, state of Minas Gerais, Brazil. The tool is made of iron pipes and is a low-cost alternative for shallow groundwater observation wells. The measurements were done in a riparian zone after being gold mined, when vegetation and upper soil layers were removed. The wells were installed in three areas following a transect from the river bank. The method was viable for digging up to its maximum depth of 3 meters in a low resistance soil and can be improved to achieve a better resistance over impact and its maximum depth of perforation. Water table levels varied distinctly according to its depth in each point. It varies most in the more shallow wells in different areas, while it was more stable in the deeper ones. The water table profile reflected the probably profile f the terrain and can be a reference for its leveling in reconstitution of degraded banks where upper layers of the soil were removed. Groundwater monitoring can be also an indicator of the suitability of the substrate for soil reconstitution in terms of the maintenance of an infiltration capacity similar to the original material.

  12. Demographic histories of adaptively diverged riparian and non-riparian species of Ainsliaea (Asteraceae) inferred from coalescent analyses using multiple nuclear loci.

    Science.gov (United States)

    Mitsui, Yuki; Setoguchi, Hiroaki

    2012-12-28

    Understanding demographic histories, such as divergence time, patterns of gene flow, and population size changes, in ecologically diverging lineages provide implications for the process and maintenance of population differentiation by ecological adaptation. This study addressed the demographic histories in two independently derived lineages of flood-resistant riparian plants and their non-riparian relatives [Ainsliaea linearis (riparian) and A. apiculata (non-riparian); A. oblonga (riparian) and A. macroclinidioides (non-riparian); Asteraceae] using an isolation-with-migration (IM) model based on variation at 10 nuclear DNA loci. The highest posterior probabilities of the divergence time parameters were estimated to be ca. 25,000 years ago for A. linearis and A. apiculata and ca. 9000 years ago for A. oblonga and A. macroclinidioides, although the confidence intervals of the parameters had broad ranges. The likelihood ratio tests detected evidence of historical gene flow between both riparian/non-riparian species pairs. The riparian populations showed lower levels of genetic diversity and a significant reduction in effective population sizes compared to the non-riparian populations and their ancestral populations. This study showed the recent origins of flood-resistant riparian plants, which are remarkable examples of plant ecological adaptation. The recent divergence and genetic signatures of historical gene flow among riparian/non-riparian species implied that they underwent morphological and ecological differentiation within short evolutionary timescales and have maintained their species boundaries in the face of gene flow. Comparative analyses of adaptive divergence in two sets of riparian/non-riparian lineages suggested that strong natural selection by flooding had frequently reduced the genetic diversity and size of riparian populations through genetic drift, possibly leading to fixation of adaptive traits in riparian populations. The two sets of riparian/non-riparian

  13. Riparian ecosystems and buffers - multiscale structure, function, and management: introduction

    Science.gov (United States)

    Kathleen A. Dwire; Richard R. Lowrance

    2006-01-01

    Given the importance of issues related to improved understanding and management of riparian ecosystems and buffers, the American Water Resources Association (AWRA) sponsored a Summer Specialty Conference in June 2004 at Olympic Valley, California, entitled 'Riparian Ecosystems and Buffers: Multiscale Structure, Function, and Management.' The primary objective...

  14. A framework for profiling a lake's riparian area development potential

    Science.gov (United States)

    Pamela J. Jakes; Ciara Schlichting; Dorothy H. Anderson

    2003-01-01

    Some of the greatest challenges for managing residential development occur at the interface between the terrestrial and aquatic ecosystems -in a lake`s riparian area. Land use planners need a framework they can use to identify development hotspots, areas were the next push for development will most likely occur. Lake riparian development profiles provide a framework...

  15. SNAG AND LARGE WOODY DEBRIS DYNAMICS IN RIPARIAN FORESTS

    Science.gov (United States)

    Important components of riparian forests are snags and streamside large woody debris (LWD) because they are functional in maintaining water quality and providing habitat for numerous plants and animals. To effectively manage riparian forests, it is important to understand the dy...

  16. Riparian adaptive management symposium: a conversation between scientists and management

    Science.gov (United States)

    Douglas F. Ryan; John M. Calhoun

    2010-01-01

    Scientists, land managers and policy makers discussed whether riparian (stream side) forest management and policy for state, federal and private lands in western Washington are consistent with current science. Answers were mixed: some aspects of riparian policy and management have a strong basis in current science, while other aspects may not. Participants agreed that...

  17. Concentrated flow paths in riparian buffer zones of southern Illinois

    Science.gov (United States)

    R.C. Pankau; J.E. Schoonover; K.W.J. Willard; P.J. Edwards

    2012-01-01

    Riparian buffers in agricultural landscapes should be designed to trap pollutants in overland flow by slowing, filtering, and infiltrating surface runoff entering the buffer via sheet flow. However, observational evidence suggests that concentrated flow is prevalent from agricultural fields. Over time sediment can accumulate in riparian buffers forming berms that...

  18. Riparian forests, a unique but endangered ecosystem in Benin

    NARCIS (Netherlands)

    Natta, A.K.; Sinsin, B.; Maesen, van der L.J.G.

    2002-01-01

    Riparian forests are often small in area, but are of extreme ecological and economic value for local people. The interest of riparian forests lies in their resources: basically fertile and moist soils, water, wood and non-timber forest products that are utilised by neighbouring populations to

  19. Characterization of nonstarch polysaccharides content from different edible organs of some vegetables, determined by GC and HPLC: comparative study.

    Science.gov (United States)

    Villanueva-Suárez, M J; Redondo-Cuenca, A; Rodríguez-Sevilla, M D; de las Heras Martínez, M

    2003-09-24

    Content and composition of dietary fiber as nonstarch polysaccharides (NSP) was determined in vegetables belonging to different types of edible organs, using GC and HPLC. Samples analyzed were subterranean organs (radish and leek), leaves (celery, swiss chard, and lettuce), stalks (celery, swiss chard, and asparagus), inflorescence (broccoli), and fruits (tomato, green pepper, and marrow). The results indicate that though the monomeric profile is similar in all these samples quantitative differences were found for neutral sugars and uronic acids among samples of the same type of vegetal organ. The NSP values determined using CG method were in good agreement with HPLC method (R(2) = 0.9005). However, arabinose, mannose, and galactose plus rhamnose are more influenced by the analytical method used than the rest of the monomers in nearly all the samples analyzed. Final values of NSP depend on the method used in celery stalks, broccoli, and green pepper.

  20. Instantaneous characterization of vegetable oils via TAG and FFA profiles by easy ambient sonic-spray ionization mass spectrometry.

    Science.gov (United States)

    Simas, Rosineide C; Catharino, Rodrigo R; Cunha, Ildenize B S; Cabral, Elaine C; Barrera-Arellano, Daniel; Eberlin, Marcos N; Alberici, Rosana M

    2010-04-01

    A fast and reliable method is presented for the analysis of vegetable oils. Easy ambient sonic-spray ionization mass spectrometry (EASI-MS) is shown to efficiently desorb and ionize the main oil constituents from an inert surface under ambient conditions and to provide comprehensive triacylglyceride (TAG) and free fatty acid (FFA) profiles detected mainly as either [TAG + Na](+) or [FFA-H](-) ions. EASI(+/-)-MS analysis is simple, easily implemented, requires just a tiny droplet of the oil and is performed without any pre-separation or chemical manipulation. It also causes no fragmentation of TAG ions hence diacylglyceride (DAG) and monoacylglyceride (MAG) profiles and contents can also be measured. The EASI(+/-)-MS profiles of TAG and FFA permit authentication and quality control and can be used, for instance, to access levels of adulteration, acidity, oxidation or hydrolysis of vegetable oils in general.

  1. Coupled hydrological, ecological, decision and economic models for monetary valuation of riparian ecosystem services

    Science.gov (United States)

    Goodrich, D. C.; Brookshire, D.; Broadbent, C.; Dixon, M. D.; Brand, L. A.; Thacher, J.; Benedict, K. K.; Lansey, K. E.; Stromberg, J. C.; Stewart, S.; McIntosh, M.

    2011-12-01

    Water is a critical component for sustaining both natural and human systems. Yet the value of water for sustaining ecosystem services is not well quantified in monetary terms. Ideally decisions involving water resource management would include an apples-to-apples comparison of the costs and benefits in dollars of both market and non-market goods and services - human and ecosystem. To quantify the value of non-market ecosystem services, scientifically defensible relationships must be developed that link the effect of a decision (e.g. human growth) to the change in ecosystem attributes from current conditions. It is this linkage that requires the "poly-disciplinary" coupling of knowledge and models from the behavioral, physical, and ecological sciences. In our experience another key component of making this successful linkage is development of a strong poly-disciplinary scientific team that can readily communicate complex disciplinary knowledge to non-specialists outside their own discipline. The time to build such a team that communicates well and has a strong sense of trust should not be underestimated. The research described in the presentation incorporated hydrologic, vegetation, avian, economic, and decision models into an integrated framework to determine the value of changes in ecological systems that result from changes in human water use. We developed a hydro-bio-economic framework for the San Pedro River Region in Arizona that considers groundwater, stream flow, and riparian vegetation, as well as abundance, diversity, and distribution of birds. In addition, we developed a similar framework for the Middle Rio Grande of New Mexico. There are six research components for this project: (1) decision support and scenario specification, (2) regional groundwater model, (3) the riparian vegetation model, (4) the avian model, (5) methods for displaying the information gradients in the valuation survey instruments (Choice Modeling and Contingent Valuation), and (6

  2. Instantaneous Characterization Of Vegetable Oils Via Tag And Ffa Profiles By Easy Ambient Sonic-spray Ionization Mass Spectrometry.

    OpenAIRE

    Simas, Rosineide C; Catharino, Rodrigo R; Cunha, Ildenize B S; Cabral, Elaine C; Barrera-Arellano, Daniel; Eberlin, Marcos N; Alberici, Rosana M

    2015-01-01

    A fast and reliable method is presented for the analysis of vegetable oils. Easy ambient sonic-spray ionization mass spectrometry (EASI-MS) is shown to efficiently desorb and ionize the main oil constituents from an inert surface under ambient conditions and to provide comprehensive triacylglyceride (TAG) and free fatty acid (FFA) profiles detected mainly as either [TAG + Na](+) or [FFA-H](-) ions. EASI(+/-)-MS analysis is simple, easily implemented, requires just a tiny droplet of the oil an...

  3. Riparian restoration in the context of Tamarix control in the western United States: Chapter 23

    Science.gov (United States)

    Shafroth, Patrick B.; Merritt, David M.; Briggs, Mark K.; Beauchamp, Vanessa B.; Lair, Kenneth D.; Scott, Michael L.; Sher, Anna; Sher, Anna; Quigley, Martin F.

    2013-01-01

    This chapter focuses on the restoration of riparian systems in the context of Tamarix control—that is, Tamarix-dominated sites are converted to a replacement vegetation type that achieves specific management goals and helps return parts of the system to a desired and more natural state or dynamic. It reviews research related to restoring native riparian vegetation following tamarix control or removal. The chapter begins with an overview of objective setting and the planning of tamarix control and proceeds by emphasizing the importance of considering site-specific factors and of context in selecting and prioritizing sites for restoration. In particular, it considers valley and bottomland geomorphology, along with river flow regime and associated fluvial disturbance, surface water and groundwater availability, and soil salinity and texture. The chapter concludes with a discussion of costs and benefits associated with active, passive, and combined ecological restoration approaches, as well as the key issues to consider in carrying out restoration projects at a range of scales.

  4. Distributions, abundances and activities of microbes associated with the nitrogen cycle in riparian and stream sediments of a river tributary.

    Science.gov (United States)

    Kim, Haryun; Bae, Hee-Sung; Reddy, K Ramesh; Ogram, Andrew

    2016-12-01

    River tributaries are ecologically important environments that function as sinks of inorganic nitrogen. To gain greater insight into the nitrogen cycle (N-cycle) in these environments, the distributions and activities of microbial populations involved in the N-cycle were studied in riparian and stream sediments of the Santa Fe River (SFR) tributaries located in northern Florida, USA. Riparian sediments were characterized by much higher organic matter content, and extracellular enzyme activities, including cellobiohydrolase, β-d-glucosidase, and phenol oxidase than stream sediments. Compared with stream sediments, riparian sediments exhibited significantly higher activities of nitrification, denitrification, dissimilatory nitrate reduction to ammonia (DNRA) and anaerobic ammonia oxidation; correspondingly, with higher copies of amoA (a biomarker for enumerating nitrifiers), nirS and nirK (for denitrifiers), and nrfA (for DNRA bacteria). Among N-cycle processes, denitrification showed the highest activities and the highest concentrations of the corresponding gene (nirK and nirS) copy numbers. In riparian sediments, substantial nitrification activities (6.3 mg-N kg soil -1 d -1 average) and numbers of amoA copies (7.3 × 10 7  copies g soil -1 average) were observed, and nitrification rates correlate with denitrification rates. The guild structures of denitrifiers and nitrifiers in riparian sediments differed significantly from those found in stream sediments, as revealed by analysis of nirS and archaeal amoA sequences. This study shows that riparian sediments serve as sinks for inorganic nitrogen loads from non-point sources of agricultural runoff, with nitrification and denitrification associated with elevated levels of carbon and nitrogen contents and extracellular enzyme activities. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Spatial and temporal variation In streamside herbaceous vegetation of the Upper Verde River: 1996-2001 [Chapter 7

    Science.gov (United States)

    Alvin L. Medina; Jonathan W. Long

    2012-01-01

    Streamside environments are inherently dynamic, yet streamside vegetation plays a key stabilizing role on riparian and aquatic habitats (Van Devender and Spaulding 1979; Van Devender and others 1987). Because of its dynamism, streamside vegetation is rarely the subject of classification analyses, yet it is a focal point for land managers regulating land uses, such as...

  6. Spatial Structure of Soil Macrofauna Diversity and Tree Canopy in Riparian Forest of Maroon River

    Directory of Open Access Journals (Sweden)

    Ehsan Sayad

    2017-02-01

    Full Text Available Introduction: Sustainability and maintenance of riparian vegetation or restoring of degraded sites is critical to sustain inherent ecosystem function and values. Description of patterns in species assemblages and diversity is an essential step before generating hypotheses in functional ecology. If we want to have information about ecosystem function, soil biodiversity is best considered by focusing on the groups of soil organisms that play major roles in ecosystem functioning when exploring links with provision of ecosystem services. Information about the spatial pattern of soil biodiversity at the regional scale is limited though required, e.g. for understanding regional scale effects of biodiversity on ecosystem processes. The practical consequences of these findings are useful for sustainable management of soils and in monitoring soil quality. Soil macrofauna play significant, but largely ignored roles in the delivery of ecosystem services by soils at plot and landscape scales. One main reason responsible for the absence of information about biodiversity at regional scale is the lack of adequate methods for sampling and analyzing data at this dimension. An adequate approach for the analysis of spatial patterns is a transect study in which samples are taken in a certain order and with a certain distance between samples. Geostatistics provide descriptive tools such as variogram to characterize the spatial pattern of continuous and categorical soil attributes. This method allows assessment of consistency of spatial patterns as well as the scale at which they are expressed. This study was conducted to analyze spatial patterns of soil macrofauna in relation to tree canopy in the riparian forest landscape of Maroon. Materilas and Methods: The study was carried out in the Maroon riparian forest of the southeasternIran (30o 38/- 30 o 39/ N and 50 o 9/- 50 o 10/ E. The climate of the study area is semi-arid. Average yearly rainfall is about 350.04 mm

  7. Small scale denitrification variability in riparian zones: Results from a high-resolution dataset

    Science.gov (United States)

    Gassen, Niklas; Knöller, Kay; Musolff, Andreas; Popp, Felix; Lüders, Tillmann; Stumpp, Christine

    2017-04-01

    Riparian zones are important compartments at the interface between groundwater and surface water where biogeochemical processes like denitrification are often enhanced. Nitrate loads of either groundwater entering a stream through the riparian zone or streamwater infiltrating into the riparian zone can be substantially reduced. These processes are spatially and temporally highly variable, making it difficult to capture solute variabilities, estimate realistic turnover rates and thus to quantify integral mass removal. A crucial step towards a more detailed characterization is to monitor solutes on a scale which adequately resemble the highly heterogeneous distribution and on a scale where processes occur. We measured biogeochemical parameters in a spatial high resolution within a riparian corridor of a German lowland river system over the course of one year. Samples were taken from three newly developed high-resolution multi-level wells with a maximum vertical resolution of 5 cm and analyzed for major ions, DOC and N-O isotopes. Sediment derived during installation of the wells was analyzed for specific denitrifying enzymes. Results showed a distinct depth zonation of hydrochemistry within the shallow alluvial aquifer, with a 1 m thick zone just below the water table with lower nitrate concentrations and EC values similar to the nearby river. Conservative parameters were consistent inbetween the three wells, but nitrate was highly variable. In addition, spots with low nitrate concentrations showed isotopic and microbial evidence for higher denitrification activities. The depth zonation was observed throughout the year, with stronger temporal variations of nitrate concentrations just below the water table compared to deeper layers. Nitrate isotopes showed a clear seasonal trend of denitrification activities (high in summer, low in winter). Our dataset gives new insight into river-groundwater exchange processes and shows the highly heterogeneous distribution of

  8. Adaptation of the QBR index for use in riparian forests of central Ohio

    Science.gov (United States)

    Stephanie R. Colwell; David M. Hix

    2008-01-01

    Although high quality riparian forests are an endangered ecosystem type throughout the world, there has been no ecological index to measure the habitat quality of riparian forests in Ohio. The QBR (qualitat del bosc de ribera, or riparian forest quality) index was developed to assess the quality of habitat in Mediterranean forested riparian areas, and we have modified...

