WorldWideScience

Sample records for riboflavina vitamina b2

  1. Efeitos de diferentes níveis das vitaminas tiamina, riboflavina e piridoxina sobre o desempenho de frangos de corte

    OpenAIRE

    Souza,Ana Lúcia Pozzobon de; Toledo,Geni Salete Pinto de; Costa,Paulo Tabajara Chaves; Alencastro,Ubiratan Gross

    1996-01-01

    O experimento foi conduzido para analisar os efeitos de níveis altos e baixos das vitaminas tiamina (B1), riboflavina (B2) e piridoxina (B6) sobre o desempenho de frangos de corte. Um total de 576 pintos de corte de um dia, foram distribuídos em desenho experimental trifatorial (2³), inteiramente casualizado onde dois níveis (alto e baixo) de cada vitamina foram testados: vitamina B1 (A=3 mg/kg; B=2 mg/kg), vitamina B2 (A=6 mg/kg; B=4 mg/kg) e vitamina B6 (A=4,5 mg/kg; B=3 mg/kg). Deste modo,...

  2. Riboflavina: uma vitamina multifuncional Riboflavin: a multifunctional vitamin

    Directory of Open Access Journals (Sweden)

    Ana Carolina Santos de Souza

    2005-10-01

    Full Text Available Riboflavin, a component of the B2 vitaminic complex, plays important roles in biochemistry, especially in redox reactions, due to the ability to participate in both one- and two-electron transfers as well as acting as a photosensitizer. Accordingly, low intakes of this vitamin have been associated with different diseases, including cancer and cardiovascular diseases. Riboflavin is thought to contribute to oxidative stress through its capacity to produce superoxide but, interestingly, it can also promote the reduction of hydroperoxides. This peculiar and multifunctional behavior allows riboflavin to take part in various biochemical pathways as a nucleophile and an electrophile, turning it into a versatile and important biological compound.

  3. Determinação espectrofotométrica de vitamina B2 (riboflavina) em formulações farmacêuticas empregando sistema de análises por injeção em fluxo

    OpenAIRE

    Aniceto, Clezio; Canaes, Larissa de Souza; Fatibello-Filho, Orlando; Cavalheiro, Carla C. S.

    2000-01-01

    A flow injection spectrophotometric procedure exploiting merging zones is proposed for determining vitamin B2 (riboflavin) in pharmaceutical preparations. The determination is based on the red-colored complex formation between vitamin B2 and silver(I) which was measured at 520 nm. Vitamin B2 was determined in four pharmaceutical preparations in the 1.0 to 50.0 mg L-1 concentration range, with a detection limit of 0.5 mg L-1. The recovery from three samples ranged from 98.0 to 104.0 %. The ana...

  4. Determinação espectrofotométrica de vitamina B2 (riboflavina) em formulações farmacêuticas empregando sistema de análises por injeção em fluxo Spectrophotometric determination of vitamin B2 (riboflavin) in pharmaceutical formulations using flow injection analysis

    OpenAIRE

    Clezio Aniceto; Larissa de Souza Canaes; Orlando Fatibello-Filho; Carla C. S. Cavalheiro

    2000-01-01

    A flow injection spectrophotometric procedure exploiting merging zones is proposed for determining vitamin B2 (riboflavin) in pharmaceutical preparations. The determination is based on the red-colored complex formation between vitamin B2 and silver(I) which was measured at 520 nm. Vitamin B2 was determined in four pharmaceutical preparations in the 1.0 to 50.0 mg L-1 concentration range, with a detection limit of 0.5 mg L-1. The recovery from three samples ranged from 98.0 to 104.0 %. The ana...

  5. Determinação espectrofotométrica de vitamina B2 (riboflavina em formulações farmacêuticas empregando sistema de análises por injeção em fluxo Spectrophotometric determination of vitamin B2 (riboflavin in pharmaceutical formulations using flow injection analysis

    Directory of Open Access Journals (Sweden)

    Clezio Aniceto

    2000-10-01

    Full Text Available A flow injection spectrophotometric procedure exploiting merging zones is proposed for determining vitamin B2 (riboflavin in pharmaceutical preparations. The determination is based on the red-colored complex formation between vitamin B2 and silver(I which was measured at 520 nm. Vitamin B2 was determined in four pharmaceutical preparations in the 1.0 to 50.0 mg L-1 concentration range, with a detection limit of 0.5 mg L-1. The recovery from three samples ranged from 98.0 to 104.0 %. The analytical frequency was 42 h-1 and r.s.d. were lower than 1% for solutions containing 10.0, 30.0 and 50.0 mg L-1 vitamin B2 (n= 10. The results obtained in commercial formulations using the FIA procedure were in good agreement with those obtained by using a conventional fluorimetric procedure (r=0.9998 and also with the label values (r= 0.9997.

  6. Efeitos de diferentes níveis das vitaminas tiamina, riboflavina e piridoxina sobre o desempenho de frangos de corte Effects of different levels of thiamine, riboflavin and pyridoxine on broiler performance

    Directory of Open Access Journals (Sweden)

    Ana Lúcia Pozzobon de Souza

    1996-12-01

    Full Text Available O experimento foi conduzido para analisar os efeitos de níveis altos e baixos das vitaminas tiamina (B1, riboflavina (B2 e piridoxina (B6 sobre o desempenho de frangos de corte. Um total de 576 pintos de corte de um dia, foram distribuídos em desenho experimental trifatorial (2³, inteiramente casualizado onde dois níveis (alto e baixo de cada vitamina foram testados: vitamina B1 (A=3 mg/kg; B=2 mg/kg, vitamina B2 (A=6 mg/kg; B=4 mg/kg e vitamina B6 (A=4,5 mg/kg; B=3 mg/kg. Deste modo, dezoito aves por tratamento (8, em quatro repetições, foram distribuídas em boxes sobre piso e receberam dietas isonutritivas, variando somente em relação às vitaminas estudadas. Os dados foram submetidos a análise de variância e teste de Tukey. Não foram observadas diferenças significativas (P>0,05 entre os tratamentos para todos os parâmetros estudados. Portanto, os resultados deste trabalho sugerem que os níveis das vitaminas B1, B2 e B6, para frangos de corte, podem ser reduzidos em até 66% dos níveis atualmente utilizados, sem prejuízo na performance dos mesmos.An experiment was carried out to evaluate the effècts of high and low levels of vitamins thiamine (B1 ribofiavin (B2 andpyridoxin (B3 on the performance of boilers. A total of 576 day old broiler chicks of both sexes was distributed in a trifactorial (23 completely randomized experimental desing, where two levels (high and low} of each vitamin were tested: vitamin B1 (A=3 mg/kg; B=2 mg/kg; vitamin B2 (A=6 mg/kg; B=4 mg/kg and vitamin B6 (A=4,5 mg/kg; B=3 mg/kg. Therefore, eighteenth birds in each treatment (8, in four replications, were distributed in floor pens andreceived isonutritious diets, varying only in respect to the vitamins studied. Data were submitted to the analysis of variance and Tukey test. No significant differences (P>0.05 among treatments were observed for all parameters studied. Then, the results from this work suggest that the levels of vitamins B1, B2 and B6, for

  7. Efecto antioxidante de la Serotonina en presencia de vitamina B2: un estudio cinético y mecanístico

    Directory of Open Access Journals (Sweden)

    Lihuel Emiliano Gutierrez

    2014-06-01

    Full Text Available La absorción de luz natural por parte de soluciones sensibilizadas produce la degradación de sustratos que son de importancia biológica, muchos de estos procesos ocurren de manera endógena.La vitamina B2 o Riboflavina (Rf es un sensibilizador típico en sistemas biológicos debido a que está presente en mucho de ellos, tanto dentro de los organismos vivos como en su entorno. La irradiación de Rf con luz visible forma el triplete activado (3Rf* que es capaz de reaccionar con el oxígeno disuelto generando las llamadas especies reactivas del oxígeno (ROS, de las cuales es de especial interés el oxígeno singlete [O2 (1Δg]. El sustrato en estudio, la serotonina (Sero, se fotodegrada en presencia de la Rf siguiendo distintas vías, puede encontrarse directamente con 3 Rf* y por medio de una transferencia de carga formar las especies como la riboflavina anión radical (Rf.- o la Serotonina catión radical (Sero.+, o puede encontrarse con las ROS fotogeneradas para dar lugar a una serie de procesos. De estos procesos el de mayor interés para este trabajo, es la desactivación física del oxígeno singlete. Esto último es una propiedad deseable en antioxidantes, ya que se desactiva a la especie oxidante sin dejar productos secundarios. Si bien ya es conocido que la serotonina y otros compuestos indólicos relacionados presentan esta clase de comportamiento fotoquímico, no se han hecho estudios que hayan determinado el mecanismo ni los parámetros cinéticos de la reacción, por este motivo el presente trabajo se enfoca en estos aspectos.

  8. Vitaminas do complexo B: uma breve revisão

    Directory of Open Access Journals (Sweden)

    Aline Rubert

    2017-01-01

    Full Text Available A maioria das vitaminas do complexo B atua como coenzimas de reações de catabolismo dos macronutrientes, os quais produzem energia para o organismo. Este grupo de vitaminas é essencial em pequenas quantidades para o organismo e devem ser obtidas a partir da alimentação, pois não são sintetizadas pelo organismo. Alimentos de origem vegetal são importantes fonte de vitaminas, sendo fundamental fazer parte da dieta alimentar. A ausência sistemática de vitaminas na dieta resulta, quase sempre, em crescimento e desenvolvimento deficientes e outras perturbações orgânicas, configurando-se um quadro sintomatológico característico de carência. O presente trabalho de revisão tem por objetivo o enfoque em vitaminas do complexo B: tiamina (B1, riboflavina (B2 e ácido fólico (B9, seus benefícios à saúde, bem como os métodos analíticos de quantificação das mesmas em alimentos.

  9. Aproveitamento de subproduto industrial de óleos vegetais para produção de riboflavina por Candida guilliermondii DM 644 Utilization industrial waste from vegetal oils riboflavine production by candida guilliermondii DM 644

    Directory of Open Access Journals (Sweden)

    Maria de Lourdes Andrade Pessoa

    2003-12-01

    Full Text Available A produção e consumo de alimentos industrializados têm aumentado a preocupação com suplementação e enriquecimento de alimentos com vitaminas e sais minerais, visando repor as possíveis perdas durante os processos de fabricação, principalmente das vitaminas hidrossolúveis, mais especificamente da vitamina B2 ou riboflavina. Assim sendo, a proposta deste trabalho foi utilizar como componente principal do meio, para produção da riboflavina, um subproduto do refino de óleos vegetais e o microrganismo Candida guillermondii DM 644. A produção da vitamina B2 foi realizada por fermentação em batelada utilizando Erlenmeyer. As condições empregadas foram agitação orbital, ausência de luz, 30°C, e 24h de incubação. A otimização da produção de riboflavina foi realizada através de Delineamento Fatorial Fracionário, para avaliar os efeitos da concentração de matéria graxa, fonte de nitrogênio, pH, velocidade de agitação, fonte de fósforo e extrato de levedura e as possíveis interações. A concentração máxima de riboflavina foi 19,12mg/mL. Os fatores mais importantes para produção de riboflavina foram a concentração de matéria graxa e a fonte de nitrogênio, enquanto que a fonte de fósforo e o extrato de leveduras não estimularam sua biossíntese. A máxima produção foi obtida com matéria graxa a 10g/L, uréia a 2,5g/L e pH 5,0. A velocidade de agitação (200 e 400rpm não interferiu no processo biotecnológico.The ever growing production and consumption of industrialized foods have increased the concern about supplementation and enrichment of food with vitamins and minerals, attempting the replenishment of the possible losses during their production processes, mainly the hydrosoluble vitamins, more specifically B2 vitamin or riboflavin. A subproduct of vegetal oil refining and the microorganism Candida guilliermondii DM 644 were used as the main substrate. The vitamin B2 was produced by the batch

  10. Tiamina e riboflavina: evolução com a maturação de Cabernet Sauvignon e comportamento durante a fermentação com diferentes níveis de anidrido sulfuroso adicionado Thiamine and riboflavin: evolution during ripening of Cabernet Sauvignon and during fermentation with different levels of so2 added

    Directory of Open Access Journals (Sweden)

    Carlos Eugenio Daudt

    1995-01-01

    Full Text Available O objetivo do trabalho foi estudar o comportamento das vitaminas,tiamina (vitamina B1 e riboflavina (vitamina B2,durante a maturação de Vitis vinifera cultivar Cabemet Sauvignon e durante a fermentação do mosto, usando diferentes quantidades de SO2. Os valores mínimos encontrados para tiamina e riboflavina foram respectivamente (ug/100nd: 7,67 e 6,85 com 5,5 °Brix e os máximos foram, respectivamente, 19,35 (na colheita e 15,75 com 12,8 °Brix. A tiamina foi quase totalmente consumida antes da fermentação inicial, aparecendo novamente ao final da mesma. A riboflavina, ao contrário aumentou durante a fermentação. Ambas as vitaminas aumentaram durante a maturação de Cabemet Sauvignon, estando a tiamina presente em maior quantidade. O aumento das quantidades de SO2 adicionado ao mosto, afetou a tiamina numa proporção direta, mas não teve nenhum efeito sobre a riboflavina. A tiamina diminuiu durante a fermentação, ao mesmo tempo em que ocorreu um aumento da riboflavina.The aim of the work was to follow the behaviour of both vitamins, thiamine and riboflavin, during ripening of Vitis vinifera Cabemet Sauvignon and during fermentation of the must using different amounts of SO2. Minimum values for thiamine and riboflavin were, respectivelly, (ug/100ml: 7.67 and 6.85 at 5.5 °Brix and the maximum values were, respectivelly, 19.35 (at harvest and 15.75 at 12.87 °Brix. Thiamine was almost completelly consumed before the start of fermentation showing up again at the end of the process; riboflavin, on the contrary, increased during fermentation. Both vitamins increased during ripening of Cabemet Sauvignon but -in grapes- the amount of thiamine was greater than riboflavin. Fermentation procedures, as increasing levels of SO2, affected thiamine in a direct proportion but did not have any effect upon riboflavin. Thiamine decreased during fermentation and riboflavin increased.

  11. Avaliação dos níveis séricos das vitaminas A, E, C e B2, de carotenóides e zinco, em idosos hospitalizados

    OpenAIRE

    Vannucchi Hélio; Cunha Daniel Ferreira da; Bernardes Mônica M.; Unamuno Maria R. Del Lama

    1994-01-01

    Foram verificados os níveis séricos de zinco, carotenóides e vitaminas A, E, C, B2 em todos os idosos (n = 202) internados nas diversas enfermarias do hospital estudado, no período de fevereiro de 1986 a outubro de 1988. Foram estudados 130 homens e 72 mulheres que apresentaram média de idade de 67,8 anos, com variação entre 60 a 88. A percentagem de níveis séricos deficitários foi de 59,5 para o zinco, 56,5% para a vitamina C, 34,5% para a vitamina B2, 26% para a vitamina E, 13,2% para a vit...

  12. Avaliação dos níveis séricos das vitaminas A, E, C e B2, de carotenóides e zinco, em idosos hospitalizados

    Directory of Open Access Journals (Sweden)

    Vannucchi Hélio

    1994-01-01

    Full Text Available Foram verificados os níveis séricos de zinco, carotenóides e vitaminas A, E, C, B2 em todos os idosos (n = 202 internados nas diversas enfermarias do hospital estudado, no período de fevereiro de 1986 a outubro de 1988. Foram estudados 130 homens e 72 mulheres que apresentaram média de idade de 67,8 anos, com variação entre 60 a 88. A percentagem de níveis séricos deficitários foi de 59,5 para o zinco, 56,5% para a vitamina C, 34,5% para a vitamina B2, 26% para a vitamina E, 13,2% para a vitamina A e 6,8% para os carotenóides. Os idosos portadores de leucoses, magaesôfogo, doença pulmonar obstrutiva crônica e insuficiência cardíaca congestiva constituíram-se no grupo de pacientes com grande prevalência de estado deficitário de zinco e das vitaminas estudadas, resultados que mostram a importância de se investigar as deficiências desses micronutrientes e dão subsídios para a abordagem terapêutica mais racional do paciente idoso internado.

  13. Avaliação dos níveis séricos das vitaminas A, E, C e B2, de carotenóides e zinco, em idosos hospitalizados Assessment of vitamin A, E, C and B2, carotenoid and zinc serum levels in elderly hospital patients

    OpenAIRE

    Hélio Vannucchi; Daniel Ferreira da Cunha; Mônica M. Bernardes; Maria R. Del Lama Unamuno

    1994-01-01

    Foram verificados os níveis séricos de zinco, carotenóides e vitaminas A, E, C, B2 em todos os idosos (n = 202) internados nas diversas enfermarias do hospital estudado, no período de fevereiro de 1986 a outubro de 1988. Foram estudados 130 homens e 72 mulheres que apresentaram média de idade de 67,8 anos, com variação entre 60 a 88. A percentagem de níveis séricos deficitários foi de 59,5 para o zinco, 56,5% para a vitamina C, 34,5% para a vitamina B2, 26% para a vitamina E, 13,2% para a vit...

  14. FONTES DE VITAMINAS NA DIETA DE POPULAÇÕES DO ESTADO DE SÃO PAULO, BRASIL.

    Directory of Open Access Journals (Sweden)

    MARIA JOSé RONCADA

    2007-01-01

    Full Text Available Os dados sobre consumo alimentar de 18 localidades paulistas foram analisados em termos de contribuição percentual dos alimentos no fornecimento das vitaminas A, B1, B2, niacina e C. Com base no per capta médio diário de alimentos consumidos pelas famílias, calculou-se a contribuição proporcional de cada alimento para o total ingerido de cada vitamina. Selecionaram-se, posteriormente, cerca de 10 principais fornecedores desses nutrientes na dieta da população das diferentes localidades estudadas. Fígado, ovos, couve, leite, margarina e peixes foram os principais contribuintes da vitamina A; para a tiamina concorreram feijão, infusão de café, arroz e carne suína. Forneceram riboflavina infusão de café, feijão, leite e carne bovina. Quanto à niacina destacaram-se infusão de café, arroz, carne bovina e feijão. Como principais fontes de vitamina C salientaram-se laranja, couve e tomate.

  15. Avaliação dos níveis séricos das vitaminas A, E, C e B2, de carotenóides e zinco, em idosos hospitalizados Assessment of vitamin A, E, C and B2, carotenoid and zinc serum levels in elderly hospital patients

    Directory of Open Access Journals (Sweden)

    Hélio Vannucchi

    1994-04-01

    Full Text Available Foram verificados os níveis séricos de zinco, carotenóides e vitaminas A, E, C, B2 em todos os idosos (n = 202 internados nas diversas enfermarias do hospital estudado, no período de fevereiro de 1986 a outubro de 1988. Foram estudados 130 homens e 72 mulheres que apresentaram média de idade de 67,8 anos, com variação entre 60 a 88. A percentagem de níveis séricos deficitários foi de 59,5 para o zinco, 56,5% para a vitamina C, 34,5% para a vitamina B2, 26% para a vitamina E, 13,2% para a vitamina A e 6,8% para os carotenóides. Os idosos portadores de leucoses, magaesôfogo, doença pulmonar obstrutiva crônica e insuficiência cardíaca congestiva constituíram-se no grupo de pacientes com grande prevalência de estado deficitário de zinco e das vitaminas estudadas, resultados que mostram a importância de se investigar as deficiências desses micronutrientes e dão subsídios para a abordagem terapêutica mais racional do paciente idoso internado.Serum levels of carotenoids, zinc and vitamins A, E, C and B2 were measured in al (n = 202 the elderly patients hospitalized in different wards of the hospital studied from February 1986 to October 1988. The study was conducted on 130 men and 72 women with a mean age of 67.8 years (range: 60 to 88 years. The percentage of nutritional deficiency was 59.5% for zinc, 56.5% for vitamin C, 34.5% for vitamin B2, 25.9% for vitamin E, 13.2% for vitamin A, and 6.8% for carotenoids. Elderly patients with leucoses, megaesophagus, chronic obstructive pulmonary disease, and congestive heart failure represent a group with a high prevalence of deficiency both of zinc and of the vitamins under study. These results show the importance of detecting deficiencies of these micronutrients and provide a basis for a more rational approach to the treatment of elderly patients.

  16. Teores de tiamina, riboflavina e piridoxina em leites bovinos comercializados na cidade de São Paulo

    Directory of Open Access Journals (Sweden)

    BIANCHINI Rute

    2000-01-01

    Full Text Available A cromatografia líquida de alta eficiência foi empregada para determinar os teores de tiamina, riboflavina e piridoxina em leites em pó, pasteurizados e esterilizados. As vitaminas foram extraídas com ácido tricloroacético 5% (p/v, permanecendo sob vibração ultrassônica por 1 hora. Foram analisadas simultaneamente, empregando-se coluna C18, fase móvel constituída por água:acetonitrila:NH4OH, contendo 0,95g de ácido hexanossulfônico/L. O pH final da solução foi ajustado para 3,6 com fluxo foi de 1,5mL/min. A tiamina e a riboflavina foram detectadas na região do UV e a piridoxina por fluorescência. Os baixos teores de tiamina dificultaram sua quantificação, principalmente nos leites pasteurizados. O uso do detector de fluorescência contribuiu para a quantificação da piridoxina na maior parte dos leites analisados. A riboflavina, por sua vez, presente com teores mais abundantes, pode ser analisada em todas as amostras. A tiamina esteve com teores bem acima dos declarados em algumas marcas de leite em pó, estando a riboflavina com teores abaixo do informado em uma delas. Em algumas marcas de leite em pó e esterilizados, a piridoxina foi encontrada com teores bem abaixo do informado.

  17. Efectos de la deficiencia de riboflavina sobre el desarrollo del tejido dentoalveolar, en ratas

    Directory of Open Access Journals (Sweden)

    Juana Delgadillo

    2009-03-01

    Full Text Available Objetivo: Determinar los cambios histomorfológicos que ocurren en el tejido dentoalveolar de la mandíbula de una progenie de ratas albinas sometidas a dietas con diferentes concentraciones de riboflavina (B2 e iguales concentraciones de los demás nutrientes, durante el periodo de gestación y lactancia, hasta los 28 días de edad. Diseño: Estudio experimental y analítico. Lugar: Centro de Investigación de Bioquímica y Nutrición Alberto Guzmán Barrón, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Material biológico: Crías de ratas albinas Holtzman. Intervenciones: Se utilizó 60 crías de ratas, que fueron progenie de 16 ratas albinas Holtzman, conformándose 4 grupos con capacidad de reproducción y con diferentes requerimientos de riboflavina: Grupo A (100% de requerimiento de B2, Grupo B (50% de B2 Grupo C (25% de B2 y Grupo D (0% de B2. Las crías de cada grupo fueron sacrificadas a los 0, 7, 14, 21 y 28 días de nacimiento, y se sometió a estudios histológicos los tejidos dentoalveolares de 60 crías. Principales medidas de resultados: Alteraciones en la talla, peso corporal y el tejido dentoalveolar de las ratas crías. Resultados: Microscópicamente, el estudio reveló que la carencia total de riboflavina en la dieta materna (0% de B2 ocasiona en el tejido dentoalveolar de las crías cambios histomorfológicos, como pérdida de la polaridad nuclear, presencia de microvacuolas y áreas de pseudo-estratificación en ameloblastos y odontoblastos, disminución del número de células del tejido dentoalveolar, aparición de edema en predentina, disminución de las células activas en el caso de fibroblastos y cementoblastos, notable disminución y adelgazamiento de las fibras colágenas y reducción del grosor de las trabeculas óseas. Alteraciones similares pero en menor cuantía se halló en ratas con deficiencia de B2. Conclusiones: La carencia total de riboflavina (0% en la dieta materna de las

  18. Antimicrobial susceptibility of photodynamic therapy (UVA/riboflavin against Staphylococcus aureus Suscetibilidade antimicrobiana da terapia fotodinâmica (UVA/riboflavina contra Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    Renata Tiemi Kashiwabuchi

    2012-12-01

    Full Text Available PURPOSE: To assess S. aureus in vitro viability after the exposure to ultraviolet light A (UVA and riboflavin (B2. METHODS: Samples of S. aureus in 96 well plates (in triplicate were exposed to riboflavin (B2 and ultraviolet light A (365 nm wavelength at a power density of 3 mW/cm², 8 mm spot diameter, for 30 minutes. Control groups were prepared as well in triplicate: blank control, ultraviolet light A only, riboflavin only and dead bacteria Control. The bacterial viability was measured using fluorescent microscopy. In order to investigate the occurrence of "viable but non-culturable" microorganisms after treatment, the cell viability was also investigated by plate culture procedure onto a broth medium. Statistical analysis was performed using the triplicate values from each experimental condition. RESULTS: No difference was observed among the treatment group and the control samples (p=1. CONCLUSION: The combination of riboflavin 0.1% and ultraviolet light A at 365 nm did not exhibit antimicrobial activity against oxacillin susceptible S. aureus.OBJETIVO: Avaliar a viabilidade celular de S. aureus in vitro após a exposição de riboflavina (B2 e luz ultravioleta A (UVA. MÉTODOS: Amostras de S. aureus colocadas em uma placa de 96 poços (em triplicata foram expostas a riboflavina 0,1% (B2 e luz ultravioleta (comprimento de onda de 365 nm poder de 3 mW/cm², 8 mm de diâmetro, por 30 minutos. Grupos controles foram também preparados em triplicata: controle branco, somente luz ultravioleta A, somente riboflavina e controle morto. A viabilidade bacteriana foi analisada usando microscópio de fluorescência. Para investigar a ocorrência de micro-organismos "viáveis porem não cultiváveis" a viabilidade celular foi avaliada utilizando-se placas de meio de cultivo bacteriano. Analise estatística foi realizada utilizando-se os valores obtidos em triplicata de cada grupo experimental. RESULTADOS: Nenhuma diferença foi observada entre o grupo

  19. Riboflavin

    Science.gov (United States)

    ... Taking riboflavin along with iron, thiamine, and vitamin C by mouth, does not reduce the number or ... 5' Phosphate, Riboflavina, Riboflavine, Vitamin B2, Vitamin G, Vitamina B2, Vitamine B2, Vitamine G.

  20. [Vitamina D. A wonderful drug?].

    Science.gov (United States)

    Casado de Frías, Enrique

    2011-01-01

    During the last years vitamina D receptors have been found in a vast number of tissues and cell types. In paralel, the therapeutic utility of vitamina D has expanded to the prophylaxis of muscular, oncologic, cardiovascular and autoinmmune disorders.

  1. Validação de métodos cromatográficos por clae para análise das vitaminas B1, B2, B6 e niacina naturalmente presentes em farinha de cereais Validation of hplc methods for analysis of vitamins B1, B2, B6 and niacin naturally present in cereal flours

    Directory of Open Access Journals (Sweden)

    Ana Elisa Ferreira Presoto

    2008-01-01

    Full Text Available Complex B vitamins are present in some cereal foods and the ingestion of enriched products contributes to the recommended dietary intake of these micronutrients. To adapt the label of some products, it is necessary to develop and validate the analytical methods. These methods must be reliable and with enough sensitivity to analyze complex B vitamins naturally present in food at low concentration. The purpose of this work is to evaluate, with validated methods, the content of vitamins B1, B2, B6 and niacin in five cereal flours used in food industry (oat, rice, barley, corn and wheat.

  2. Vitamina E y aceites vegetales

    Directory of Open Access Journals (Sweden)

    Morales, M. T.