  9. Impacts of an invasive snail (Tarebia granifera) on nutrient cycling in tropical streams: the role of riparian deforestation in Trinidad, West Indies.

    Science.gov (United States)

    Moslemi, Jennifer M; Snider, Sunny B; Macneill, Keeley; Gilliam, James F; Flecker, Alexander S

    2012-01-01

    Non-native species and habitat degradation are two major catalysts of environmental change and often occur simultaneously. In freshwater systems, degradation of adjacent terrestrial vegetation may facilitate introduced species by altering resource availability. Here we examine how the presence of intact riparian cover influences the impact of an invasive herbivorous snail, Tarebia granifera, on nitrogen (N) cycling in aquatic systems on the island of Trinidad. We quantified snail biomass, growth, and N excretion in locations where riparian vegetation was present or removed to determine how snail demographics and excretion were related to the condition of the riparian zone. In three Neotropical streams, we measured snail biomass and N excretion in open and closed canopy habitats to generate estimates of mass- and area-specific N excretion rates. Snail biomass was 2 to 8 times greater and areal N excretion rates ranged from 3 to 9 times greater in open canopy habitats. Snails foraging in open canopy habitat also had access to more abundant food resources and exhibited greater growth and mass-specific N excretion rates. Estimates of ecosystem N demand indicated that snail N excretion in fully closed, partially closed, and open canopy habitats supplied 2%, 11%, and 16% of integrated ecosystem N demand, respectively. We conclude that human-mediated riparian canopy loss can generate hotspots of snail biomass, growth, and N excretion along tropical stream networks, altering the impacts of an invasive snail on the biogeochemical cycling of N.

  10. Spectral discrimination of giant reed (Arundo donax L.): A seasonal study in riparian areas

    Science.gov (United States)

    Fernandes, Maria Rosário; Aguiar, Francisca C.; Silva, João M. N.; Ferreira, Maria Teresa; Pereira, José M. C.

    2013-06-01

    The giant reed (Arundo donax L.) is amongst the one hundred worst invasive alien species of the world, and it is responsible for biodiversity loss and failure of ecosystem functions in riparian habitats. In this work, field spectroradiometry was used to assess the spectral separability of the giant reed from the adjacent vegetation and from the common reed, a native similar species. The study was conducted at different phenological periods and also for the giant reed stands regenerated after mechanical cutting (giant reed_RAC). A hierarchical procedure using Kruskal-Wallis test followed by Classification and Regression Trees (CART) was used to select the minimum number of optimal bands that discriminate the giant reed from the adjacent vegetation. A new approach was used to identify sets of wavelengths - wavezones - that maximize the spectral separability beyond the minimum number of optimal bands. Jeffries Matusita and Bhattacharya distance were used to evaluate the spectral separability using the minimum optimal bands and in three simulated satellite images, namely Landsat, IKONOS and SPOT. Giant reed was spectrally separable from the adjacent vegetation, both at the vegetative and the senescent period, exception made to the common reed at the vegetative period. The red edge region was repeatedly selected, although the visible region was also important to separate the giant reed from the herbaceous vegetation and the mid infrared region to the discrimination from the woody vegetation. The highest separability was obtained for the giant reed_RAC stands, due to its highly homogeneous, dense and dark-green stands. Results are discussed by relating the phenological, morphological and structural features of the giant reed stands and the adjacent vegetation with their optical traits. Weaknesses and strengths of the giant reed spectral discrimination are highlighted and implications of imagery selection for mapping purposes are argued based on present results.

  11. Production and characterization of a functional Iranian white brined cheese by replacement of dairy fat with vegetable oils.

    Science.gov (United States)

    Achachlouei, B Fathi; Hesari, J; Damirchi, S Azadmard; Peighambardoust, Sh; Esmaiili, M; Alijani, S

    2013-10-01

    Full-fat cheese usually contains high amounts of saturated fatty acids and cholesterol, which may have negative health effects. In this study, full-fat white brined cheese, as a control sample, and experimental cheeses with olive and canola oils (T1, white brined cheese containing 50% canola oil, T2, white brined cheese containing 50% olive oil, T3, white brined cheese containing 100% canola oil and T4, white brined cheese containing 100% olive oil) were prepared from bovine milk. Physicochemical properties, lipolysis, proteolysis patterns and sensorial properties in the prepared samples were determined during 80 days of storage at 20-day intervals. Cheese incorporating vegetable oils showed lower amounts of saturated fatty acids and higher amounts of unsaturated fatty acids compared with the full-fat cheese (control) samples. Moisture, pH, lipolysis value, as assessed by the acid-degree value, and proteolysis values (pH 4.6 SN/TN% and NPN/TN%) significantly (p titrable acidity decreased during 40 days of ripening but then increased slightly. Sensory properties of white brined cheese incorporating with vegetable oils were different from those of full-fat cheese samples. White brined cheese containing olive and canola oils (100% fat substitution) received better sensory scores compared to other samples. The results showed that it is possible to replace dairy fat with olive and canola oils, which can lead to produce a new healthy and functional white brined cheese.

  12. Impacts of Karkheh Dam on Spatial Pattern of Riparian Zones in Karkheh National Park

    Directory of Open Access Journals (Sweden)

    H. Madadi

    2013-03-01

    Full Text Available Effective river ecosystem management requires that the existing hydrologic regime be characterized in terms of the natural hydrologic regime and the degree to which the human-altered regime differs from natural conditions. This is known as Range of Variation Approach (RVA and can be used for variation of stream flow, range of variation and appraisal of dam impacts on riparian zones. In this paper, we used 31 hydrologic parameters, classified into five groups, monthly flow indices, extreme flow indices, timing indices, high-flow and low-flow indices, and rate of change, to assess hydrologic regime alteration in downstream of Karkheh dam. For this, purpose the hydrologic parameters of Pay-Pol hydrometric station have been taken. into consideration. As the Riparian ecosystems are highly dependent on and sensitive to variation in the hydrological cycle, the focus of this study was the 50-meter buffer of the Karkheh River. To examine the impacts caused by the variation of hydrologic regime, we tested if this variation and 8 different landscape metrics in the study area are correlated. The results showed that variation of hydrologic regime had a significant impact on the landscape structure of riparian zone in Karkheh downstream and caused isolation in landscape pattern of the woodland cover. Therefore, landscape structure in Karkheh downstream is highly correlated to hydrologic processes of upstream of the river. It can be concluded that an effective water management strategy is keeping safe the ecological condition and integrity of the riparian zone of Karkheh. This happens when all the hydrologic parameters are in the natural range of variation as they were before dam construction.

  13. Characterization of the aroma of a meatlike process flavoring from soybean-based enzyme-hydrolyzed vegetable protein.

    Science.gov (United States)

    Wu, Yi-Fang G; Cadwallader, Keith R

    2002-05-08

    Defatted soybean meal was converted into enzyme-hydrolyzed vegetable protein (E-HVP) using the proteolytic enzyme Flavorzyme. Total free amino acids increased by 40-fold after enzyme hydrolysis, with leucine being the most abundant, followed by phenylalanine, lysine, glutamine/glutamic acid, and alanine. Volatile components from a meatlike process flavoring made from E-HVP were isolated by direct solvent extraction (DSE)-high vacuum transfer (HVT), dynamic headspace sampling and static headspace sampling and analyzed by gas chromatography (GC)-mass spectrometry and GC-olfactometry. Aroma extract dilution analysis was used to establish a flavor dilution chromatogram of the DSE-HVT extract. Results of these complementary techniques indicated the importance of odorants of high (hydrogen sulfide and methanethiol), intermediate (2-methyl-3-furanthiol, 3-mercapto-2-pentanone, 2-furanmethanethiol, and 3-(methylthiol)propanal) and low volatility (maltol and Furaneol) in the overall aroma of the meatlike process flavoring.

  14. Characterization of antibiotic resistance in Salmonella enterica isolates determined from ready-to-eat (RTE) salad vegetables.

    Science.gov (United States)

    Taban, Birce Mercanoglu; Aytac, Sait Aykut; Akkoc, Nefise; Akcelik, Mustafa

    2013-01-01

    In the last decade, ready-to-eat (RTE) salad vegetables are gaining increasing importance in human diet. However, since they are consumed fresh, inadequate washing during processing can bring on some foodborne illnesses, like salmonellosis, since these food items have natural contamination from soil and water. During 2009-2010, a total of 81 samples were purchased arbitrarily from local markets in Ankara, and were examined for Salmonella contamination. Salmonella screening was performed by using anti-Salmonella magnetic beads system and polymerase chain reaction (PCR) identification of the suspected colonies. Then, the antibiotic resistance profiles of four Salmonella strains identified (strains RTE-1, RTE-2, RTE-3, and RTE-4) were also investigated, since the mechanism by which Salmonella spp. have accumulated antibiotic resistance genes is of interest. All strains showed resistance against sulfonamides (MIC > 128 mg/L). Further results suggested that associated sulfonamide resistance genes were encoded by the 55.0 kb plasmid of strain RTE-1 that involves no integrons. As a result of using two primers (P1254 and P1283) in randomly amplified polymorphic DNA-PCR (RAPD-PCR) analysis, two common amplicons (364 bp and 1065 bp) were determined. The findings of this study provide support to the adoption of guidelines for the prudent use of antibiotics in order to reduce the number of pathogens present on vegetable and fruit farms. Besides, since it is shown that these bacteria started to gain resistance to antibiotics, it is necessary to further investigate the prevalence of them in foods.

  15. Characterization of antibiotic resistance in Salmonella enterica isolates determined from ready-to-eat (RTE salad vegetables

    Directory of Open Access Journals (Sweden)

    Birce Mercanoglu Taban

    2013-01-01

    Full Text Available In the last decade, ready-to-eat (RTE salad vegetables are gaining increasing importance in human diet. However, since they are consumed fresh, inadequate washing during processing can bring on some foodborne illnesses, like salmonellosis, since these food items have natural contamination from soil and water. During 2009-2010, a total of 81 samples were purchased arbitrarily from local markets in Ankara, and were examined for Salmonella contamination. Salmonella screening was performed by using anti-Salmonella magnetic beads system and polymerase chain reaction (PCR identification of the suspected colonies. Then, the antibiotic resistance profiles of four Salmonella strains identified (strains RTE-1, RTE-2, RTE-3, and RTE-4 were also investigated, since the mechanism by which Salmonella spp. have accumulated antibiotic resistance genes is of interest. All strains showed resistance against sulfonamides (MIC > 128 mg/L. Further results suggested that associated sulfonamide resistance genes were encoded by the 55.0 kb plasmid of strain RTE-1 that involves no integrons. As a result of using two primers (P1254 and P1283 in randomly amplified polymorphic DNA-PCR (RAPD-PCR analysis, two common amplicons (364 bp and 1065 bp were determined. The findings of this study provide support to the adoption of guidelines for the prudent use of antibiotics in order to reduce the number of pathogens present on vegetable and fruit farms. Besides, since it is shown that these bacteria started to gain resistance to antibiotics, it is necessary to further investigate the prevalence of them in foods.

  16. Relationships Between Land Use and Stream Nutrient Concentrations in a Highly Urbanized Tropical Region of Brazil: Thresholds and Riparian Zones.

    Science.gov (United States)

    Tromboni, F; Dodds, W K

    2017-07-01

    Nutrient enrichment in streams due to land use is increasing globally, reducing water quality and causing eutrophication of downstream fresh and coastal waters. In temperate developed countries, the intensive use of fertilizers in agriculture is a main driver of increasing nutrient concentrations, but high levels and fast rates of urbanization can be a predominant issue in some areas of the developing world. We investigated land use in the highly urbanized tropical State of Rio de Janeiro, Brazil. We collected total nitrogen, total phosphorus, and inorganic nutrient data from 35 independent watersheds distributed across the State and characterized land use at a riparian and entire watershed scales upstream from each sample station, using ArcGIS. We used regression models to explain land use influences on nutrient concentrations and to assess riparian protection relationships to water quality. We found that urban land use was the primary driver of nutrient concentration increases, independent of the scale of analyses and that urban land use was more concentrated in the riparian buffer of streams than in the entire watersheds. We also found significant thresholds that indicated strong increases in nutrient concentrations with modest increases in urbanization reaching maximum nutrient concentrations between 10 and 46% urban cover. These thresholds influenced calculation of reference nutrient concentrations, and ignoring them led to higher estimates of these concentrations. Lack of sewage treatment in concert with urban development in riparian zones apparently leads to the observation that modest increases in urban land use can cause large increases in nutrient concentrations.

  17. Determination of S-methyl-L-methionine (SMM) from Brassicaceae Family Vegetables and Characterization of the Intestinal Transport of SMM by Caco-2 Cells.

    Science.gov (United States)

    Song, Ji-Hoon; Lee, Hae-Rim; Shim, Soon-Mi

    2017-01-01

    The objectives of the current study were to determine S-methyl-L-methionine (SMM) from various Brassicaceae family vegetables by using validated analytical method and to characterize the intestinal transport mechanism of SMM by the Caco-2 cells. The SMM is well known to provide therapeutic activity in peptic ulcers. The amount of SMM from various Brassicaceae family vegetables ranged from 89.08 ± 1.68 μg/g to 535.98 ± 4.85 μg/g of dry weight by using validated ultra-performance liquid chromatography-electrospray ionization-mass spectrometry method. For elucidating intestinal transport mechanism, the cells were incubated with or without transport inhibitors, energy source, or a metabolic inhibitor. Phloridzin and verapamil as inhibitors of sodium glucose transport protein (SGLT1) and P-glycoprotein, respectively, were not responsible for cellular uptake of SMM. Glucose and sodium azide were not affected by the cellular accumulation of SMM. The efflux ratio of SMM was 0.26, implying that it is not effluxed through Caco-2 cells. The apparent coefficient permeability (P app ) of SMM was 4.69 × 10 -5 cm/s, indicating that it will show good oral absorption in in vivo. © 2016 Institute of Food Technologists®.

  18. Regeneration of Salicaceae riparian forests in the Northern Hemisphere: A new framework and management tool

    Science.gov (United States)

    Gonzalez, Eduardo; Martinez-Fernandez, Vanesa; Shafroth, Patrick B.; Sher, Anna A.; Henry, Annie L.; Garofano-Gomez, Virginia; Corenblit, Dov

    2018-01-01

    Human activities on floodplains have severely disrupted the regeneration of foundation riparian shrub and tree species of the Salicaceae family (Populus and Salix spp.) throughout the Northern Hemisphere. Restoration ecologists initially tackled this problem from a terrestrial perspective that emphasized planting. More recently, floodplain restoration activities have embraced an aquatic perspective, inspired by the expanding practice of managing river flows to improve river health (environmental flows). However, riparian Salicaceae species occupy floodplain and riparian areas, which lie at the interface of both terrestrial and aquatic ecosystems along watercourses. Thus, their regeneration depends on a complex interaction of hydrologic and geomorphic processes that have shaped key life-cycle requirements for seedling establishment. Ultimately, restoration needs to integrate these concepts to succeed. However, while regeneration of Salicaceae is now reasonably well-understood, the literature reporting restoration actions on Salicaceae regeneration is sparse, and a specific theoretical framework is still missing. Here, we have reviewed 105 peer-reviewed published experiences in restoration of Salicaceae forests, including 91 projects in 10 world regions, to construct a decision tree to inform restoration planning through explicit links between the well-studied biophysical requirements of Salicaceaeregeneration and 17 specific restoration actions, the most popular being planting (in 55% of the projects), land contouring (30%), removal of competing vegetation (30%), site selection (26%), and irrigation (24%). We also identified research gaps related to Salicaceae forest restoration and discuss alternative, innovative and feasible approaches that incorporate the human component.