    2007-03-01

    Full Text Available An interest in vitamin E has increased in recent years due to its potent antioxidant properties and its role in preventing age-related diseases, cardiovascular diseases or Alzheimer. This work describes the biogenesis, bioavailability, nutritional requirements, activity and properties of vitamin E. Vegetable oils constitute one of the main sources of vitamin E dietary intake and an extensive bibliographic revision of this vitamin in vegetable oils is carried out from four points of view: antioxidant properties, health benefits, effects of external agents and effects of processing on vitamin E content and analytical techniques used for its analysis.El interés por la vitamina E ha aumentado en los últimos años debido a su potente poder antioxidante y a su papel frente a enfermedades relacionadas con la edad, trastornos cardiovasculares o Alzheimer. En este trabajo se detallan la biogénesis, biodisponibilidad, requerimientos nutricionales, actividad y propiedades de la vitamina E. Los aceites vegetales constituyen una de las fuentes principales de aporte de vitamina E a través de la dieta, por lo que se lleva a cabo una amplia revisión bibliográfica desde cuatro puntos de vista: vitamina E y propiedades antioxidantes, beneficios para la salud debidos a la ingestión de aceites vegetales, efecto de agentes externos y procesado sobre el contenido de vitamina E y técnicas analíticas utilizadas para su análisis.

  3. Vitaminas y minerales contra el estrés

    OpenAIRE

    Espinosa Hernández, Jose Antonio; Cué Brugueras, Manuel

    2001-01-01

    Se define el estrés como tal, así como los tipos de tratamientos para este. Se expresan las relaciones entre las multivitaminas y minerales y el estr��s y se dan criterios sobre su uso. Se concluye que los principales medicamentos antiestrés encontrados contienen las vitaminas E, B1, B2, B3, B5, B6, B12,C, ácido fólico y minerales cinc y hierro; entre los principales fabricantes se encuentran: Lederle, Rugby, Ayerst, Scherin, Vicks Health Care, Goldline, Squibbs, Miles Inc. y Natural Life.The...

  4. Papel da vitamina D no risco cardiovascular

    OpenAIRE

    Santos, Alejandro

    2011-01-01

    A prevenção da doença cardiovascular (DCV) é umaprioridade global de saúde pública. A vitamina D tem sido classicamente associada à saúde óssea, estando bem estabelecido que a carência de vitamina D provoca raquitismo na idade pediátrica e, osteomalacia e osteoporose na idade adulta. Contudo, hoje sabemos que níveis adequados de vitamina D são essenciais ao bom funcionamento de vários tecidos e órgãos do nossoorganismo, incluindo o sistema cardiovascular.

  5. Alimentos enriquecidos com vitaminas e minerais

    OpenAIRE

    Barroso, Tiago Filipe Reis

    2014-01-01

    Mestrado em Engenharia Alimentar - Qualidade e segurança Alimentar - Instituto Superior de Agronomia - UL O presente estudo teve como objetivo principal, fazer um levantamento dos principais alimentos enriquecidos/fortificados com vitaminas e minerais comercializados em Portugal. Foram igualmente consideradas simulações de dietas com alimentos enriquecidos que poderiam ser administrados durante um dia, e estimou-se o consumo de vitaminas e minerais fornecidos pelos mesmos. Essas doses cons...

  6. Vitamina D y dolor crónico

    OpenAIRE

    Alcántara Montero, A.

    2016-01-01

    La vitamina D, una vitamina liposoluble que se encuentra en algunas fuentes de alimentos naturales, se sintetiza en la piel humana después de la exposición al sol. La insuficiencia y la deficiencia de vitamina D son muy frecuentes en el mundo, lo cual se cree que contribuye a una gran variedad de problemas de salud. La vitamina D durante mucho tiempo ha sido utilizada en combinación con el calcio para mejorar la salud ósea y reducir el riesgo de fracturas. Los suplementos de vitamina D se han...

  7. Erythrocyte vitamin B, and B6 dependent enzymes in adult and newborn Thoroughbred horses

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Cepa Matos

    1996-09-01

    Full Text Available Com o propósito de determinar o estado nutricional de cavalos Puro-Sangue Inglês (PSI em relação à riboflavina (vitamina B2 e à piridoxina (vitamina B6, 10 animais adultos e 30 recém-nascidos foram investigados. Foi observado um bom estado nutricional quanto à riboflavina, notando-se moderada deficiência de piridoxina nos animais adultos, mas não nos recém-nascidos. Estes fatos sugerem que os animais adultos devam receber suplementação com piridoxina.

  8. Teratogenia da vitamina A Vitamin A teratogenicity

    Directory of Open Access Journals (Sweden)

    Maria Helena de Castro Chagas

    2003-09-01

    Full Text Available A vitamina A é essencial à preservação e ao funcionamento normal dos tecidos, assim como, ao crescimento e desenvolvimento. No humano há evidência indireta que a vitamina A em excesso, durante as primeiras semanas de gestação é teratogênica. Do contrário, não há dúvidas sobre os efeitos deletérios, de uma alimentação carente neste micronutriente e sobre a disponibilidade do conhecimento técnico para evitá-los. A preocupação com o fato de que a vitamina A conduziria a teratogenia em humanos, tem retardado a implementação de programas de combate a carência de vitamina A, atingindo principalmente os programas de enriquecimento de alimentos. A literatura é controvertida e dispõe de poucas informações sobre as doses para suplementação de gestantes. Como o retinol circulante materno é controlado homeostaticamente após o consumo de alimentos fonte de vitamina A, espera-se a mesma resposta metabólica após o consumo de alimentos fortificados, indicando que não há risco de teratogenia. Consequentemente, parece altamente improvável que o consumo de alimentos enriquecidos ou de suplementos de vitamina A pré-formada, nas doses unitárias habituais, tenha efeito teratogênico no homem.The vitamin A is essential to the preservation and the normal functioning of tissues, as well as, to the growth and development. In the human being it has indirect evidence that the vitamin A in excess, during the first weeks of gestation is teratogenic. Of the opposite, it does not have doubts on the deleterious effect, of a devoid feeding in this micronutrient and on the availability of the knowledge technician to prevent them. The concern with the fact of that the vitamin A would lead it the teratogenicity in human beings, has delayed the implementation of combat programs the vitamin A lack, mainly reaching the programs of food enrichment. Literature is controverted and makes use of few information on the doses for supplementation of

  9. Vitamina D. Consenso colombiano de expertos

    Directory of Open Access Journals (Sweden)

    David Vásquez-Awad

    2017-11-01

    Full Text Available La Vitamina D ha adquirido importancia no solo por su conocido papel en el mantenimiento de la masa ósea, sino por la evidencia reciente que vincula su deficiencia con patologías cardiovasculares, metabólicas, gineco-obstétricas, oncológicas e infecciosas entre otras. Se han considerado normales niveles por encima de 30 ng/mL y hay una relación inversamente proporcional entre los niveles de Vitamina D y la presencia de patologías diversas, entre las cuales se destacan las osteomusculares que ofrecen más contundencia de la relación en la evidencia. Por eso, la evaluación de los niveles de Vitamina D en población de alto riesgo y el tratamiento de la hipovitaminosis constituyen medidas que el personal de salud debe realizar. La identificación de esta población y la revisión de los esquemas de suplementación representan los objetivos primordiales de este consenso. En forma de sugerencias y recomendaciones, pensando en el impacto que el documento pueda tener en la salud pública, se presenta el Consenso colombiano de Vitamina D que contó con la participación de especialistas de siete ramas de la medicina y la implementación de la técnica Delphi, técnica mundialmente aceptada para este tipo de ejercicios académicos.

  10. Vitaminas y minerales contra el estrés

    Directory of Open Access Journals (Sweden)

    Jose Antonio Espinosa Hernández

    2001-04-01

    Full Text Available Se define el estrés como tal, así como los tipos de tratamientos para este. Se expresan las relaciones entre las multivitaminas y minerales y el estr��s y se dan criterios sobre su uso. Se concluye que los principales medicamentos antiestrés encontrados contienen las vitaminas E, B1, B2, B3, B5, B6, B12,C, ácido fólico y minerales cinc y hierro; entre los principales fabricantes se encuentran: Lederle, Rugby, Ayerst, Scherin, Vicks Health Care, Goldline, Squibbs, Miles Inc. y Natural Life.The stress as such, as well as the types of treatment are defined. The relations between the multivitamins and minerals and the stress are described and criteria about their use are given. It is concluded that the main antistress drugs found contain vitamins E, B1, B2, B3, B5, B6, B12, C, folic acid and the minerals zinc and iron. Lederle, Rugny, Ayerst, Scherin, Vicks Health Care, Goldline, Squibbs, Miles Inc. and Natural Life are among the main manufacturers.

  11. Uso de vitamina A em dermatologia Uso de vitamina A em dermatologia

    Directory of Open Access Journals (Sweden)

    Lorivaldo Minelli

    1978-11-01

    Full Text Available In the present study, the use of the vitamin A in affections of the skin, hair and nails is discussed; and the various dermatological pathologies are also grouped, according to the researched bibliography. The sources of vitamin A, its chemistry and the importance of the lack and/or excess of this vitamin in organism is also studied. The dermatoses to which the use of vitamin A is indicated as therapy are briefly discussedNo presente trabalho, discute-se o emprego da vitamina A em afecções da pele, cabelos e unhas e agrupa-se as várias patologias dermatológicas, de acordo com a bibliografia consultada Estuda-se as fontes produtoras da vitamina A, sua química e importância da carência e/ou excesso dessa vitamina no organismo. Discute-se resumidamente as dermatoses para as quais encontra-se indicações terapêuticas da vitamina A.

  12. Adición de vitaminas y minerales a harinas de maíz y de trigo en México

    Directory of Open Access Journals (Sweden)

    Rosado Jorge L.

    1999-01-01

    Full Text Available En México la deficiencia marginal de algunas vitaminas y minerales afecta la salud y la funcionalidad de un número elevado de mexicanos, por lo que la Secretaría de Salud ha iniciado un programa para promover la adición de nutrimentos a las harinas de trigo y de maíz que se procesan industrialmente. El presente documento expone las bases científicas y tecnológicas para dicha adición. El objetivo primordial es restaurar los nutrimentos que se pierden durante el proceso de obtención de las harinas y durante la fabricación de los alimentos a partir de las harinas; además, se adicionan aquellos nutrimentos cuya presencia es deficiente en una proporción importante de la población y cuya suplementación en la dieta ha demostrado ser benéfica en la salud y la funcionalidad de la población. En la definición de la fórmula para adicionar a las harinas de trigo y maíz se consideraron, además de los factores mencionados, los niveles de absorción de los diferentes nutrimentos, la interacción probable entre nutrimentos y un malgar muy amplio de seguridad, de manera que se eliminara cualquier riesgo de algún efecto adverso en la salud, aun en los niveles más altos de ingestión de los alimentos. Finalmente, se sugieren los compuestos más apropiados para la adición a las harinas considerando su reactividad y sus posibles efectos negativos en la estabilidad de las harinas, así como su biodisponibilidad, su disponibilidad en el mercado y su costo. Con lo anterior se recomienda la adición de 5 mg/kg de tiamina (mononitrato de tiamina, 3 mg/kg de riboflavina (hidroclorhidrato de riboflavina, 35 mg/kg de niacina (nicotinamida, 30 mg/kg de hierro (hierro reducido extrafino y 20 mg/kg de zinc (óxido de zinc para ambas harinas, así como 2 mg/kg y 0.5 mg/kg de ácido fólico para las harinas de trigo y maíz, respectivamente.

  13. Estabilización de disoluciones acuosas de riboflavina por solapamiento espectral Stabilization of aqueous solution of Riboflavin by spectral overlapping

    Directory of Open Access Journals (Sweden)

    Cecilia Gallardo Cabrera

    2011-12-01

    Full Text Available Se evaluó la fotoestabilización de la riboflavina en disolución acuosa a través de solapamiento espectral. En estudios previos se determinó que la longitud de onda a 445 nm promueve la degradación de la riboflavina, por eso se escogieron los colorantes que mejor eficiencia de absorción presentaran a esta longitud de onda. El estudio de fotoprotección consistió en determinar y comparar las constantes de velocidad (k0 de las reacciones de fotodegradación de la riboflavina en disoluciones (80 µM en presencia y ausencia de colorantes a diferentes concentraciones: tartrazina (40, 58, 71 y 187 µM, amarillo ocaso (80, 160, 442 y 1 600 µM y amarillo de quinoleína (80,133, 160 y 1 600 µM. Las cinéticas se realizaron irradiando las muestras en una cámara de simulación solar a 250 W.m-2, a diferentes tiempos y cuantificando la riboflavina residual, mediante cromatografía líquida de alta resolución. Las constantes de velocidad (k0 se determinaron mediante el método integral. En ausencia de colorantes la fotodegradación de la riboflavina obedece a una cinética de orden cero (k0= 0,0012 mg.mL-1×min-1 con un 79,9 % de degradación tras 20 min de exposición a la luz. En presencia de colorantes la estabilidad de la riboflavina mejora significativamente con el aumento de la concentración del colorante empleado; sin embargo, se encontró que el amarillo de quinoleína a bajas concentraciones (The photostabilization of Riboflavin (RF in aqueous solution was evaluated through spectral overlap. Previous studies established that wavelength at 445nm promoted RF degradation; hence dyes that exhibited high absorption performance at 445 nm were selected. The photoprotection study consisted in determining and comparing the rate constants (k0 of the RF photodegradation reactions in solutions (80 µM, both in presence and absence of dyes at different concentrations: tartrazine (40, 58, 71 y 187 µM, sunset yellow (80, 160, 442 y 1 600 µM and

  14. Hiperparatiroidismo secundario al déficit de vitamina D

    OpenAIRE

    López-Ramiro, E.; Rubert, M.; Mahillo, I.; de la Piedra, C.

    2016-01-01

    Introducción: Cada vez está más demostrado el papel de la vitamina D en múltiples patologías, una de ellas el desarrollo de un hiperparatiroidismo secundario al déficit de vitamina D. Los métodos de laboratorio de cuantificación de vitamina D en suero no estaban bien estandarizados hasta ahora, por lo que no podía establecerse con certeza a partir de qué niveles de vitamina D se producían determinadas anomalías como la elevación de la PTH. Nuestro estudio pretende determinar por debajo de qué...

  15. Papel da vitamina B12 na patogenia da mielose funicular

    Directory of Open Access Journals (Sweden)

    Horacio M. Canelas

    1965-12-01

    Full Text Available Foi estudada a absorção da vitamina B12 radioativa em 29 casos de mielose funicular. O diagnóstico baseou-se na clássica sintomatologia neu- rológica e na presença de acloridria gástrica e eventuais alterações hemato-lógicas. As manifestações neurológicas foram avaliadas de modo semiquan-titativo e correlacionadas com os resultados do teste de excreção urinária da vitamina B12. Não foi verificada correlação significante da absorção da vitamina B12, quer com a sintomatologia nuerológica total, quer com as síndromes periférica e funicular dorsal. Contudo, foi encontrada significante correlação negativa entre a síndrome piramidal e a absorção da vitamina B12. Os resultados são confrontados com o papel desempenhado pela vitamina B12 na síntese das bainhas de mielina e do ácido ribonuclêico, sendo salientada a importância dêste último para a vida das células nervosas e dos longos axônios.

  16. Funciones de la vitamina E: Actualización

    Directory of Open Access Journals (Sweden)

    Carmen Febles Fernández

    2002-04-01

    Full Text Available La vitamina E agrupa diferentes compuestos, dentro de los cuales se incluyen los tocoferoles y los tocotrienoles. El más importante en la especie humana es el RRR-alfa-tocoferol. Una de las funciones más importantes atribuidas a la vitamina E es su acción antioxidante. No obstante, se han observado otras no relacionadas con esta acción. Entre estas se encuentran sus efectos sobre la proliferación celular y la acción fagocítica en el sistema inmune, que a su vez se relacionan con el efecto de esta vitamina como mensajero del estado oxidativo celular. Paralelamente, existen evidencias de su relación con la apoptosis. En este trabajo pretendemos profundizar en estas funciones de la vitamina E por sus enormes potencialidades de utilización en la terapia de enfermedades médicas y estomatológicas.Vitamin E comprises different compounds such as tocopherols and tocotrienols. The most important in the human species is RRR-alpha-tocopherol. One of the main functions attributed to vitamin E is its antioxidant action. However, other functions have been observed that are not connected with this action, as its effects on cellular proliferation and the fagocitic action in the immune system that is related at the same time to the effect of this vitamin as a messenger of the oxidative cellular state. Parallel, there are other evidences of its relationship with apoptosis. In this paper we intend to go deep into these functions of vitamin E due to its great potentialities to be used in the therapy of medical and dental diseases.

  17. La Vitamina D y su Importancia en la Salud Humana

    Directory of Open Access Journals (Sweden)

    David Vásquez Awad

    2013-09-01

    Full Text Available En los últimos años, la vitamina D ha cobrado una importancia creciente en razón de que, además de sus beneficios reconocidos sobre el hueso, ha mostrado claros efectos benéficos en enfermedades crónicas, graves y altamente prevalentes como hipertensión, cáncer, síndrome metabólico,diabetes y esclerosis múltiple; igualmente, estados fisiológicos como el embarazo, la adolescencia y el envejecimiento se ven beneficiados, y sus eventuales adversidades mitigadas, si se mantienen niveles adecuados de 25 hidroxi-vitamina D que debieran estar en más de 40 ng/mL. Muy importante resulta entonces la suplementación con vitamina D en muchas situaciones fi siológicas o patológicas y en las dosis adecuadas, las cuales pueden situarse en el rango de 1000 a 2000 UI diarias, con la adherencia requerida para lograr los resultados óptimos que se persiguen.

  18. DIAGNÓSTICO Y TRATAMIENTO DE LA DEFICIENCIA DE VITAMINA D

    OpenAIRE

    Miranda C, Daisy; Leiva B, Laura; León S, José Pablo; de la Maza C, Ma Pía

    2009-01-01

    El estado nutrícional de vitamina D ha cobrado importancia en los últimos años debido a que su deficiencia es altamente prevalente, y además por sus conocidos efectos en el metabolismo óseo, participa en la diferenciación y proliferación celular, función muscular y equilibrio, entre otros. La molécula activa es la 1,25(OH)2D, pero se recomienda medir niveles séricos de 25 OH vitamina D total (es decir la suma de ergocalciferol o vitamina D2 y colecalciferol o vitamina D3), como reflejo del st...

  19. Ultra B2 - Promoção de ligações covalentes do colágeno corneal (Corneal cross-linking no tratamento de ceratocone: resultados preliminares Corneal Cross-linking for the treatment of keratoconus: preliminary results

    Directory of Open Access Journals (Sweden)

    Mirko R. Jankov II

    2008-12-01

    Full Text Available OBJETIVO: Apresentar os resultados visuais e ceratométricos, seis meses após tratamento foto-terapêutico com luz ultravioleta (UV e vitamina B2 (Ultra B2, em pacientes com ceratocone progressivo. MÉTODOS: Vinte e cinco olhos de 20 pacientes (15 homens e 5 mulheres com ceratocone progressivo, determinado pelo aumento de curvatura em exames seriados de topografia corneal, nos últimos seis meses foram avaliados. Acuidade visual não corrigida (UVA, acuidade visual melhor corrigida com óculos (BSCVA, equivalente esférico (SEQ, cilindro refrativo manifesto e a curvatura máxima (max K pré e pós-operatórios (1, 3 e 6 meses foram determinadas. Todos os pacientes foram submetidos ao tratamento Ultra B2 usando riboflavina (vitamina B2 e a luz ultravioleta (UV, 370 nm. O epitélio corneal foi removido após assepsia, colocação de blefarostato e anestesia tópica com proparacaína, por meio de solução de álcool hidratado (20% utilizada por 30 segundos. A córnea foi saturada com vitamina B2 por 15 minutos; em seguida, foi irradiada por luz UV por 30 minutos. Ao final do procedimento, foi colocada lente de contato terapêutica (LCT, mantida até a epitelização total. RESULTADOS: Houve melhora na UVA após o primeiro mês (de 0,15 ± 0,15 para 0,23 ± 0,20, com contínua mudança no terceiro e sexto mês pós-operatório, atingindo a diferença estatisticamente significante nesse período (p=0,025 e p=0,037 respectivamente. BSCVA melhorou de 0,41 ± 0,27 para 0,49 ± 0,29 no sexto mês, sem atingir a diferença estatisticamente significante. A progressão do ceratocone após o procedimento não foi notada em nenhum paciente, em comparação com o avanço topográfico nos 6 meses precedentes. Após 6 meses do procedimento, max K diminuiu em mais que 2,00 D (de 53,02 ± 8,42 para 50,88 ± 6,05 D, SEQ em menos que 1 D (de -3,27 ± 4,08 para -2,68 ± 3,02 D e o cilindro refrativo em menos que 0,5 D (de -2,29 ± 1,77 para -1,86 ± 0,92, sem

  20. B2-B2.5 code benchmarking

    Energy Technology Data Exchange (ETDEWEB)

    Dekeyser, W.; Baelmans, M; Voskoboynikov, S.; Rozhansky, V.; Reiter, D.; Wiesen, S.; Kotov, V.; Boerner, P.

    2011-01-15

    ITER-IO currently (and since about 15 years) employs the SOLPS4.xxx code for its divertor design, currently version SOLPS4.3. SOLPS.xxx is a special variant of the B2-EIRENE code, which was originally developed by an European consortium (FZ Juelich, AEA Culham, ERM Belgium/KU Leuven) in the late eighties and early nineties of the last century under NET contracts. Until today even the very similar edge plasma codes within the SOLPS family, if run on a seemingly identical choice of physical parameters, still sometimes disagree significantly with each other. It is obvious that in computational engineering applications, as they are carried out for the various ITER divertor aspects with SOLPS4.3 for more than a decade now, any transition from one to another code must be fully backward compatible, or, at least, the origin of differences in the results must be identified and fully understood quantitatively. In this report we document efforts undertaken in 2010 to ultimately eliminate the third issue. For the kinetic EIRENE part within SOLPS this backward compatibility (back until 1996) was basically achieved (V. Kotov, 2004-2006) and SOLPS4.3 is now essentially up to date with the current EIRENE master maintained at FZ Juelich. In order to achieve a similar level of reproducibility for the plasma fluid (B2, B2.5) part, we follow a similar strategy, which is quite distinct from the previous SOLPS benchmark attempts: the codes are ''disintegrated'' and pieces of it are run on smallest (i.e. simplest) problems. Only after full quantitative understanding is achieved, the code model is enlarged, integrated, piece by piece again, until, hopefully, a fully backward compatible B2 / B2.5 ITER edge plasma simulation will be achieved. The status of this code dis-integration effort and its findings until now (Nov. 2010) are documented in the present technical note. This work was initiated in a small workshop by the three partner teams of KU Leuven, St. Petersburg

  1. Contextualized B2B Registries

    OpenAIRE

    Radetzki, U; Boniface, M.J.; Surridge, M.

    2007-01-01

    Abstract. Service discovery is a fundamental concept underpinning the move towards dynamic service-oriented business partnerships. The business process for integrating service discovery and underlying registry technologies into busi-ness relationships, procurement and project management functions has not been examined and hence existing Web Service registries lack capabilities required by business today. In this paper we present a novel contextualized B2B registry that supports dynamic regist...

  2. Contenido de vitamina C en zumos de frutas envasados y naturales. Práctica de laboratorio interactiva.

    OpenAIRE

    Milla González, Miguel; Espada Bellido, Estrella

    2016-01-01

    En esta práctica de laboratorio simulada se aplica el método oficial (método del 2,6-diclorofenolindofenol) para determinar el contenido en vitamina C (ácido ascórbico) en un zumo. Hay tres opciones de análisis: contenido en vitamina C en un zumo de marca comercial, contenido en vitamina C en un zumo de marca blanca y contenido en vitamina C en el zumo natural de naranja. Para cada caso, se hacen cinco determinaciones y se calcula el valor medio de vitamina C expresado en mg por 100 mililitro...

  3. Variación del contenido de vitamina C y antocianinas en Myrciaria dubia "camu camu"

    OpenAIRE

    Castro Gómez, Juan C.; Gutiérrez Rodríguez, Freddy; Acuña Amaral, Cinthya; Cerdeira Gutiérrez, Luis A.; Tapullima Pacaya, Alex; Cobos Ruiz, Marianela; Imán Correa, Sixto A.

    2013-01-01

    Myrciaria dubia es un arbusto amazónico que produce varios compuestos nutritivos y bioactivos. Esta investigación se realizó para ampliar el conocimiento relacionado a la vitamina C y antocianinas. Las muestras fueron obtenidas de la Colección de Germoplasma del INIA. La vitamina C y las antocianinas se analizaron con técnicas estándares. El contenido de vitamina C mostró una amplia variación y gradientes de concentración con diferencias significativas en frutos verdes (F = 36, gl = 3, p < 0,...

  4. Demencia por déficit de vitamina B12: reporte de caso

    OpenAIRE

    Junco Bonet, Miguel Damián

    2014-01-01

    Fundamento: la deficiencia de vitamina B12 (cianocobalamina) puede producir varios desórdenes neurológicos, incluida la neuropatía periférica, degeneración subaguda combinada de la médula espinal, neuropatía óptica y alteraciones cognitivas que van desde la confusión leve hasta la demencia o la psicosis. La causa más frecuente de deficiencia de vitamina B12 es la anemia perniciosa. Objetivo: presentar un caso clínico de demencia por déficit de vitamina B12. Caso clínico: paciente masculino de...

  5. Vitamina A e diabetes gestacional Vitamin A and gestational diabetes

    Directory of Open Access Journals (Sweden)

    Larissa Queiroz de Lira

    2010-01-01

    Full Text Available O diabetes mellitus (DM, patologia de caráter crônico e evolutivo, atualmente apresenta configuração de epidemia mundial. O diabetes gestacional, condição associada tanto à resistência à insulina quanto à diminuição da função das células-β, também caracteriza-se pela elevada incidência em diversas populações e grupos étnicos. Recentemente têm sido constatadas fortes evidências para o comprometimento dos níveis de retinol de gestantes com DM em resposta à evolução dessa patologia. Essa condição torna as gestantes diabéticas mais propensas a apresentar estado bioquímico marginal ou deficiente em vitamina A quando comparadas com as de gestação saudável. Dessa maneira, tendo conhecimento sobre o papel fisiológico da vitamina A e as consequências do DM na gestação, esta revisão visa esclarecer o impacto da instalação do DM sobre os níveis de retinol dessas gestantes, bem como, as consequências que o estado de deficiência em vitamina A poderá causar para essas mulheres e para seus lactantes.Diabetes mellitus (DM a pathology with chronic evolution, has now acquired a connotation of global epidemic. Gestational diabetes, a condition associated with insulin resistance and decreased β-cells function is also characterized by a high incidence in different populations and ethnic groups. Recently strong evidence has been found for involvement of retinol levels of pregnant women with DM due to the pathology’s evolution. This condition makes these diabetics prone to have a marginal biochemical profile or a vitamin A deficiency when compared to those of healthy pregnant women. Therefore, with an awareness of the physiological role of vitamin A and consequences of diabetes during pregnancy, this review intends to clarify the impact of DM on retinol levels of these pregnant women and the consequences that vitamin A deficiency may cause to these women and their infants.

  6. Marketing Optimization for B2B Market

    OpenAIRE

    Kaynova Tatyana V.

    2012-01-01

    The article presents market definition B2B, the necessity to optimize marketing B2B market, provides a system for B2B-marketing and developed stages of its formation. On this basis it was identified key factors of customer loyalty and are the stages of development of loyalty programs for customers market B2B.

  7. The Vaporization of B2O3(l) to B2O3(g) and B2O2(g)

    Science.gov (United States)

    Jacobson, Nathan S.; Myers, Dwight L.