  19. Riparian zones attenuate nitrogen loss following bark beetle-induced lodgepole pine mortality

    Science.gov (United States)

    Biederman, Joel A.; Meixner, Thomas; Harpold, Adrian A.; Reed, David E.; Gutmann, Ethan D.; Gaun, Janelle A.; Brooks, Paul D.

    2016-03-01

    A North American bark beetle infestation has killed billions of trees, increasing soil nitrogen and raising concern for N loss impacts on downstream ecosystems and water resources. There is surprisingly little evidence of stream N response in large basins, which may result from surviving vegetation uptake, gaseous loss, or dilution by streamflow from unimpacted stands. Observations are lacking along hydrologic flow paths connecting soils with streams, challenging our ability to determine where and how attenuation occurs. Here we quantified biogeochemical concentrations and fluxes at a lodgepole pine-dominated site where bark beetle infestation killed 50-60% of trees. We used nested observations along hydrologic flow paths connecting hillslope soils to streams of up to third order. We found soil water NO3 concentrations increased 100-fold compared to prior research at this and nearby southeast Wyoming sites. Nitrogen was lost below the major rooting zone to hillslope groundwater, where dissolved organic nitrogen (DON) increased by 3-10 times (mean 1.65 mg L-1) and NO3-N increased more than 100-fold (3.68 mg L-1) compared to preinfestation concentrations. Most of this N was removed as hillslope groundwater drained through riparian soils, and NO3 remained low in streams. DON entering the stream decreased 50% within 5 km downstream, to concentrations typical of unimpacted subalpine streams (~0.3 mg L-1). Although beetle outbreak caused hillslope N losses similar to other disturbances, up to 5.5 kg ha-1y-1, riparian and in-stream removal limited headwater catchment export to <1 kg ha-1y-1. These observations suggest riparian removal was the dominant mechanism preventing hillslope N loss from impacting streams.

  20. Model analysis of riparian buffer effectiveness for reducing nutrient inputs to streams in agricultural landscapes

    Science.gov (United States)

    McKane, R. B.; M, S.; F, P.; Kwiatkowski, B. L.; Rastetter, E. B.

    2006-12-01

    Federal and state agencies responsible for protecting water quality rely mainly on statistically-based methods to assess and manage risks to the nation's streams, lakes and estuaries. Although statistical approaches provide valuable information on current trends in water quality, process-based simulation models are essential for understanding and forecasting how changes in human activities across complex landscapes impact the transport of nutrients and contaminants to surface waters. To address this need, we developed a broadly applicable, process-based watershed simulator that links a spatially-explicit hydrologic model and a terrestrial biogeochemistry model (MEL). See Stieglitz et al. and Pan et al., this meeting, for details on the design and verification of this simulator. Here we apply the watershed simulator to a generalized agricultural setting to demonstrate its potential for informing policy and management decisions concerning water quality. This demonstration specifically explores the effectiveness of riparian buffers for reducing the transport of nitrogenous fertilizers from agricultural fields to streams. The interaction of hydrologic and biogeochemical processes represented in our simulator allows several important questions to be addressed. (1) For a range of upland fertilization rates, to what extent do riparian buffers reduce nitrogen inputs to streams? (2) How does buffer effectiveness change over time as the plant-soil system approaches N-saturation? (3) How can buffers be managed to increase their effectiveness, e.g., through periodic harvest and replanting? The model results illustrate that, while the answers to these questions depend to some extent on site factors (climatic regime, soil properties and vegetation type), in all cases riparian buffers have a limited capacity to reduce nitrogen inputs to streams where fertilization rates approach those typically used for intensive agriculture (e.g., 200 kg N per ha per year for corn in the U

  1. Analysis of carbon and nitrogen dynamics in riparian soils: model development.

    Science.gov (United States)

    Brovelli, A; Batlle-Aguilar, J; Barry, D A

    2012-07-01

    The quality of riparian soils and their ability to buffer contaminant releases to aquifers and streams are connected intimately to moisture content and nutrient dynamics, in particular of carbon (C) and nitrogen (N). A multi-compartment model-named the Riparian Soil Model (RSM)-was developed to help investigate the influence and importance of environmental parameters, climatic factors and management practices on soil ecosystem functioning in riparian areas. The model improves existing tools, in particular regarding its capability to simulate a wide range of temporal scales, from days to centuries, along with its ability to predict the concentration and vertical distribution of dissolved organic matter (DOM). It was found that DOM concentration controls the amount of soil organic matter (SOM) stored in the soil as well as the respiration rate. The moisture content was computed using a detailed water budget approach, assuming that within each time step all the water above field capacity drains to the layer underneath, until it becomes fully saturated. A mass balance approach was also used for nutrient transport, whereas the biogeochemical reaction network was developed as an extension of an existing C and N turnover model. Temperature changes across the soil profile were simulated analytically, assuming periodic temperature changes in the topsoil. To verify the consistency of model predictions and to illustrate its capabilities, a synthetic but realistic soil profile in a deciduous forest was simulated. Model parameters were taken from the literature, and model predictions were consistent with experimental observations for a similar scenario. Modelling results stressed the importance of environmental conditions on SOM cycling in soils. The mineral and organic C and N stocks fluctuate at different time scales in response to oscillations in climatic conditions and vegetation inputs/uptake. Copyright © 2012 Elsevier B.V. All rights reserved.

  2. Carbon stock and turnover in riparian soils under lowland rainforest transformation systems on Sumatra, Indonesia

    Science.gov (United States)

    Hennings, Nina; Kuzyakov, Yakov

    2017-04-01

    In many tropical areas, rainforests are being cleared in order to exploit timber and other forest products as well as plant crops for food, feed and fuel use. The determinants of different patterns of deforestation and the roles of resulting transformation systems of tropical riparian rainforests for ecological functions have yet received little attention in scientific research. Especially C stocks in riparian zones are strongly affected by climate and land use changes that lead to changes in water regime and ground water level drops. We investigated the effects of land transformations in riparian ecosystems of Sumatra, on soil C content, stocks and decomposability at the landscape scale. We compare C losses in transformation systems and rainforests and estimate the contribution of soil erosion and organic matter mineralization. Further, these losses are related to changing water level and temperature increase along increasing distance to the stream. This approach is based on changing δ13C values of SOC in the topsoil as compared to those in subsoil. The shift of δ13C of SOC in the topsoil from the linear regression calculated by δ13C value with log(SOC) in the topsoil represents the modification of the C turnover rate in the top soil. Erosion is estimated by the shift of the δ13C value of SOC in the subsoil under plantations. Further, the δ13C and δ15N soil profiles and their comparison with litter of local vegetation, can be used to estimate the contribution of autochthonous and allochthonous organics to soil C stocks. Preliminary results show strong increase of erosive losses, increased decomposition with land-use transformation and decrease of C stocks with decreasing water table.

  3. Improved Mapping of Riparian Wetlands Using Reach Topography (ECOSERV)

    Science.gov (United States)

    Riparian wetlands provide a suite of ecosystems services including floodwater retention, biogeochemical processing, and habitat provisioning. However in one mid-Atlantic watershed the National Wetlands Inventory was shown to underrepresent these systems by greater than 50%. These...

  4. Improved Mapping of Riparian Wetlands Using Reach Topography

    Science.gov (United States)

    Riparian wetlands provide a suite of ecosystems services including floodwater retention, biogeochemical processing, and habitat provisioning. However in one mid-Atlantic watershed the National Wetlands Inventory was shown to underrepresent these systems by greater than 50%. These...

  5. Riparian trees as common denominators across the river flow ...

    African Journals Online (AJOL)

    Riparian tree species, growing under different conditions of water availability, can ... leaf area and increasing wood density correlating with deeper groundwater levels. ... and Sanddrifskloof Rivers (South Africa) under reduced flow conditions.

  6. Throughfall and stemflow dynamics in a riparian cedar swamp: possible ecohydrological feedbacks

    Science.gov (United States)

    Duval, T. P.

    2012-12-01

    Partitioning of rainfall through forest canopies as throughfall and stemflow have deservedly been the subject of much research in the past; however, very little is known about the fluxes of water and solutes through forested wetland communities. Temperate swamps are characterized by intermittent canopy coverage, with areas that are denser than upland forests of similar species, but also contain canopy gaps of meadow and marsh communities,. Understanding the role of vegetation on the distribution of precipitation in these ecosystems is necessary to effectively constrain water balance estimates and predict possible community responses to shifting climate regimes. This study examines throughfall, stemflow, and interception dynamics in a riparian cedar swamp in Alliston, Ontario, Canada over the 2012 growing season. Throughfall averaged 76 % of above-canopy rainfall; however, there were spatial-magnitude interaction variations within the swamp. For events less than 20 mm, between 17 and 75 % of the measured swamp floor received greater depth of rain than above the canopy, whereas for events greater than 20 mm only between 2 and 23 % of the sampled swamp floor received more water than the actual event. The observed spatial variability in throughfall was not related to leaf area index, suggesting remote sensing modelling efforts may not be an accurate method for quantification of wetland precipitation dynamics. Stemflow along the predominantly cedar trees averaged 5 %; therefore, net precipitation on a seasonal basis in this cedar swamp was 81 % of above canopy rainfall. Throughfall DOC and total nitrogen concentrations averaged 31 and 2.2 mg/L, respectively, with stemflow DOC and TN concentrations averaging 109 and 6.5 mg/L, respectively. These values are much higher than reported for upland forest species. In general, throughfall magnitudes increased and solute concentrations decreased with increasing distance from the existing forest boles. The delivery of high

  7. Riparian zone controls on base cation concentrations in boreal streams

    Science.gov (United States)

    Ledesma, J. L. J.; Grabs, T.; Futter, M. N.; Bishop, K. H.; Laudon, H.; Köhler, S. J.

    2013-01-01

    Forest riparian zones are a major in control of surface water quality. Base cation (BC) concentrations, fluxes, and cycling in the riparian zone merit attention because of increasing concern of negative consequences for re-acidification of surface waters from future climate and forest harvesting scenarios. We present a two-year study of BC and silica (Si) flow-weighted concentrations from 13 riparian zones and 14 streams in a boreal catchment in northern Sweden. The Riparian Flow-Concentration Integration Model (RIM) was used to estimate riparian zone flow-weighted concentrations and tested to predict the stream flow-weighted concentrations. Spatial variation in BC and Si concentrations as well as in flow-weighted concentrations was related to differences in Quaternary deposits, with the largest contribution from lower lying silty sediments and the lowest contribution from wetland areas higher up in the catchment. Temporal stability in the concentrations of most elements, a remarkably stable Mg / Ca ratio in the soil water and a homogeneous mineralogy suggest that the stable patterns found in the riparian zones are a result of distinct mineralogical upslope groundwater signals integrating the chemical signals of biological and chemical weathering. Stream water Mg / Ca ratio indicates that the signal is subsequently maintained in the streams. RIM gave good predictions of Ca, Mg, and Na flow-weighted concentrations in headwater streams. The difficulty in modelling K and Si suggests a stronger biogeochemical influence on these elements. The observed chemical dilution effect with flow in the streams was related to variation in groundwater levels and element concentration profiles in the riparian zones. This study provides a first step toward specific investigations of the vulnerability of riparian zones to changes induced by forest management or climate change, with focus on BC or other compounds.

  8. Historic carbon burial spike in an Amazon floodplain lake linked to riparian deforestation near Santarém, Brazil

    Science.gov (United States)

    Sanders, Luciana M.; Taffs, Kathryn; Stokes, Debra; Sanders, Christian J.; Enrich-Prast, Alex; Amora-Nogueira, Leonardo; Marotta, Humberto

    2018-01-01

    Forests along the Amazon Basin produce significant quantities of organic material, a portion of which is deposited in floodplain lakes. Deforestation in the watershed may then have potentially important effects on the carbon fluxes. In this study, a sediment core was extracted from an Amazon floodplain lake to examine the relationship between carbon burial and changing land cover and land use. Historical records from the 1930s and satellite data from the 1970s were used to calculate deforestation rates between 1930 to 1970 and 1970 to 2010 in four zones with different distances from the margins of the lake and its tributaries (100, 500, 1000 and 6000 m buffers). A sediment accumulation rate of ˜ 4 mm yr-1 for the previous ˜ 120 years was determined from the 240+239Pu signatures and the excess 210Pb method. The carbon burial rates ranged between 85 and 298 g C m-2 yr-1, with pulses of high carbon burial in the 1950s, originating from the forest vegetation as indicated by δ13C and δ15N signatures. Our results revealed a potentially important spatial dependence of the organic carbon (OC) burial in Amazon lacustrine sediments in relation to deforestation rates in the catchment. These deforestation rates were more intense in the riparian vegetation (100 m buffer) during the period 1930 to 1970 and the larger open water areas (500, 1000 and 6000 m buffer) during 1970 to 2010. The continued removal of vegetation from the interior of the forest was not related to the peak of OC burial in the lake, but only the riparian deforestation which peaked during the 1950s. Therefore, this supports the conservation priority of riparian forests as an important management practice for Amazon flooded areas. Our findings suggest the importance of abrupt and temporary events in which some of the biomass released by deforestation, especially restricted to areas along open water edges, might reach the depositional environments in the floodplain of the Amazon Basin.

  9. Riparian and Upland Restoration at the U.S. Department of Energy Rocky Flats, Colorado, Site - 12360

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Jody K. [S.M. Stoller Corporation, Contractor to the U.S. Department of Energy Office of Legacy Management, Westminster, Colorado 80021 (United States)

    2012-07-01

    Remedial investigation and cleanup at the Rocky Flats, Colorado, Site was completed in 2005. Uplands, riparian, and wetland habitat were disturbed during cleanup and closure activities and required extensive revegetation. Unavoidable disturbances to habitat of the Preble's meadow jumping mouse (a federally listed species) and wetlands required consultation with regulatory agencies and mitigation. Mitigation wetlands were constructed in two drainages, and a third developed naturally where a soil borrow area intercepted the groundwater table. During the 50-plus years of site operations, 12 ponds were constructed in three drainages to manage and retain runoff and sewage treatment plant discharges prior to release off site. A batch-release protocol has been used for the past several decades at the terminal ponds, which has affected the riparian communities downstream. To return the hydrologic regime to a more natural flow-through system similar to the pre-industrial-use conditions, seven interior dams (of 12) have been breached, and the remaining five dams are scheduled for breaching between 2011 and 2020. At the breached dams, the former open water areas have transformed to emergent wetlands, and the stream reaches have returned to a flow-through system. Riparian and wetland vegetation has established very well. The valves of the terminal ponds were opened in fall 2011 to begin flow-through operations and provide water to the downstream plant communities while allowing reestablishment of vegetation in the former pond bottoms prior to breaching. A number of challenges and issues were addressed during the revegetation effort. These included reaching an agreement on revegetation goals, addressing poor substrate quality and soil compaction problems, using soil amendments and topsoil, selecting seeds, determining the timing and location of revegetation projects relative to continuing closure activities, weed control, erosion control, revegetation project field

  10. Incorporating climate change projections into riparian restoration planning and design

    Science.gov (United States)

    Perry, Laura G.; Reynolds, Lindsay V.; Beechie, Timothy J.; Collins, Mathias J.; Shafroth, Patrick B.