    2011-01-01

    The vaporization of B2O3 in a reducing environment leads to formation of both B2O3(g) and B2O2(g). While formation of B2O3(g) is well understood, many questions about the formation of B2O2(g) remain. Previous studies using B(s) + B2O3(l) have led to inconsistent thermodynamic data. In this study, it was found that after heating, B(s) and B2O3(l) appear to separate and variations in contact area likely led to the inconsistent vapor pressures of B2O2(g). To circumvent this problem, an activity of boron is fixed with a two-phase mixture of FeB and Fe2B. Both second and third law enthalpies of formation were measured for B2O2(g) and B2O3(g). From these the enthalpies of formation at 298.15 K are calculated to be -479.9 +/- 41.5 kJ/mol for B2O2(g) and -833.4 +/- 13.1 kJ/mol for B2O3(g). Ab initio calculations to determine the enthalpies of formation of B2O2(g) and B2O3(g) were conducted using the W1BD composite method and show good agreement with the experimental values.

  8. Preformulación de vitamina A en tabletas

    Directory of Open Access Journals (Sweden)

    Mirta Castiñeiras Díaz

    1996-04-01

    Full Text Available Se realizaron estudios acerca de la posible influencia de algunos excipientes en la degradación de vitamina A acetato. Se escogieron excipientes que pudieran hacer posible el futuro diseño de formulaciones de este producto para su producción por compresión directa, dentro de ellas se encuentran: celulosa microcristalina ph 101, manitol, sacarosa, lactosa, almidón de maíz, fosfato de calcio dihidratado, talco, estearato de magnesio y dióxido de silicio. Se comprobó que algunos excipientes como lactosa y talco aceleran la degradación de la vitamina A al coexistir en la formulación de las tabletas. De acuerdo con los resultados obtenidos se diseñaron 4 formulaciones que cumplieron con todos los parámetros tecnológicos, y se lograron formulaciones que mantenían su valoración entre el 90 y el 110 % que es el rango establecido por la USP XXII, después de un año de elaboradas, lo que coincidió con elSeveral studies were carried out about the possible influence of some components in the degradation of vitamin A acetate. There was a selection of components that could make possible the future design of this product formulations for its production by direct compression; among them there are microcristalline cellulose ph 101, mannitol, sucrose, lactose, cornstarch, dehydrated calcium phosphate, talc, magnesium stearate, and silica. Some components, as lactose and talc, were confirmed as accelerators for vitamin A degradation when coexisting in the tablets formulation. According to the results achieved, 4 formulations designed fulfilled all the technological parameters, and there were formulations obtained that kept their valuation between 90 and 110 % (this is the USP XXII established range after a year from its manufacturing, which was coincident with the period of life issued by the manufacturer.

  9. Doseamento de vitamina D em produtos lácteos consumidos em Portugal

    OpenAIRE

    Parreira, Diana; Serra, Maria Celeste; Dias, M. Graça

    2015-01-01

    Objetivo: O presente trabalho apresentou como objetivo a determinação do teor de vitamina D em produtos lácteos disponíveis no mercado português de modo a contribuir para a avaliação da ingestão desta vitamina e estabelecer comparações com os valores apresentados nos respectivos rótulos.

  10. Calcio y vitamina D en la paciente climatérica

    Directory of Open Access Journals (Sweden)

    J.R. Aguilera

    2015-06-01

    La vitamina D aumenta la absorción intestinal de calcio y fosfato. Las bajas concentraciones de vitamina D se asocian con un deterioro de la absorción de calcio, un equilibrio negativo de calcio y un aumento compensatorio en la hormona paratiroidea, lo que provoca resorción ósea excesiva y pérdida de la densidad del hueso.

  11. 32 CFR 806b.2 - Basic guidelines.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Basic guidelines. 806b.2 Section 806b.2 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE ADMINISTRATION PRIVACY ACT PROGRAM Overview of the Privacy Act Program § 806b.2 Basic guidelines. This part implements the Privacy Act of 1974...

  12. Vitamina K: metabolismo e nutrição Vitamin K: metabolism and nutrition

    Directory of Open Access Journals (Sweden)

    Sílvia Maria Custódio das DÔRES

    2001-12-01

    Full Text Available O objetivo desta revisão foi discutir aspectos que envolvem a compreensão do metabolismo da vitamina K e os recentes avanços quanto ao papel da vitamina na nutrição humana. São abordadas questões sobre as fontes da vitamina, sua absorção, distribuição e metabolismo, recomendações dietéticas, avaliação do estado nutricional relacionado à vitamina K e ainda fatores que afetam sua concentração plasmática. Diante das novas evidências sobre a participação da vitamina K no metabolismo ósseo, pesquisas adicionais são necessárias a fim de identificar as possíveis conseqüências à saúde, a longo prazo, de deficiência subclínica desta vitamina. Pesquisadores e comitês futuros encontram um desafio no que se refere a investigar novos requerimentos nutricionais da vitamina.The aim of this study was to discuss the aspects that involve the understanding of vitamin K metabolism and recent advances of its role in human nutrition. The paper presents dietary sources, absorption, distribution in the body and metabolism of vitamin K, nutritional recommendations, evaluation of nutritional status related to the vitamin and factors influencing its plasmatic concentration. In the light of evidences about vitamin K role in bone metabolism, further studies are needed to identify the possible long-term consequences to health of subclinical vitamin K deficiency. A great challenge for researchers and further scientific committees will be certainly concerned with investigation of new nutritional requirements of the vitamin.

  13. EFEITOS DO PROCESSAMENTO INDUSTRIAL DE ALIMENTOS SOBRE A ESTABILIDADE DE VITAMINAS

    Directory of Open Access Journals (Sweden)

    L. F. M. CORREIA

    2008-12-01

    Full Text Available

    O processamento industrial de alimentos promove o prolongamento da sua vida útil, tornando-os mais atraentes ao paladar; entretanto, induz mudanças e interações entre os constituintes de alimentos. Assim, o processamento pode ter um impacto positivo (destruição de inibidores ou formação de complexos desejáveis entre os componentes dos alimentos e os íons metálicos ou um impacto negativo (perdas de nutrientes. Durante o processamento, o alimento é exposto a diversos fatores que podem interferir na sua estrutura e composição nutricional, sendo que temperatura, luz, oxigênio, umidade e pH do meio são os fatores que mais contribuem para essa alteração. A importância da ingestão de alimentos seguros e saudáveis e o conhecimento relacionado a este assunto, ainda disperso e insuficiente, justifi cam a revisão, apresentada por este estudo, sobre a estabilidade de vitaminas em alimentos processados industrialmente. A análise crítica dos estudos encontrados mostra que alguns métodos de processamento industrial retêm melhor as vitaminas enquanto outros promovem uma maior perda. Entre os trabalhos analisados, pôde-se observar maior referência à vitamina C e ao ß-caroteno, sendo que as vitaminas K, D e ácido pantotênico foram as vitaminas menos estudadas. As vitaminas mais sensíveis ao processamento industrial são a vitamina C e tiamina.

  14. CLAE-PI aplicada ao doseamento de vitaminas do complexo B em misturas: fundamentação e validação de método Ion-pair HPLC applied to the assay of the vitamin B group mixture: theorical bases and method validation

    Directory of Open Access Journals (Sweden)

    Eliane Maria Donato

    2004-09-01

    Full Text Available Um método simples e rápido para determinação simultânea das vitaminas nicotinamida, tiamina, piridoxina, riboflavina e pantotenato de cálcio, em associação com minerais, foi desenvolvido por cromatografia líquida de alta eficiência, utilizando a técnica de pareamento iônico, coluna C-8 Perkin Elmer (150 x 4,6 mm DI, partícula 5 mm, poro 80 Å e detector de ultravioleta (210 e 270 nm. A fase móvel composta de água e metanol (894:106, contendo 10 mM de hexanossulfonato de sódio, 0,5% de ácido acético e 0,1% de trietilamina a pH 3,5 promoveu excelente separação das vitaminas. O método foi aplicado com sucesso à forma farmacêutica de comprimidos e drágeas, contendo também minerais. Linearidade, precisão, recuperação e especificidade foram satisfatórias. A taxa de recuperação do método foi de 98% a 102% e os desvios padrão relativos encontrados variaram entre 0,9 e 2,5%.A rapid and simple method for the simultaneous determination of nicotinamide, thiamine, pyridoxine, riboflavin and calcium pantothenate, associated with minerals was developed by high performance liquid chromatography. These vitamins were simultaneously assayed by reversed-phase ion-pair HPLC with C-8 column Perkin Elmer (150 x 4.6 mm, 5 mm, 80 Å and UV detection (210 and 270 nm. A mobile phase of water-methanol (894:106, 10 mM hexanesulfonate, 0,5% acetic acid and 0,1% triethylamine at pH 3.5 allowed the most satisfactory separation of these vitamins. The method was successfully applied to the determination of vitamins in tablets and coated tablets. Linearity, precision, recovery and specificity were always satisfactory. The average recoveries were from 98% to 102% and the relative standard deviations were between 0.9 to 2.5%.

  15. DESARROLLO DE APIO MINIMAMENTE PROCESADO FORTIFICADO CON VITAMINA E, UTILIZANDO LA INGENIERIA DE MATRICES

    Directory of Open Access Journals (Sweden)

    YISELL JOHAN MARTELO CASTAÑO

    2011-01-01

    Full Text Available El objetivo de este trabajo fue desarrollar un producto minimamente procesado fortificado con vitamina E, a partir de apio (Apium graveolens L. var.dulce, utilizando la ingenieria de matrices como metodologia de obtencion de alimentos funcionales. Trozos de apio impregnados al vacio con dl¿¿tocoferol acetato emulsificado en una solucion isotonica al vegetal de NaCl, 1,2%, fueron evaluados en funcion del tiempo de almacenamiento y el envasado (con y sin vacio, en terminos de la cuantificacion de sus propiedades fisicoquimicas, color, textura, estabilidad de la vitamina E y caracteristicas sensoriales. Se formulo la emulsion con el objetivo de adicionar teoricamente un 73% del Valor Diario Recomendado (VDR vitamina E/100 g de apio fresco y su cuantificacion se realizo por HPLC. La respuesta a la impregnacion en la matriz fue de 12,10+-1,15%, lo cual permitio alcanzar un 112% VDR vitamina E/100g apio fresco, manteniendose este contenido durante el almacenamiento de 9 dias en ambos tipos de envasado. Los parametros fisicoquimicos del producto fueron afectados por la IV, el tiempo y el envasado, manteniendo su coloracion verdosa y presentando disminucion en la firmeza. La ingenieria de matrices constituye una metodologia efectiva para el desarrollo de apio minimamente procesado adicionado con vitamina E.

  16. CAPACIDAD ANTIOXIDANTE EN RATAS DIABÉTICAS ROL DE LA VITAMINA E

    Directory of Open Access Journals (Sweden)

    R. Oré Valdivieso

    2014-06-01

    Full Text Available En el presente estudio se analizó el rol antioxidante de la vitamina E, administrada a ratas diabéticas, evaluando los cambios en la glicemia, hemoglobina glicosilada (HbA1c, lipoperoxidación, antioxidantes totales, albúmina y proteínas totales. Se trabajó con 4 grupos de animales de experimentación: I Control, II control más vitamina E (25 mg/día, III Diabético inducidos con estreptozotocina (35 mg/kg y IV Diabético más vitamina E. Después de 8 semanas de tratamiento, con insulina 4 U/kg de peso observamos que en animales diabéticos con suplemento vitamínico mejora la glicemia y disminuyen los niveles de HbA1c. En los grupos diabéticos y control que recibieron vitamina E disminuyen los niveles de lipoperoxidación en un 25%, comparados con los que no recibieron el suplemento. Nuestros resultados sugieren que la vitamina E tiende a mejorar la glicemia, disminuir la HbA1c y peroxidación lipídica y aumenta los antioxidantes totales en el grupo diabético.

  17. Lattice dynamical and thermodynamical properties of ReB2, RuB2, and OsB2 compounds in the ReB2 structure

    International Nuclear Information System (INIS)

    Deligoz, E.; Colakoglu, K.; Ciftci, Y. O.

    2012-01-01

    Structural and lattice dynamical properties of ReB 2 , RuB 2 , and OsB 2 in the ReB 2 structure are studied in the framework of density functional theory within the generalized gradient approximation. The present results show that these compounds are dynamically stable for the considered structure. The temperature-dependent behaviors of thermodynamical properties such as internal energy, free energy, entropy, and heat capacity are also presented. The obtained results are in good agreement with the available experimental and theoretical data

  18. Fisiopatologia da deficiência de vitamina B12 e seu diagnóstico laboratorial

    OpenAIRE

    Paniz,Clóvis; Grotto,Denise; Schmitt,Gabriela Cristina; Valentini,Juliana; Schott,Karen Lílian; Pomblum,Valdeci Juarez; Garcia,Solange Cristina

    2005-01-01

    INTRODUÇÃO: A vitamina B12 é hidrossolúvel, não-sintetizada pelo organismo humano, presente em alimentos de origem animal. Sua deficiência é muito freqüente entre idosos, vegetarianos e indivíduos que adotam baixa dieta protéica ou apresentam problemas de absorção gastrintestinal. FISIOPATOLOGIA: A deficiência de vitamina B12 leva a transtornos hematológicos, neurológicos e cardiovasculares, principalmente, por interferir no metabolismo da homocisteína (Hcy) e nas reações de metilação do orga...

  19. Analise dos efeitos de diferentes parametros na estabilidade de vitamina C em vegetais processados

    OpenAIRE

    Marta de Toledo Benassi

    1990-01-01

    Resumo: O trabalho foi conduzido no sentido de se estudar a estabilidade e verificar a cinética de perda de vitamina C em diferentes processos, utilizando-se como, matéria prima, vegetais selecionados: couve, couve-flor e pimentão. Foram feitos diferentes tipos de cozimento (água, vapor e microondas) e estocagem (temperatura ambiente, refrigerada e congelada), variando-se os tempos e condições de processamento. Foi constatado que as perdas de vitamina C nos produtos, durante o cozimento em ág...

  20. Afectación ocular severa bilateral por déficit de vitamina A

    OpenAIRE

    Ruiz-Martín, MM; Boto-de-los-Bueis, A; Romero-Martín, R

    2005-01-01

    Caso clínico: Se presenta un paciente con pancreatitis crónica alcohólica con una queratitis ulcerativa periférica (QUP) en el ojo derecho (OD) y una úlcera estromal necrotizante e hifema en el ojo izquierdo (OI) asociadas a una malnutrición calórico-proteica con déficit de vitaminas liposolubles. Discusión: Aunque es raro en los países desarrollados, debe considerarse el déficit de vitamina A ante afectación corneal bilateral en pacientes alcohólicos, con patología gastrointestinal, pancreát...

  1. Interação entre vitamina A e ferro em diferentes grupos populacionais

    OpenAIRE

    Netto,Michele Pereira; Priore,Silvia Eloiza; Franceschini,Sylvia do Carmo Castro

    2007-01-01

    A interação entre ferro e vitamina A tem sido alvo de pesquisas científicas, visto que existem questões ainda pouco esclarecidas. Através de um levantamento bibliográfico, mediante consulta à base de dados Medline da National Library of Medicine, Estados Unidos da America, foram selecionadas publicações que tratavam sobre a interação entre ferro e vitamina A em seres humanos, a partir da década de 80 até o ano de 2003. As palavras chave utilizadas no levantamento bibliográfico foram "ferro", ...

  2. Seguimiento a largo plazo de un paciente con raquitismo dependiente de vitamina D tipo I

    OpenAIRE

    Velásquez-Jones, Luis; Medeiros, Mara; Valverde-Rosas, Saúl; Jiménez-Triana, Clímaco; del Moral-Espinosa, Irma; Romo-Vázquez, José Carlos; Franco-Alvarez, Isidro

    2015-01-01

    Introducción: El raquitismo dependiente de vitamina D tipo I es una enfermedad hereditaria rara debida a una mutación en el gen CYP27B1 que codifica la enzima 1α-hidroxilasa. Se caracteriza por la presentación de raquitismo hipocalcémico grave desde la edad de la lactancia debido al déficit de producción del metabolito activo de la vitamina D, la 1α,25-dihidroxivitamina D3. Caso clínico: Presentamos el caso de un paciente con raquitismo diagnosticado a los 11 meses de edad y el seguimiento...

  3. Relação entre renda e consumo alimentar habitual de β-caroteno, vitamina C e vitamina E de crianças

    OpenAIRE

    de Paiva-Bandeira, Geovanna T; Rios-Asciutti, Luiza S; Rivera, Amélia A; Rodrigues-Gonçalves, Maria da Conceição; Pordeus-de-Lima, Rafaella C; Marinho-Albuquerque, Tarciane; de-Morais, Ronei Marcos; de Toledo-Vianna, Rodrigo Pinheiro; de-Oliveira, Adyla Farias; Teixeira-Lima, Roberto; de Carvalho-Costa, Maria J

    2011-01-01

    Objetivo Analisar a relação entre renda e consumo alimentar de b-caroteno, vitamina C e vitamina E em crianças na cidade de João Pessoa, Brasil. Método Foram avaliadas 183 crianças com idade entre 2 e < 10 anos, em uma amostra representativa estratificada por níveis de renda da população de João Pessoa. O instrumento de pesquisa consistiu de questionários que abordaram aspectos sócio-econômicos, demográficos, antropométricos e de consumo alimentar. Analisou-se os resultados com o software R, ...

  4. Vitamina D y cáncer: acción antineoplásica de la 1α, 25(OH2 -vitamina D3

    Directory of Open Access Journals (Sweden)

    Verónica González Pardo

    2012-04-01

    Full Text Available La forma hormonalmente activa de la vitamina D, 1α,25(OH2-vitamina D3 (1α,25(OH2D3, además de desempeñar un rol crucial en el mantenimiento de la homeostasis de calcio en el cuerpo, también regula el crecimiento y la diferenciación de diferentes tipos celulares, incluyendo células cancerosas. Actualmente hay numerosos estudios que investigan los efectos de la hormona en estas células, debido al interés en el uso terapéutico del 1α,25(OH2D3 y de análogos con menor actividad calcémica para el tratamiento o prevención del cáncer. En este trabajo de revisión se describe el sistema endocrino de la vitamina D, su mecanismo de acción, su acción antineoplásica y se provee información sobre los últimos avances en el estudio de nuevos análogos de la hormona con menos actividad calcémica para el tratamiento del cáncer.

  5. B11 NMR in the layered diborides OsB2 and RuB2

    Science.gov (United States)

    Suh, B. J.; Zong, X.; Singh, Y.; Niazi, A.; Johnston, D. C.

    2007-10-01

    B11 nuclear magnetic resonance (NMR) measurements have been performed on B11 enriched OsB2 and RuB2 polycrystalline powder samples in an external field of 4.7T and in the temperature range, 4.2KOsB2 and RuB2 , respectively. The experimental results indicate that a p character dominates the conduction electron wave function at the B site with a negligibly small s character in both compounds.

  6. Ni-ZrB2 electrocomposites

    International Nuclear Information System (INIS)

    Pushpavanam, M.; Natarajan, S.R.

    1992-01-01

    New generation materials require high temperature oxidation resistance besides many other tribological properties. Ni-ZrB 2 composites and their properties are dealt with in this paper. (author). 7 refs., 3 figs., 4 tabs

  7. A Model of B2B Exchanges

    OpenAIRE

    Gabor Fath; Miklos Sarvary

    2001-01-01

    B2B exchanges are revolutionizing the way businesses will buy and sell a variety of intermediary products and services. It is estimated that most of the roughly $7 trillion worth of business transactions are likely to go through these new institutions within the next decade. This paper tries to understand the economics governing the transactions within B2B exchanges and analyze their likely evolution over time. In doing so, we start by providing the rigorous definitions to a number of critica...

  8. Hotelzon's B2B content marketing plan

    OpenAIRE

    Nguyen, Trang

    2015-01-01

    This thesis follows a research-based structure. The objective of this research was to help the case company Hotelzon develop a practical business-to-business (B2B) content marketing plan to engage new customers. The research topic came up when the case company named Hotelzon started expanding its business to many other countries. Therefore, attracting new prospects has become a critical issue to B2B corporates in this online world and constantly changing business environment. The first pa...

  9. Ultra B2 - Promoção de ligações covalentes do colágeno corneal (Corneal cross-linking) no tratamento de ceratocone: resultados preliminares

    OpenAIRE

    Jankov, Mirko R; Hafezi, Farhad; Beko, Maja; Ignjatovic, Zora; Djurovic, Branislav; Markovic, Vujica; Schor, Paulo

    2008-01-01

    OBJETIVO: Apresentar os resultados visuais e ceratométricos, seis meses após tratamento foto-terapêutico com luz ultravioleta (UV) e vitamina B2 (Ultra B2), em pacientes com ceratocone progressivo. MÉTODOS: Vinte e cinco olhos de 20 pacientes (15 homens e 5 mulheres) com ceratocone progressivo, determinado pelo aumento de curvatura em exames seriados de topografia corneal, nos últimos seis meses foram avaliados. Acuidade visual não corrigida (UVA), acuidade visual melhor corrigida com óculos ...

  10. Vitamina A em dieta de juvenis de pacu cultivados em tanques-rede

    Directory of Open Access Journals (Sweden)

    Arcangelo Augusto Signor

    2013-08-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da suplementação de vitamina A na alimentação de juvenis de pacu cultivados em tanques-rede. Foram utilizados 2.000 peixes, com peso inicial médio de 66,93±15,03 g, distribuídos em delineamento inteiramente casualizado, em 20 tanques-rede de 5,0 m³, com cinco tratamentos e quatro repetições. As rações foram formuladas com 0, 3.000, 6.000, 9.000 e 12.000 UI de vitamina A por quilograma de dieta, por meio da suplementação com acetato de retinol. O arraçoamento foi realizado às 8:30, 13:30 e 17:30 h, até a saciedade aparente dos animais. Não foram observadas diferenças quanto aos parâmetros de desempenho produtivo, rendimento e composição química da carcaça, e aos parâmetros hematológicos e lipídios no fígado dos peixes que foram alimentados com diferentes níveis de vitamina A. A suplementação de vitamina A em dietas para juvenis de pacu criados em tanques-rede não influencia o desempenho produtivo dos peixes.

  11. Wssv y temperatura, inmunoestimulantes, vitaminas... ¿cómo se relaciona todo?

    OpenAIRE

    Rodriguez, Jenny; Echeverría, Fabrizio; Sonneholznher, Stanislaus; Molina, César; Gullian, Mariel

    2001-01-01

    WSSV y temperatura, inmunoestimulantes, vitaminas... ¿Cómo se relaciona todo? Los experimentos desarrollados a la fecha indican que a temperatura de 33°C disminuye tanto la prevalencia (porcentaje de animales positivos) como la intensidad de la infección en juveniles y en larvas (Boletín Septiembre 15).

  12. Fluctuación diurna del contenido de vitamina C en hojas de Myrciaria dubia “camu camu”

    Directory of Open Access Journals (Sweden)

    Franz Correa Meléndez

    2013-12-01

    Full Text Available Myrciaria dubia “camu camu” es un frutal del trópico amazónico caracterizado por sus frutos con gran contenido de vitamina C, siendo considerado un producto importante del país. Sin embargo, hay pocos reportes sobre el metabolismo y transporte de vitamina C en esta especie. El objetivo de la investigación fue determinar la fluctuación diurna del contenido de vitamina C en hojas de M. dubia “camu camu”. Las hojas se colectaron de la colección de germoplasma de “camu camu” del INIA a las 2, 6, 10, 14, 18 y 22 horas; de cuatro plantas y en tres fechas diferentes. La vitamina C fue extraída de las hojas con un método estandarizado en el laboratorio y se cuantificó mediante espectrofotometría a 530nm, previa reacción con 2,6-diclorofenolindofenol. Los resultados muestran que el contenido de vitamina C de las hojas de “camu camu” fue en promedio 231±35 mg vitamina C/100g de hoja. Además, el contenido de vitamina C en las hojas del “camu camu” mostró fluctuación diurna, siendo menor a las 6 horas y mayor a las 2 y 14 horas del día. También, se registraron concentraciones intermedias en horas de menor o ausencia de radiación solar (235±17 y 237±35 mg vitamina C/100g de hoja a las 18 y 22 horas respectivamente. Se concluye que existe alto contenido de vitamina C en las hojas del “camu camu” y que este contenido presenta fluctuación diurna.

  13. Comparison of monoclonal antibodies and rabbit antisera in B2 microglobulin (B2m) radioimmunoassay

    International Nuclear Information System (INIS)

    Vincent, C.

    1981-01-01

    Human B2m is a globular protein devoid of carbohydrates and is composed of 100 aminoacids with an intrachain disulfide bridge in position 25-81. Its aminoacid sequence and three dimensional structure shows a partial homology with the constant domains of immunoglobulins. B2m has been detected at the surface of nearly all cell types with the exception of erythrocytes and trophoblastic cells and also in all biological fluids. On the cell surface B2m is found non-covalently associated with HLA molecules, and in serum and urine only a small part of the B2m is associated with HLA heavy chain, the remaining is found as free B2m. The aim of this paper is firstly to try to demonstrate the presence of two types of epitopes one of them specific of free B2m and secondly to compare monoclonal antibodies with rabbit antisera for B2m radioimmunoassay. (Auth.)

  14. DEGRADAÇÃO DA VITAMINA C EM SUCO DE FRUTA

    Directory of Open Access Journals (Sweden)

    M. TEIXEIRA

    2009-01-01

    Full Text Available

    A vitamina C participa de inúmeras reações no organismo humano, sendo responsável, por exemplo, pela síntese e manutenção do colágeno e pela síntese de importantes neurotransmissores. O homem não sintetiza a vitamina C tornando necessária sua ingestão pela dieta alimentar. Frutas como acerola, cupuaçu, goiaba e laranja são importantes fontes de vitamina C na dieta. A produção de polpas e sucos vem sendo estimulada devido à sazonalidade da produção e à perecibilidade das frutas. Contudo, durante a produção de sucos de fruta e ao longo de sua vida-de-prateleira pode ocorrer degradação da vitamina C. Os principais fatores que influenciam na degradação da vitamina C dos sucos de fruta são o tipo de processamento, as condições de estocagem, o tipo de embalagem, a presença de oxigênio, de luz e de enzimas.

  15. Electronic structure of MgB2

    Indian Academy of Sciences (India)

    Abstract. Results of ab initio electronic structure calculations on the compound MgB2 using the. FPLAPW method employing GGA for the exchange-correlation energy are presented. Total energy minimization enables us to estimate the equilibrium volume, c/a ratio and the bulk modulus, all of which are in excellent ...

  16. Electronic structure of MgB 2

    Indian Academy of Sciences (India)

    Results of ab initio electronic structure calculations on the compound MgB2 using the FPLAPW method employing GGA for the exchange-correlation energy are presented. Total energy minimization enables us to estimate the equilibrium volume, / ratio and the bulk modulus, all of which are in excellent agreement with ...

  17. Vitamina B12, Acido Fólico y Función Mental en Adultos Mayores

    OpenAIRE

    Meertens-R, Lesbia; Solano-R, Liseti

    2005-01-01

    Los adultos mayores constituyen un grupo de población vulnerable a cuadros de deficiencias de nutrientes específicos como la vitamina B12 y el ácido fólico, íntimamente ligados al deterioro de las funciones mentales, en especial, del área cognitiva. El objetivo de este estudio fue determinar indicadores del estado de vitamina B12 y ácido fólico y asociarlos a la evaluación de la función mental de 53 adultos mayores de 60 años de edad, residenciados en un hogar geriátrico. Se evaluó consumo di...

  18. Thermodynamic properties of vitamin B2

    International Nuclear Information System (INIS)

    Knyazev, A.V.; Letyanina, I.A.; Plesovskikh, A.S.; Smirnova, N.N.; Knyazeva, S.S.