    2015-01-01

    Climate change and associated changes in streamflow may alter riparian habitats substantially in coming decades. Riparian restoration provides opportunities to respond proactively to projected climate change effects, increase riparian ecosystem resilience to climate change, and simultaneously address effects of both climate change and other human disturbances. However, climate change may alter which restoration methods are most effective and which restoration goals can be achieved. Incorporating climate change into riparian restoration planning and design is critical to long-term restoration of desired community composition and ecosystem services. In this review, we discuss and provide examples of how climate change might be incorporated into restoration planning at the key stages of assessing the project context, establishing restoration goals and design criteria, evaluating design alternatives, and monitoring restoration outcomes. Restoration planners have access to numerous tools to predict future climate, streamflow, and riparian ecology at restoration sites. Planners can use those predictions to assess which species or ecosystem services will be most vulnerable under future conditions, and which sites will be most suitable for restoration. To accommodate future climate and streamflow change, planners may need to adjust methods for planting, invasive species control, channel and floodplain reconstruction, and water management. Given the considerable uncertainty in future climate and streamflow projections, riparian ecological responses, and effects on restoration outcomes, planners will need to consider multiple potential future scenarios, implement a variety of restoration methods, design projects with flexibility to adjust to future conditions, and plan to respond adaptively to unexpected change.

  11. Biomass carbon, nitrogen and phosphorus stocks in hybrid poplar buffers, herbaceous buffers and natural woodlots in the riparian zone on agricultural land.

    Science.gov (United States)

    Fortier, Julien; Truax, Benoit; Gagnon, Daniel; Lambert, France

    2015-05-01

    In many temperate agricultural areas, riparian forests have been converted to cultivated land, and only narrow strips of herbaceous vegetation now buffer many farm streams. The afforestation of these riparian zones has the potential to increase carbon (C) storage in agricultural landscapes by creating a new biomass sink for atmospheric CO2. Occurring at the same time, the storage of nitrogen (N) and phosphorus (P) in plant biomass, is an important water quality function that may greatly vary with types of riparian vegetation. The objectives of this study were (1) to compare C, N and P storage in aboveground, belowground and detrital biomass for three types of riparian vegetation cover (9-year-old hybrid poplar buffers, herbaceous buffers and natural woodlots) across four agricultural sites and (2) to determine potential vegetation cover effects on soil nutrient supply rate in the riparian zone. Site level comparisons suggest that 9-year-old poplar buffers have stored 9-31 times more biomass C, 4-10 times more biomass N, and 3-7 times more biomass P than adjacent non managed herbaceous buffers, with the largest differences observed on the more fertile sites. The conversion of these herbaceous buffers to poplar buffers could respectively increase C, N and P storage in biomass by 3.2-11.9 t/ha/yr, 32-124 kg/ha/yr and 3.2-15.6 kg/ha/yr, over 9 years. Soil NO3 and P supply rates during the summer were respectively 57% and 66% lower in poplar buffers than in adjacent herbaceous buffers, potentially reflecting differences in nutrient storage and cycling between the two buffer types. Biomass C ranged 49-160 t/ha in woodlots, 33-110 t/ha in poplar buffers and 3-4 t/ha in herbaceous buffers. Similar biomass C stocks were found in the most productive poplar buffer and three of the four woodlots studied. Given their large and varied biomass C stocks, conservation of older riparian woodlots is equally important for C balance management in farmland. In addition, the

  12. Experimental study on water transport observations of desert riparian forests in the lower reaches of the Tarim River in China.

    Science.gov (United States)

    Chen, Yaning; Li, Weihong; Zhou, Honghua; Chen, Yapeng; XinmingHao; Fu, Aihong; Ma, Jianxin

    2017-06-01

    Studying the water use processes of desert riparian vegetation in arid regions and analyzing the response and adaptation strategies of plants to drought stress are of great significance for developing ecological restoration measures. Based on field monitoring and test analyses of physiological ecological indicators of dominant species (Populus euphratica and Tamarix chinensis) in the desert riparian forest in the lower reaches of the Tarim River, the water relations of P. euphratica and T. chinensis under drought stress are discussed and some water use strategies put forward. The results show that (1) concerning plant water uptake, desert riparian forests depend mainly on groundwater to survive under long-term water stress. (2) Concerning plant water distribution, the survival of P. euphratica and nearby shallow root plants is mainly due to the hydraulic lift and water redistribution of P. euphratica under drought stress. (3) Concerning plant water transport, P. euphratica sustains the survival of competitive and advantageous branches by improving their ability to acquire water while restraining the growth of inferior branches. (4) Concerning plant transpiration, the sap flow curves of daily variations of P. euphratica and T. chinensis were wide-peak sin and narrower-peak respectively. T. chinensis has better environmental adaptability.

  13. Hydrological mediated denitrification in groundwater below a seasonal flooded restored riparian zone

    DEFF Research Database (Denmark)

    Jensen, Jannick Kolbjørn; Engesgaard, Peter; Johnsen, Anders R.

    2017-01-01

    nitrate removal in groundwater primarily by two mechanisms. First, by creating a stagnant flow zone beneath the flooded area thereby increasing the residence time and leaving more time for nitrate removal. Secondly, nitrate removal is increased by enhancing upward flow into the highly reactive organic......A restored riparian zone was characterized to understand the effects of flooding on subsurface hydrological flow paths and nitrate removal in groundwater. Field and laboratory investigations were combined with numerical modeling of dynamic flow and reactive nitrate transport. Flooding enhances...

  14. Woody vegetation of the Upper Verde River: 1996-2007 [Chapter 6

    Science.gov (United States)

    Alvin L. Medina

    2012-01-01

    Streamside vegetation is an integral component of a stable riparian ecosystem, providing benefits to both terrestrial and aquatic fauna (Brown and others 1977; National Research Council 2002) as well as Native Americans (Betancourt and Van Devender 1981). On the UVR, stable streambanks are a desirable management goal to attain channel stability for a variety of...

  15. Foliar moisture content of Pacific Northwest vegetation and its relation to wildland fire behavior.

    Science.gov (United States)

    James K. Agee; Clinton S. Wright; Nathan Williamson; Mark H. Huff

    2002-01-01

    Fotiar moisture was monitored for five conifers and associated understory vegetation in Pacific Northwest forests. Decline in foliar moisture of new foliage occurred over the dry season, while less variation was evident in older foliage. Late season foliar moisture ranged from 130 to 170%. In riparian-upland comparisons, largest differences were found for understory...

  16. Riparian plant succession in the dam-regulated Colorado River: Why is saltcedar losing?

    International Nuclear Information System (INIS)

    Stevens, L.

    1993-01-01

    Three modes of plant succession (inhibition, facilitation and tolerance) were tested to explain the replacement of exotic saltcedar (Tamarix ramosissima) by naive phreatophytes in the Colorado River corridor in the Grand Canyon. Dam construction reduced flood frequency and sediment transport, interrupting the open-quotes perpetual successionclose quotes of the pre-dam riparian vegetation and initially allowing saltcedar to proliferate. Inhibition results from direct or indirect competition, but field measurements and experiments demonstrate limited evidence of competitive superiority by naive species over saltcedar in three life stages. Field observations and experiments on germination, physiological responses to gradients and comparative life history analyses demonstrate that saltcedar is a stress tolerant, disturbance specialist in an ecologically stabilized river corridor where safe germination sites are increasingly rare. Altered flood frequency, increased soil coarseness and differential herbivory contribute to succession in this system

  17. River water infiltration enhances denitrification efficiency in riparian groundwater.

    Science.gov (United States)

    Trauth, Nico; Musolff, Andreas; Knöller, Kay; Kaden, Ute S; Keller, Toralf; Werban, Ulrike; Fleckenstein, Jan H

    2018-03-01

    Nitrate contamination in ground- and surface water is a persistent problem in countries with intense agriculture. The transition zone between rivers and their riparian aquifers, where river water and groundwater interact, may play an important role in mediating nitrate exports, as it can facilitate intensive denitrification, which permanently removes nitrate from the aquatic system. However, the in-situ factors controlling riparian denitrification are not fully understood, as they are often strongly linked and their effects superimpose each other. In this study, we present the evaluation of hydrochemical and isotopic data from a 2-year sampling period of river water and groundwater in the riparian zone along a 3rd order river in Central Germany. Based on bi- and multivariate statistics (Spearman's rank correlation and partial least squares regression) we can show, that highest rates for oxygen consumption and denitrification in the riparian aquifer occur where the fraction of infiltrated river water and at the same time groundwater temperature, are high. River discharge and depth to groundwater are additional explanatory variables for those reaction rates, but of minor importance. Our data and analyses suggest that at locations in the riparian aquifer, which show significant river water infiltration, heterotrophic microbial reactions in the riparian zone may be fueled by bioavailable organic carbon derived from the river water. We conclude that interactions between rivers and riparian groundwater are likely to be a key control of nitrate removal and should be considered as a measure to mitigate high nitrate exports from agricultural catchments. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Riverine Landscape Patch Heterogeneity Drives Riparian Ant Assemblages in the Scioto River Basin, USA.

    Directory of Open Access Journals (Sweden)

    Paradzayi Tagwireyi

    Full Text Available Although the principles of landscape ecology are increasingly extended to include riverine landscapes, explicit applications are few. We investigated associations between patch heterogeneity and riparian ant assemblages at 12 riverine landscapes of the Scioto River, Ohio, USA, that represent urban/developed, agricultural, and mixed (primarily forested, but also wetland, grassland/fallow, and exurban land-use settings. Using remotely-sensed and ground-collected data, we delineated riverine landscape patch types (crop, grass/herbaceous, gravel, lawn, mudflat, open water, shrub, swamp, and woody vegetation, computed patch metrics (area, density, edge, richness, and shape, and conducted coordinated sampling of surface-active Formicidae assemblages. Ant density and species richness was lower in agricultural riverine landscapes than at mixed or developed reaches (measured using S [total number of species], but not using Menhinick's Index [DM], whereas ant diversity (using the Berger-Park Index [DBP] was highest in agricultural reaches. We found no differences in ant density, richness, or diversity among internal riverine landscape patches. However, certain characteristics of patches influenced ant communities. Patch shape and density were significant predictors of richness (S: R2 = 0.72; DM: R2=0.57. Patch area, edge, and shape emerged as important predictors of DBP (R2 = 0.62 whereas patch area, edge, and density were strongly related to ant density (R2 = 0.65. Non-metric multidimensional scaling and analysis of similarities distinguished ant assemblage composition in grass and swamp patches from crop, gravel, lawn, and shrub as well as ant assemblages in woody vegetation patches from crop, lawn, and gravel (stress = 0.18, R2 = 0.64. These findings lend insight into the utility of landscape ecology to river science by providing evidence that spatial habitat patterns within riverine landscapes can influence assemblage characteristics of riparian

  19. The spatial distribution and temporal variation of desert riparian forests and their influencing factors in the downstream Heihe River basin, China

    Science.gov (United States)

    Ding, Jingyi; Zhao, Wenwu; Daryanto, Stefani; Wang, Lixin; Fan, Hao; Feng, Qiang; Wang, Yaping

    2017-05-01

    Desert riparian forests are the main restored vegetation community in Heihe River basin. They provide critical habitats and a variety of ecosystem services in this arid environment. Since desert riparian forests are also sensitive to disturbance, examining the spatial distribution and temporal variation of these forests and their influencing factors is important to determine the limiting factors of vegetation recovery after long-term restoration. In this study, field experiment and remote sensing data were used to determine the spatial distribution and temporal variation of desert riparian forests and their relationship with the environmental factors. We classified five types of vegetation communities at different distances from the river channel. Community coverage and diversity formed a bimodal pattern, peaking at the distances of 1000 and 3000 m from the river channel. In general, the temporal normalized difference vegetation index (NDVI) trend from 2000 to 2014 was positive at different distances from the river channel, except for the region closest to the river bank (i.e. within 500 m from the river channel), which had been undergoing degradation since 2011. The spatial distribution of desert riparian forests was mainly influenced by the spatial heterogeneity of soil properties (e.g. soil moisture, bulk density and soil particle composition). Meanwhile, while the temporal variation of vegetation was affected by both the spatial heterogeneity of soil properties (e.g. soil moisture and soil particle composition) and to a lesser extent, the temporal variation of water availability (e.g. annual average and variability of groundwater, soil moisture and runoff). Since surface (0-30 cm) and deep (100-200 cm) soil moisture, bulk density and the annual average of soil moisture at 100 cm obtained from the remote sensing data were regarded as major determining factors of community distribution and temporal variation, conservation measures that protect the soil structure

  20. The dark side of suibsidies: quantifying contaminant exposure to riparian predators via stream insects

    Science.gov (United States)

    Aquatic insects provide a critical nutrient subsidy to riparian food webs, yet their role as vectors of contaminants to terrestrial ecosystems is poorly understood. We investigated relationships between aquatic (resource utilization) and contaminant exposure for a riparian invert...

  1. Riparian Raptors on USACE Projects: Red-Shouldered Hawk (Buteo lineatus)

    National Research Council Canada - National Science Library

    Mitchell, Wilma

    2000-01-01

    ...) reservoir operations. For management purposes, these raptors are considered riparian generalists because they inhabit the riparian zones surrounding streams and lakes on Corps project lands but may seasonally use adjacent...

  2. Caracterização físico-química e sensorial de hambúrguer vegetal elaborado à base de caju Physical chemical and sensory characterization of vegetal hamburger elaborated from cashew apple

    Directory of Open Access Journals (Sweden)

    Janice Ribeiro Lima

    2008-02-01

    Full Text Available A elaboração de produtos derivados do caju é uma alternativa para seu aproveitamento e para o consumo fora o período de safra. Objetivou-se neste trabalho caracterizar hambúrgueres elaborados à base de caju e comparar suas características com as de produtos comerciais. Foram adquiridos quatro tipos de hambúrgueres comerciais, um deles à base de carne e os demais à base de proteína vegetal. Os hambúrgueres foram analisados quanto às características físico-químicas (proteína, gordura, umidade, cinzas, carboidratos, atividade de água e pH e aceitação sensorial (aparência, aroma, sabor, textura e impressão global. Foram observadas grandes variações nas características dos hambúrgueres: proteínas variaram de 5,75 a 12,95%, gordura de 5,79 a 16,44%, umidade de 45,83 a 63,71%, cinzas de 2,89 a 4,75%, carboidratos de 16,35 a 33,99%, atividade de água de 0,958 a 0,983 e pH de 4,75 a 6,78. Os hambúrgueres de caju apresentaram menor pH e menores teores de proteína e gordura do que a maioria dos produtos comerciais. A aceitação sensorial também apresentou grandes variações, com notas para aparência de 6,2 a 7,8, aroma de 6,1 a 7,9, sabor de 5,7 a 8,0, textura de 5,9 a 7,9 e impressão global de 5,9 a 7,9. Para o hambúrguer de caju, a aceitação sensorial foi, em média, próxima da avaliação gostei ligeiramente (nota 6,0, para todos os atributos avaliados.Products elaborated from cashew are good alternatives for their utilization and for consumption after harvest period. This work aimed to characterize hamburgers made from cashew apple and to compare their characteristics with the ones from commercial products. Four kinds of commercial products were bought, one made of meat and the others made of vegetal protein. Hamburgers were analyzed for their physical chemical characteristics (protein, fat, moisture, ash, carbohydrates, water activity and pH and sensory acceptance (appearance, flavor, taste, texture and overall

  3. Kuchler Vegetation

    Data.gov (United States)

    California Natural Resource Agency — Digital version of potential natural plant communites as compiled and published on 'Map of the Natural Vegetation of California' by A. W. Kuchler, 1976. Source map...

  4. Wieslander Vegetation

    Data.gov (United States)

    California Natural Resource Agency — Digital version of the 1945 California Vegetation Type Maps by A. E. Wieslander of the U.S. Forest Service. Source scale of maps are 1:100,000. These compiled maps...

  5. Water use sources of desert riparian Populus euphratica forests.

    Science.gov (United States)

    Si, Jianhua; Feng, Qi; Cao, Shengkui; Yu, Tengfei; Zhao, Chunyan

    2014-09-01

    Desert riparian forests are the main body of natural oases in the lower reaches of inland rivers; its growth and distribution are closely related to water use sources. However, how does the desert riparian forest obtains a stable water source and which water sources it uses to effectively avoid or overcome water stress to survive? This paper describes an analysis of the water sources, using the stable oxygen isotope technique and the linear mixed model of the isotopic values and of desert riparian Populus euphratica forests growing at sites with different groundwater depths and conditions. The results showed that the main water source of Populus euphratica changes from water in a single soil layer or groundwater to deep subsoil water and groundwater as the depth of groundwater increases. This appears to be an adaptive selection to arid and water-deficient conditions and is a primary reason for the long-term survival of P. euphratica in the desert riparian forest of an extremely arid region. Water contributions from the various soil layers and from groundwater differed and the desert riparian P. euphratica forests in different habitats had dissimilar water use strategies.