    2014-01-01

    Graphical abstract: - Highlights: • Temperature dependence of heat capacity of vitamin B 2 has been measured by precision adiabatic vacuum calorimetry. • The thermodynamic functions of the vitamin B 2 have been determined for the range from T → 0 to 322 K. • The energy of combustion of the riboflavin has been measured at 298.15 K. • The enthalpy of combustion Δ c H° and the thermodynamic parameters Δ f H°, Δ f S°, Δ f G° have been calculated. - Abstract: In the present work temperature dependence of heat capacity of vitamin B 2 (riboflavin) has been measured for the first time in the range from 6 to 322 K by precision adiabatic vacuum calorimetry. Based on the experimental data, the thermodynamic functions of the vitamin B 2 , namely, the heat capacity, enthalpy H°(T) − H°(0), entropy S°(T) − S°(0) and Gibbs function G°(T) − H°(0) have been determined for the range from T → 0 to 322 K. The value of the fractal dimension D in the function of multifractal generalization of Debye's theory of the heat capacity of solids was estimated and the character of heterodynamics of structure was detected. In a calorimeter with a static bomb and an isothermal shield, the energy of combustion of the riboflavin has been measured at 298.15 K. The enthalpy of combustion Δ c H° and the thermodynamic parameters Δ f H°, Δ f S°, Δ f G° and of reaction of formation of the riboflavin from simple substances at T = 298.15 K and p = 0.1 MPa have been calculated

  19. Mielopatia por deficiência de vitamina B12 apresentando-se como mielite transversa

    Directory of Open Access Journals (Sweden)

    Vasconcellos Luiz Felipe Rocha

    2002-01-01

    Full Text Available As manifestações neurológicas associadas à deficiência de vitamina B12 incluem polineuropatia, mielopatia, demência e neuropatia óptica. O diagnóstico laboratorial é feito através da dosagem sérica de cianocobalamina ou homocisteína e da excreção urinária de ácido metilmalônico. No estudo anatomopatológico observa-se na microscopia a destruição da mielina e de axônios vistos na substância branca. A região mais comumente afetada é o cordão posterior cervical e/ou torácico. O acometimento da coluna lateral é raro, ocorrendo em casos graves e avançados. O tratamento consiste na reposição de vitamina B12 e a resposta depende da gravidade do quadro e do tempo transcorrido entre o inicio dos sintomas e inicio do tratamento. Relatamos o caso de um paciente que apresentou, como manifestação de deficiência de vitamina B12, mielite transversa. O estudo morfológico da medula demonstrou comprometimento dos tractos cortico-espinhais lateral e anterior, da coluna dorsal e ainda do tracto espino-talâmico.

  20. FORTIFICACIÓN DE PULPA DE UCHUVA CON CALCIO, OLIGOFRUCTOSA Y VITAMINA C, ESTABILIZADA CON HIDROCOLOIDE

    Directory of Open Access Journals (Sweden)

    ALBA LUCIA DUQUE

    2014-06-01

    Full Text Available La pulpa de uchuva fortificada con calcio, oligofructosa y vitamina C es un alimento funcional con grandes beneficios para la salud. Para ello se le adicionó componentes biológicamente activos, como ácidos grasos, fibra alimentaria y antioxidantes. En este trabajo se estudió la estabilidad de la pulpa enriquecida en diferentes formulaciones, teniendo en cuenta los criterios de incorporación de calcio y vitamina C (20% del valor diario recomendado VDR y para la oligofructosa (fibra dietaría en relación 1:1 con el calcio. Los resultados obtenidos mostraron que la pulpa de uchuva fortificada con CMC, ologofructosa, calcio y vitamina C presentó en promedio una estabilidad de 87,7±10,0; una viscosidad de 22,8±7,9; una aw de 0,9863±0; pH de 3,3±0,1; acidez de 1,6±0,1; grados Brix de 13,3±0,7; una densidad de 1,32±0 g/mL y las mejores respuestas sensoriales en cuanto a color, aroma, fluidez y sabor.

  1. Effect of TiB2 Pretreatment on Pt/TiB2 Catalyst Performance

    International Nuclear Information System (INIS)

    Huang, Zhen; Lin, Rui; Fan, Renjie; Fan, Qinbai; Ma, Jianxin

    2014-01-01

    Highlights: • We pretreated Titanium diboride by different acids and alkali. • We synthesis the Pt/as-pretreated TiB 2 catalysts by a colloid route. • We investigated the effects of TiB 2 Pretreatment on Pt/TiB 2 Catalyst Performance. • The BET surface area and defects on the surface have a close relationship with the deposition of Pt nanoparticles. - Abstract: Carbon support corrosion of traditional Pt/C catalyst is one of the major contributors causing poor durability of proton exchange membrane fuel cells (PEMFC). Titanium diboride (TiB 2 ) has high electrical conductivity and considerable chemical stability, which making it as a good candidate for catalyst support in PEMFC. In this work, TiB 2 was pretreated by different acid and alkali. The as-obtained samples were characterized by Ex-situ microscopy (ESM) and X-ray diffraction (XRD). The pore size distribution (PSD) was analyzed by using DFT method. The PSD shows distinct volume in mesopore regions (less than 50 nm). The TiB2 pretreated by H 2 O 2 shows the biggest BET surface area of 57 m 2 g −1 and its PSD focus on mesoporous (1.5-8 nm) region, which resulted to high dispersion and better loading of Pt particles. The Hydrogen oxidization reaction (HOR) and oxygen reduction reaction (ORR) activity was characterized by Rotating Disk Electrode (RDE). The Pt/TiB 2 prepared by H 2 O 2 -pretreated TiB 2 using the colloidal method showed better half-cell electrochemical performance. Facile synthetic for the development of Pt/TiB 2 catalysts was developed

  2. Deficiencia de 25-hidoroxivitamina D, VDBP y péptidos antimicrobianos vitamina D dependientes en el paciente séptico

    OpenAIRE

    Pérez San Martín, Sonia

    2017-01-01

    Introducción: La vitamina D desempeña un papel importante en la regulación de la inflamación y protección frente a las infecciones, induciendo la síntesis de péptidos antimicrobianos. La deficiencia de vitamina D se ha asociado con un incremento de mortalidad en pacientes sépticos adultos. La proteína transportadora de vitamina D (VDBP) también tiene funciones antiinflamatorias y autoinmunes. Objetivo: Evaluar los niveles de 25-hidroxivitamina D (25(OH) D), 1,25-dihidroxi vitamina D (1,25(OH)...

  3. RECOMENDACIONES SOBRE SUPLEMENTOS DE VITAMINA D Y CALCIO PARA LAS PERSONAS ADULTAS EN ESPAÑA

    Directory of Open Access Journals (Sweden)

    Ana Isabel Rigueira García

    2012-01-01

    Full Text Available Fundamentos: Los suplementos de calcio y vitamina D están involucrados en debates sanitarios actuales, como la seguridad cardiovascular del calcio y la corrección de los niveles vitamínicos. El objetivo de esta revisión es la evaluación de la información existente de los suplementos de calcio y/o vitamina D disponibles y financiados en España, así como la evaluación de las recomendaciones para su utilización. Métodos: Análisis de la oferta comercial e información disponible sobre aspectos farmacológicos de los suplementos medicamentos españoles en 39 fichas técnicas, guías e informes institucionales y profesionales actualizados, con búsqueda complementaria de información y de datos epidemiológicos españoles relacionados en Cochrane Database of Systematic Reviews®, PubMed® (herramienta "Clinical Queries", base de datos Dialnet y búsqueda manual en revistas españolas directamente relacionadas. Resultados: No existe uniformidad en cuanto a indicación, expresión de contenido, posologías, precauciones y seguridad ni en fichas técnicas ni en los informes técnicos. La búsqueda bibliográfica ha encontrado un mayor volumen de publicaciones recientes para la vitamina D que para el calcio. No se han encontrado pruebas científicas apropiadas para establecer regímenes posológicos indiscutibles ni universales, ni pruebas de biodisponibilidad para colecalciferol con vehiculización acuosa. En España se constata una situación nutricional generalmente adecuada para el calcio pero un estatus mayoritariamente inadecuado para la vitamina D, con varias referencias de insuficiencia y carencia vitamínica en adultos. Los tratamientos correctores inciden fundamentalmente en el uso de suplementos de calcio. Conclusiones: Existe una amplia oferta de suplementos de calcio y vitamina D en España cuyo diseño farmacológico debería replantearse puesto que no responden a las necesidades detectadas ni a las posibilidades de correcci

  4. Fortification of industrialized foods with vitamins Fortificação de alimentos industrializados com vitaminas

    Directory of Open Access Journals (Sweden)

    Selma Coelho Liberato

    2006-04-01

    Full Text Available Vitamins are essential to life. Inadequate eating habits, high caloric intake and metabolic defects lead to micronutrient deficiencies, affecting more than two billion people worldwide. The increasing intake of industrialized foods, combined with low vitamin stability has led to the common practice of adding these nutrients to processed foods. This review discusses the terminology, availability, intake and risk of hypervitaminosis, due to the intake and nutritional importance of foods fortified with vitamins. The addition of nutrients should occur in foods that are effectively consumed by the target population and must meet the real needs of a significant segment of the population. In Brazil, a total of 166 products available in supermarkets are vitamin-enriched. A 10-year study involving children and adolescents in Germany showed that 90% of those surveyed used at least one fortified food. During this 10-year period, 472 fortified products were consumed. The enrichment of foods should be based on the needs of each country and, if possible, regional needs. For instance, in order to increase its intake, Vitamin D is added to foods in Denmark during the winter, mainly for the elderly. However, in Brazil, there is no evidence of the need to fortify food with this vitamin. A survey showed that of the 76 enriched dairy products, 37 contained vitamin D. Food-fortification is a very important strategy to solve nutritional deficiency problems, but it can also cause many health problems.Vitaminas são nutrientes essenciais à vida. Hábitos alimentares inadequados, alto consumo energético e falhas no metabolismo levam a deficiências de micronutrientes, que afetam mais de dois bilhões de pessoas mundialmente. O consumo, cada vez maior, de alimentos industrializados, somado à baixa estabilidade das vitaminas, têm induzido à prática de adição de nutrientes aos alimentos processados. Esta revisão discute terminologia, disponibilidade, ingestão e

  5. Lattice Thermal Conductivity from Atomistic Simulations: ZrB2 and HfB2

    Science.gov (United States)

    Lawson, John W.; Daw, Murray S.; Bauschlicher, Charles W.

    2012-01-01

    Ultra high temperature ceramics (UHTC) including ZrB2 and HfB2 have a number of properties that make them attractive for applications in extreme environments. One such property is their high thermal conductivity. Computational modeling of these materials will facilitate understanding of fundamental mechanisms, elucidate structure-property relationships, and ultimately accelerate the materials design cycle. Progress in computational modeling of UHTCs however has been limited in part due to the absence of suitable interatomic potentials. Recently, we developed Tersoff style parameterizations of such potentials for both ZrB2 and HfB2 appropriate for atomistic simulations. As an application, Green-Kubo molecular dynamics simulations were performed to evaluate the lattice thermal conductivity for single crystals of ZrB2 and HfB2. The atomic mass difference in these binary compounds leads to oscillations in the time correlation function of the heat current, in contrast to the more typical monotonic decay seen in monoatomic materials such as Silicon, for example. Results at room temperature and at elevated temperatures will be reported.

  6. B2B oriented on-line applications generator

    OpenAIRE

    Vintilă Bogdan-Cătălin

    2008-01-01

    B2B applications are presented. Quality characteristics of B2B applications are defined. B2B application structure is defined. The application for contracts is developed. The advantages are identified.

  7. To be or not B2B?

    CERN Document Server

    Symons, L J

    2001-01-01

    La question du commerce électronique interentreprises par le web (Business to Business, B2B) est posée actuellement par les grands groupes industriels impliqués dans le commerce mondial. Les prévisions sont imposantes, le B2B atteindra le C.A. de 3000 milliards de dollars en 2003. Les conditions d'accès, la façon de procéder des deux organisateurs (ARIBA et COMMERCE ONE) des plus grandes places de marchés actuelles, sont décrites. La base de l'énorme pyramide est le catalogue électronique multilingue UNSPSC (United Nations Standard Products and Services Classification) et l'organisation ECCMA (Electronic Commerce Code Management Association) qui gère le développement des UNSPSC codes en 8 langues. Dans ce contexte, l'auteur (re)-déclare qu'un des efforts principaux à fournir par le CERN est la création de son propre catalogue électronique. Dans la Division ST, une aide partielle à ce vaste programme pourrait être apportée par la normalisation des codes et désignations des pièces de maint...

  8. Adición de vitaminas y minerales a harinas de maíz y de trigo en México Vitamin and mineral addition to corn and wheat flours in Mexico

    Directory of Open Access Journals (Sweden)

    Jorge L. Rosado

    1999-03-01

    Full Text Available En México la deficiencia marginal de algunas vitaminas y minerales afecta la salud y la funcionalidad de un número elevado de mexicanos, por lo que la Secretaría de Salud ha iniciado un programa para promover la adición de nutrimentos a las harinas de trigo y de maíz que se procesan industrialmente. El presente documento expone las bases científicas y tecnológicas para dicha adición. El objetivo primordial es restaurar los nutrimentos que se pierden durante el proceso de obtención de las harinas y durante la fabricación de los alimentos a partir de las harinas; además, se adicionan aquellos nutrimentos cuya presencia es deficiente en una proporción importante de la población y cuya suplementación en la dieta ha demostrado ser benéfica en la salud y la funcionalidad de la población. En la definición de la fórmula para adicionar a las harinas de trigo y maíz se consideraron, además de los factores mencionados, los niveles de absorción de los diferentes nutrimentos, la interacción probable entre nutrimentos y un malgar muy amplio de seguridad, de manera que se eliminara cualquier riesgo de algún efecto adverso en la salud, aun en los niveles más altos de ingestión de los alimentos. Finalmente, se sugieren los compuestos más apropiados para la adición a las harinas considerando su reactividad y sus posibles efectos negativos en la estabilidad de las harinas, así como su biodisponibilidad, su disponibilidad en el mercado y su costo. Con lo anterior se recomienda la adición de 5 mg/kg de tiamina (mononitrato de tiamina, 3 mg/kg de riboflavina (hidroclorhidrato de riboflavina, 35 mg/kg de niacina (nicotinamida, 30 mg/kg de hierro (hierro reducido extrafino y 20 mg/kg de zinc (óxido de zinc para ambas harinas, así como 2 mg/kg y 0.5 mg/kg de ácido fólico para las harinas de trigo y maíz, respectivamente.In Mexico, marginal micronutrient deficiency is widespread and affects the health status and function of many Mexicans

  9. Efeito da suplementação com pupunha como fonte de vitamina A em dieta: estudo em ratos

    Directory of Open Access Journals (Sweden)

    Lucia K.O. Yuyama

    1996-02-01

    Full Text Available Foi estudado o efeito da suplementação com pupunha (Bactris gasipaes H.B.K., polpa cozida e transformada em farinha, como fonte de vitamina A, em dieta regional de Manaus, AM,Brasil, por meio do ensaio biológico com ratos. A metodologia utilizada foi da depleção dos animais em zinco e vitamina A, seguida da repleção com a dieta regional (DR, DR + pupunha, DR + vitamina A e dieta controle (DC. A dieta foi elaborada para famílias com rendimentos inferiores a dois salários-mínimos. Foram utilizadas ratas albinas adultas pós-parto, cada qual com 6 filhotes machos, que receberam ração à base de caseína lavada com EDTA a 1%, sem adição de Zn e vitamina A, por 25 dias, com a finalidade de obtenção de animais recém-desmamados deficientes nestes dois nutrientes. O período de repleção dos animais, recém-desmamados, foi de 30 dias e o delineamento foi inteiramente casualizado com 4 tratamentos de 8 animais cada. A suplementação efetuada seguiu as recomendações do "Committee on Laboratory Animal Diets". Os parâmetros empregados para a avaliação da utilização de vitamina A foram as concentrações de vitamina A no fígado e plasma e o crescimento dos animais. Ao final do experimento, observou-se que os animais que consumiram a ração à base da dieta regional de Manaus, suplementada com pupunha e vitamina A, apresentaram, respectivamente, concentração significativamente maior de vitamina A no fígado, 43,3 ± 6,5 µg/g e 42,0 ± 4,3 µg/g em relação à dieta regional, 5,5 ± 1,1 µg/g (p<0,05. A quantidade de zinco presente na dieta regional de Manaus, 10,7 mg diários, foi biodisponível quando avaliada pela concentração de zinco nos fêmures. Os resultados sugerem que existe necessidade de suplementação da dieta regional de Manaus com vitamina A para a manutenção das reservas hepáticas, podendo, para tanto, ser utilizada a fonte natural da pupunha.

  10. ONLINE ACQUISITIONS IN B2B MODEL

    Directory of Open Access Journals (Sweden)

    Constantin SASU

    2016-12-01

    Full Text Available Within the present paper, we propose to review some of the main aspects documented by the academic research so far with regard to the online purchasing behaviour in the B2B online environment (more specifically, in the case of the small and medium-sized companies. Preliminary conclusions reveal that, at least in the case studies, the dominant feature is that the geographic delimitation creates a potential obstacle when it comes to applying a general principle governing the small and medium-sized enterprises. Despite this, we consider that some theoretical elements can be acknowledged, elements from which future research can start to develop theories and hypothesis aimed at better explaining the phenomenon. Furthermore, the fact that the studies are rarely involving the same sector, makes it impossible to generalise the process.

  11. Diffusion in substitutionally disordered B2 intermetallics

    International Nuclear Information System (INIS)

    Belova, I.V.; Murch, G.E.

    2002-01-01

    In this paper, a comprehensive diffusion kinetics theory is formulated to describe seamlessly tracer and chemical diffusion in antistructurally disordered B2 intermetallics showing positive and negative deviations from stoichiometry. The theory is based around unit processes consisting of six-jump cycles that can be assisted by intrinsic and extrinsic antistructural atoms of either atomic species. The Ising alloy model is used to illustrate the formalism, but the formalism can be adapted to other models. Expressions are developed for the tracer diffusion coefficients, the phenomenological coefficients, the intrinsic diffusion coefficients, the interdiffusion coefficient and the various correlation factor components. Results for the tracer and collective correlation factors and the vacancy wind factor (in interdiffusion) are in excellent agreement with results from Monte Carlo computer simulations based around single vacancy jumps. (author)

  12. Desarrollo de apio minimamente procesado fortificado con vitamina e, utilizando la ingenieria de matrices

    OpenAIRE

    MARTELO CASTAÑO, YISELL JOHAN; CORTES RODRIGUEZ, MISAEL; SUAREZ MAHECHA, HÉCTOR

    2011-01-01

    El objetivo de este trabajo fue desarrollar un producto minimamente procesado fortificado con vitamina E, a partir de apio (Apium graveolens L. var.dulce), utilizando la ingenieria de matrices como metodologia de obtencion de alimentos funcionales. Trozos de apio impregnados al vacio con dl¿¿tocoferol acetato emulsificado en una solucion isotonica al vegetal de NaCl, 1,2%, fueron evaluados en funcion del tiempo de almacenamiento y el envasado (con y sin vacio), en terminos de la cuantificacio...

  13. Aporte de vitaminas y minerales por grupo de alimentos en estudiantes universitarios chilenos

    OpenAIRE

    Samuel Durán Agüero; Susanne Reyes García; María Cristina Gaete

    2013-01-01

    Introducción: La etapa universitaria es un proceso en el cual las personas pasan por periodos prolongados de inactividad física y horarios irregulares de comidas, lo que conlleva al incremento en el consumo de alimentos procesados y de comida rápida. Objetivo: Fue determinar el aporte vitaminas y minerales por grupo de alimentos en la alimentación de estudiantes universitarios. Métodos: Se trabajó con una muestra de 654 estudiantes universitarios chilenos (18-24 años, 54% mujeres), a quienes ...

  14. Suplementação de vitaminas na prevenção de câncer

    Directory of Open Access Journals (Sweden)

    SILVA Cyntia Rosa de Melo

    2001-01-01

    Full Text Available Este trabalho constitui uma revisão de dados epidemiológicos sobre a relação entre o consumo de vitaminas e prevenção de câncer. Estudos observacionais evidenciam uma associação inversa consistente entre a ingestão de frutas e hortaliças e risco de câncer, e um efeito protetor das vitaminas C, E e dos carotenóides contra certos tipos de câncer. Resultados de estudos de intervenção, na prevenção primária de câncer, são contraditórios, sendo que em dois desses estudos o beta-caroteno, suplementado em doses consideradas farmacológicas, isolado ou associado à vitamina E ou à vitamina A, mostrou-se deletério para tabagistas. Ao contrário, a ingestão de doses mais fisiológicas de antioxidantes parece ser mais eficaz, sendo que a ação sinérgica dessas substâncias na quimioprevenção de câncer já foi demonstrada tanto em modelo in vivo de carcinogênese quanto em estudo epidemiológico de intervenção. Como estratégia de prevenção de câncer preconiza-se o consumo de dietas ricas em frutas e hortaliças, que aportem cerca de 150 mg de vitamina C, 30 mg de vitamina E e 4 mg de carotenóides. A ingestão de quantidades mais elevadas, na forma de suplementos, não está recomendada.

  15. Osteoporose na artrite reumatoide: papel do sistema vitamina D/hormônio paratireóideo

    Directory of Open Access Journals (Sweden)

    Mattia Bellan

    2015-06-01

    Full Text Available A osteoporose é uma característica extra-articular bem estabelecida da artrite reumatoide (AR. A inflamação sistêmica parece ser essencial para causar uma alteração em múltiplos sistemas homeostáticos implicados na saúde óssea, como as vias RANK/RANKL/osteoprotegerina e Wnt/β catenina; vários outros fatores causais têm sido implicados, como o uso crônico de corticosteroides. Como a vitamina D exerce funções imunorreguladoras importantes, tem-se afirmado que o desarranjo do sistema vitamina D/hormônio paratireóideo (HPT, um determinante bem conhecido da saúde óssea, pode desempenhar um papel patogênico na autoimunidade; estudos com animais e dados clínicos apoiam essa hipótese. Além disso, os pacientes com AR parecem ser relativamente refratários à supressão de HPT induzida pela vitamina D. Portanto, a ligação entre a AR e a osteoporose pode ser em parte causada por alterações no sistema vitamina D/HPT. Uma melhor compreensão da fisiopatologia desse sistema pode ser crucial para prevenir e curar a osteoporose em pacientes com doenças inflamatórias/autoimunes. A maior evidência da correlação clínica de cooperação e interdependência entre a vitamina D e o HPT é que a correção da deficiência de vitamina D, pelo menos nas doenças autoimunes, deve ser orientada para a supressão do HPT.

  16. Vitamin-A deficiency and its determinants among preschool children: a community based cross-sectional study in Ethiopia.

    Science.gov (United States)

    Tariku, Amare; Fekadu, Abel; Ferede, Ayanaw Tsega; Mekonnen Abebe, Solomon; Adane, Akilew Awoke

    2016-06-24

    Vitamin A deficiency is the leading cause of preventable visual impairments in children. It is also an underlying cause for nearly one-fourth of global child mortality associated with measles, diarrhea, and malaria. The limited literature available in Ethiopia shows severe public health significance of vitamin-A deficiency. Hence the aim of the current study was to assess the prevalence and factors determining vitamin-A deficiency among preschool children in Dembia District, northwest Ethiopia. A community-based cross-sectional study was conducted among preschool children of Dembia District from January to February, 2015. A multi-stage sampling, followed by a systematic sampling technique was employed to select study participants. A structured interviewer-administered questionnaire was used to collect data. Using a binary logistic regression model, multivariable analysis was fitted to identify the associated factors of vitamin-A deficiency. The adjusted odds ratio (AOR) with a 95 % confidence interval was computed to assess the strength of the association, and variables with a p value of preschool children were included in the study, giving a response rate of 96.5 %. The overall prevalence of xerophthalmia was 8.6 %. The result of the multivariable analysis revealed that nonattendance at the antenatal care clinic [AOR 2.65,95 % CI (1.39,5.07)], being male [AOR 1.81, 95 % CI (1.01,3.24)], and in the age group of 49-59 months [AOR 3.00, 95 % CI (1.49,6.02)] were significantly associated with vitamin-A deficiency. Vitamin-A deficiency is a severe public health problem in the study area. Further strengthening antenatal care utilization and giving emphasis to preschool children will help to mitigate vitamin-A deficiency in the study area.

  17. Riesgo de niveles bajos de vitamina D en la población y cómo la fortificación de alimentos puede corregirlos

    Directory of Open Access Journals (Sweden)

    Yorleny Araya Quesada

    2017-12-01

    Full Text Available El ergocalciferol y el colecalciferol, vitamina D2 y vitamina D3, respectivamente, se conocen comúnmente con el nombre de vitamina D. La vitamina D3 se sintetiza en la piel a partir de 7-dehidrocolesterol a causa de la irradiación de los rayos ultravioleta. La bioactivación de la vitamina D3 como hormona posteriormente se lleva a cabo por 1 α,25-dihidroxivitamina D3 (calcitriol en el riñón. La concentración de la vitamina D3, 25-(OHD3 se ha usado como indicador del estatus de vitamina D. Se han detectado deficiencias en la población, debido al aumento en un estilo de vida sedentario y a la protección solar que utilizan los individuos o a causa de ciertas enfermedades, y se considera un problema emergente de salud mundial. El riesgo de insuficiencia de vitamina D se relaciona con la raza (color de la piel, latitud geográfica, exposición solar (estilo de vida, género y la salud del individuo en general. Es mayor la deficiencia en zonas del sur del continente que del norte y más en mujeres que en hombres, así como en invierno. Se hizo una recopilación del impacto de la vitamina D en suero sanguíneo sobre la salud, como lo es la osteoporosis, efecto sobre la tiroides y el cerebro, enfermedades cardiovasculares, artritis enfermedades autoinmunes, cáncer y diabetes, y las dosis recomendadas de vitamina D para mantener los niveles suficientes, así como la fortificación de alimentos para lograr llenar esas recomendaciones.

  18. Determinación de la vida útil de fresa (fragaria ananassa duch.) fortificada con vitamina e

    OpenAIRE

    RESTREPO, ANA MARIA; CORTÉS, MISAEL; ROJANO, BENJAMÍN

    2010-01-01

    Las frutas fortificadas por la técnica de impregnación al vacío (IV) representan una expectativa mundial en el desarrollo de productos mínimanente procesados con características funcionales. El presente estudio evalúa el tiempo de vida útil de fresa Fragaria ananassa Duch. fortificada con vitamina E, en función del color, textura y estabilidad de la vitamina E a diferentes condiciones de almacenamiento. El dl-;-tocoferol acetato fue cuantificado por HPLC en extractos hexánicos y sus niveles s...

  19. Homocisteína, acido fólico y vitamina B12 en adultos mayores venezolanos

    OpenAIRE

    Meertens G, Lesbia; Díaz W, Nayka; Solano R, Liseti; Baron, Maria Adela; Rodríguez M, Adelmo

    2007-01-01

    Los cambios anatomo-fisiológicos propios del envejecimiento hacen de los adultos mayores un grupo vulnerable a los estados de malnutrición y deficiencias específicas de nutrientes como la vitamina B12 y el folato. El objetivo de este estudio fue establecer la relación existente entre la vitamina B12, folato, homocisteína y el consumo y adecuación de estos nutrientes. Se evaluaron 55 adultos mayores de 60 años de edad, de ambos sexos, no institucionalizados, a quienes se les determinó homocist...

  20. Deficiencia de vitamina D en la edad pediátrica. Una oportunidad de prevención

    OpenAIRE

    López-González, Desirée; Méndez-Sánchez, Lucía; Guagnelli, Miguel Ángel; Clark, Patricia

    2015-01-01

    La prevalencia de deficiencia de vitamina D en la población pediátrica ha incrementado en los últimos años y se considera que continúa subdiagnosticada y subtratada. De acuerdo con datos de la Encuesta Nacional de Salud y Nutrición 2006, en México se ha estimado una prevalencia del 16% en niños de 2 a 12 años. La vitamina D desempeña un papel fundamental en la formación y homeostasis del hueso, y consecuentemente en el crecimiento. Su deficiencia se asocia con enfermedades como raquitismo y o...