  6. Colonization by benthic macroinvertebrates in two artificial substrate types of a Riparian Forest

    Directory of Open Access Journals (Sweden)

    Lívia Borges dos Santos

    Full Text Available Abstract: Aim To analyze the efficiency of organic and inorganic substrates in samples of benthic macroinvertebrates of riparian forests from the Cerrado. Specific objectives (i characterize the ecological succession and taxonomic richness of benthic macroinvertebrates in stream affluent of a riparian forest; (ii analyze the influence of seasonality on the colonization of macroinvertebrates; and (iii determine the effect of the types of artificial substrates on the richness, composition and abundance of the benthic community. Methods Sampling was carried out in the rainy and dry seasons, and we installed in the watercourse two types of substrates: organic (leaf packs and inorganic (bricks, organized in pairs. Six samples per season were done to verify colonization, succession, richness and abundance of benthic community. The substrates were carefully sorted and the organisms were identified to the lowest possible taxonomic level. Results The ecological succession was clearly observed, with the initial occurrence of Chironomidae and Baetidae (considered early colonizers, and a late occurrence of organisms such as Helotrephidae and Trichoptera (considered late colonizers. No significant difference was found in the richness and abundance among the studied seasons (rainy and dry, but the organic substrate was significantly higher than the inorganic substrate for these parameters. Conclusion Organic artificial substrates are more efficient in characterizing the community of benthic macroinvertebrates in the study area, because they are more similar to the conditions of the substrate found naturally in the environment.

  7. SOIL NITROUS OXIDE, NITRIC OXIDE, AND AMMONIA EMISSIONS FROM A RECOVERING RIPARIAN ECOSYSTEM IN SOUTHERN APPALACHIA

    Science.gov (United States)

    The paper presents two years of seasonal nitric oxide, ammonia, and nitrous oxide trace gas fluxes measured in a recovering riparian zone with cattle excluded and in an adjacent riparian zone grazed by cattle. In the recovering riparian zone, average nitric oxide, ammonia, and ni...

  8. Riparian Habitat Management for Reptiles and Amphibians on Corps of Engineers Projects

    National Research Council Canada - National Science Library

    Dickerson, Dena

    2001-01-01

    ... important taxonomic groups such as reptiles and amphibians. This note provides an overview of the importance of riparian habitat at Corps projects for reptiles and amphibians, identifies riparian zone functions and habitat characteristics, provides examples of representative taxa and regional comparisons, and describes impacts of riparian habitat modification.

  9. Vegetation studies on Vandenberg Air Force Base, California

    Science.gov (United States)

    Schmalzer, Paul A.; Hickson, Diana E.; Hinkle, C. Ross

    1988-01-01

    Vandenburg Air Force Base, located in coastal central California with an area of 98,400 ac, contains resources of considerable biological significance. Available information on the vegetation and flora of Vandenburg is summarized and new data collected in this project are presented. A bibliography of 621 references dealing with vegetation and related topics related to Vanderburg was compiled from computer and manual literature searches and a review of past studies of the base. A preliminary floristic list of 642 taxa representing 311 genera and 80 families was compiled from past studies and plants identified in the vegetation sampling conducted in this project. Fifty-two special interest plant species are known to occur or were suggested to occur. Vegetation was sampled using permanent plots and transects in all major plant communities including chaparral, Bishop pine forest, tanbark oak forest, annual grassland, oak woodland, coastal sage scrub, purple sage scrub, coastal dune scrub, coastal dunes, box elder riparian woodland, will riparian woodland, freshwater marsh, salt marsh, and seasonal wetlands. Comparison of the new vegetation data to the compostie San Diego State University data does not indicate major changes in most communities since the original study. Recommendations are made for additional studies needed to maintain and extend the environmental data base and for management actions to improve resource protection.

  10. Vegetative communities, Davis and Lavender Canyons, Paradox Basin, Utah: ecosystem studies

    International Nuclear Information System (INIS)

    1983-04-01

    The major vegetative communities of Davis and Lavender canyons located in southeastern Utah are characterized. The report identifies potential secondary impacts and appropriate mitigation options. The Davis Canyon and Lavender Canyon Study Area contains nine major vegetative communities: galleta-shadscale, juniper-blackbrush, juniper-shadscale-ephedra, shadscale-ephedra, grayia-shadscale, juniper, drywash, greasewood, and riparian. The natural recovery times of these communities are exceedingly long. Natural reinvasion of various species would take from 15 to 100 years. No threatened or endangered plant species were identified in the study area. Davis and Lavender canyons have been subject to off-road vehicle activity and extensive grazing. The plant communities may be subject to additional impacts as a result of increased human activity and off-highway activities such as camping, hiking, and hunting could result in changes in cover, composition, and frequency of plant species. Mitigation options for potential impacts include shuttle-busing workers to the site from the highway and fencing site access roads to prevent vehicles from leaving the roads

  11. Water and Energy Balance in Response to the Removal of Invasive Phragmites Australis in a Riparian Wetland

    Science.gov (United States)

    Mykleby, P.; Lenters, J. D.; Cutrell, G. J.; Herrman, K.; Istanbulluoglu, E.; Scott, D.

    2011-12-01

    Vegetation plays an important role in the surface energy and water balance of wetlands. Transpiration from phreatophytes, in particular, withdraws water directly from groundwater, often impacting streamflow rates in adjacent tributaries. In the Republican River basin of the Central Plains (USA), streamflow has declined significantly in the past 30-40 years. Invasive vegetation species (such as Phragmites australis) have been removed from portions of the riparian corridor in an effort to halt or reverse the downward trend in streamflow. In this study, we investigated the energy and water balance of a P. australis-dominated riparian wetland in south-central Nebraska to assess the potential effectiveness of such an approach. Evapotranspiration (ET) rates were measured during two growing seasons - one being 2009, when the P. australis was at full growth, and the other during 2010, after the vegetation had been sprayed with herbicide (and remained only as dead, standing biomass). Energy balance measurements at the field site included net radiation, heat storage rates in the canopy, soil, and standing water, and sensible heat flux, which was measured using a large-aperture scintillometer (LAS). Latent heat flux (i.e., ET) was calculated as a residual of the energy balance, and comparisons were made between the two growing seasons. As a result of the spraying of the P. australis vegetation, season-mean ET rates dropped from 4.4 mm day-1 in 2009 to 3.0 mm day-1 in 2010. This decrease in ET was associated with a large increase in sensible heat flux, which more than doubled between the two years (from 33 W m-2 in 2009 to 76 W m-2 in 2010). Meteorological conditions at the site were slightly different from one year to the next, but the differences were not large enough to account for the dramatic changes in latent and sensible heat flux that were observed. We conclude, therefore, that the majority of the ~30% decrease in ET (and ~130% increase in sensible heat flux) was the

  12. Deforestation and benthic indicators: how much vegetation cover is needed to sustain healthy Andean streams?

    Science.gov (United States)

    Iñiguez-Armijos, Carlos; Leiva, Adrián; Frede, Hans-Georg; Hampel, Henrietta; Breuer, Lutz

    2014-01-01

    Deforestation in the tropical Andes is affecting ecological conditions of streams, and determination of how much forest should be retained is a pressing task for conservation, restoration and management strategies. We calculated and analyzed eight benthic metrics (structural, compositional and water quality indices) and a physical-chemical composite index with gradients of vegetation cover to assess the effects of deforestation on macroinvertebrate communities and water quality of 23 streams in southern Ecuadorian Andes. Using a geographical information system (GIS), we quantified vegetation cover at three spatial scales: the entire catchment, the riparian buffer of 30 m width extending the entire stream length, and the local scale defined for a stream reach of 100 m in length and similar buffer width. Macroinvertebrate and water quality metrics had the strongest relationships with vegetation cover at catchment and riparian scales, while vegetation cover did not show any association with the macroinvertebrate metrics at local scale. At catchment scale, the water quality metrics indicate that ecological condition of Andean streams is good when vegetation cover is over 70%. Further, macroinvertebrate community assemblages were more diverse and related in catchments largely covered by native vegetation (>70%). Our results suggest that retaining an important quantity of native vegetation cover within the catchments and a linkage between headwater and riparian forests help to maintain and improve stream biodiversity and water quality in Andean streams affected by deforestation. This research proposes that a strong regulation focused to the management of riparian buffers can be successful when decision making is addressed to conservation/restoration of Andean catchments.

  13. Riparian buffer zones on selected rivers in Lower Silesia - an important conservation practice and the management strategy in urban planning

    Science.gov (United States)

    Adamska, Maryna

    2013-09-01

    Buffer zones are narrow strips of land lying along the surface water, covered with appropriately selected vegetation. They separate aquatic ecosystems from the direct impact of agricultural land and reduce the movement of nutrients in the environment. In 2008 the European Commission established requirements for the implementation of buffer strips along water courses. Poland committed to the enforcement of these requirements until 1 January 2012. This was one of the reasons of this study. The subject of the analysis included the following rivers in Lower Silesia: Smortawa, Krynka, Czarna Woda and the selected transects of Ślęza and Nysa Łużycka. Detailed studies were designed to estimate the buffer zones occurring on these watercourses and assess these zones’ structure. This will be used to develop clear criteria for the selection of the width of these zones based on land use land management. It can be used in the implementation of executive acts at different levels of space management. Field research consisted of inventory the extent of riparian buffer strips on selected water courses and photographic documentation. Species composition of the vegetation forming a buffer zone was identified by using Braun-Blanquet method. There was lack of continuity of the riparian buffer zones on investigated rivers. Buffer zones should have carefully formulated definition and width because they are element of the significant ecological value, they perform important environmental protective functions and they are also the subject of Community law.

  14. Effects of reintroduced beaver (Castor canadensis) on riparian bird community structure along the upper San Pedro River, southeastern Arizona and northern Sonora, Mexico

    Science.gov (United States)

    Johnson, Glenn E.; van Riper, Charles

    2014-01-01

    Chapter 1.—We measured bird abundance and richness along the upper San Pedro River in 2005 and 2006, in order to document how beavers (Castor canadensis) may act as ecosystem engineers after their reintroduction to a desert riparian area in the Southwestern United States. In areas where beavers colonized, we found higher bird abundance and richness of bird groups, such as all breeding birds, insectivorous birds, and riparian specialists, and higher relative abundance of many individual species—including several avian species of conservation concern. Chapter 2.—We conducted bird surveys in riparian areas along the upper San Pedro River in southeastern Arizona (United States) and northern Sonora (Mexico) in order to describe factors influencing bird community dynamics and the distribution and abundance of species, particularly those of conservation concern. These surveys were also used to document the effects of the ecosystem-altering activities of a recently reintroduced beavers (Castor canadensis). Chapter 3.—We reviewed Southwestern Willow Flycatcher (Empidonax traillii extimus) nest records and investigated the potential for future breeding along the upper San Pedro River in southeastern Arizona, where in July 2005 we encountered the southernmost verifiable nest attempt for the species. Continued conservation and management of the area’s riparian vegetation and surface water has potential to contribute additional breeding sites for this endangered Willow Flycatcher subspecies. Given the nest record along the upper San Pedro River and the presence of high-density breeding sites to the north, the native cottonwood-willow forests of the upper San Pedro River could become increasingly important to E. t. extimus recovery, especially considering the anticipated effect of the tamarisk leaf beetle (Diorhabda carinulata) on riparian habitat north of the region.

  15. Effect of organic matter and roots in soil respiration in a Mediterranean riparian areas in Central Spain

    Science.gov (United States)

    Gonzalez-Garrido, Laura; Delgado, Juan Antonio; Martinez, Teodora

    2010-05-01

    Soil respiration is one of the largest carbon flux components within terrestrial ecosystems, and small changes in the magnitude of soil respiration could have a large effect on the concentration of CO2 in the atmosphere. The main objective is evaluating the factors controlling soil respiration on the global carbon cycle in riparian areas of Henares River. We evaluated total soil respiration as it was affected by soil temperature, soil moisture, root respiration and organic matter in four areas differing in vegetation cover. We specifically assessed the contribution of soil organic matter and fine root biomass (≤1 mm.) in soil carbon dioxide flux. The study area is located on the riverbanks of Henares River where it passes through the municipal term of Alcala de Henares (Madrid) in Central Spain. Measurements were performed in spring and autumn of 2009. The study was conducted on four different types of riparian vegetation: natural Mediterranean riparian forest, reforestation of 1994, reforestation of 1999 and riparian grassland without trees. In each area of study 3, 25x25 m, plots were delimited and within each plot three sampling units of 50x50 cm were selected at random. The temperature of the ground was taken during the measures from respiration using a Multi-thermometer (-50°C - +300°C) at 5 cm depth. The moisture content of the ground was measured at 5 cm of depth with a HH2 Moisture meter (Delta Devices, Cambridge, UK). The measures of respiration of the ground were realised in field by means of LCI portable (LC pro ADC Bioscientific, Ltd. UK) connected to a ground respiration camera. We introduced the camera 3 cm into the soil just after eliminating the vegetation grass of the surface of measurement cutting carefully the aerial part, without damaging the roots. Soil CO2 flux measurements were registered after stabilization. Immediately after CO2 measurements, we obtained soil samples by means of a drill of 2.18 cm of diameter taking samples to 10 cm and

  16. The interactive effects of climate change, riparian management, and a non-native predators on stream-rearing salmon

    Science.gov (United States)

    Lawrence, David J.; Stewart-Koster, Ben; Olden, Julian D.; Ruesch, Aaron S.; Torgersen, Christian E.; Lawler, Joshua J.; Butcher, Don P.; Crown, Julia K.

    2014-01-01

    Predicting how climate change is likely to interact with myriad other stressors that threaten species of conservation concern is an essential challenge in aquatic ecosystems. This study provides a framework to accomplish this task in salmon-bearing streams of the northwestern United States, where land-use related reductions in riparian shading have caused changes in stream thermal regimes, and additional warming from projected climate change may result in significant losses of coldwater fish habitat over the next century. Predatory non-native smallmouth bass have also been introduced into many northwestern streams and their range is likely to expand as streams warm, presenting an additional challenge to the persistence of threatened Pacific salmon. The goal of this work was to forecast the interactive effects of climate change, riparian management, and non-native species on stream-rearing salmon, and to evaluate the capacity of restoration to mitigate these effects. We intersected downscaled global climate forecasts with a local-scale water temperature model to predict mid- and end-of-century temperatures in streams in the Columbia River basin; we compared one stream that is thermally impaired due to the loss of riparian vegetation and another that is cooler and has a largely intact riparian corridor. Using the forecasted stream temperatures in conjunction with fish-habitat models, we predicted how stream-rearing Chinook salmon and bass distributions would change as each stream warmed. In the highly modified stream, end-of-century warming may cause near total loss of Chinook salmon rearing habitat and a complete invasion of the upper watershed by bass. In the less modified stream, bass were thermally restricted from the upstream-most areas. In both systems, temperature increases resulted in higher predicted spatial overlap between stream-rearing Chinook salmon and potentially predatory bass in the early summer (2-4-fold increase) and greater abundance of bass. We

  17. The interactive effects of climate change, riparian management, and a nonnative predator on stream-rearing salmon.

    Science.gov (United States)

    Lawrence, David J; Stewart-Koster, Ben; Olden, Julian D; Ruesch, Aaron S; Torgersen, Christian E; Lawler, Joshua J; Butcher, Don P; Crown, Julia K

    2014-06-01

    Predicting how climate change is likely to interact with myriad other stressors that threaten species of conservation concern is an essential challenge in aquatic ecosystems. This study provides a framework to accomplish this task in salmon-bearing streams of the northwestern United States, where land-use-related reductions in riparian shading have caused changes in stream thermal regimes, and additional warming from projected climate change may result in significant losses of coldwater fish habitat over the next century. Predatory, nonnative smallmouth bass have also been introduced into many northwestern streams, and their range is likely to expand as streams warm, presenting an additional challenge to the persistence of threatened Pacific salmon. The goal of this work was to forecast the interactive effects of climate change, riparian management, and nonnative species on stream-rearing salmon and to evaluate the capacity of restoration to mitigate these effects. We intersected downscaled global climate forecasts with a local-scale water temperature model to predict mid- and end-of-century temperatures in streams in the Columbia River basin. We compared one stream that is thermally impaired due to the loss of riparian vegetation and another that is cooler and has a largely intact riparian corridor. Using the forecasted stream temperatures in conjunction with fish-habitat models, we predicted how stream-rearing chinook salmon and bass distributions would change as each stream warmed. In the highly modified stream, end-of-century warming may cause near total loss of chinook salmon-rearing habitat and a complete invasion of the upper watershed by bass. In the less modified stream, bass were thermally restricted from the upstream-most areas. In both systems, temperature increases resulted in higher predicted spatial overlap between stream-rearing chinook salmon and potentially predatory bass in the early summer (two- to fourfold increase) and greater abundance of

  18. VEGETATION MAPPING IN WETLANDS

    Directory of Open Access Journals (Sweden)

    F. PEDROTTI

    2004-01-01

    Full Text Available The current work examines the main aspects of wetland vegetation mapping, which can be summarized as analysis of the ecological-vegetational (ecotone gradients; vegetation complexes; relationships between vegetation distribution and geomorphology; vegetation of the hydrographic basin lo which the wetland in question belongs; vegetation monitoring with help of four vegetation maps: phytosociological map of the real and potential vegetation, map of vegetation dynamical tendencies, map of vegetation series.

  19. The contribution of vegetation to riverbed morphology (Invited)

    Science.gov (United States)

    Bertoldi, W.; Gurnell, A. M.

    2010-12-01

    The occurrence, form and species composition of riparian and aquatic vegetation are all strongly affected by the flow energy regime, sediment calibre and dimensions of river systems. In this paper, we build on field examples to conceptualise how interactions between vegetation and fluvial processes may affect river form across a gradient of river types from high-energy gravel-bed braided rivers to lowland single-thread silt-bed rivers. We explore how different vegetation types (e.g. riparian trees, shrubs, emergent macrophytes), and in some cases particular plant species, can produce similar impacts on the bed topography of rivers of different size, because of their effect on sediment transport flux and sediment cohesion, and a resultant positive feedback that increases the bar or bank height. We illustrate these concepts using two case studies representing extremes of river size and energy. Field and remotely sensed data are used to identify and quantify impacts of vegetation density on the bed morphology of the >1km wide, gravel-bed, braided Tagliamento River (Italy). Analysis of airborne LiDAR data is used to compute a highly detailed digital elevation model, along with data on tree height and density. The comparison between reaches with different tree height and density clearly shows the active role of vegetation in determining river pattern and form, with tree growth rate being the main parameter determining the vegetation effect. Analysis of field measurements of flow patterns and mechanical properties of emergent aquatic macrophytes on the <10m wide, silt-bed, single-thread River Blackwater (England) illustrate the close correspondence of the bed topography with vegetation structures, with position along an energy gradient dictating changes in the structure of the vegetation-bed morphology interaction.

  20. Vegetative regeneration

    Science.gov (United States)

    George A. Schier; John R. Jones; Robert P. Winokur

    1985-01-01

    Aspen is noted for its ability to regenerate vegetatively by adventitious shoots or suckers that arise on its long lateral roots. It also produces sprouts from stumps and root collars; but they are not common. In a survey of regeneration after clearcutting mature aspen in Utah. Baker (1918b) found that 92% of the shoots originated from roots, 7% from root collars, and...

  1. Understory vegetation

    Science.gov (United States)

    Steve Sutherland; Todd F. Hutchinson; Jennifer L. Windus

    2003-01-01

    This chapter documents patterns of species composition and diversity within the understory vegetation layer and provides a species list for the four study areas in southern Ohio. Within each of 108 plots, we recorded the frequency of all vascular plant species in sixteen 2-m² quadrats. We recorded 297 species, including 187 forbs (176 perennials, 9 annuals, 2...

  2. Permafrost in vegetated scree slopes below the timberline - characterization of thermal properties and permafrost conditions by temperature measurements and geoelectrical monitoring

    Science.gov (United States)

    Schwindt, Daniel; Kneisel, Christof

    2010-05-01

    Discontinuous alpine permafrost is expected to exist at altitudes above 2400m a.s.l. at mean annual air temperatures (MAAT) of less than -1°C. Below timberline only a few sites are known, where sporadic permafrost exists in vegetated talus slopes with positive MAAT. Aim of the study is to characterize permafrost-humus interaction, the thermal regime and its influence on temporal and spatial permafrost variability. Results of geophysical and thermal measurements from three talus slopes, located in the Swiss Alps (Engadin, Appenzell) at elevations between 1200 and 1800m a.s.l. with MAAT between 2.8°C and 5.5°C are presented. Parent rock-material of the slopes are granite (Bever Valley, Engadin) and dolomite (Susauna Valley, Engadin; Brüeltobel, Appenzell). Joint application of electrical resistivity tomography (ERT) and refraction seismic tomography (RST) is used to detect and characterize permafrost. To observe temporal and spatial variability in ice content and characteristics year-around geoelectrical monitoring and quasi-3D ERT are used. A forward modeling approach has been applied to validate the results of geoelectrical monitoring. A number of temperature data loggers were installed in different depth of the humus layer and in different positions of the slope to monitor the ground thermal regime. Isolated permafrost has been detected by the combination of ERT and RST in the lower parts of the investigated talus slopes. Results from geophysical measurements and monitoring indicate a high spatial and temporal variability in ice content and ice characteristics (temperature, density, content of unfrozen water) for all sites. A distinct rise of resistivities between November and December indicates a decrease of unfrozen water content, caused by a pronounced cooling in the lower parts of the slope. Decreasing ice content and extent of the permafrost lenses can be observed in decreasing seismic velocities from 2600m/sec in spring to only 1500m/sec in October. Ice

  3. Fire history of coniferous riparian forests in the Sierra Nevada

    Science.gov (United States)

    K. Van de Water; M. North

    2010-01-01

    Fire is an important ecological process in many western U.S. coniferous forests, yet high fuel loads, rural home construction and other factors have encouraged the suppression of most wildfires. Using mechanical thinning and prescribed burning, land managers often try to reduce fuels in strategic areas with the highest fuel loads. Riparian forests, however, are often...

  4. Feasibility of Mapping Riparian Habitats Under Natural Conditions in California

    Science.gov (United States)

    David R. Dawdy

    1989-01-01

    The California State Water Resources Control Board is conducting hearings to set quantity and quality standards for river flows into San Francisco Bay. Comparisons of present conditions with "natural conditions" prior to European settlement were introduced into the hearings. Consumptive use relations were developed for various riparian and water-related...

  5. Identifying spatially integrated floodplains/riparian areas and wetlands

    Science.gov (United States)

    Floodplain delineation may play an important role in managing wetlands and riparian areas at multiple scales - local, state, and federal. This poster demonstrates multiple GIS-based approaches to delimiting floodplains and contrasts these with observed flooding events from a majo...

  6. Panel - People and riparian ecosystems: Past, present, and future

    Science.gov (United States)

    Richard D. Periman; Carol Raish; Frank E. Wozniak; David S. Brookshire; Michael McKee; Christian Schmidt; Tony Barron

    1996-01-01

    The purpose of this panel is to review past, present, and future human needs and desires associated with riparian environments. Our focus concerns the diverse demands, interactions, and expectations that people have for the riverine lands. The discussion is designed to take place within historic, economic, and social/cultural contexts.

  7. Linked in: connecting riparian areas to support forest biodiversity

    Science.gov (United States)

    Marie Oliver; Kelly Burnett; Deanna Olson

    2010-01-01

    Many forest-dwelling species rely on both terrestrial and aquatic habitat for their survival. These species, including rare and little-understood amphibians and arthropods, live in and around headwater streams and disperse overland to neighboring headwater streams. Forest management policies that rely on riparian buffer strips and structurebased management—practices...

  8. Lowland riparian herpetofaunas: the San Pedro River in southeastern Arizona

    Science.gov (United States)

    Philip C. Rosen

    2005-01-01

    Previous work has shown that southeastern Arizona has a characteristic, high diversity lowland riparian herpetofauna with 62-68 or more species along major stream corridors, and 46-54 species in shorter reaches within single biomes, based on intensive fieldwork and museum record surveys. The San Pedro River supports this characteristic herpetofauna, at least some of...

  9. Nitrogen transformation and retention in riparian buffer zones

    NARCIS (Netherlands)

    Hefting, Maria Margaretha

    2003-01-01

    Diffuse pollution of nutrients and pesticides from agricultural areas is increasingly recognised as a major problem in water management. Ecotechnological measures as constructed wetlands and riparian buffer zones clearly have an important role in the reduction of diffuse pollution by removing and

  10. Riparian trees as common denominators across the river flow ...

    African Journals Online (AJOL)

    2014-03-04

    Mar 4, 2014 ... may be a valuable indicator for water stress, while the other measurements might provide ... O'Keeffe, 2000) as the life histories of riparian plants are inti- .... Southern Africa, some in the context of groundwater depend- .... and C. gratissimus were spread out next to a ruler on a white .... The data were log.

  11. A phytosociological study of riparian forests in Benin (West Africa)

    NARCIS (Netherlands)

    Natta, A.K.; Sinsin, B.; Maesen, van der L.J.G.

    2004-01-01

    Floristic ordination and classification of riparian forests in Benin were derived from a comprehensive floristic inventory. TWINSPAN classification and DCA analysis of a data set of 818 plant species and 180 releve's yielded 12 plant communities. Importance of waterways, relief, topography, latitude

  12. Plant Growth and Phosphorus Uptake of Three Riparian Grass Species

    Science.gov (United States)

    Riparian buffers can significantly reduce sediment-bound phosphorus (P) entering surface water, but control of dissolved P inputs is more challenging. Because plant roots remove P from soil solution, it follows that plant uptake will reduce dissolved P losses. We evaluated P uptake of smooth bromegr...

  13. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    Energy Technology Data Exchange (ETDEWEB)

    Akamatsu, Fumikazu, E-mail: f-akamt55@pwri.go.jp [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Toda, Hideshige [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan)

    2011-05-15

    Stable nitrogen isotopic composition ({delta}{sup 15}N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in {delta}{sup 15}N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider {delta}{sup 15}N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: > {delta}{sup 15}N of aquatic insects increases downstream with anthropogenic nitrogen inputs. > {delta}{sup 15}N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. > The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  14. Riparian Sediment Delivery Ratio: Stiff Diagrams and Artifical Neural Networks

    Science.gov (United States)

    Various methods are used to estimate sediment transport through riparian buffers and grass jilters with the sediment delivery ratio having been the most widely applied. The U.S. Forest Service developed a sediment delivery ratio using the stiff diagram and a logistic curve to int...

  15. Riparian Meadow Response to Modern Conservation Grazing Management

    Science.gov (United States)

    Oles, Kristin M.; Weixelman, Dave A.; Lile, David F.; Tate, Kenneth W.; Snell, Laura K.; Roche, Leslie M.

    2017-09-01

    Riparian meadows occupy a small proportion of the public lands in the western United States but they provide numerous ecosystem services, including the production of high-quality forage for livestock grazing. Modern conservation management strategies (e.g., reductions in livestock stocking rates and adoption of new riparian grazing standards) have been implemented to better balance riparian conservation and livestock production objectives on publicly managed lands. We examined potential relationships between long-term changes in plant community, livestock grazing pressure and environmental conditions at two spatial scales in meadows grazed under conservation management strategies. Changes in plant community were not associated with either livestock stocking rate or precipitation at the grazing allotment (i.e., administrative) scale. Alternatively, both grazing pressure and precipitation had significant, albeit modest, associations with changes in plant community at the meadow (i.e., ecological site) scale. These results suggest that reductions in stocking rate have improved the balance between riparian conservation and livestock production goals. However, associations between elevation, site wetness, precipitation, and changes in plant community suggest that changing climate conditions (e.g., reduced snowpack and changes in timing of snowmelt) could trigger shifts in plant communities, potentially impacting both conservation and agricultural services (e.g., livestock and forage production). Therefore, adaptive, site-specific management strategies are required to meet grazing pressure limits and safeguard ecosystem services within individual meadows, especially under more variable climate conditions.

  16. Characterising the water use and hydraulic properties of riparian ...

    African Journals Online (AJOL)

    Daily transpiration was strongly correlated to solar radiation (R2 > 0.81) while the air vapour pressure deficit (VPD) constrained transpiration at high VPD values. We conclude that the water use of the poplar invasions is significantly lower than that of other riparian invasions. The impact of these invasions on the water ...

  17. A COMPARISON OF APPROACHES TO PRIORITIZING SITES FOR RIPARIAN RESTORATION

    Science.gov (United States)

    This study compares the results of Olson and Harris (1997) and Russell et al.(1997)in their work to prioritize sites for riparian restoration in the San Luis Rey River watershed. Olson and Harris defined reaches of the mainstem and evaluated the relative potential for restoration...

  18. Developing rapid methods for analyzing upland riparian functions and values.

    Science.gov (United States)

    Hruby, Thomas

    2009-06-01

    Regulators protecting riparian areas need to understand the integrity, health, beneficial uses, functions, and values of this resource. Up to now most methods providing information about riparian areas are based on analyzing condition or integrity. These methods, however, provide little information about functions and values. Different methods are needed that specifically address this aspect of riparian areas. In addition to information on functions and values, regulators have very specific needs that include: an analysis at the site scale, low cost, usability, and inclusion of policy interpretations. To meet these needs a rapid method has been developed that uses a multi-criteria decision matrix to categorize riparian areas in Washington State, USA. Indicators are used to identify the potential of the site to provide a function, the potential of the landscape to support the function, and the value the function provides to society. To meet legal needs fixed boundaries for assessment units are established based on geomorphology, the distance from "Ordinary High Water Mark" and different categories of land uses. Assessment units are first classified based on ecoregions, geomorphic characteristics, and land uses. This simplifies the data that need to be collected at a site, but it requires developing and calibrating a separate model for each "class." The approach to developing methods is adaptable to other locations as its basic structure is not dependent on local conditions.

  19. Effects of riparian buffers on hydrology of northern seasonal ponds

    Science.gov (United States)

    Randall K. Kolka; Brian J. Palik; Daniel P. Tersteeg; James C. Bell

    2011-01-01

    Although seasonal ponds are common in northern, glaciated, forested landscapes, forest management guidelines are generally lacking for these systems. The objective of this study was to determine the effect of riparian buffer type on seasonal pond hydrology following harvest of the adjacent upland forest. A replicated block design consisting of four buffer treatments...

  20. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    International Nuclear Information System (INIS)

    Akamatsu, Fumikazu; Toda, Hideshige

    2011-01-01

    Stable nitrogen isotopic composition (δ 15 N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in δ 15 N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider δ 15 N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: → δ 15 N of aquatic insects increases downstream with anthropogenic nitrogen inputs. → δ 15 N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. → The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  1. Transpirational water loss in invaded and restored semiarid riparian forests

    Science.gov (United States)

    Georgianne W. Moore; M. Keith Owens

    2011-01-01

    The invasive tree, Tamarix sp., was introduced to the United States in the 1800s to stabilize stream banks. The riparian ecosystem adjacent to the middle Rio Grande River in central NewMexico consists of mature cottonwood (Populus fremontii ) gallery forests with a dense Tamarix understory. We hypothesized that Populus would compensate for reduced competition by...