  1. Impacto nutricio del consumo de una leche entera adicionada con vitaminas y minerales en niños

    OpenAIRE

    Maulen-Radovan Irene; Villagómez Sandra; Soler Esther; Villicaña Rolando; Hernández-Ronquillo Lizbeth; Rosado Jorge L.

    1999-01-01

    OBJETIVO: Determinar el impacto nutricio del consumo de leche entera fortificada con vitaminas y minerales en niños. MATERIAL Y MÉTODOS: Se hizo un estudio prospectivo, longitudinal, en 227 niños de entre 8 a 60 meses de edad. Se ofreció a los menores 500 ml diarios de leche entera fortificada por 90 días. Se registró ingestión, aceptación, peso, talla, hemoglobina (Hb), hierro (Fe), vitamina B12 y folatos séricos. El análisis estadístico se realizó con medidas de tendencia central y dispersi...

  2. Vitamina c e seus derivados em produtos dermatológicos : aplicações e estabilidade

    OpenAIRE

    Dalcin, Karina Borges; Schaffazick, Scheila Rezende; Guterres, Silvia Stanisçuaski

    2003-01-01

    A vitamina C (ácido ascórbico) tem sido muito utilizada em produtos cosméticos e dermatológicos por apresentar importantes efeitos fisiológicos na pele. Um dos principais efeitos do ácido ascórbico é no combate à pele foto-envelhecida, em decorrência de sua característica antioxidante. Entretanto, a estabilidade da vitamina C é muito prejudicada devido a suas propriedades físico-químicas, degradando-se facilmente em solução aquosa. Em vista disso, derivados hidrofílicos e lipofílicos da vitam...

  3. Electronic Commerce in Tourism in China: B2B or B2C?

    Science.gov (United States)

    Li, Hongxiu; Suomi, Reima

    E-commerce has significantly changed the distribution channels of travel products in the world including China. Online channels are growing important in travel service distribution. In China tourism industry has been developed rapidly with the economic development, more and more international travel service providers are trying to expand their Chinese market through the Internet. This paper sheds lights on the e-commerce development models in China for international travel service providers. It explores the current e-tourism in China from the three different participants in the value chain in tourism industry - consumer, travel agent and travel service provider. The paper also identifies the barriers in B2C arena in international outbound travel market, and discusses the possible approaches for international travel service providers to develop their e-commerce in the huge Chinese market. The results in this study reveal that international travel service providers should focus on B2B model to expand their electronic market in China. B2C development in tourism largely depends on the change of Chinese customers' behavior and the change of international tourism regulations. The findings of the study are expected to assist international travel service providers to understand current e-tourism in China and to support their planning for future e-commerce development in China.

  4. Prevalência de deficiência de vitamina D em pacientes com úlceras de perna de etiologia venosa

    Directory of Open Access Journals (Sweden)

    Claudine Juliana C Burkievcz

    Full Text Available OBJETIVO: Estudar se a prevalência da deficiência de vitamina D em indivíduos com úlcera de perna de causa venosa é maior do que em população controle. MÉTODOS: Estudaram-se os níveis séricos de 25-OH-vitamina D por quimioluminescência em 27 portadores de úlcera venosa crônica e 58 controles do Hospital Universitário Evangélico de Curitiba. RESULTADOS: Os níveis de 25-OH-vitamina D3 eram inferiores a 8 ng/dl em 11,1% dos pacientes com úlcera e 3,4% dos controles; entre 8 e 20 ng/dl em 46,1% dos pacientes com úlcera e 25,8% dos controles; entre 21 e 30 ng/dl em 22.2% dos pacientes com úlcera e 27,5% dos controles e acima de 30 ng/dl em 43,1% dos controles e 18,5% dos pacientes com úlcera (p=0,04. CONCLUSÃO: Existe aumento de prevalência de deficiência de vitamina D em pacientes com úlceras venosas crônicas de pernas.

  5. EFEITO DA DESIDRATAÇÃO FOAM MAT NA RETENÇÃO DA VITAMINA C DA POLPA DE CAJAMANGA

    Directory of Open Access Journals (Sweden)

    Caroline Alves BREDA

    2013-04-01

    Full Text Available O objetivo do trabalho foi avaliar o efeito da desidratação foam mat na retenção da vitamina C em polpa de cajamanga. A polpa de cajamanga foi elaborada a partir de quatro formulações utilizando três agentes espumantes combinados em diferentes concentrações: 1 pectina cítrica, 2 produto à base de monoglicerídeos destilados, monoestearato de sorbitana e polissorbato 60 (Emustab e 3 produto à base de sacarose, carboximetilcelulose e goma guar (Super Liga Neutra. A composição proximal e o conteúdo de vitamina C foram determinados na polpa fresca e nas polpas desidratadas obtidas a partir das formulações. Os resultados mostraram que a adição de agentes espumantes favoreceu ao incremento de açúcares e fibras na polpa desidratada. Os agentes formadores de espuma influenciaram na retenção da vitamina C. A polpa desidratada contendo 1,5% de Emustab e 1,0% de pectina obteve maior retenção da vitamina (28,55%.

  6. Processamento de biscoitos adicionados de óleo de buriti (Mauritia flexuosa L.: uma alternativa para o consumo de alimentos fontes de vitamina A na merenda escolar

    Directory of Open Access Journals (Sweden)

    Jailane de Souza Aquino

    2012-12-01

    Full Text Available OBJETIVO: Este trabalho teve como objetivo desenvolver biscoitos tipo cookie adicionado de óleo de buriti a fim de se analisarem sua aceitação sensorial e seu valor nutricional, visando a sua utilização na merenda escolar, bem como avaliar o consumo de alimentos fontes de vitamina A por escolares. MÉTODOS: Uma formulação-controle (15% de óleo de soja e duas formulações experimentais (7,5% e 15% de óleo de buriti foram produzidas e avaliadas quanto à composição centesimal, conteúdo de vitamina A e aceitação sensorial, testada por 201 escolares. Avaliou-se também o consumo de alimentos fontes de vitamina A por esses escolares mediante questionário semiquantitativo contendo 28 alimentos considerados fontes da referida vitamina. RESULTADOS: O biscoito elaborado com 15% de óleo de buriti obteve boa aceitação, e apresenta maior percentual de proteínas, de minerais e de vitamina A, podendo ser considerado fonte deste último nutriente. Observou-se uma maior frequência de consumo de alimentos com baixo teor de vitamina A, como também uma menor frequência de consumo dos frutos da região Nordeste. CONCLUSÃO: Os biscoitos adicionados de óleo de buriti podem ser uma alternativa de inclusão de alimentos fontes de vitamina A na dieta de escolares, no entanto o consumo de frutas e hortaliças fontes dessa vitamina deve ser estimulado, tendo em vista que os escolares consomem pouca variedade de alimentos fontes dessa vitamina, o que aumenta o risco de deficiência a longo prazo.

  7. Laser cladding of aluminium using TiB2

    CSIR Research Space (South Africa)

    Kumar, S

    2010-03-01

    Full Text Available to that of steel (5) and Tita- nium (6; 7). Previous work con- sists of an effort to make deep laser injection of TiB2 on Al or the creation of in-situ of TiB2 using other reactant particles. In-situ creation of TiB2 suffers from other side effects...

  8. Theoretical study of the ionization of B2H5

    International Nuclear Information System (INIS)

    Curtiss, L.A.; Pople, J.A.

    1989-01-01

    Ab initio molecular orbital calculations at the G1 level of theory have been carried out on neutral B 2 H 5 radical, doubly bridged B 2 H + 5 cation, and the first triplet excited state of B 2 H + 5 . Singly bridged B 2 H 5 is 4.0 kcal/mol (without zero-point energies) more stable than doubly bridged B 2 H 5 . Based on this work and previous theoretical work on triply bridged B 2 H + 5 , ionization potentials (vertical and adiabatic) are determined for B 2 H 5 . The adiabatic ionization potentials of the two B 2 H 5 structures are 6.94 eV (singly bridged) and 7.53 eV (doubly bridged). A very large difference is found between the vertical and adiabatic ionization potentials (3.37 eV) of the singly bridged B 2 H 5 structure. The first triplet state of B 2 H + 5 is found to be 4.55 eV higher in energy than the lowest energy B 2 H + 5 cation (triply bridged). The results of this theoretical study support the interpretation of Ruscic, Schwarz, and Berkowitz of their recent photoionization measurements on B 2 H 5

  9. Component Based System Framework for Dynamic B2B Interaction

    NARCIS (Netherlands)

    Hu jinmin, Jinmin; Grefen, P.W.P.J.

    Business-to-Business (B2B) collaboration is becoming a pivotal way to bring today's enterprises to success in the dynamically changing e-business environment. Though many business-to-business protocols are developed to support B2B interaction, none are generally accepted. A B2B system should support

  10. TRUST IN B2B E-MARKETPLACES

    Directory of Open Access Journals (Sweden)

    SEBASTIAN KOT

    2011-01-01

    Full Text Available The paper presents background of B2B exchanges and review of their forms and functionalities. The benefits and fails reasons are noticed. European enterprises interest in B2B trade is next aspect of consideration. Finally, the trust barriers of B2B exchanges are presented.

  11. Efecto de la suplementación de vitamina K3 sobre el comportamiento productivo y calidad ósea de pollos de engorde

    OpenAIRE

    Duarte, CRA; Bratti, FC; Murakami, AE; Fernandes, JIM; Ospina-Rojas, IC; Furlan, AC

    2014-01-01

    La vitamina K participa en los procesos de coagulación sanguínea y también tiene un importante papel en la formación de los huesos. Así, el objetivo de este estudio fue evaluar la suplementación de diferentes niveles de vitamina K3 sobre el comportamiento productivo y indicadores óseos de pollos de engorde. Se utilizaron 1.500 pollos de engorde, distribuidos en un diseño experimental completamente al azar. Los tratamientos consistieron en una dieta control conteniendo 1,6 mg de vitamina K3/kg...

  12. Influência da vitamina D associada ao interferon alfa-peguilado e ribavirina na resposta virológica sustentada na hepatite C crônica

    OpenAIRE

    Luiza Vitelo ANDRIGHETTO; Jacqueline Shaurich dos SANTOS; Graziella NICOLETTI; Patricia Martins BOCK

    2016-01-01

    O objetivo deste trabalho foi avaliar a influência da vitamina D no tratamento de hepatite C com interferon-alfa peguilado e ribavirina. Foram utilizados artigos científicos relevantes publicados entre os anos de 2000 e 2015. Em diversos estudos foi observado que níveis mais elevados de vitamina D estavam associados à rápida resposta ao tratamento e à maior taxa de RVS, sugerindo que a deficiência de vitamina D pode estar ligada a uma falta de resposta ao tratamento antiviral. A i...

  13. MANZANA DESHIDRATADA FORTIFICADA CON VITAMINA E UTILIZANDO LA INGENIERÍA DE MATRICES: AIR DRIED APPLE FORTIFIED WITH VITAMIN E USING MATRIX ENGINEERING

    OpenAIRE

    CORTÉS, Misael; OSORIO, Alexander; GARCÍA, Eduard

    2007-01-01

    Se ha evaluado el tiempo de vida de manzana, fortificada con vitamina E, deshidratada por aire a 40°C, en función de la estabilidad de la vitamina E y de los atributos de calidad, color y textura a diferentes condiciones de almacenamiento. La cuantificación de la vitamina E es realizada por cromatografía de gases (CG-FID) sobre extractos de las muestras en hexano. El criterio de fortificación en el producto impregnado es del 100% IDR/200 g manzana fresca. No se encuentra influencia del envasa...

  14. B-2 Extremely High Frequency SATCOM and Computer Increment 1 (B-2 EHF Inc 1)

    Science.gov (United States)

    2015-12-01

    Confidence Level Confidence Level of cost estimate for current APB: 55% This APB reflects cost and funding data based on the B-2 EHF Increment I SCP...This cost estimate was quantified at the Mean (~55%) confidence level . Total Quantity Quantity SAR Baseline Production Estimate Current APB...Production Estimate Econ Qty Sch Eng Est Oth Spt Total 33.624 -0.350 1.381 0.375 0.000 -6.075 0.000 -0.620 -5.289 28.335 Current SAR Baseline to Current

  15. Papel antioxidante de la vitamina E en la aterogénesis inducida por hiperfibrinogenemia

    Directory of Open Access Journals (Sweden)

    Mónica Moya

    2010-01-01

    Full Text Available Con el propósito de estudiar el efecto de la vitamina E sobre el estrés oxidativo desencade- nado por hiperfibrinogenemia (HF en un modelo experimental de aterogénesis y la posible normalización de los indicadores de estrés oxidativo, se evaluaron: óxido nítrico (NO, L-citrulina, superóxido dismutasa (SOD e involución de lesiones histopatológicas en la aorta torácica. El estudio se realizó en 36 ratas, cepa Wistar, que se dividieron en tres grupos (n = 12 cada uno: A, control; B, HF × 90 días; C, HF × 90 días + vitamina E. La HF se indujo mediante inyecciones de adrenalina (0,1 ml/día/rata por 90 días. La dosis de vitamina E fue de 2 mg/día/rata durante 75 días. Se dosaron en plasma los niveles de fibrinógeno (mg/dl, NO (uM y L-citrulina (mM y en lisado de glóbulos rojos, por espectrofotometría, se determinó la actividad de la SOD (U/ml. Se analizaron cortes de la aorta torácica por microscopia óptica (MO. Para el análisis estadístico se emplearon MANOVA y la prueba de Fisher; se estableció un nivel de significación de p < 0,05. Se observó un aumento significativo de fibrinógeno en el grupo B (407 ± 8,9 mg/dl en comparación con los grupos A (203 ± 9 mg/dl y C (191,58 ± 17,79 mg/dl (p < 0,001. El NO disminuyó significativamente en el grupo B (13,73 ± 1,76 uM frente a los grupos A (23,58 ± 0,08 uM y C (26,64 ± 3,65 uM (p < 0,001. La L-citrulina aumentó en forma significativa en los grupos B (4,99 ± 0,18 mM y C (6,60 ± 0,16 mM en comparación con el grupo A (3,03 ± 0,13 mM (p < 0,001. El SOD incrementó su actividad en los grupos B (251,67 ± 10,34 U/ml y C (304,75 ± 10,43 U/ml frente al grupo A (139,44 ± 4,74 U/ml (p < 0,001. La microscopia óptica mostró denudación endotelial, engrosamiento intimal y protrusión de la pared en el grupo B (90% y recuperación de la denudación endotelial y disminución del 50% del engrosamiento intimal en el grupo C (p < 0,001. Niveles aumentados de SOD ser

  16. Reposição de vitamina B12 reduz comportamento depressivo induzido em ratos jovens = Vitamin B12 replacement therapy reduces induced depressive behavior in young rats

    Directory of Open Access Journals (Sweden)

    Brito, Adriana Maria de Oliveira

    2016-01-01

    Conclusões: A depleção suave de vitamina B12 na dieta, em nível não indutor de anemia, favoreceu o estado depressivo em ratos jovens, enquanto a sua suplementação na situação de depleção reverteu esse quadro. Em condições de nutrição adequada, entretanto, a suplementação dessa vitamina não exerceu efeito sobre o estado depressivo. Estes resultados estimulam a realização de mais estudos que aprofundem a avaliação das relações entre vitamina B12 e depressão em jovens. Além disso, este estudo também abre perspectivas para um novo modelo experimental de depressão, induzida por depleção de vitamina B12

  17. Vitamina D e cicatrização de pele: estudo prospectivo, duplo-cego, placebo controlado na cicatrização de úlceras de perna

    Directory of Open Access Journals (Sweden)

    Claudine Juliana Cristina Caznoch Burkiewicz

    Full Text Available OBJETIVO: Estudar a relação entre deficiência de vitamina D e cicatrização de pele em pacientes com úlceras de perna, relacionar esta deficiência com características da úlcera e avaliar se a reposição de vitamina D nos indivíduos deficientes acelera a cicatrização da úlcera. MÉTODOS: Foram escolhidos aleatoriamente 26 pacientes com úlceras venosas de perna e 26 sem úlcera pareados para sexo, idade, HAS e tabagismo. Os grupos foram comparados com relação à dosagem sérica de vitamina D. O grupo úlcera foi dividido em dois subgrupos: um que tomou placebo e outro que recebeu vitamina D 50.000UI por semana durante dois meses. Foi realizada a dosagem da 25-OH-vitamina D e avaliados o tamanho da úlcera e a gravidade da dor, antes e após o tratamento. RESULTADOS: A maioria dos pacientes apresentava níveis insuficientes de vitamina D. Não foi encontrada correlação entre o tamanho da úlcera sem tratamento e os níveis de vitamina D. Nos pacientes que receberam vitamina D, após o tratamento, o tamanho mediano da área da úlcera, diminui de 25cm², para 18cm² e no grupo placebo, de 27cm² para 24,5cm² (p=0,7051 e p=0,7877, respectivamente. Considerando-se a variabilidade da área da úlcera do grupo vitamina D versus placebo, a mediana foi igual a -0,75cm² no primeiro grupo e 4cm² no segundo grupo (p=0,0676. CONCLUSÃO: Pacientes com úlcera de perna têm mais deficiência de vitamina D que os sem. A deficiência de vitamina D não influiu nas características das lesões. A cicatrização nos pacientes com hipovitaminose D mostrou tendência para ser maior naqueles que receberam reposição vitamínica.

  18. Vitamina D y riesgo de preeclampsia: revisión sistemática y metaanálisis.

    Science.gov (United States)

    Serrano-Díaz, Norma Cecilia; Gamboa-Delgado, Edna Magaly; Domínguez-Urrego, Clara Lucía; Vesga-Varela, Andrea Liliana; Serrano-Gómez, Sergio Eduardo; Quintero-Lesmes, Doris Cristina

    2018-05-01

    Introducción. Cada vez son más los hallazgos sobre la relación entre las concentraciones de vitamina D en el ser humano y diversas condiciones clínicas. Hay una gran cantidad de estudios que informan sobre dicha asociación, especialmente con complicaciones obstétricas, incluidas la preeclampsia y la diabetes mellitus de la gestación, entre otras, pero sus resultados todavía no son definitivos, por lo que se requieren estudios de intervención de calidad que confirmen la relación de la vitamina D con dichos resultados.Objetivo. Revisar la información plasmada en estudios en torno al papel de la vitamina D materna y el desarrollo de la preeclampsia.Materiales y métodos. La metodología usada siguió las recomendaciones de la guía Cochrane para la elaboración de revisiones sistemáticas y de la guía del grupo Meta-analysis of Observational Studies in Epidemiology (MOOSE) para los metaanálisis. La búsqueda incluyó estudios observacionales y ensayos clínicos controlados.Resultados. Los niveles bajos de vitamina D, medida con el examen de 25-hidroxivitamina D, son comunes en el embarazo. Los resultados de esta revisión sistemática y del metaanálisis sugieren una asociación inversa entre los niveles de vitamina D y el desarrollo de preeclampsia. Hubo heterogeneidad en los estudios en cuanto a su diseño, población y ubicación geográfica, así como a las definiciones de exposición y resultado. Los ensayos clínicos controlados aleatorizados se excluyeron del metaanálisis.Conclusión. Se encontró una asociación inversa que sugiere que, a mayores concentraciones de vitamina D, menor es la probabilidad de desarrollar preclampsia, a pesar de la heterogeneidad de la medida global en este tipo de análisis.

  19. Cálcio e vitamina D em adultos atendidos em ambulatório de nutrição

    Directory of Open Access Journals (Sweden)

    Bruna Amanda Martini

    2018-02-01

    Full Text Available Objetivo: Avaliar o consumo de cálcio e vitamina D de pacientes atendidos em um ambulatório de Nutrição de referência. Métodos: Estudo transversal quantitativo realizado no período de novembro de 2015 a junho de 2016 avaliou 1.000 recordatórios alimentares de pacientes na faixa etária de 20 a 59 anos do ambulatório de Nutrição de um centro universitário do interior do Rio Grande do Sul, Brasil. Excluíram-se os recordatórios com medidas caseiras incompletas. Para a padronização dessas medidas utilizou-se registro fotográfico de um livro de medidas caseiras. Utilizou-se como referência para análise de ingestão do cálcio e vitamina D a Dietary Reference Intakes. Os dados foram analisados por meio de estatística descritiva e inferencial com nível de significância de 5%. Resultados: O consumo de cálcio e de vitamina D foi simétrico, apresentando 89,5% (n=895 de inadequação do consumo de vitamina D e 86,6% (n=866 de inadequação do consumo de cálcio, portanto, abaixo da recomendação diária. Homens apresentaram ingestão significativamente maior de cálcio em comparação às mulheres (p<0,001, enquanto o consumo de vitamina D não apresentou diferença significativa entre os sexos (p=0,307. Conclusão: Verificou-se elevada inadequação quanto à ingestão de cálcio e vitamina D pela população estudada.

  20. Concentraciones plasmáticas de 25-OH vitamina D y parathormona en sangre de cordón umbilical

    Directory of Open Access Journals (Sweden)

    Sandra Ortigosa Gómez

    2015-01-01

    Full Text Available Fundamentos: Los niveles de vitamina D (25(OHD del recién nacido dependen de los depósitos maternos, presentando mayor riesgo de hipocalcemia, raquitismo e infecciones durante el primer año de vida si existe déficit. Recientemente se han publicado estudios que muestran una alta prevalencia de deficiencia de vitamina D en mujeres gestantes. El objetivo del estudio fue analizar los niveles de 25(OHD en sangre de cordón umbilical y determinar si existe una relación con factores nutricionales, socioeconómicos y clínicos de las mujeres gestantes. Métodos: Entre marzo y mayo de 2013 se seleccionó a 99 gestantes del Hospital del Mar (Barcelona, en las que se determinaron las concentraciones de 25(OHD y parathormona en sangre de cordón umbilical. Se recogieron datos de la historia clínica y se realizó una encuesta sobre ingesta de vitamina D y calcio así como de exposición solar. Se realizó el análisis estadístico mediante el programa SPSS. Las comparaciones se realizaron mediante test de Kruskal-Wallis y U de Mann-Whitney, aplicando corrección por comparaciones múltiples de Bonferroni. Se consideró estadísticamente significativa una p<0,05 y de 0,0083 para comparaciones múltiples. Resultados. El valor medio de 25(OHD en sangre de cordón fue 10,4±6,1 ng/ml. El 94% de las mujeres presentaron niveles de 25(OHD en sangre de cordón <20 ng/ml. La ingesta de vitamina D y calcio fueron adecuadas en 92%, aunque la exposición solar resultó deficitaria en 47%. Se encontró una correlación entre niveles de 25(OHD e ingesta de vitamina D (p<0,033 y calcio (p<0,005, exposición solar (p<0,001, etnia (p<0,001, fototipo cutáneo (p<0,001 y uso de indumentaria tradicional (p<0,001. Conclusiones. Existe una elevada prevalencia de déficit de vitamina D en sangre de cordón umbilical tras los meses de invierno. Los niveles de 25(OHD más bajos se observaron en etnia indopakistaní, fototipo oscuro y baja exposición solar.

  1. Efeitos do Ácido L-Glutâmico e da Vitamina D3 no Desempenho e nas Anomalias Ósseas de Pintos de Corte

    Directory of Open Access Journals (Sweden)

    Silva Fernanda Alvares da

    2001-01-01

    Full Text Available Um experimento foi conduzido para estudar os efeitos de níveis de ácido L-Glutâmico (L-Glu e vitamina D3 (VD da dieta em pintos de corte de um dia, machos, Hubbard, recebendo dieta básica purificada, contendo todos os L-aminoácidos essenciais, minerais e vitaminas (exceto vitamina D3, suplementada com 5, 10 e 15% de L-Glu, combinados com 0, 5.000, 10.000 e 15.000 UI de vitamina D3. O experimento foi realizado utilizando-se esquema fatorial, em delineamento inteiramente casualizado 3 x 4, com quatro repetições de sete aves cada. O ganho de peso aumentou até o nível máximo estimado, de 8,56% de L-Glu e 15.000 UI de vitamina D3. A melhor taxa de conversão alimentar foi verificada com nível estimado de 8,40% de L-Glu. O maior consumo de ração estimado foi obtido com 8,48% de L-Glu e 15.000 UI de vitamina D3. Houve redução na incidência de problemas de pernas com 10% de L-Glu e 15.000 UI de vitamina D3. L-Glu estimado em 8,56% e 15.000 UI de vitamina D3 permitiu um melhor desempenho das aves, confirmando que esse aminoácido é boa fonte de nitrogênio não-específico para maximizar o desempenho e reduzir a incidência de problemas de pernas.

  2. ¿Es equivalente la suplementación diaria con vitamina D2 o vitamina D3 en adultos mayores?

    Directory of Open Access Journals (Sweden)

    Mariana Seijo

    2012-06-01

    Full Text Available Tanto la equivalencia entre colecalciferol (D3 y ergocalciferol (D2, como las dosis y forma de administración de ambos, son actualmente un tema controvertido. El objetivo de este estudio fue comparar la efectividad de 800 UI/día de D2 (gotas y D3 (comprimidos para alcanzar niveles adecuados de 25 hidroxivitamina D (25OHD (= 30 ng/ml. Veintiún mujeres posmenopáusicas que vivían en la Ciudad de Buenos Aires, edad promedio ( ± DS 77.1 ± 6.8 años fueron incluidas y asignadas en forma aleatoria a uno de los siguientes grupos: GD2 (n = 13: 800 UI (gotas y GD3 (n = 8: 800 UI (comprimidos. Se midió 25OHD sérica (RIA-DIASORIN basal y a los 7, 28 y 45 días del estudio. Basalmente, 19 de las 21 mujeres presentaron niveles de deficiencia de 25(OHD (< 20 ng/ml: GD2: 14.0 ± 4.8 y GD3: 13.2 ± 4.9 (NS. Se observó en el día 7 un incremento del ~25% solo en GD3 y un aumento significativo al final del estudio en ambos grupos, sin alcanzar los valores adecuados de 25OHD (GD2: 17.4 ± 5.5 vs. GD3:22.9 ± 4.6 ng/ml p < 0.001. La administración por 45 días de 800 UI de vitamina D3 fue más efectiva que D2 para incrementar los niveles de 25OHD, aunque ambas fueron insuficientes para alcanzar niveles adecuados de 25OHD (= 30 ng/ml.

  3. Harnessing marketing automation for B2B content marketing

    OpenAIRE

    Järvinen, Joel; Taiminen, Heini

    2016-01-01

    The growing importance of the Internet to B2B customer purchasing decisions has motivated B2B sellers to create digital content that leads potential buyers to interact with their company. This trend has engendered a new paradigm referred to as ‘content marketing.’ This study investigates the organizational processes for developing valuable and timely content to meet customer needs and for integrating content marketing with B2B selling processes. The results of this single case study demonstra...

  4. Desempenho de frangos de corte alimentados com diferentes níveis de suplementação de vitamina E

    Directory of Open Access Journals (Sweden)

    M.A. Pompeu

    2015-04-01

    Full Text Available Objetivou-se a avaliação dos efeitos dos níveis de suplementação de vitamina E na ração para frangos de corte sobre o desempenho na fase inicial (um a 21 dias de idade e de crescimento (21 a 39 dias de idade. Os tratamentos foram definidos pelos níveis de suplementação de vitamina E (DL-α tocoferol. As quantidades adicionadas às rações foram: 10; 30; 50; 75 e 100mg de vitamina E para cada kg de ração. Na fase inicial (experimento I, o menor nível de suplementação de vitamina E mostrou-se superior aos demais, apresentando efeito significativo (P≤0,05 sobre o peso médio aos 21 dias de idade e ganho de peso de um a 21 dias de idade. Na fase de crescimento (experimento II, não houve efeito significativo (P>0,05 dos níveis de suplementação de vitamina E sobre as variáveis estudadas. O nível mínimo de suplementação de vitamina E testado (10mg/kg é suficiente para atender às exigências dos frangos de corte machos sobre o desempenho.