  2. Riparian erosion vulnerability model based on environmental features.

    Science.gov (United States)

    Botero-Acosta, Alejandra; Chu, Maria L; Guzman, Jorge A; Starks, Patrick J; Moriasi, Daniel N

    2017-12-01

    Riparian erosion is one of the major causes of sediment and contaminant load to streams, degradation of riparian wildlife habitats, and land loss hazards. Land and soil management practices are implemented as conservation and restoration measures to mitigate the environmental problems brought about by riparian erosion. This, however, requires the identification of vulnerable areas to soil erosion. Because of the complex interactions between the different mechanisms that govern soil erosion and the inherent uncertainties involved in quantifying these processes, assessing erosion vulnerability at the watershed scale is challenging. The main objective of this study was to develop a methodology to identify areas along the riparian zone that are susceptible to erosion. The methodology was developed by integrating the physically-based watershed model MIKE-SHE, to simulate water movement, and a habitat suitability model, MaxEnt, to quantify the probability of presences of elevation changes (i.e., erosion) across the watershed. The presences of elevation changes were estimated based on two LiDAR-based elevation datasets taken in 2009 and 2012. The changes in elevation were grouped into four categories: low (0.5 - 0.7 m), medium (0.7 - 1.0 m), high (1.0 - 1.7 m) and very high (1.7 - 5.9 m), considering each category as a studied "species". The categories' locations were then used as "species location" map in MaxEnt. The environmental features used as constraints to the presence of erosion were land cover, soil, stream power index, overland flow, lateral inflow, and discharge. The modeling framework was evaluated in the Fort Cobb Reservoir Experimental watershed in southcentral Oklahoma. Results showed that the most vulnerable areas for erosion were located at the upper riparian zones of the Cobb and Lake sub-watersheds. The main waterways of these sub-watersheds were also found to be prone to streambank erosion. Approximatively 80% of the riparian zone (streambank

  3. Variation in experimental flood impacts and ecogeomorphic feedbacks among native and exotic riparian tree seedlings

    Science.gov (United States)

    Kui, L.; Stella, J. C.; Skorko, K.; Lightbody, A.; Wilcox, A. C.; Bywater-Reyes, S.

    2012-12-01

    Flooding interacts with riparian plants on a variety of scales, resulting in coevolution of geomorphic surfaces with plant vegetation communities. Our research aims to develop a mechanistic understanding of riparian seedling damage from small floods, with a focus on differential responses among species (native and non-native), ecogeomorphic feedbacks, and implications for riparian restoration. We tested the effects of controlled flood events on cottonwood (Populus fremontii) and tamarisk (Tamarix spp.) seedlings in an experimental meandering stream channel. We hypothesized that seedling dislodgement and burial would be influenced by individual plant height, species-specific morphology, patch density, and differences in hydraulic forces (as a function of location on the bar). Four experimental floods were tested, with different combinations of plant species and seedling densities. For each flood run, rooted seedlings were installed within a 1.5-m-wide sandbar during low flow conditions and stream discharge was increased to a constant flood level for approximately 8 hours, after which seedling response was assessed. Seedling damage was analyzed within a logistic regression framework that predicted the probability of dislodgement or burial as a function of the explanatory variables. Plant dislodgement depended on root length and the location on the sandbar, whereas burial depended on plant height, species-specific morphology, and location. For every centimeter increase in plant height, the odds of plant burial decreased by 10 percent, illustrating the rate at which plants developed flood resistance as they grow taller. With every meter closer to the thalweg, plant dislodgement was four times more likely, and plant burial was 2.6 times more likely. The probability of burial was twice as great for tamarisk seedlings as for cottonwood. The increased sedimentation within tamarisk patches was associated with a denser foliage and a more compact crown for this species. The

  4. Inundation and Fire Shape the Structure of Riparian Forests in the Pantanal, Brazil.

    Science.gov (United States)

    Arruda, Wellinton de Sá; Oldeland, Jens; Paranhos Filho, Antonio Conceição; Pott, Arnildo; Cunha, Nicolay L; Ishii, Iria Hiromi; Damasceno-Junior, Geraldo Alves

    2016-01-01

    Inundation and fire can affect the structure of riparian vegetation in wetlands. Our aim was to verify if there are differences in richness, abundance, basal area, composition and topographic preference of woody species in riparian forests related to the fire history, flooding duration, or the interaction between both. The study was conducted in the riparian forests of the Paraguay River some of which were burned three times between 2001 and 2011. We sampled trees with a girth of at least 5 cm at breast height in 150 5 × 10 m plots (79 burned and 71 unburned). We also measured height of the flood mark and estimated the flooding duration of each plot. We performed Generalized Linear Mixed Models to verify differences in richness, basal area, and abundance of individuals associated to interaction of fire and inundation. We used an analysis of similarity (ANOSIM) and indicator species analysis to identify differences in composition of species and the association with burned and unburned area according to different levels of inundation. Finally, we used a hierarchical set of Generalized Linear Models (GLM), the so-called HOF models, to analyse each species' specific response to inundation based on topography and to determine their preferred optimal topographic position for both burned as well as unburned areas. Richness was positively associated with elevation only in burned areas while abundance was negatively influenced by inundation only in burned areas. Basal area was negatively associated with time of inundation independent of fire history. There were 15 species which were significant indicators for at least one combination of the studied factors. We found nine species in burned areas and 15 in unburned areas, with response curves in HOF models along the inundation gradient. From these, five species shifted their optimal position along the inundation gradient in burned areas. The interaction of fire and inundation did not appear to affect the basal area, but it

  5. Phenology of Guarea macrophylla Vahl (Meliaceae in subtropical riparian forest in southern Brazil

    Directory of Open Access Journals (Sweden)

    A. Müller

    2017-08-01

    Full Text Available Abstract Climate is one of the main factors that affect plant behavior. The phenology of Guarea macrophylla Vahl, which is a small tree used for reforestation of degraded areas, was monitored for 18 months in a riparian forest at the Schmidt Stream, Campo Bom, in the state of Rio Grande do Sul, southern Brazil. Vegetative (leaf fall and leaf flushing and reproductive events were observed, with the latter divided into flowering (flower buds and anthesis and fruiting (unripe, ripening and ripe fruit. Phenological events were related to temperature, photoperiod and precipitation and their seasonality was verified by circular statistical analysis. Vegetative phenophases were continuous; they were not related to climate factors and presented low intensity, emphasizing the perennial aspect of the species. Flowering occurred during spring and summer. Both flower buds and anthesis were related to temperature and photoperiod. Fruiting was constant and went through all stages of development. Unripe fruits developed during the months with the lowest photoperiod and ripen more intensely in winter, on colder days. Ripe fruit became available for dispersal in spring, in times of longer photoperiod and higher temperatures. Except for leaf fall, all other phenological events showed seasonality in their manifestation. The one-month difference between the onsets of the flowering phases observed in this study indicated that local climate changes induced the early occurrence of this phenophase.

  6. A wooded riparian strip set up for nitrogen removal can affect the water flux microbial composition

    Directory of Open Access Journals (Sweden)

    Mizanur Md. Rahman

    2014-02-01

    Full Text Available This research is part of a project aimed at verifying the potential of a specifically assessed wooded riparian zone in removing excess of combined nitrogen from the Zero river flow for the reduction of nutrient input into Venice Lagoon. Specific objectives were pursued to determine seasonal fluctuations of the microbial populations from the input water to a drainage ditch, conveying back the flux into the river after passing through the soil of the wooded riparian strip. The bacterial communities were determined by combined approaches involving cultivation, microscopic methods and DNA based techniques to determine both culturable and total microbial community in water. The results indicate that the size of the bacterial population, including the culturable fraction, increases from the river to the drainage ditch especially on the warm season. The multiple approach here adopted enabled also to demonstrate that the special condition created in the buffer strip supports the development and the metabolism of the microbial community. The nature of the bacterial population, in terms of phylotypes distribution, was investigated by 16S rDNA analysis indicating that the most represented genera belong to Gamma-proteobacteria, which is known to include an exceeding number of important pathogens. In spring, the effect of the buffer strip seems to significantly reduce such a sub-population. The changes observed for the total bacterial community composition become much evident in summer, as revealed by both denaturing gradient gel electrophoresis cluster analysis and by the diversity index calculation. The hydraulic management coupled to the suspension of farming practices and the development of the woody and herbaceous vegetation resulted in a condition suitable for the containment of undesired microbiota (mainly during the spring season while continuing to support denitrification activity (especially throughout the summer as verified by the total nitrogen

  7. Trace element levels in whole blood of riparian villagers of the Brazilian Amazon

    Energy Technology Data Exchange (ETDEWEB)

    Lisboa Rodrigues, Jairo; Lemos Batista, Bruno [Laboratorio de Toxicologia e Essencialidade de Metais, Depto. de Analises Clinicas, Toxicologicas e Bromatologicas, Faculdade de Ciencias Farmaceuticas de Ribeirao Preto-USP, Avenida do Cafe s/n, Monte Alegre, 14040-903, Ribeirao Preto-SP (Brazil); Fillion, Myriam [Centre interdisciplinaire de recherche sur la biologie, la sante, la societe et l' environnement (CINBIOSE), Universite du Quebec a Montreal (Canada); Passos, Carlos J.S. [Faculdade UnB Planaltina (FUP), Universidade de Brasilia, Planaltina (DF) (Brazil); Mergler, Donna [Centre interdisciplinaire de recherche sur la biologie, la sante, la societe et l' environnement (CINBIOSE), Universite du Quebec a Montreal (Canada); Barbosa, Fernando, E-mail: fbarbosa@fcfrp.usp.br [Laboratorio de Toxicologia e Essencialidade de Metais, Depto. de Analises Clinicas, Toxicologicas e Bromatologicas, Faculdade de Ciencias Farmaceuticas de Ribeirao Preto-USP, Avenida do Cafe s/n, Monte Alegre, 14040-903, Ribeirao Preto-SP (Brazil)

    2009-06-15

    Monitoring the nutritional status of essential elements is of critical importance in human health. However, trace element concentrations in biological fluids are affected by environmental and physiological parameters, and therefore considerable variations can occur between specific population subgroups. Brazil is a large country with much food diversity. Moreover, dietary habits differ from north to south. As an example, the traditional populations of the Brazilian Amazon basin are heavily dependent on fish, fruits, vegetables and manioc for their daily sustenance. However, very few studies have examined to what extent these diets reflect adequate nutritional status for essential elements. Then, in the present study we have evaluated the levels of some trace elements (Cu, Co, Zn Sr, and Rb) in the whole blood of a riparian Brazilian Amazonian population and estimated the influence of age and gender on levels and inter-element interactions in the same population. For this, 253 subjects, aged 15 to 87, from 13 communities situated on the banks of the Tapajos, one of the major tributaries of the Amazon, were randomly selected. The values found for cobalt, copper and strontium in whole blood are in the same range as in other populations. On the other hand, the levels of rubidium and zinc may be considered higher. Moreover, gender was shown to influence Zn and Cu levels while age influenced the concentrations of Sr and Rb in men and Cu in women. Given the scarcity of studies examining nutritional status in traditional communities of the Amazon, our study is the first to provide relevant insight into trace element values in this region and inter-element interactions. This paper is also of particular importance for future studies looking at the possible protective effects of traditional Amazon riparian diets against mercury intake from fish consumption.

  8. Trace element levels in whole blood of riparian villagers of the Brazilian Amazon

    International Nuclear Information System (INIS)

    Lisboa Rodrigues, Jairo; Lemos Batista, Bruno; Fillion, Myriam; Passos, Carlos J.S.; Mergler, Donna; Barbosa, Fernando

    2009-01-01

    Monitoring the nutritional status of essential elements is of critical importance in human health. However, trace element concentrations in biological fluids are affected by environmental and physiological parameters, and therefore considerable variations can occur between specific population subgroups. Brazil is a large country with much food diversity. Moreover, dietary habits differ from north to south. As an example, the traditional populations of the Brazilian Amazon basin are heavily dependent on fish, fruits, vegetables and manioc for their daily sustenance. However, very few studies have examined to what extent these diets reflect adequate nutritional status for essential elements. Then, in the present study we have evaluated the levels of some trace elements (Cu, Co, Zn Sr, and Rb) in the whole blood of a riparian Brazilian Amazonian population and estimated the influence of age and gender on levels and inter-element interactions in the same population. For this, 253 subjects, aged 15 to 87, from 13 communities situated on the banks of the Tapajos, one of the major tributaries of the Amazon, were randomly selected. The values found for cobalt, copper and strontium in whole blood are in the same range as in other populations. On the other hand, the levels of rubidium and zinc may be considered higher. Moreover, gender was shown to influence Zn and Cu levels while age influenced the concentrations of Sr and Rb in men and Cu in women. Given the scarcity of studies examining nutritional status in traditional communities of the Amazon, our study is the first to provide relevant insight into trace element values in this region and inter-element interactions. This paper is also of particular importance for future studies looking at the possible protective effects of traditional Amazon riparian diets against mercury intake from fish consumption.

  9. Susceptibility of riparian wetland plants to perfluorooctanoic acid (PFOA) accumulation.

    Science.gov (United States)

    Mudumbi, J B N; Ntwampe, S K O; Muganza, M; Okonkwo, J O

    2014-01-01

    As plants have been shown to accumulate organic compounds from contaminated sediments, there is a potential for long-lasting ecological impact as a result of contaminant accumulation in riparian areas of wetlands, particularly the accumulation of non-biodegradable contaminants such as perfluorooctanoic acid (PFOA). In this study, commonly found riparian wetland plants including reeds, i.e., Xanthium strumarium, Phragmites australis, Schoenoplectus corymbosus, Ruppia maritime; Populus canescens, Polygonum salicifolium, Cyperus congestus; Persicaria amphibian, Ficus carica, Artemisia schmidtiana, Eichhornia crassipes, were studied to determine their susceptibility to PFOA accumulation from PFOA contaminated riparian sediment with a known PFOA concentration, using liquid chromatography/tandem mass spectrometry (LC/MS/MS). The bioconcentration factor (BCF) indicated that the plants affinity to PFOA accumulation was; E. crassipes, > P. sali-cifolium, > C. congestus, > P. x canescens, > P. amphibian, > F. carica, > A. schmidtiana, > X. strumarium,> P. australis, > R. maritime, > S. corymbosus. The concentration of PFOA in the plants and/or reeds was in the range 11.7 to 38 ng/g, with a BCF range of 0.05 to 0.37. The highest BCF was observed in sediment for which its core water had a high salinity, total organic carbon and a pH which was near neutral. As the studied plants had a higher affinity for PFOA, the resultant effect is that riparian plants such as E. crassipes, X. strumarium, and P. salicifolium, typified by a fibrous rooting system, which grow closer to the water edge, exacerbate the accumulation of PFOA in riparian wetlands.

  10. Long-term monitoring of stream bank stability under different vegetation cover

    Science.gov (United States)

    Krzeminska, Dominika; Skaalsveen, Kamilla; Kerkhof, Tjibbe

    2017-04-01

    Vegetated buffer zones are common environmental measures in many countries, including Norway. The presence of riparian vegetation on stream banks not only provides ecological benefits but also influence bank slope stability, through several complex interactions between riparian vegetation and hydro - mechanical processes. The hydrological processes associated with slope stability are complex and yet difficult to quantify, especially because their transient effects (e.g. changes throughout the vegetation life cycle). Additionally, there is very limited amount of field scale research focusing on investigation of coupled hydrological and mechanical influence of vegetation on stream bank behavior, accounting for both seasonal time scale and different vegetation type, and none dedicated to marine clay soils (typically soil for Norway). In order to fill this gap we established continues, long term hydrogeological monitoring o selected cross - section within stream bank, covered with different types of vegetation, typical for Norwegian agriculture areas (grass, shrubs, and trees). The monitoring involves methods such as spatial and temporal monitoring of soil moisture conditions, ground water level and fluctuation of water level in the stream. Herein we will present first 10 months of monitoring data: observed hydrological trends and differences between three cross - sections. Moreover, we will present first modelling exercises that aims to estimate stream banks stability with accounting on presence of different vegetation types using BSTEM and HYDRUS models. With this presentation, we would like to stimulate the discussion and get feedback that could help us to improve both, our experimental set up and analysis approach.