  5. NMR relaxation rates and Knight shifts in MgB2 and AlB2: theory versus experiments

    International Nuclear Information System (INIS)

    Pavarini, E; Baek, S H; Suh, B J; Borsa, F; Bud'ko, S L; Canfield, P C

    2003-01-01

    We have performed 11 B NMR measurements in 11 B enriched MgB 2 powder sample in the normal phase. The Knight shift was accurately determined by using the magic angle spinning technique. Results for 11 B and 27 Al Knight shifts (K) and relaxation rates (1/T 1 ) are also reported for AlB 2 . The data show a dramatic decrease of both K and 1/T 1 for 11 B in AlB 2 with respect to MgB 2 . We compare experimental results with ab initio calculated NMR relaxation rates and Knight shifts. The experimental values for 1/T 1 and K are in most cases in good agreement with the theoretical results. We show that the decrease of K and 1/T 1 for 11 B is consistent with a drastic drop of the density of states at the boron site in AlB 2 with respect to MgB 2

  6. Los niños del Cauca II. Receptor de la vitamina D con secuencia normal en un foco de pacientes con raquitismo dependiente de la vitamina D, tipo II

    Directory of Open Access Journals (Sweden)

    Luis Fernando García-Ramirez

    1993-12-01

    Full Text Available El Raquitismo Dependiente de Vitamina D, tipo II (RDVD II, es una enfermedad de herencia autosómica recesiva que se caracteriza por resistencia generalizada a la 1,25-dihidroxivitamina D, originada en alteraciones que comprometen la función del receptor para la vitamina D (RVD. El clonaje y caracterización del cDNA del RVD ha permitido el estudio de su secuencia en pacientes con RDVD II y el hallazgo de diversas mutaciones puntuales que explican el cuadro clínico. En este estudio, hemos utilizado las técnicas de PCR y clonación, para secuenciar el RVD de dos pacientes pertenecientes a un foco descrito previamente en el departamento del Cauca (Colombia, cuyas manifestaciones clínicas y de laboratorio son compatibles con RDVD II. La secuencia del RVD de nuestros pacientes fue normal, sugiriendo una alteración a nivel postranscripcional o postraduccional relacionada con la función del receptor, en lo que podría corresponder a una nueva variante de resistencia a la vitamina D.

  7. Qualidade de balas de gelatina fortificadas com vitaminas A, C e E Quality of gelatine gums fortified with vitamins A, C and E

    Directory of Open Access Journals (Sweden)

    Telma Garcia

    2005-12-01

    Full Text Available O estudo teve como objetivo verificar a estabilidade das vitaminas A, C e E, na forma de acetato de vitamina A, ácido ascórbico e acetato de vitamina E, sobredosadas em 80%, 80% e 50% respectivamente na fortificação de confeitos do tipo balas de gelatina, fornecendo 30% da IDR destas vitaminas em 100 g de produto. As vitaminas adicionadas não afetaram a qualidade das gomas de gelatina em relação à textura e claridade, parâmetros estes avaliados após processamento. Houve uma perda média no processamento de vitamina A de 25% em relação ao adicionado, seguida da vitamina E com 12% e vitamina C com 1%. Aumentando-se a temperatura de depósito da calda das gomas, de 70ºC para 80ºC encontrou-se uma diminuição na concentração da vitamina A de aproximadamente 37% e de 9% para a vitamina C. A eliminação do ácido cítrico da formulação das gomas com o propósito de minimizar perdas no processo não foi benéfica para as vitaminas C e E. Na estocagem de 6 meses obteve-se uma queda média de 93% da vitamina A, 57% para a vitamina C e 24% da vitamina E. Verificou-se, portanto que as vitaminas A e C irão ditar a vida de prateleira das gomas de gelatina e não foram sobredosadas em concentrações suficientes para garantir o declarado no rótulo até 6 meses numa estocagem controlada a 20ºC.This study had as objective to verify the stability of vitamins A, C and E, in the form of vitamin A acetate, ascorbic acid and vitamin E acetate, with overages at 80%, 80% and 50% respectively in gelatine gums confectionery type, supplying 30% of RDI of these vitamins in 100 g product. The added vitamins did not affect the quality of gelatine gums in relation to the texture and clarity, which were analyzed after processing; however, the gums with vitamins became brown with shelf life, being vitamin C the responsible for the presented defect. There were an average loss of vitamin A of 25% in relation to the initially added, followed by vitamin E

  8. Suplementação de vitaminas na prevenção de câncer

    OpenAIRE

    SILVA, Cyntia Rosa de Melo; NAVES, Maria Margareth Veloso

    2001-01-01

    Este trabalho constitui uma revisão de dados epidemiológicos sobre a relação entre o consumo de vitaminas e prevenção de câncer. Estudos observacionais evidenciam uma associação inversa consistente entre a ingestão de frutas e hortaliças e risco de câncer, e um efeito protetor das vitaminas C, E e dos carotenóides contra certos tipos de câncer. Resultados de estudos de intervenção, na prevenção primária de câncer, são contraditórios, sendo que em dois desses estudos o beta-caroteno, suplement...

  9. B2B or Not to Be: Does B2B E-Commerce Increase Labour Productivity?

    OpenAIRE

    Bertschek, Irene; Fryges, Helmut; Kaiser, Ulrich

    2004-01-01

    We implement an endogeneous switching-regression model for labour productivity and firms' decision to use business-to-business (B2B) e-commerce. Our approach allows B2B usage to affect any parameter of the labour productivity equation and to properly take account of strategic complementarities between the input factors and B2B usage. Empirical evidence from 1,394 German firms shows that firms using B2B e-commerce have a significantly higher output elasticity with respect to ICT-investment and...

  10. Influence of TiB2 particles on machinability and machining parameter optimization of TiB2/Al MMCs

    Directory of Open Access Journals (Sweden)

    Ruisong JIANG

    2018-01-01

    Full Text Available In situ formed TiB2 particle reinforced aluminum matrix composites (TiB2/Al MMCs have some extraordinary properties which make them be a promising material for high performance aero-engine blade. Due to the influence of TiB2 particles, the machinability is still a problem which restricts the application of TiB2/Al MMCs. In order to meet the industrial requirements, the influence of TiB2 particles on the machinability of TiB2/Al MMCs was investigated experimentally. Moreover, the optimal machining conditions for this kind of MMCs were investigated in this study. The major conclusions are: (1 the machining force of TiB2/Al MMCs is bigger than that of non-reinforced alloy and mainly controlled by feed rate; (2 the residual stress of TiB2/Al MMCs is compressive while that of non-reinforced alloy is nearly neutral; (3 the surface roughness of TiB2/Al MMCs is smaller than that of non-reinforced alloy under the same cutting speed, but reverse result was observed when the feed rate increased; (4 a multi-objective optimization model for surface roughness and material removal rate (MRR was established, and a set of optimal parameter combinations of the machining was obtained. The results show a great difference from SiC particle reinforced MMCs and provide a useful guide for a better control of machining process of this material.

  11. ORM-based semantics of B2B transactions.

    NARCIS (Netherlands)

    Balsters, H.; van Blommestein, F.; Meersman, R; Herrero, P; Dillon, T

    2009-01-01

    After widespread implementation of Enterprise Resource Planning and Personal Information Management, the next wave in the application of ICT is headed towards business to business (B2B) communication. B2B has a number of specific aspects, one of them being negotiation. This aspect has been largely

  12. 17 CFR 270.8b-2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... such document is filed with such exchange. (j) Share. The term “share” means a share of stock in a... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions. 270.8b-2 Section 270.8b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND...

  13. Hexagonal OsB2: Sintering, microstructure and mechanical properties

    International Nuclear Information System (INIS)

    Xie, Zhilin; Lugovy, Mykola; Orlovskaya, Nina; Graule, Thomas; Kuebler, Jakob; Mueller, Martin; Gao, Huili; Radovic, Miladin; Cullen, David A.

    2015-01-01

    Highlights: • ReB 2 -type hexagonal OsB 2 powder has been densified by spark plasma sintering. • The sintered OsB 2 contains ∼80 wt.% hexagonal and ∼20 wt.% orthorhombic phases. • The average grain size of the sintered OsB 2 sample was 0.56 ± 0.26 μm. • H = 31 ± 9 GPa and E = 574 ± 112 GPa measured by nanoindentation. - Abstract: The metastable high pressure ReB 2 -type hexagonal OsB 2 bulk ceramics was produced by spark plasma sintering. The phase composition, microstructure, and mechanical behavior of the sintered OsB 2 were studied by X-ray diffraction, optical microscopy, TEM, SEM, EDS, and nanoindentation. The produced ceramics was rather porous and contained a mixture of hexagonal (∼80 wt.%) and orthorhombic (∼20 wt.%) phases as identified by X-ray diffraction and EBSD analysis. Two boron-rich phases, which do not contain Os, were also identified by TEM and SEM/EDS analysis. Nanoindentation measurements yielded a hardness of 31 ± 9 GPa and Young’s modulus of 574 ± 112 GPa, indicating that the material is rather hard and very stiff; however, it is very prone to crack formation and propagation, which is indicative of a very brittle nature of this material. Improvements in the sintering regime are required in order to produce dense, homogeneous and single phase hexagonal OsB 2 bulk ceramics

  14. Multiband model for tunneling in MgB2 junctions

    NARCIS (Netherlands)

    Brinkman, Alexander; Golubov, Alexandre Avraamovitch; Rogalla, Horst; Dolgov, O.V.; Kortus, J.; Kong, Y.; Jepsen, O.; Andersen, O.K.

    2002-01-01

    A theoretical model for quasiparticle and Josephson tunneling in multiband superconductors is developed and applied to MgB2-based junctions. The gap functions in different bands in MgB2 are obtained from an extended Eliashberg formalism, using the results of band structure calculations. The

  15. B2B myynnin johtaminen ravintola-alalla

    OpenAIRE

    Pajari, Katja

    2014-01-01

    Tämän opinnäytetyön tavoitteena oli selvittää, miten ravintola-alan yrityksissä johdetaan B2B myyntiä. Tarkoituksena oli kartoittaa, miten yrityksissä panostetaan B2B myyntiin ja sen johtamiseen sekä millä tavoin yritysmyyntiä johdetaan. Tutkimus pohjautuu opinnäytetyön tietoperustaan, jossa käsitellään B2B myyntiprosessia ja myynnin johtamista. Työssä käsitellään B2B myyntiä ja selvitetään myyntiprosessin eri vaiheita. Aihe on rajattu koskemaan nimenomaan johtamisen näkökulmaa B2B myynni...

  16. UCHUVA MÍNIMAMENTE PROCESADA IMPREGNADA AL VACÍO CON CALCIO Y VITAMINAS B9, D Y E

    Directory of Open Access Journals (Sweden)

    FABIOLA PEÑA

    Full Text Available Se evaluó la respuesta a la impregnación a vacío (IV de la uchuva ecotipo Colombia con diferentes líquidos, para formular una emulsión fortificante con calcio y vitaminas B9, D y E. La fracción volumétrica de impregnación y porosidad efectiva de la uchuva identifican una buena porosidad disponible al proceso. De acuerdo al índice R, la emulsión de impregnación es estable durante 35 días a 4°C. El proceso de IV no afectósignificativamente las uchuvas en cuanto a sus propiedades físico-químicas y niveles de vitamina C. Se obtuvieron uchuvas impregnadas que aportan, en una porción de 200g, niveles del 69, 82, 40, 50 y 15% de los valores diarios de referencia para las vitaminas C, B9, D, y E y el calcio, respectivamente. Micrografías tomadas por microscopia electrónica de barrido, evidenciaron la incorporación de las partículas oleosas en los poros del pedúnculo de la uchuva.

  17. Efetividade da "multimistura" como suplemento de dietas deficientes em vitaminas e/ou minerais na recuperação ponderal de ratos submetidos à desnutrição pós-natal

    OpenAIRE

    Ferreira,Haroldo da Silva; Assunção,Monica Lopes de; França,Adijane Oliveira Santos de; Cardoso,Eliana Paiva Cunha; Moura,Fabiana Andréa

    2005-01-01

    OBJETIVO: Avaliar a efetividade da "multimistura", usada como suplemento de dietas deficientes em vitaminas, deficientes em minerais, ou deficientes em vitaminas e minerais, na recuperação ponderal de ratos desnutridos. MÉTODOS: Após o desmame, 56 ratos Wistar, submetidos à desnutrição pós-natal, foram aleatoriamente distribuídos em 7 grupos diferenciados segundo o tipo de dieta oferecida: controle, dietas deficientes em vitaminas, deficientes em minerais, deficientes em vitaminas e minerais ...

  18. Magnetic and Moessbauer studies on GdCo3B2 and DyCo3B2

    International Nuclear Information System (INIS)

    Malik, S.K.; Umarji, A.M.; Shenoy, G.K.

    1984-10-01

    Magnetization and Moessbauer studies have been carried out on GdCo 3 B 2 and DyCo 3 B 2 . These compounds are magnetically ordered with Curie temperatures of 56 0 and 21 0 K respectively. The Co atoms are either nonmagnetic or carry a small moment in these compounds. The saturation moment of DyCo 3 B 2 at 5 0 K is smaller than the Dy 3+ free-ion value. From 161 Dy Moessbauer studies, the measured hyperfine magnetic field at the Dy site is also observed to be smaller than the free-ion value. 155 Gd Moessbauer measurements in GdCo 3 B 2 reveal the presence of large crystalline electric fields at the rare earth site. This causes the moment and the hyperfine field at the Dy site in DyCo 3 B 2 to be reduced from its free-ion value

  19. Defect structure of ultrafine MgB2 nanoparticles

    International Nuclear Information System (INIS)

    Bateni, Ali; Somer, Mehmet; Repp, Sergej; Erdem, Emre; Thomann, Ralf; Acar, Selçuk

    2014-01-01

    Defect structure of MgB 2 bulk and ultrafine particles, synthesized by solid state reaction route, have been investigated mainly by the aid of X-band electron paramagnetic resonance spectrometer. Two different amorphous Boron (B) precursors were used for the synthesis of MgB 2 , namely, boron 95 (purity 95%–97%, <1.5 μm) and nanoboron (purity >98.5%, <250 nm), which revealed bulk and nanosized MgB 2 , respectively. Scanning and transmission electron microscopy analysis demonstrate uniform and ultrafine morphology for nanosized MgB 2 in comparison with bulk MgB 2 . Powder X-ray diffraction data show that the concentration of the by-product MgO is significantly reduced when nanoboron is employed as precursor. It is observed that a significant average particle size reduction for MgB 2 can be achieved only by using B particles of micron or nano size. The origin and the role of defect centers were also investigated and the results proved that at nanoscale MgB 2 material contains Mg vacancies. Such vacancies influence the connectivity and the conductivity properties which are crucial for the superconductivity applications

  20. Efeito da corticotropina sobre a absorção de vitamina B12 na mielose funicular

    Directory of Open Access Journals (Sweden)

    Horacio M. Canelas

    1965-06-01

    Full Text Available Foi estudada a absorção de vitamina B12 em 9 casos de mielose funicular antes e após a administração de ACTH por via intravenosa em um esquema terapêutico com duração variável entre 19 e 43 dias. Em 7 casos foi verificado aumento da absorção. A diferença média de modificação no teste de excreção urinaria de vitamina B12 radioativa situou-se próximo do nível de significancia estatística. Este resultado reforça a indicação do emprego de corticotropina na mielose funicular, pois o hormônio irá atuar tanto sobre o componente alérgico do prccesso desmielinizante, quanto sobre a carência de vitamina B12 resultante do déficit de absorção. Embora o material aqui analisado seja muito pequeno para garantir uma conclusão definitiva, nossos resultados demonstram que, provavelmente, o ACTH age sobre a absorção da vitamina B12 através da mucosa intestinal, e não mediante o aumento de secreção do fator intrínseco ou a mobilização dos depósitos dessa vitamina. In order to study a possible mobilizing effect of ACTH on the radioactive vitamin B12 stores, the intervals between the last urinary excretion test and the test after completion of treatment were analyzed (Table 1. It is easily noticed that in the 7 cases with increase of vitamin B12 absorption these periods were the most varied, lasting from 9 to 62 days. And also in the 2 cases with decrease of absorption the intervals were very dissimilar, namely 15 and 56 days. So, it seems that this effect of ACTH did not play a significant role in the results. Likewise, the time elapsed between the completion of treatment and the repetition of the Schilling's test had no apparent relationship with the results.

  1. Digitaalisen markkinoinnin suunnitelma b2b-yritykselle

    OpenAIRE

    Harhakoski, Oskari

    2011-01-01

    Työ käsittelee digitaalisen markkinoinnin suunnitelman tekemistä b2b-yritykselle. Tavoitteena oli kilpailuedun hankkiminen sosiaalisen median tehokkaalla hyödyntämisellä mark-kinoinnissa. Konkreettisemmin yritys halusi lisää näkyvyyttä ja myyntiä. Suunnitelman laatimisessa hyödynnettiin POST-menetelmää. Erityistä huomiota kiinnitettiin b2b-markkinoinnin eroihin b2c-markkinointiin verrattuna. Myös yrityksen toimiminen Suomen markkinoilla huomioitiin. Lisäksi analysoitiin kilpailijoita asia...

  2. Pulse laser irradiation into superconducting MgB2 detector

    International Nuclear Information System (INIS)

    Fujiwara, Daisuke; Miki, Shigehito; Satoh, Kazuo; Yotsuya, Tsutomu; Shimakage, Hisashi; Wang, Zhen; Okayasu, Satoru; Katagiri, Masaki; Machida, Masahiko; Kato, Masaru; Ishida, Takekazu

    2005-01-01

    We performed 20-ps pulse laser irradiation experiments on a MgB 2 neutron detector to know a thermal-relaxation process for designing a MgB 2 neutron detector. The membrane-type structured MgB 2 device was fabricated to minimize the heat capacity of sensing part of a detector as well as to enhance its sensitivity. We successfully observed a thermal-relaxation signal resulting from pulse laser irradiation by developing a detection circuit. The response time was faster than 1 μs, meaning that the detector would be capable of counting neutrons at a rate of more than 10 6 events per second

  3. Magnetic anisotropy of YNi2B2C single crystals

    International Nuclear Information System (INIS)

    Baran, M.; Gladczuk, L.; Gorecka, J.; Szymczak, H.; Szymczak, R.; Drzazga, Z.; Winiarska, H.

    1994-01-01

    Reversible and irreversible magnetization processes in YNi 2 B 2 C single crystal have been measured and analysed in terms of existing theories. Performed measurements suggest that anisotropy of the effective mass in YNi 2 B 2 C superconductor is rather small and similar to that observed in conventional superconductors. Effect of hydrostatic pressure on T c is shown to be typical of low-temperature superconductors. It is suggested that the layered structure of YNi 2 B 2 C has some effect on the irreversible magnetization processes observed in this superconductor. ((orig.))

  4. Concentração de vitamina A no leite humano maduro Vitamin A concentration in mature human milk

    Directory of Open Access Journals (Sweden)

    Gisele Souza

    2012-12-01

    Full Text Available OBJETIVO: Quantificar a concentração de vitamina A no leite maduro de nutrizes assistidas em maternidade pública no município do Rio de Janeiro e avaliar a sua relação com variáveis sociodemográficas e grau de conhecimento de nutrição. MÉTODOS: Para a quantificação do retinol, foram coletadas amostras de 10 mL de leite maduro. Os pontos de corte adotados para identificação da deficiência de vitamina A e constituição de reserva hepática foram de 2,3 µmol/L, respectivamente. Foram avaliadas, ainda, as variáveis: grau de conhecimento de nutrição, sexo, idade, renda familiar, escolaridade, condições de saneamento básico, número de moradores na residência, idade materna e assistência pré-natal. Resultados: Participaram do estudo 196 nutrizes, com concentração média de vitamina A no leite maduro de 1,76±0,85 µmol/L e prevalência de 20,5% de deficiência de vitamina A. Não houve diferença na concentração de vitamina A no leite das nutrizes segundo as variáveis sociodemográficas e conhecimento de nutrição. Apenas 38,9% das nutrizes apresentavam concentração de vitamina A no leite suficiente para constituição de reserva hepática dos lactentes. RESULTADOS: Participaram do estudo 196 nutrizes, com concentração média de vitamina A no leite maduro de 1,76±0,85 µmol/L e prevalência de 20,5% de deficiência de vitamina A. Não houve diferença na concentração de vitamina A no leite das nutrizes segundo as variáveis sociodemográficas e conhecimento de nutrição. Apenas 38,9% das nutrizes apresentavam concentração de vitamina A no leite suficiente para constituição de reserva hepática dos lactentes. CONCLUSÕES: Os achados aqui apresentados revelam alta prevalência de inadequação do estado nutricional de vitamina A materno e do lactente, concordante com a prevalência nacional descrita em mulheres em idade fértil e crianças brasileiras, e que as medidas de intervenção para combate à car

  5. Vitamina C em "cabeludinha" (Myrciaria glomerata Berg Vitamin C content in fruits of Myrciaria glomerata

    Directory of Open Access Journals (Sweden)

    J. Soubihe Sobrinho

    1955-01-01

    Full Text Available Êste trabalho faz parte do estudo do melhoramento genético das mirtáceas frutíferas, que vem sendo realizado pela Seção de Frutas Tropicais do Instituto Agronômiso e pela Seção de Genética da Escola Superior de Agricultura "Luiz de Queiroz", em Piracicaba. Colaboraram na parte analítica a Seção Técnica "Química Agrícola" e a Cadeira de Química, da "Luiz de Queiroz''. A extração de vitamina C foi feita num liqüidificador durante dois minutos, utilizando-se o ácido oxálico a quatro por mil como solução protetora. A determinação se fez no "EEL. portable colorimeter". A determinação do conteúdo de vitamina C no fruto integral de plantas expostas ao pleno sol revelou o seguinte : planta 1, 2147 mg/100 g ; planta 2, 2389 mg/100 g ; planta 3, 2322 mg/100 g de fruto (vêr figura 1-A. Os teores de ácido ascórbico encontrados nos graus de maturação foram : fruto verde, 2716 mg/100 g ; fruto de vez, 2391 mg/100 g; fruto maduro, 2417 mg/100 g. O fruto verde tem o teor mais alto, enquanto o de vez e o maduro não diferem entre si. Também foram analisadas as diversas partes do fruto maduro, encontrando-se na casca 2482 mg/100 g e na polpa 3018 mg/100 g. Isto quer dizer que na "cabeludinha" a riqueza em ácido ascórbico aumenta da periferia para o centro. Tal fato é de suma importância, uma vez que só é aproveitada a polpa, portanto, a parte mais rica do fruto. Determinou-se também o conteúdo de vitamina C no fruto integral e maduro, de plantas sombreadas, encontrando-se na planta 1, 717, 28 mg/100 g; na planta 2, 838,66 mg/100 g ; na planta 3, 560,83 mg/100 g ; na planta 4, 713, 28 mg/100 g. Êstes resultados indicam, provavelmente, que as plantas localizadas à sombra são bem mais pobres em ácido ascórbico que aquelas crescendo ao sol; indicam ainda, que entre as plantas sombreadas há diferenças significativas, talvez de origem genética. As figuras dos gráficos 3 e 4 mostram, respectivamente, que a "cabeludinha

  6. The role of TiB2 in strengthening TiB2 reinforced aluminium casting composites

    International Nuclear Information System (INIS)

    Chen, Z; Kang, H; Zhao, Y; Zheng, Y; Wang, T

    2016-01-01

    With an aim of developing high quality in situ TiB 2 reinforced aluminium foundry alloy based composites, the conventional direct synthesis method was modified into a two-step route. In step one we optimized the halide salt route to fabricate in situ TiB 2 particulate reinforced aluminium matrix composites and in step two we investigated the effects of the Al-5wt.% TiB 2 composite, as a “master composite”, on strengthening the practical foundry alloys. The in situ formed TiB 2 particles play two roles while strengthening the composites: (1) The grain refinement effect that improves the quality of the alloy matrix; and (2) The interactions between the hard particulates and the matrix add extra increment to the material strength. In different alloy systems, TiB 2 may play distinct roles in these two aspects (figure 1). Further analysis of the strengthening mechanisms shows that particle agglomeration behaviour during solidification is responsible for the latter one. The present work details the role of TiB 2 in strengthening TiB 2 reinforced aluminium casting composites. (paper)

  7. 26 CFR 1.403(b)-2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.403(b)-2 Definitions. (a) Application... 1450(b) of the Small Business Job Protection Act of 1996 (110 Stat. 1755, 1814) for special rules...

  8. Applying conceptual design to B2B sales negotiations

    DEFF Research Database (Denmark)

    Illi, Mikko; Ylirisku, Salu

    This paper addresses the challenge of perceiving B2B sales negotiation in a manner that would open up new possibilities for the improvement of the practice. B2B sales agents work under high pressure in developing relevant and appealing proposals when negotiating for a deal with a customer. The key...... problem that will be addressed is the building of understanding of a customer’s current needs and requirements, and then trying to devise an appropriate proposal to match these. The work of the sales agents in B2B sales negotiations is highly complex, as they need to understand both the modular machinery...... on the ways in which design sense making artefacts may drive also B2B sales agents’ work....

  9. B2B Models for DoD Acquisition

    National Research Council Canada - National Science Library

    Kamel, Magdi N

    2008-01-01

    A central vision of B2B e-commerce is that of an electronic marketplace that would bring suppliers together with major buyers of goods and services for the purpose of conducting "frictionless commerce...

  10. Novel high pressure hexagonal OsB2 by mechanochemistry

    International Nuclear Information System (INIS)

    Xie, Zhilin; Graule, Moritz; Orlovskaya, Nina; Andrew Payzant, E.; Cullen, David A.; Blair, Richard G.

    2014-01-01

    Hexagonal OsB 2 , a theoretically predicted high-pressure phase, has been synthesized for the first time by a mechanochemical method, i.e., high energy ball milling. X-ray diffraction indicated that formation of hexagonal OsB 2 begins after 2.5 h of milling, and the reaction reaches equilibrium after 18 h of milling. Rietveld refinement of the powder data indicated that hexagonal OsB 2 crystallizes in the P63/mmc space group (No. 194) with lattice parameters of a=2.916 Å and c=7.376 Å. Transmission electron microscopy confirmed the appearance of the hexagonal OsB 2 phase after high energy ball milling. in situ X-ray diffraction experiments showed that the phase is stable from −225 °C to 1050 °C. The hexagonal OsB 2 powder was annealed at 1050 °C for 6 days in vacuo to improve crystallinity and remove strain induced during the mechanochemical synthesis. The structure partially converted to the orthorhombic phase (20 wt%) after fast current assisted sintering of hexagonal OsB 2 at 1500 °C for 5 min. Mechanochemical approaches to the synthesis of hard boride materials allow new phases to be produced that cannot be prepared using conventional methods. - Graphical abstract: High resolution transmission electron micrograph of hexagonal OsB 2 nanocrystallite with corresponding fast Fourier transform and simulated diffraction pattern. - Highlights: • Hexagonal OsB 2 has been synthesized for the first time by mechanochemical method. • Hexagonal OsB 2 crystallizes in P63/mmc space group (No. 194), a=2.916 Å and c=7.376 Å. • The hexagonal structure was confirmed by a transmission electron microscope. • No phase transformation was observed after being annealed at 1050 °C for 6 days. • 20 wt% of h-OsB 2 was transformed to o-OsB 2 after being sintered at 1500 °C for 5 min

  11. Thermal stability of hexagonal OsB2

    Science.gov (United States)

    Xie, Zhilin; Blair, Richard G.; Orlovskaya, Nina; Cullen, David A.; Andrew Payzant, E.

    2014-11-01

    The synthesis of novel hexagonal ReB2-type OsB2 ceramic powder was performed by high energy ball milling of elemental Os and B powders. Two different sources of B powder have been used for this mechanochemical synthesis. One B powder consisted of a mixture of amorphous and crystalline phases and a mixture of 10B and 11B isotopes with a fine particle size, while another B powder was a purely crystalline (rhombohedral) material consisting of enriched 11B isotope with coarse particle size. The same Os powder was used for the synthesis in both cases. It was established that, in the first case, the hexagonal OsB2 phase was the main product of synthesis with a small quantity of Os2B3 phase present after synthesis as an intermediate product. In the second case, where coarse crystalline 11B powder was used as a raw material, only Os2B3 boride was synthesized mechanochemically. The thermal stability of hexagonal OsB2 powder was studied by heating under argon up to 876 °C and cooling in vacuo down to -225 °C. During the heating, the sacrificial reaction 2OsB2+3O2→2Os+2B2O3 took place due to presence of O2/water vapor molecules in the heating chamber, resulting in the oxidation of B atoms and formation of B2O3 and precipitation of Os metal out of the OsB2 lattice. As a result of such phase changes during heating, the lattice parameters of hexagonal OsB2 changed significantly. The shrinkage of the a lattice parameter was recorded in 276-426 °C temperature range upon heating, which was attributed to the removal of B atoms from the OsB2 lattice due to oxidation followed by the precipitation of Os atoms and formation of Os metal. While significant structural changes occurred upon heating due to presence of O2, the hexagonal OsB2 ceramic demonstrated good phase stability upon cooling in vacuo with linear shrinkage of the lattice parameters and no phase changes detected during cooling.

  12. Combustion synthesis of AlB2-Al2O3 composite powders with AlB2 nanowire structures

    Science.gov (United States)

    Yang, Pan; Xiao, Guoqing; Ding, Donghai; Ren, Yun; Yang, Shoulei; Lv, Lihua; Hou, Xing

    2018-05-01

    Using of Al and B2O3 powders as starting materials, and Mg-Al alloy as additives, AlB2-Al2O3 composite powders with AlB2 nanowire structures were successfully fabricated via combustion synthesis method in Ar atmosphere at a pressure of 1.5 MPa. The effect of different amount of Mg-Al alloy on the phase compositions and morphology of the combustion products was investigated. The results revealed that AlB2 and Al2O3 increased, whereas Al decreased with the content of Mg-Al alloy increasing. The impurities MgAl2O4 and AlB12 would exist in the sample with adding of 18 wt% Mg-Al alloy. Interestingly, FESEM/TEM/EDS results showed that AlB2 nanowires were observed in the products when the content of Mg-Al alloy is 6 wt% and 12 wt%. The more AlB2 nanowires can be found as the content of Mg-Al alloy increased. And the yield of AlB2 nanowires with the diameter of about 200 nanometers (nm) and the length up to several tens of micrometers (μm) in the combustion product is highest when the content of Mg-Al alloy is 12 wt%. The vapor, such as Mg-Al (g), B2O2 (g), AlO (g) and Al2O (g), produced during the process of combustion synthesis, reacted with each other to yield AlB2 nanowires by vapor-solid (VS) mechanism and the corresponding model was also proposed.

  13. B2B Models for DoD Acquisition

    Science.gov (United States)

    2007-07-30

    product design, demand forecasting, asset management, and sales and marketing plans 35 Proctor & Gamble’s Private Industrial Network SOURCE: Laudon... B2B Models for DoD Acquisition 30 July 2007 by Magdi N. Kamel, Associate Professor Graduate School of Operational & Information Sciences...number. 1. REPORT DATE 30 JUL 2007 2. REPORT TYPE 3. DATES COVERED 00-00-2007 to 00-00-2007 4. TITLE AND SUBTITLE B2B Models for DoD

  14. Creating Competitive Advantage by Rethinking B2B Software Pricing

    OpenAIRE

    Adelstrand, Carl; Brostedt, Emil

    2016-01-01

    The choice of pricing model for software products is a complex procedure due to the different characteristics compared to physical products. This thesis investigates and compares software pricing models in a B2B setting, and describes how KAM plays a role in executing a pricing model. The research has been conducted as an opportunist case study on Adebro, a technology company in the B2B sector. The thesis have come to the following conclusions, with data from interviews and literature: Perpet...

  15. Scope of Internal Marketing in B2B Companies

    OpenAIRE

    Nigam, Niharika

    2007-01-01

    Abstract Previous studies have focused on "internal marketing" from services marketing perspective. There is, therefore, a great dearth of in-depth research on its application to other business types. This research attempts to find the scope of internal marketing in B2B companies. The purpose of this research is to closely examine the elements, their linkage, tools and applications of Internal marketing when applied to B2B settings. Internal marketing, the application of marketing managem...

  16. Il B2B e il paradigma dei costi di transazione (B2B and the Transaction Costs Paradigm

    Directory of Open Access Journals (Sweden)

    Pierluigi Sabbatini

    2001-06-01

    Full Text Available Business to Business (B2B Internet commerce causes a significant contraction of transaction costs. According to the Coase paradigm, we would thus expect a deverticalization of the industry and broader scope for anonymous market mechanisms. In reality, such expectations are not fully borne out by the facts. When the industrial structure is concentrated the B2Bgenerally loses its independence, and is owned by the firms which most contribute to its development, e.g. the ones able to bring the liquidity to it. The B2B governance mechanism established by these firms gives hierarchical mechanisms a role which they do not usually play in extensive, anonymous markets.

  17. Novel high pressure hexagonal OsB2 by mechanochemistry

    Science.gov (United States)

    Xie, Zhilin; Graule, Moritz; Orlovskaya, Nina; Andrew Payzant, E.; Cullen, David A.; Blair, Richard G.

    2014-07-01

    Hexagonal OsB2, a theoretically predicted high-pressure phase, has been synthesized for the first time by a mechanochemical method, i.e., high energy ball milling. X-ray diffraction indicated that formation of hexagonal OsB2 begins after 2.5 h of milling, and the reaction reaches equilibrium after 18 h of milling. Rietveld refinement of the powder data indicated that hexagonal OsB2 crystallizes in the P63/mmc space group (No. 194) with lattice parameters of a=2.916 Å and c=7.376 Å. Transmission electron microscopy confirmed the appearance of the hexagonal OsB2 phase after high energy ball milling. in situ X-ray diffraction experiments showed that the phase is stable from -225 °C to 1050 °C. The hexagonal OsB2 powder was annealed at 1050 °C for 6 days in vacuo to improve crystallinity and remove strain induced during the mechanochemical synthesis. The structure partially converted to the orthorhombic phase (20 wt%) after fast current assisted sintering of hexagonal OsB2 at 1500 °C for 5 min. Mechanochemical approaches to the synthesis of hard boride materials allow new phases to be produced that cannot be prepared using conventional methods.

  18. Thermal stability of hexagonal OsB2

    International Nuclear Information System (INIS)

    Xie, Zhilin; Blair, Richard G.; Orlovskaya, Nina; Cullen, David A.; Andrew Payzant, E.

    2014-01-01

    The synthesis of novel hexagonal ReB 2 -type OsB 2 ceramic powder was performed by high energy ball milling of elemental Os and B powders. Two different sources of B powder have been used for this mechanochemical synthesis. One B powder consisted of a mixture of amorphous and crystalline phases and a mixture of 10 B and 11 B isotopes with a fine particle size, while another B powder was a purely crystalline (rhombohedral) material consisting of enriched 11 B isotope with coarse particle size. The same Os powder was used for the synthesis in both cases. It was established that, in the first case, the hexagonal OsB 2 phase was the main product of synthesis with a small quantity of Os 2 B 3 phase present after synthesis as an intermediate product. In the second case, where coarse crystalline 11 B powder was used as a raw material, only Os 2 B 3 boride was synthesized mechanochemically. The thermal stability of hexagonal OsB 2 powder was studied by heating under argon up to 876 °C and cooling in vacuo down to −225 °C. During the heating, the sacrificial reaction 2OsB 2 +3O 2 →2Os+2B 2 O 3 took place due to presence of O 2 /water vapor molecules in the heating chamber, resulting in the oxidation of B atoms and formation of B 2 O 3 and precipitation of Os metal out of the OsB 2 lattice. As a result of such phase changes during heating, the lattice parameters of hexagonal OsB 2 changed significantly. The shrinkage of the a lattice parameter was recorded in 276–426 °C temperature range upon heating, which was attributed to the removal of B atoms from the OsB 2 lattice due to oxidation followed by the precipitation of Os atoms and formation of Os metal. While significant structural changes occurred upon heating due to presence of O 2 , the hexagonal OsB 2 ceramic demonstrated good phase stability upon cooling in vacuo with linear shrinkage of the lattice parameters and no phase changes detected during cooling. - Graphical abstract: The in situ high temperature XRD

  19. CONTEÚDO DE RIBOFLAVINA EM LEITE E PRODUTOS LÁCTEOS E COMPARAÇÃO COM O VALOR ANUNCIADO NO RÓTULO

    Directory of Open Access Journals (Sweden)

    MONISE VIANA ABRANCHES

    2009-06-01

    Full Text Available

    O leite e seus derivados são alimentos de alto valor nutricional, muito presentes na dieta do brasileiro e ricos em riboflavina, cuja defi ciência é endêmica em várias regiões do mundo. Esse estudo investigou o conteúdo de riboflavina em leites e derivados e avaliou se os valores encontrados são condizentes com os declarados no rótulo. Foram avaliadas 3 marcas de leite integral, 2 de leite desnatado, 2 de queijo tipo petit suisse e 3 de iogurte. As análises foram conduzidas por Cromatografia Liquida de Alta Eficiência (CLAE. Não foi observada diferença quanto ao conteúdo de riboflavina entre os leites desnatados, mesmo quando apresentado no rótulo o termo “enriquecido com vitaminas”. O mesmo não foi observado em leites integrais, sendo encontradas diferenças significativas quanto ao conteúdo vitamínico entre as marcas analisadas. Em iogurtes, esta diferença não foi significativa. Uma das marcas de queijo tipo petit suisse apresentou teor de riboflavina duas vezes superior à outra. Notou-se superestimação dos valores de riboflavina descritos nos rótulos dos produtos que continham esta informação quando comparados àqueles encontrados no presente trabalho. Verifica-se a necessidade de fiscalização quanto ao enriquecimento de produtos lácteos e de intensificar as pesquisas nessa área, devido à escassez de dados na literatura.

  20. Lattice Thermal Conductivity of Ultra High Temperature Ceramics ZrB2 and HfB2 from Atomistic Simulations

    Science.gov (United States)

    Lawson, John W.; Murray, Daw S.; Bauschlicher, Charles W., Jr.

    2011-01-01

    Atomistic Green-Kubo simulations are performed to evaluate the lattice thermal conductivity for single crystals of the ultra high temperature ceramics ZrB2 and HfB2 for a range of temperatures. Recently developed interatomic potentials are used for these simulations. Heat current correlation functions show rapid oscillations which can be identified with mixed metal-Boron optical phonon modes. Agreement with available experimental data is good.

  1. Pseudopotential approach to superconductivity in MgB2

    International Nuclear Information System (INIS)

    Sharma, K.S.; Bhargava, Nidhi; Jain, Ritu; Goyal, Varsha; Sharma, Ritu; Sharma, Smita

    2010-01-01

    Superconductivity in MgB 2 has been re-examined in BCS-Eliashberg framework by employing Mc-Millan's T c -equation and form factors of MgB 2 computed from the form factors of component metals (Model-I). The empty core model pseudopotential due to Ashcroft and random phase approximation form of dielectric screening due to Gellmann and Brueckner are used in the present work. An excellent agreement between the present values and other theoretically computed values of T c and with the relevant experimental data for MgB 2 confirms the validity of the present approach. The explicit dependence of λ and T c on the isotopic masses of Mg and B, as revealed from the present work, confirms the role of lattice vibrations in the superconducting behaviour of MgB 2 and the high value of T c in it may be attributed to the phonon mediated e-e interaction coupled with higher values of phonon frequencies due to light mass of B atoms. It has also been observed that the pseudo-atom model (Model-II) with appropriate choice of the potential parameter r c successfully explains high value of T c and isotope effect in MgB 2 , confirming the prominent role played by electron-phonon interaction in the high-T c superconductivity observed in MgB 2 . The isotope effect exponent α-values obtained from the two models are in complete agreement with each other and the present value α = 0.46 is also much closer to the BCS value of 0.5. Interaction strength N 0 V values obtained from the two models are also in perfect agreement with each other and the present value N 0 V = 0.48 suggests that MgB 2 is a strong coupling superconductor. (author)

  2. Efecto de los suplementos de calcio, vitamina D e isoflavonas sobre marcadores del remodelado óseo en mujeres postmenopaúsicas recientes: papel de polimorfismos del receptor de vitamina D

    OpenAIRE

    Pérez Alonso, María

    2016-01-01

    La osteoporosis es una enfermedad de elevada prevalencia, morbimortalidad y alto coste económica que se hace clínicamente evidente cuando aparecen las fracturas características. La vitamina D juega un importante papel en el mantenimiento de la integridad del esqueleto y de la resistencia ósea, principal determinante de la aparición de fracturas. Pot otra parte la incidencia de la hipovitaminosis D es muy frecuente con hiperparatiroidismo secundario asociado y aumento del remodelado óseo Ob...

  3. Dry cryomagnetic system with MgB2 coil

    Science.gov (United States)

    Abin, D. A.; Mineev, N. A.; Osipov, M. A.; Pokrovskii, S. V.; Rudnev, I. A.

    2017-12-01

    MgB2 may be the future superconducting wire material for industrial magnets due to it’s higher operation temperature and potentially lower cost than low temperature superconductors (LTS) have. We designed a compact cryomagnetic system with the use of MgB2. The possibility of creating a magnet with a central field of 5 T from a commercial MgB2 wire by the “react and wound” method was investigated. The magnetic system is cooled by a cryocooler through a copper bus. The magnet has a warm bore diameter of 4 cm. The design of a magnet consisting of three concentric solenoids is proposed: an internal one of high-temperature superconductor (HTS), an average of MgB2, and an external of NbTi. The operating current of the system is 100 A. Two pairs of current leads are used. A separate pair of current leads for power supplying NbTi coil allows testing of MgB2 and HTS coils in an external field. The load curves for each of the magnets are calculated.

  4. Estrés oxidativo y marcadores bioquímicos en ratas diabéticas con dieta suplementada con vitamina E

    OpenAIRE

    Valdivieso Izquierdo, Lázaro Rubén

    2015-01-01

    Determina el rol de la vitamina E en los parámetros bioquímicos y antioxidantes en ratas diabéticas. La diabetes es inducida experimentalmente con estreptozotocina (35 mg/kg de peso por v.i.p.). Los animales (n= 24) son divididos en cuatro grupos: Grupo I: Control, Grupo II: Control + Vitamina E (25 mg/día), Grupo III: Diabética y Grupo IV: Diabética + Vitamina E (25 mg/día), durante 8 semanas. Parámetros bioquímicos como glucosa, la hemoglobina glicada y perfil lipídico son evaluados, así mi...

  5. Comparación entre dos inmunoensayos automatizados por quimioluminiscencia para la cuantificación de 25(OH) vitamina D

    OpenAIRE

    Torrubia, B.; Alonso, I.; López-Ramiro, E.; Mahillo, I.; De la Piedra, C.

    2016-01-01

    Introducción: La cuantificación de 25(OH) vitamina D total en sangre es el marcador más preciso del estado de vitamina D en un individuo. La técnica patrón-oro para su medición es la cromatografía líquida/espectrometría de masas en tándem (LC-MS/MS), aunque actualmente los laboratorios clínicos utilizan de rutina técnicas de quimioluminiscencia. El objetivo del estudio fue comparar las concentraciones de 25(OH) vitamina D obtenidas mediante dos métodos automatizados comerciales y estudiar la ...

  6. Determinación del contenido de vitamina C en miel de abejas venezolanas por volumetría de óxido-reducción

    OpenAIRE

    Zago G, Karina I; García F, María Y; Di Bernardo, María L; Vit, Patricia; Luna, José R; Gualtieri, María

    2010-01-01

    En este trabajo se ha determinado el contenido de Vita mina C en mieles de abeja de la región andina venezolana. La Vitamina C pertenece junto con la Vitamina B al grupo de las hidrosolubles. Ayuda en el desarrollo de huesos, cartílagos, a la absorción del hierro, a la producción de colágeno (actuando como cofactor en la hidroxilación de los aminoácidos lisina y prolina). La propiedad química antioxidante es la más importante de la vitamina C; esto ayuda a prevenir la oxidación de las vitamin...

  7. Phasing out of the Universal Mega Dose of Vitamin-A Prophylaxis to Avoid Toxicity

    Directory of Open Access Journals (Sweden)

    Sudip Bhattacharya

    2017-01-01

    Full Text Available Childhood blindness due to corneal ulceration was prevalent among poor Indian children. To tackle this situation, the National Institute of Nutrition (NIN, Hyderabad, India, Vitamin-A (Vit-A prophylaxis programme was launched nationally in 1970 after field testing. Research of Indian Council for Medical Research (ICMR documented that prevalence of Vit-A deficiency signs such as Bitot’s spot decreased among children, over a period of time. However, this decrease cannot be ascertained is due to mass Vit-A prophylaxis programme. This is because coverage was low and patchy. Improved nutrition status, wider vaccination coverage, increased rate in breast feeding and improvement of healthcare services played a crucial role. Rather many studies revealed that (mass prophylaxis to the child who is having adequate Vit-A level it may be harmful to certain group of children as a result of acute toxic symptoms. High dose of Vit-A is capable of loss of bone density-hence retarded growth may be observed in susceptible individuals. To tackle this issue food based approach should be promoted (which includes breast feeding along with timely measles vaccination. The children who have signs of Vit-A deficiency (e.g. night blindness, xeropthalmia, Bitot’s spot or post measles children should receive Vit-A in age specific daily doses for two weeks along with Vit-A rich food, like green leafy vegetables, red palm oil, liver etc. Public spirited citizens, together with scientific community in India, should discourage this “one size fit to all” approach. It will not only avoid the ill effects of high dose of Vit-A but also it will help us optimal utilization of health resources in a resource poor country like India.

  8. Studies on the intestinal absorption of vitamin B2

    International Nuclear Information System (INIS)

    Yamaguchi, Keiko; Moriwaki, Chiaki

    1978-01-01

    The intestinal absorption of vitamin B 2 was studied by in situ mesenteric perfusion system. Free form riboflavin (FR), FMN and FAD (1 mg each) were injected into the ligated jejunum of rat which was infused Krebs Ringer bicarbonate solution from the superior mesenteric artery. Perfusate was recovered from the mesenteric vein and the recoveries of the total riboflavin during 120 min after the administration of these 3 types vitamin B 2 were 1.0, 1.5 and 2.8%, respectively. Furthermore, riboflavin and its esters were detected in the perfusates from 14 C-FR and 14 C-FAD given rats. There was a considerable amount of labeled substance which was not vitamin B 2 derivatives in the radiopaperchromatogram of the perfusate of 14 C-FR dosed rats, and it is suggested that a portion of riboflavin is decomposed in the process of absorption. (auth.)

  9. B2B-myynnin nykytila ja haasteet Suomessa

    OpenAIRE

    Ylimaula, Jukka

    2014-01-01

    Tämä opinnäytetyö tutki B2B-myynnin nykytilaa valituissa suomalaisissa yrityksissä. Tutkimuksen tavoite oli selvittää myyntijohdon mielestä B2B-myynnissä tärkeitä asioita ja hahmottaa tapaa, jolla organisaatio toimii yhteistyössä myynnissä. Näin teemojen pohjalta opinnäytetyö pyrki muodostamaan ajankuvan suomalaisesta B2B-myynnistä. Opinnäytetyö muodostuu teoriaosasta ja empiirisestä osasta. Teoreettinen osuus tutkii myyntiä sekä myyjän että ostajan näkökulmasta. Myös asiakassuhteita ja m...

  10. Chemical vapor deposition of TiB2 on graphite

    International Nuclear Information System (INIS)

    Pierson, H.O.; Randich, E.; Mattox, D.M.

    1978-01-01

    This study is an experimental investigation of the coating of graphite with TiB 2 by chemical vapor deposition (CVD) using the hydrogen reduction of BCl 3 and TiCl 4 at 925 0 C and 1 atm. Reasonable matching of the thermal expansion of TiB 2 and graphite was necessary to eliminate cracking. A suitable graphite was POCO DFP-1. Adhesion was improved by having a slightly rough graphite surface. Heat treatment at 2000 0 C and above resulted in a certain degree of diffusion. No melting or solid phases other than TiB 2 and graphite were detected up to 2400 0 C. The coatings showed no failure when repeatedly submitted to an electron beam pulse of 2 KW/cm 2 for 0.8 sec

  11. ORM-Based Semantics of B2B Transactions

    Science.gov (United States)

    Balsters, H.; van Blommestein, F.

    After widespread implementation of Enterprise Resource Planning and Personal Information Management, the next wave in the application of ICT is headed towards business to business (B2B) communication. B2B has a number of specific aspects, one of them being negotiation. This aspect has been largely neglected by present implementations of standard EDI- or XML-messaging and by B2B webservice implementations. In this paper a precise model is given of the negotiation process. The requirements of a potential Buyer and the offer of a potential Seller are matched and, if the negotiation is successful, a contract is concluded. The negotiation process model is represented in ORM, extended with dynamic constraints. Our model may be implemented in the databases of the trading partners and in message- or service definitions.

  12. Densification and properties of HfB2 based materials

    International Nuclear Information System (INIS)

    Sonber, J.K.; Ch Murthy, T.S.R.; Bedse, R.D.; Subramanian, C.; Kumar, Sunil; Fotedar, R.K.; Krishnamurthy, N.; Suri, A.K.

    2011-01-01

    This paper presents the results of investigation carried out on densification and properties of HfB 2 based materials. Densification study of HfB 2 with and without sinter additive was carried out by hot pressing. TiSi 2 and CrSi 2 were used as sinter additive. Monolithic HfB 2 was densified to only 80%ρ th at 1850 deg C with a pressure of 35 MPa. Addition of 10 wt% TiSi 2 resulted in a density of 95% TD at a relatively low temperature of 1650 deg C and a low pressure of 20 MPa. Addition of 10% CrSi 2 resulted in a density of 99% TD at the same operating conditions. All the samples were characterized by SEM/EDS and mechanical property measurement. (author)

  13. Electromagnetic densification of MgB2/Cu wires

    International Nuclear Information System (INIS)

    Woźniak, M; Glowacki, B A

    2014-01-01

    Electromagnetic compaction of in situ MgB 2 /Cu wire has been achieved using a custom-built 200 J device. The monofilament core packing density was increased by 8% and up to 31% for unreacted and reacted wires respectively. The higher density of the MgB 2 core resulted in a critical current density increase of up to 75% in comparison to that for cold-drawn-only wire. Applying this treatment to a wire with Cu powder additions to the core and with an optimized heat treatment resulted in one of the highest ever reported values of J c for MgB 2 /Cu wires of 6.83 × 10 3  A cm −2 at 4.2 K and 6 T. (paper)

  14. Vitamin B2 (riboflavin content in cereal products

    Directory of Open Access Journals (Sweden)

    Soňa Škrovánková

    2010-01-01

    Full Text Available Vitamin B2 (riboflavin is a water-soluble essential vitamin. Nowadays an increased risk for riboflavin deficiency may be seen in people on special diets (diabetes mellitus, smokers or heavy alcohol drinkers. In the Czech diet the main sources of the vitamin intake are milk and dairy products followed by cereals and meat. Cereals are good source of this vitamin as it is widely and regularly consumed in different forms. Analyses of the vitamin B2 content in different types of cereal products (flours, breads, pastries, breakfast cereals, cooked pasta of Czech origin using HPLC with reversed phase and UV detection were done. The vitamin B2 content of chosen cereal products decreased in this progression: enriched wholemeal breakfast cereals (the best source of the vitamin, enriched wheat flours, breads – rye and wholemeal wheat breads, whole wheat and spelt flours, wheat bread, cooked whole wheat and rye spaghetti, wheat and multigrain pastries and finally scoured wheat flours.

  15. MgB2 superconducting wires basics and applications

    CERN Document Server

    2016-01-01

    The compendium gives a complete overview of the properties of MgB2 (Magnesium Diboride), a superconducting compound with a transition temperature of Tc = 39K, from the fundamental properties to the fabrication of multifilamentary wires and to the presentation of various applications. Written by eminent researchers in the field, this indispensable volume not only discusses superconducting properties of MgB2 compounds, but also describes known preparation methods of thin films and of bulk samples obtained under high pressure methods. A unique selling point of the book is the detailed coverage of various applications based on MgB2, starting with MRI magnets and high current cables, cooled by Helium (He) vapor. High current cables cooled by liquid hydrogen are also highlighted as an interesting alternative due to the shrinking He reserves on earth. Other pertinent subjects comprise permanent magnets, ultrafine wires for space applications and wind generator projects.

  16. A new superhard material: Osmium diboride OsB 2

    Science.gov (United States)

    Hebbache, M.; Stuparević, L.; Živković, D.

    2006-08-01

    Superhard materials have many industrial applications, wherever resistance to abrasion and wear are important. The synthesis of new superhard materials is one of the great challenges to scientists. We re-examined the phase diagram of the binary osmium-boron system and confirmed the existence of two hexagonal phases, OsB 1.1, Os 2B 3, and an orthorhombic phase, OsB 2. Almost nothing is known about the physical properties of osmium borides. Microhardness measurements show that OsB 2 is extremely hard. Ab initio calculations show that this is due to formation of covalent bonds between boron atoms. OsB 2 is also a low compressibility material. It can be used as hard coating.

  17. Construction of the irreducibles of B(2, 2)

    International Nuclear Information System (INIS)

    Melas, Evangelos

    2006-01-01

    The ordinary Bondi-Metzner-Sachs (BMS) group B is the common asymptotic symmetry group of all radiating, asymptotically flat, Lorentzian spacetimes. As such, B is the best candidate for the universal symmetry group of general relativity. However, in studying quantum gravity, spacetimes with signatures other than the usual Lorentzian one and complex spacetimes are frequently considered. Generalizations of B appropriate to these other signatures have been defined earlier. In particular, the generalization B(2, 2) appropriate to the ultrahyperbolic signature (+, +, -, -) has been described in detail, and the study of its irreducible unitary representations (IRs) of B(2, 2) has been initiated. The infinite little groups have been given explicitly, but the finite little groups have only been partially described. This study is completed by describing in detail the finite little groups and by giving all the necessary information in order to construct the IRs of B(2, 2) in all cases

  18. Estrés oxidativo en la diabetes mellitus papel de la vitamina E y antioxidantes endógenos

    OpenAIRE

    Montier Iglesias, Ariel; Ramos Arencibia, Arle Luís; Gómez García, Marcia Leticia; Pérez Cardoso, Javier Joaquín; Quintana Pérez, Quinley

    2015-01-01

    Introducción: la diabetes mellitus es una entidad clínica resultado de la secreción deficiente de insulina que puede ser absoluta o relativa. El marcador bioquímico de la entidad es la hiperglucemia y es la causa de los síntomas característicos de su mal control. La hiperglucemia produce neuropatías, nefropatías, microangiopatía y macroangiopatía. Objetivo: describir el comportamiento de la vitamina E y antioxidantes endógenos en el estrés oxidativo por hiperglucemia crónica en el curso de la...

  19. Ácidos grasos, vitamina E y rotulado nutricional de margarinas y esparcibles comercializados en Bogotá, Colombia

    Directory of Open Access Journals (Sweden)

    Lorena A. Bolívar C.