  11. Vegetation inventory, mapping, and classification report, Fort Bowie National Historic Site

    Science.gov (United States)

    Studd, Sarah; Fallon, Elizabeth; Crumbacher, Laura; Drake, Sam; Villarreal, Miguel

    2013-01-01

    A vegetation mapping and characterization effort was conducted at Fort Bowie National Historic Site in 2008-10 by the Sonoran Desert Network office in collaboration with researchers from the Office of Arid lands studies, Remote Sensing Center at the University of Arizona. This vegetation mapping effort was completed under the National Park Service Vegetation Inventory program which aims to complete baseline mapping inventories at over 270 national park units. The vegetation map data was collected to provide park managers with a digital map product that met national standards of spatial and thematic accuracy, while also placing the vegetation into a regional and even national context. Work comprised of three major field phases 1) concurrent field-based classification data collection and mapping (map unit delineation), 2) development of vegetation community types at the National Vegetation Classification alliance or association level and 3) map accuracy assessment. Phase 1 was completed in late 2008 and early 2009. Community type descriptions were drafted to meet the then-current hierarchy (version 1) of the National Vegetation Classification System (NVCS) and these were applied to each of the mapped areas. This classification was developed from both plot level data and censused polygon data (map units) as this project was conducted as a concurrent mapping and classification effort. The third stage of accuracy assessment completed in the fall of 2010 consisted of a complete census of each map unit and was conducted almost entirely by park staff. Following accuracy assessment the map was amended where needed and final products were developed including this report, a digital map and full vegetation descriptions. Fort Bowie National Historic Site covers only 1000 acres yet has a relatively complex landscape, topography and geology. A total of 16 distinct communities were described and mapped at Fort Bowie NHS. These ranged from lush riparian woodlands lining the

  12. componente vegetal

    Directory of Open Access Journals (Sweden)

    Fabio Moscovich

    2005-01-01

    Full Text Available In order to determine environmental impact, indicators based on vegetation characteristics that would generate the forestry monoculture with the adjacent native forest, 32 sample unit were installed in an area of LIPSIA private enterprise, Esperanza Department, Misiones with those characteristics. The plots of 100 m2 were distributed systematically every 25 meters. The vegetation was divided in stratum: superior (DBH ≥ 10 cm, middle (1,6 cm ≤ DBH > 10 cm and inferior (DBH< cm. There were installed 10 plots in a logged native forest, 10 plots in a 18 years old Pinus elliottii Engelm. with approximately 400 trees/ha., 6 plots in a 10 – 25 years old Araucaria angustifolia (Bertd. Kuntze limiting area with approximately 900 trees/ha., and 6 plots located in this plantation. In the studied area were identified 150 vegetation species. In the inferior stratum there were found differences as function of various floristic diversity indexes. In all the cases the native forest showed larger diversity than plantations, followed by Pinus elliottii, Araucaria plantation and Araucaria limiting area. All the studied forest fitted to a logarithmical series of species distributions, that would indicate the incidence of a environmental factor in this distribution.

  13. Sediment dynamics in the restored reach of the Kissimmee River Basin, Florida: A vast subtropical riparian wetland

    Science.gov (United States)

    Schenk, E.R.; Hupp, C.R.; Gellis, A.

    2012-01-01

    Historically, the Kissimmee River Basin consisted of a broad nearly annually inundated riparian wetland similar in character to tropical Southern Hemisphere large rivers. The river was channelized in the 1960s and 1970s, draining the wetland. The river is currently being restored with over 10 000 hectares of wetlands being reconnected to 70 river km of naturalized channel. We monitored riparian wetland sediment dynamics between 2007 and 2010 at 87 sites in the restored reach and 14 sites in an unrestored reference reach. Discharge and sediment transport were measured at the downstream end of the restored reach. There were three flooding events during the study, two as annual flood events and a third as a greater than a 5-year flood event. Restoration has returned periodic flood flow to the riparian wetland and provides a mean sedimentation rate of 11.3 mm per year over the study period in the restored reach compared with 1.7 mm per year in an unrestored channelized reach. Sedimentation from the two annual floods was within the normal range for alluvial Coastal Plain rivers. Sediment deposits consisted of over 20% organics, similar to eastern blackwater rivers. The Kissimmee River is unique in North America for its hybrid alluvial/blackwater nature. Fluvial suspended-sediment measurements for the three flood events indicate that a majority of the sediment (70%) was sand, which is important for natural levee construction. Of the total suspended sediment load for the three flood events, 3%–16% was organic and important in floodplain deposition. Sediment yield is similar to low-gradient rivers draining to the Chesapeake Bay and alluvial rivers of the southeastern USA. Continued monitoring should determine whether observed sediment transport and floodplain deposition rates are normal for this river and determine the relationship between historic vegetation community restoration, hydroperiod restoration, and sedimentation.

  14. Explaining landholders' decisions about riparian zone management: the role of behavioural, normative, and control beliefs.

    Science.gov (United States)

    Fielding, Kelly S; Terry, Deborah J; Masser, Barbara M; Bordia, Prashant; Hogg, Michael A

    2005-10-01

    Water quality is a key concern in the current global environment, with the need to promote practices that help to protect water quality, such as riparian zone management, being paramount. The present study used the theory of planned behaviour as a framework for understanding how beliefs influence decisions about riparian zone management. Respondents completed a survey that assessed their behavioural, normative, and control beliefs in relation to intentions to manage riparian zones on their property. The results of the study showed that, overall, landholders with strong intentions to manage their riparian zones differed significantly in terms of their beliefs compared to landholders who had weak intentions to manage their riparian zones. Strong intentions to manage riparian zones were associated with a favourable cost-benefit analysis, greater perceptions of normative support for the practice and lower perceptions of the extent to which barriers would impede management of riparian zones. It was also evident that willingness to comply with the recommendations of salient referents, beliefs about the benefits of riparian zone management and perceptions of the extent to which barriers would impede riparian zone management were most important for determining intentions to manage riparian zones. Implications for policy and extension practice are discussed.

  15. Characterization of the key aroma compounds in beef and pork vegetable gravies á la chef by application of the aroma extract dilution analysis.

    Science.gov (United States)

    Christlbauer, Monika; Schieberle, Peter

    2009-10-14

    By application of the aroma extract dilution analysis (AEDA) on an aroma distillate isolated from a freshly prepared, stewed beef/vegetable gravy, 52 odor-active compounds were detected in the flavor dilution (FD) factor range of 4-4096. On the basis of high FD factors in combination with the results of the identification experiments, 3-(methylthio)propanal (cooked potato), 3-mercapto-2-methylpentan-1-ol (gravy-like), (E,E)-2,4-decadienal (deep-fried, fatty), 3-hydroxy-4,5-dimethyl-2(5H)-furanone (lovage-like), vanillin (vanilla-like), (E,E)-2,4-nonadienal (deep-fried), and (E)-2-undecenal (metallic) are suggested as key contributors to the aroma of the gravy. To get an insight into the role of the vegetables as sources of gravy odorants, a beef gravy was prepared without vegetables. The AEDA results revealed that, in particular, onions and leek are important sources of gravy aroma compounds, adding particularly the very potent, gravy-like smelling 3-mercapto-2-methylpentan-1-ol to the overall aroma profile. Further compounds that were clearly derived from the vegetables and, thus, are important modifiers of the overall aroma were 4-vinyl-2-methoxyphenol, (E)-beta-damascenone, beta-ionone, 2-isopropyl-3-methoxypyrazine, and 2-(sec-butyl)-3-methoxypyrazine. Interestingly, none of the key odorants detected in the gravy can be assumed to be formed from a reaction between beef and vegetable constituents. A comparison of the odorants in the beef/vegetable gravy with a gravy prepared according to the same procedure, but substituting beef by pork meat, indicated that most of the aroma compounds were identical-although different in FD factors-but the tallowy smelling 12-methyltridecanal was detected as key odorant only in the beef/vegetable gravy.

  16. Preliminary investigation of the transport of small plastic litter along a vegetated riverbank

    Science.gov (United States)

    Liu, Da; Valyrakis, Manousos

    2017-04-01

    Plastics are widely used in consumer products, due to its low cost, low weight and high durability compared to other types of materials. Contamination of marine ecosystems due to plastics (including microplastics) is a challenge that has received a lot of attention due to the significant risks it poses for the environment and human health. Plastics find their way to the ocean from land via the river system. Studying and obtaining a better understanding of the mechanisms contributing to the fate of plastic litter is therefore important in proactively devising methods to reduce their quantity or produce designs to trap plastic pollutants and prevent them from entering the ocean through estuaries. In this context, it is a common observation of hydraulic practitioners and field geomorphologists, that plastic litter can be trapped within riparian vegetation patches along streams or canals, which can be washed away in periods of high flows. To this goal this study aims to use a series of purpose specific physical experiments to examine the mechanisms of dispersion of plastic litter along the water surface of a channel with simulated riparian vegetation. The set of experiments are conducted in a recirculating flume with rigid riverbank and riparian vegetation modeled by a large number of acrylic rods, placed on the top of the riverbank section. Six different sizes of pieces of Styrofoam are used to simulate plastic litter. These are released from different locations upstream and in the vicinity of the riparian vegetation for various configurations (linear, staggered and random) of characteristic solid density. The trajectory of the plastic litter is recorded with a camera offering a top view of the arrangement. From the analysis of this a variety of results are obtained including transport metrics (including transport velocity and time to trapping) and litter-trapping location. The relation between the size of the litter, the vegetation configuration and the traveling

  17. Nile Basin Vegetation Response and Vulnerability to Climate Change: A Multi-Sensor Remote Sensing Approach

    Science.gov (United States)

    Yitayew, M.; Didan, K.; Barreto-munoz, A.

    2013-12-01

    The Nile Basin is one of the world's water resources hotspot that is home to over 437 million people in ten riparian countries with 54% or 238 millions live directly within the basin. The basin like all other basins of the world is facing water resources challenges exacerbated by climate change and increased demand. Nowadays any water resource management action in the basin has to assess the impacts of climate change to be able to predict future water supply and also to help in the negotiation process. Presently, there is a lack of basin wide weather networks to understand sensitivity of the vegetation cover to the impacts of climate change. Vegetation plays major economic and ecological functions in the basin and provides key services ranging from pastoralism, agricultural production, firewood, habitat and food sources for the rich wildlife, as well as a major role in the carbon cycle and climate regulation of the region. Under the threat of climate change and the incessant anthropogenic pressure the distribution and services of the region's ecosystems are projected to change The goal of this work is to assess and characterize how the basin vegetation productivity, distribution, and phenology have changed over the last 30+ years and what are the key climatic drivers of this change. This work makes use of a newly generated multi-sensor long-term land surface data set about vegetation and phenology. Vegetation indices derived from remotely sensed surface reflectance data are commonly used to characterize phenology or vegetation dynamics accurately and with enough spatial and temporal resolution to support change detection. We used more than 30 years of vegetation index and growing season data from AVHRR and MODIS sensors compiled by the Vegetation Index and Phenology laboratory (VIP LAB) at the University of Arizona. Available climate data about precipitation and temperature for the corresponding 30 years period is also used for this analysis. We looked at the

  18. RIP-ET: A riparian evapotranspiration package for MODFLOW-2005

    Science.gov (United States)

    Maddock, Thomas; Baird, Kathryn J.; Hanson, R.T.; Schmid, Wolfgang; Ajami, Hoori

    2012-01-01

    A new evapotranspiration package for the U.S. Geological Survey's groundwater-flow model, MODFLOW, is documented. The Riparian Evapotranspiration Package (RIP-ET) provides flexibility in simulating riparian and wetland transpiration not provided by the Evapotranspiration (EVT) or Segmented Function Evapotranspiration (ETS1) Packages for MODFLOW 2005. This report describes how the RIP-ET package was conceptualized and provides input instructions, listings and explanations of the source code, and an example. Traditional approaches to modeling evapotranspiration (ET) processes assume a piecewise linear relationship between ET flux and hydraulic head. The RIP-ET replaces this traditional relationship with a segmented, nonlinear dimensionless curve that reflects the eco-physiology of riparian and wetland ecosystems. Evapotranspiration losses from these ecosystems are dependent not only on hydraulic head, but on the plant types present. User-defined plant functional groups (PFGs) are used to elucidate the interaction between plant transpiration and groundwater conditions. Five generalized plant functional groups based on transpiration rates, plant rooting depth, and water tolerance ranges are presented: obligate wetland, shallow-rooted riparian, deep-rooted riparian, transitional riparian and bare ground/open water. Plant functional groups can be further divided into subgroups (PFSGs) based on plant size, density or other characteristics. The RIP-ET allows for partial habitat coverage and mixtures of plant functional subgroups to be present in a single model cell. RIP-ET also distinguishes between plant transpiration and bare-ground evaporation. Habitat areas are designated by polygons; each polygon can contain a mixture of PFSGs and bare ground, and is assigned a surface elevation. This process requires a determination of fractional coverage for each of the plant functional subgroups present in a polygon to account for the mixture of coverage types and resulting

  19. Contrasting patterns of groundwater evapotranspiration in grass and tree dominated riparian zones of a temperate agricultural catchment

    Science.gov (United States)

    Satchithanantham, Sanjayan; Wilson, Henry F.; Glenn, Aaron J.

    2017-06-01

    Consumptive use of shallow groundwater by phreatophytic vegetation is a significant part of the water budget in many regions, particularly in riparian areas. The influence of vegetation type on groundwater level fluctuations and evapotranspiration has rarely been quantified for contrasting plant communities concurrently although it has implications for downstream water yield and quality. Hourly groundwater evapotranspiration (ETG) rates were estimated for grass and tree riparian vegetation in southwestern Manitoba, Canada using two modified White methods. Groundwater table depth was monitored in four 21 m transects of five 3 m deep monitoring wells in the riparian zone of a stream reach including tree (Acer negundo; boxelder) and grass (Bromus inermis; smooth brome) dominated segments. The average depths to the groundwater table from the surface were 1.4 m and 1 m for the tree and grass segments, respectively, over the two-year study. During rain free periods of the growing season ETG was estimated for a total of 70 days in 2014 and 79 days in 2015 when diurnal fluctuations were present in groundwater level. Diurnal groundwater level fluctuations were observed during dry periods under both segments, however, ETG was significantly higher (p < 0.001) under trees compared to grass cover in 2014 (a wet year with 72% higher than normal growing season precipitation) and 2015 (a drier year with 15% higher than normal growing season precipitation). The two methods used to estimate ETG produced similar daily and seasonal values for the two segments. In 2014, total ETG was approximately 50% (148 mm) and 100% (282-285 mm) of reference evapotranspiration (ETref, 281 mm) for the grass and tree segments, respectively. In 2015, total ETG was approximately 40% (106-127 mm) and 120% (369-374 mm) of ETref (307 mm) for the grass and tree segments, respectively. Results from the study show the tree dominated portions of the stream reach consumed approximately 2.4 ML ha-1 yr-1 more

  20. Historic carbon burial spike in an Amazon floodplain lake linked to riparian deforestation near Santarém, Brazil

    Directory of Open Access Journals (Sweden)

    L. M. Sanders

    2018-01-01

    Full Text Available Forests along the Amazon Basin produce significant quantities of organic material, a portion of which is deposited in floodplain lakes. Deforestation in the watershed may then have potentially important effects on the carbon fluxes. In this study, a sediment core was extracted from an Amazon floodplain lake to examine the relationship between carbon burial and changing land cover and land use. Historical records from the 1930s and satellite data from the 1970s were used to calculate deforestation rates between 1930 to 1970 and 1970 to 2010 in four zones with different distances from the margins of the lake and its tributaries (100, 500, 1000 and 6000 m buffers. A sediment accumulation rate of  ∼ 4 mm yr−1 for the previous  ∼ 120 years was determined from the 240+239Pu signatures and the excess 210Pb method. The carbon burial rates ranged between 85 and 298 g C m−2 yr−1, with pulses of high carbon burial in the 1950s, originating from the forest vegetation as indicated by δ13C and δ15N signatures. Our results revealed a potentially important spatial dependence of the organic carbon (OC burial in Amazon lacustrine sediments in relation to deforestation rates in the catchment. These deforestation rates were more intense in the riparian vegetation (100 m buffer during the period 1930 to 1970 and the larger open water areas (500, 1000 and 6000 m buffer during 1970 to 2010. The continued removal of vegetation from the interior of the forest was not related to the peak of OC burial in the lake, but only the riparian deforestation which peaked during the 1950s. Therefore, this supports the conservation priority of riparian forests as an important management practice for Amazon flooded areas. Our findings suggest the importance of abrupt and temporary events in which some of the biomass released by deforestation, especially restricted to areas along open water edges, might reach the depositional environments in

  1. Riparian woodland encroachment following flow regulation: a comparative study of Mediterranean and Boreal streams

    Directory of Open Access Journals (Sweden)

    Dolores Bejarano M.

    2011-10-01

    Full Text Available Water development accompanying mankind development has turned rivers into endangered ecosystems. Improving the understanding of ecological responses to river management actions is a key issue for assuring sustainable water management. However, few studies have been published where ecological metrics have been quantified in response to various degrees of flow alteration. In this work, changes in natural distribution of trees and shrubs within the riparian