    2010-05-01

    Conclusiones: 91% de las margarinas y esparcibles más comercializados en cinco localidades de Bogotá en agosto de 2008 es libre de ácidos grasos trans (< 0,5 g/porción y en promedio aportan 13% de la RDA de vitamina E/porción. Sólo 40% de los productos analizados declara todos los nutrientes de carácter obligatorio según la Resolución 0288 de 2008.

  20. Aspectos de la historia del descubrimiento de algunas vitaminas Aspects of the history of the discovery of some vitamins

    Directory of Open Access Journals (Sweden)

    Miriam Bolet Astoviza

    2004-08-01

    Full Text Available Hasta hace relativamente poco tiempo, los médicos no tomaban en serio la indicación de la dieta apropiada a cada enfermedad para lograr la mejoría y la curación de los pacientes. Nos propusimos como objetivo actualizar los conocimientos de aspectos de la historia de la nutrición y de los descubrimientos de algunas vitaminas. Se realizó una revisión de la historia de la alimentación y del descubrimiento de algunas vitaminas en el mundo. Se visitó la biblioteca del museo "Carlos Juan Finlay" de la Academia de Ciencias, donde se revisaron libros de la época en que se desarrollaron los descubrimientos científicos relacionados con la nutrición y las vitaminas C, B y A. Además se revisaron otras bibliografías y se concluyó que el estudio de la historia de la nutrición y del descubrimiento de algunas vitaminas, en la que tantos científicos se han esforzado, es muy importante, porque sirve de ejemplo para continuar las investigaciones de problemas de salud aún no definidos.Until recently, the physicians did not take seriously the indication of a suitable diet for every disease to attain the improvement and cure of the patients. Objective: to update the knowledge of different aspects of the history of nutrition and of the discovery of some vitamins. A review of the history of nutrition and of the discovery of some vitamins in the world is made. The library of "Carlos J. Finlay" Museum of the Academy of Sciences was visited to review the books of the time when the scientific discoveries related to nutrition and vitamins C, B and A were made. The study of the history of nutrition and of the discovery of some vitamins , in which so many scientists have strived, is very important because it is an example to continue investigating those health problems that have not been defined yet.

  1. Papel de la vitamina C y los β-glucanos sobre el sistema inmunitario: revisión

    OpenAIRE

    Ismael San Mauro-Martín; Elena Garicano Vilar

    2016-01-01

    Existe un creciente interés en conocer herramientas nutricionales al alcance de profesionales para el manejo de la modulación del sistema inmunitario del humano. Esta revisión bibliográfica se centra en los potenciales efectos beneficiosos sobre el sistema inmune atribuidos a productos alimenticios compuestos por β-glucanos de Pleurotus ostreatus, y/o Vitamina C. Este trabajo muestra el resultado obtenido en diferentes estudios con la ingesta de estos componentes sobre el sistema inmunitario,...

  2. Papel de la vitamina C y los β-glucanos sobre el sistema inmunitario: revisión

    OpenAIRE

    San Mauro-Martín, Ismael; Garicano-Vilar, Elena

    2015-01-01

    Existe un creciente interés en conocer herramientas nutricionales al alcance de profesionales para el manejo de la modulación del sistema inmunitario del humano. Esta revisión bibliográfica se centra en los potenciales efectos beneficiosos sobre el sistema inmune atribuidos a productos alimenticios compuestos por β-glucanos de Pleurotus ostreatus, y/o Vitamina C. Este trabajo muestra el resultado obtenido en diferentes estudios con la ingesta de estos componentes sobre el sistema inmunitario,...

  3. Impacto nutricio del consumo de una leche entera adicionada con vitaminas y minerales en niños

    Directory of Open Access Journals (Sweden)

    Maulen-Radovan Irene

    1999-01-01

    Full Text Available OBJETIVO: Determinar el impacto nutricio del consumo de leche entera fortificada con vitaminas y minerales en niños. MATERIAL Y MÉTODOS: Se hizo un estudio prospectivo, longitudinal, en 227 niños de entre 8 a 60 meses de edad. Se ofreció a los menores 500 ml diarios de leche entera fortificada por 90 días. Se registró ingestión, aceptación, peso, talla, hemoglobina (Hb, hierro (Fe, vitamina B12 y folatos séricos. El análisis estadístico se realizó con medidas de tendencia central y dispersión en variables dimensionales utilizando prueba t de Student para comparación de promedios y ji² para variables nominales. RESULTADOS: Al inicio de la suplementación 45 niños estaban desnutridos, y 36, anémicos. Al final de la misma estas cifras disminuyeron: 35 desnutridos (p< 0.21 y 18 niños anémicos (p< 0.01. Al inicio nueve niños tenían desnutrición severa y, al finalizar, sólo eran cinco los que la padecían. La comparación ingreso-egreso en los datos antropométricos fue como sigue (media±desviación estándar: Z peso/talla, -0.35±0.88 vs. -0.14±0.9 (p= 0.01; Hb en g/dl, 11±1.3 vs. 11.9±1.9 (p< 0.001; Fe en mg/dl, 108±44 vs. 115±31 (p= 0.06; vitamina B12 en pg/ml, 649±494 vs. 1 053±854 (p< 0.001. El apego y la aceptación fueron de 100 y 85%, respectivamente. CONCLUSIONES: El consumo de leche entera fortificada durante 90 días mejora significativamente el estado nutricio de los niños, reduce significativamente el número de niños con anemia e incrementa los niveles plasmáticos de Hb, Vitamina B12 y folatos.

  4. Influência da vitamina C e da hidrocortisona sobre a tensão anastomótica jejunal em ratos

    Directory of Open Access Journals (Sweden)

    Petroianu Andy

    2000-01-01

    Full Text Available O efeito da vitamina C e da hidrocortisona sobre os processos cicatriciais anastomóticos apresenta resultados conflitantes na literatura. Dessa forma, o presente trabalho teve o objetivo de comparar a resistência cicatricial de anastomoses jejunais em ratos, submetidos à administração de vitamina C e de hidrocortisona, em distintos períodos pós-operatórios. Foram estudados 40 ratos Wistar, submetidos a secção e subseqüente anastomose término-terminal de segmento jejunal, a 10 cm da flexura duodenojejunal. Os animais foram divididos em quatro grupos (n=10: Grupo I - controle; Grupo II - administração de vitamina C oral 100 mg/kg; Grupo III - administração de hidrocortisona intraperitoneal 10 mg/kg; Grupo IV - administração de vitamina C mais hidrocortisona nas doses e vias de administração acima. Avaliaram-se as pressões de ruptura anastomótica nos 5 º e 21º dias pós-operatórios. Os ratos que receberam vitamina C isolada ou associada a hidrocortisona tenderam a uma pressão de ruptura maior do que os demais grupos, tanto no 5º quanto no 21º dias pós-operatórios. Os resultados deste trabalho sugerem que a vitamina C contribui para aumentar a resistência das anastomoses jejunais dos ratos durante os primeiros 5 dias pós-operatórios. A resistência das anastomoses jejunais murinas foi pouco influenciada pela administração de corticóide intraperitoneal.

  5. B2B-myyntiprosessi : case: Yritys X

    OpenAIRE

    Lamppu, Samuli

    2017-01-01

    Opinnäytetyön aiheena on B2B-myyntiprosessi yrityksessä x. Työn tavoitteena on kartoittaa yrityksen B2B-myyntiprosessin nykytila, tunnistaa mahdolliset ongelma-alueet ja tehdä tämän perusteella ehdotukset toimenpiteistä prosessin parantamiseksi. Työ tehdään suomalaisen PK-yrityksen toimeksiannosta. Opinnäytetyön taustalla on oma urani yrityksen yritysmyynnissä, ja työni kautta tunnistamani haasteet sekä mahdollisuudet, joita hyödyntämällä yritys voisi kehittää myyntitoimintaansa. Yritykse...

  6. Cosima B2B - Sales Automation for E-Procurement

    OpenAIRE

    Kießling, Werner (Prof. Dr.); Fischer, Stefan; Döring, Sven

    2006-01-01

    E-procurement is one of the fastest growing application areas for e-commerce. Though B2B transaction costs could be reduced recently by establishing XML based standards for electronic product catalogs and data interchange, B2B sales costs are still high due to the amount of human interaction. For the first time we present a fully automated electronic sales agent for e-procurement portals. The key technologies for this breakthrough are based on preferences modeled as strict partial orders, ena...

  7. How has IT impacted the B2B sales process?

    OpenAIRE

    Bjørnstad, Julia Jemli

    2017-01-01

    B2B sales role plays a major role in driving the economy, and this industry has been experiencing major changes over the year with the advances in technology which allow for more cost savings and driving for more efficient ways of conducting sales operations. The objective of this exploratory qualitative research paper was to raise interest in the role technology plays in the B2B sales process today from the salesperson’s view point. It was further partly built on previous rese...

  8. B2B Integration in Global Supply Chains

    DEFF Research Database (Denmark)

    Schubert, Petra; Legner, Christine

    2011-01-01

    The competitiveness of businesses is increasingly dependent on their electronic networks with customers, suppliers, and partners. While the strategic and operational impact of external integration and IOS adoption has been extensively studied, much less attention has been paid to the organizational...... and technical design of electronic relationships. The objective of our longitudinal research project is the development of a framework for understanding and explaining B2B integration. Drawing on existing literature and empirical cases we present a reference model (a classification scheme for B2B Integration...

  9. Suplementación con vitamina D en epilepsia: estudio en pacientes con antiepilépticos clásicos y de nueva generación

    OpenAIRE

    Villegas Martinez, Irene

    2016-01-01

    INTRODUCCIÓN Y OBJETIVOS: el metabolismo óseo es un sistema complejo en el que intervienen numerosos actores, como la vitamina D. Los farmacos antiepilépticos (FAEs) clásicos como la carbamacepina (CBZ), la fenitoína (PHT) o el ácido valproico (VPA), se han relacionado con la aparición de una osteoporosis prematura en los pacientes epilépticos y se recomienda la suplementación con vitamina D, pero la dosis e incluso el tipo de suplementación no está clara. También se desconoce el impacto de l...

  10. Papel de la Vitamina D en la postmenopausia. Influencia de la suplementación en el metabolismo óseo y otras dianas.

    OpenAIRE

    Arribas Ferriol, Gemma

    2015-01-01

    Actualmente existe un problema de salud mundial con la osteoporosis postmenopáusica y entre los determinantes de salud ósea está un nivel adecuado de vitamina D. También cabe considerar que mantener un nivel adecuado de dicha vitamina influye en otras dianas determinantes en la salud en la postmenopausia, como es el nivel de lípidos, glucemia e insulina, tensión arterial o peso. Entre las tácticas recomendadas por las guías de práctica clínica se contempla la suplementación universal con v...

  11. Efecto de la suplementación con vitamina D en monodosis en niños con parálisis cerebral. Estudio preliminar controlado y aleatorizado

    OpenAIRE

    Le Roy, C.

    2015-01-01

    Los niños con parálisis cerebral (PC) tienen mayor riesgo de deficiencia de vitamina D (VD). Aunque existen bastantes estudios sobre VD en PC, hay limitada información sobre suplementación con VD en estos pacientes. El objetivo de este artículo es evaluar el efecto de la suplementación con VD en monodosis en las concentraciones plasmáticas de 25-hidroxi-vitamina-D (25OHD) en niños con PC.

  12. Asociación entre el déficit de vitamina D y bienestar emocional en pacientes con Diabetes Mellitus tipo 1

    OpenAIRE

    Waselle Vallina, Rebeca

    2016-01-01

    Introducción: La deficiencia de vitamina D se asocia con un mayor riesgo de padecer enfermedades autoinmunes, como sería el caso de los pacientes con diabetes mellitus tipo 1. Esta enfermedad tiene un impacto, sobre la calidad de vida y el bienestar emocional de los pacientes, relacionado con el control glucémico, las complicaciones y algunas variables socioeconómicas. Objetivos: El objetivo principal fue evaluar el grado de asociación entre la vitamina D y el bienestar emocional de los ...

  13. EFECTO DEL ALBENDAZOL Y LA VITAMINA A PERIÓDICOS SOBRE HELMINTOS INTESTINALES Y ANEMIA EN NIÑOS DEL URABÁ ANTIOQUEÑO (COLOMBIA)

    OpenAIRE

    Carmona-Fonseca, Jaime; Correa-Botero, Adriana

    2015-01-01

    Problema: En Colombia no hay informes sobre efectos en humanos del tratamiento periódico antihelmíntico-vitamina A. Objetivo: Evaluar efectos de albendazol/pamoato de pirantel-vitamina A trimestrales sobre Ascaris lumbricoides, Trichuris trichiura, Necator americanus y sobre niveles séricos de retinol y hemoglobina, en niños del Urabá antioqueño. Metodología: Estudio clínico, aleatorio, con grupos paralelos, cerrado, intervenidos y evaluados cada 3-4 meses por 4 veces, seguidos 12 meses. Inte...

  14. ACETURATO DE DIMINAZENO ASSOCIADO AO SELENITO DE SÓDIO E A VITAMINA E: TESTES IN VITRO E EM RATOS EXPERIMENTALMENTE INFECTADOS COM Trypanosoma evansi

    OpenAIRE

    Alexandre Alberto Tonin

    2012-01-01

    O objetivo deste estudo foi avaliar a utilização de um tratamento padrão contra a infecção causada pelo T. evansi, baseado na utilização do aceturato de diminazeno associado ao selenito de sódio e a vitamina E. Os testes in vitro mostraram um efeito tripanocida relacionados ao tratamento com aceturato de diminazeno e selenito de sódio; contudo a vitamina E não gerou nenhum efeito nocivo sobre o tripanossomas. Experimentos in vivo utilizaram um total de 72 fêmeas adultas de rato...

  15. Papel de la vitamina D y su receptor (VDR) en tejido adiposo y su relación con el metabolismo de los hidratos de carbono

    OpenAIRE

    Muñoz Garach, Araceli

    2014-01-01

    El déficit de vitamina D es una patología frecuente que se relaciona con el desarrollo de diabetes y con las alteraciones de los sujetos con obesidad. La asociación de estas tres entidades no esta claramente establecida. Objetivos Cuantificar los niveles plasmáticos de vitamina D y la expresión de su receptor VDR en tejido adiposo de sujetos clasificados según su índice de masa corporal (IMC) y su perfil glucémico. Pacientes y métodos Se analizaron 119 sujetos y clasificados según...

  16. Efecto de la adición de vitaminas B en la digestibilidad In Vitro de dietas con diferente fuente de carbohidratos

    OpenAIRE

    Oziel Dante Montañez Valdez

    2006-01-01

    Se realizó un estudio con el fin de observar el efecto de la adición de vitaminas hidrosolubles en la digestibilidad in vitro de la materia seca (DIVMS) y materia orgánica (DIVMO) en dietas con distinta fuente de carbohidratos (sorgo y cebada en grano), adicionadas con cinco dosis de vitaminas B (VB; 0, 2, 4, 6 y 8 g kgMS). Se encontraron diferencias significativas (P < 0,01), tanto para los efectos principales (fuente de carbohidratos y cantidad de VB), como para la interacción de éstos, en ...

  17. Il B2B e il paradigma dei costi di transazione (B2B and the Transaction Costs Paradigm

    Directory of Open Access Journals (Sweden)

    Pierluigi Sabbatini

    2012-04-01

    Full Text Available Business to Business (B2B Internet commerce causes a significant contraction of transaction costs. According to the Coase paradigm, we would thus expect a deverticalization of the industry and broader scope for anonymous market mechanisms. In reality, such expectations are not fully borne out by the facts. When the industrial structure is concentrated the B2Bgenerally loses its independence, and is owned by the firms which most contribute to its development, e.g. the ones able to bring the liquidity to it. The B2B governance mechanism established by these firms gives hierarchical mechanisms a role which they do not usually play in extensive, anonymous markets.         JEL Codes: D23, L86Keywords: Cost, Transaction Costs, Transactions

  18. Investigation of TaC–TaB2 ceramic composites

    Indian Academy of Sciences (India)

    ture and the mechanical properties of the composites were investigated. The results .... 300 nm. Jingangzuan in the TaC/TaB2 composites SPS for 10 min at different temperatures are .... [1] Liu L, Yea F, Hea X and Zhoua Y 2011 Mater. Chem.

  19. Canonical realizations of B2 approximately C2 Lie algebras

    International Nuclear Information System (INIS)

    Iosifescu, M.; Scutaru, H.

    1982-12-01

    Canonical realizations associated to subrepresentations of ad x ad, for B 2 apppoximately C 2 semisimple Lie algebras, have been determined. An algebraic foundation has been obtained for the constraints satisfied by the dinamical variables of the classical limit of the generalized Helium problem. (authors)

  20. Selenidation of epitaxial silicene on ZrB2

    NARCIS (Netherlands)

    Wiggers, F. B.; Yamada-Takamura, Y.; Kovalgin, A. Y.; de Jong, M. P.

    2018-01-01

    The deposition of elemental Se on epitaxial silicene on ZrB2 thin films was investigated with synchrotron-based core-level photoelectron spectroscopy and low-energy electron diffraction. The deposition of Se at room temperature caused the appearance of Si 2p peaks with chemical shifts of n × 0.51 ±

  1. Structural, electronic and magnetic properties of MnB2

    Indian Academy of Sciences (India)

    5Hassan II Academy of Science and Technology, Rabat, Morocco ... Abstract. The self-consistent ab-initio calculations, based on density functional theory approach and using the full ... The exchange interactions between the magnetic atoms Mn–Mn in MnB2 are ... involved, and on the local environment of the transition-.

  2. Microwave absorption studies of MgB2 superconductor

    Indian Academy of Sciences (India)

    band (9–. 10 GHz) spectrometer. Both polycrystalline pellet and single-grain MgB2, having nearly the same Tc (∼ 39 K) and same size (3×2×1 mm3), were used in the present investigations. Low field modulated microwave absorption signals ...

  3. Electronic structure and superconductivity of MgB 2

    Indian Academy of Sciences (India)

    Results of ab initio electronic structure calculations on the compound, MgB2, using the FPLAPW method employing GGA for the exchange–correlation energy are presented. Total energy minimization enables us to estimate the equilibrium volume, / ratio and the bulk modulus, all of which are in excellent agreement with ...

  4. Intelligent Information Integration in B2B Electronic Commerce

    NARCIS (Netherlands)

    Fensel, Dieter; Omelayenko, Borys; Ding, Ying; Klein, Michel; Flett, Alan; Schulten, Ellen; Botquin, Guy; Brown, Mike; Dabiri, Gloria

    2002-01-01

    Internet and web technology penetrates many aspects of our daily life. Its importance as a medium for business transactions will grow exponentially during the next few years. In terms of the involved market volume, the B2B area will hereby be the most interesting area. Also, it will be the place,

  5. Superconducting state in (W, Ta)5SiB2

    Science.gov (United States)

    Fukuma, M.; Kawashima, K.; Akimitsu, J.

    We characterize the superconducting state in a boro-silicide (W, Ta)5SiB2, with Tc of 6.5 K by means of magnetization, electrical resistivity, and specific heat measurements. As x increased, the transition temperature Tc abruptly enhances from 5.8 to 6.5 K. The magnetization versus magnetic field (M-H) curve indicated that (W, Ta)5SiB2 was a conventional type-II superconductor. The estimated lower critical field Hc1(0) and upper critical field Hc2(T) are about 121 Oe and 14.7 kOe, respectively. The penetration depth λ(0) and coherence length ξ(0) are calculated to be approximately 369 and 14.9 nm, respectively, using Ginzburg-Landau (GL) equations. Specific heat data shows the superconductivity in W4.5Ta0.5SiB2 belongs to a week-coupling BCS superconductor. Finally, we discuss the increasing of Tc in of (W, Ta)5SiB2 system.

  6. Preparation and characterization of MgB2 superconductor

    Indian Academy of Sciences (India)

    2Tata Institute of Fundamental Research, Homi Bhabha Road, Mumbai 400 005, India. Abstract. The MgB2 superconductor, synthesized using solid-state and liquid-phase sintering methods, have been characterized for various properties. The upper critical field, irreversibility line and critical current density have been ...

  7. 26 CFR 48.4161(b)-2 - Meaning of terms.

    Science.gov (United States)

    2010-04-01

    ... EXCISE TAXES MANUFACTURERS AND RETAILERS EXCISE TAXES Sporting Goods § 48.4161(b)-2 Meaning of terms. (a... with the particular type of arrow shaft. (b) Parts and accessories—(1) In general. “Parts and... attachment to, a bow or arrow of the type described in section 4161(b)(1) and paragraph (a) of this section...

  8. Marketing-sales interface configurations in B2B firms

    NARCIS (Netherlands)

    Biemans, Wim G.; Brencic, Maja Makovec; Malshe, Avinash; Makovec Brenciv, M.

    As the body of knowledge on marketing-sales interface expands, there is a greater need to investigate the specific aspects of marketing-sales configurations in B2B firms. Using a qualitative methodology and interview data collected from over 100 sales and marketing professionals from the US, The

  9. Development of New B2B Venture Corporate Brand Identity

    DEFF Research Database (Denmark)

    Törmälä, Minna; Gyrd-Jones, Richard I.

    2017-01-01

    of interviews and archival data generated during a three-year period to examine the development of corporate brand over time. This study shows that the development of corporate brand identity and the context of the development of new B2B venture are closely intertwined processes and provides a framework...

  10. Microwave absorption studies of MgB 2 superconductor

    Indian Academy of Sciences (India)

    Microwave absorption studies have been carried out on MgB2 superconductor using a standard X-band EPR spectrometer. The modulated low-field microwave absorption signals recorded for polycrystalline (grain size ∼ 10m) samples suggested the absence of weak-link character. The field dependent direct microwave ...

  11. Itinerant magnetism in CeRh3B2

    DEFF Research Database (Denmark)

    Eriksson, Olle; Johansson, Börje; Brooks, M. S. S.

    1989-01-01

    Spin-polarized energy-band calculations, including spin-orbit coupling in the band Hamiltonian, have been performed on CeRh3B2. Good agreement is obtained between theory and experiment concerning the magnetic moment. It is also found that the magnetic moment varies strongly with volume and from...

  12. Insulator layer formation in MgB2 SIS junctions

    International Nuclear Information System (INIS)

    Shimakage, H.; Tsujimoto, K.; Wang, Z.; Tonouchi, M.

    2005-01-01

    The dependence of current-voltage characteristics on thin film deposition conditions was investigated using MgB 2 /AlN/NbN SIS junctions. By increasing the substrate temperature in AlN insulator deposition, the current density decreased and the normal resistance increased. The results indicated that an additional insulator layer between the MgB 2 and AlN formed, either before or during the AlN deposition. The thickness of the additional insulator layer was increased with an increase in the AlN deposition temperature. From the dependence of current density on the thickness of AlN in low temperature depositions, the thickness of the additional insulator layer was estimated to be 1-1.5 nm when the AlN insulator was deposited from 0.14 to 0.7 nm. Moreover, with the current density of MgB 2 /AlN/MgB 2 SIS junctions, further insulator layer formation was confirmed

  13. E-Business Models in B2B: Process Based Categorization and Analysis of B2B Models

    OpenAIRE

    Mahesh S. Raisinghani; Turan Melemez; Lijie Zou; Chris Paslowski; Irma Kimvidze; Susanne Taha; Klaus Simons

    2005-01-01

    The business models in business-to-business (B2B) e-commerce and their effectiveness have been a major topic of research in recent years. Due to the variety of existing models, it seems difficult to find a widely accepted categorization that can be analyzed and assessed. An in-depth study that provides a process-based approach to B2B e-commerce is presented and illustrated with examples from industry. A comparative examination of both the buy and the sell side based on a process-related appro...

  14. Directional crystallization of B4C-NbB2 and B4C-MoB2 eutectic compositions

    International Nuclear Information System (INIS)

    Paderno, Varvara; Paderno, Y.B.; Filippov, Vladimir; Liashchenko, Alfred

    2004-01-01

    We studied the directional crystallization of different compositions in B 4 C-NbB 2 and B 4 C-MoB 2 systems. The eutectic compositions for both systems are evaluated. It is shown that in the first system the rod-like eutectic structure is formed, in second, the 'Chinese hieroglyphics'. In both cases high hardness and high microplasticity are observed, which are much more than for individual component phases. These compositions may be considered as a new kind of self-strengthening composite materials

  15. OsB 2 and RuB 2, ultra-incompressible, hard materials: First-principles electronic structure calculations

    Science.gov (United States)

    Chiodo, S.; Gotsis, H. J.; Russo, N.; Sicilia, E.

    2006-07-01

    Recently it has been reported that osmium diboride has an unusually large bulk modulus combined with high hardness, and consequently is a most interesting candidate as an ultra-incompressible and hard material. The electronic and structural properties of the transition metal diborides OsB 2 and RuB 2 have been calculated within the local density approximation (LDA). It is shown that the high hardness is the result of covalent bonding between transition metal d states and boron p states in the orthorhombic structure.

  16. Papel de la vitamina C y los β-glucanos sobre el sistema inmunitario: revisión

    Directory of Open Access Journals (Sweden)

    Ismael San Mauro-Martín

    2016-01-01

    Full Text Available Existe un creciente interés en conocer herramientas nutricionales al alcance de profesionales para el manejo de la modulación del sistema inmunitario del humano. Esta revisión bibliográfica se centra en los potenciales efectos beneficiosos sobre el sistema inmune atribuidos a productos alimenticios compuestos por β-glucanos de Pleurotus ostreatus, y/o Vitamina C. Este trabajo muestra el resultado obtenido en diferentes estudios con la ingesta de estos componentes sobre el sistema inmunitario, así como el efecto específico sobre marcadores inmunitarios como las interleuquinas, los linfocitos, células Natural Killer y los leucocitos, no sólo atendiendo a los mecanismos, sino a las experiencias en modelos in vitro e in vivo (animal y humano. Tanto la vitamina C como los β-glucanos parecen mostrar eficacia sobre el sistema inmune en diversos estudios, especialmente de forma conjunta, pero son necesarios más estudios.

  17. EFECTO DE UN COMPLEJO DE VITAMINAS Y AMINOÁCIDOS EN EL COMPORTAMIENTO PRODUCTIVO DE GALLINAS PONEDORAS

    Directory of Open Access Journals (Sweden)

    MÓNICA MARÍA ESTRADA P.

    Full Text Available Los sistemas intensivos de producción de huevo comercial pueden conllevar a las aves a un estado de inmunodepresión, esto puede ser mitigado con el suministro de nutrientes que activen los mecanismos fisiológicos del animal. Este trabajo evaluó el efecto de un complejo de vitaminas y aminoácidos en el desempeño productivo de gallinas ponedoras. Un lote de 20395 gallinas de la línea Lohmann LSL, se dividió en dos grupos, el primer grupo recibió el tratamiento de vitaminas y aminoácidos (T2, el segundo grupo se estableció como el control (T1. Se empleó la estadística de T2 de Hotelling, se utilizó el método de Spearman para la determinación de la relación entre variables donde el análisis se suplementó por medio de la técnica descriptiva unidireccional. Para las variables productivas consumo de alimento, porcentaje de producción de huevos, huevo ave alojada, viabilidad y conversión alimenticia se encontró diferencias estadísticas altamente significativas (p<0,0001 en el efecto promedio de los grupos tomando en forma simultánea todas las variables respuesta. El grupo (T2 presentó mejor desempeño productivo.

  18. Thermoelastic properties of ScB2, TiB2, YB4 and HoB4

    DEFF Research Database (Denmark)

    Waskowska, A.; Gerward, L.; Staun Olsen, J.

    2011-01-01

    (4)GPa). No pressure-induced phase transformations are observed in any of the above borides up to about 20GPa. A continuous temperature-driven orthorhombic distortion is observed for HoB4 below 285K. Values of the thermal expansion coefficient are reported for ScB2 and HoB4 at 293, 200 and 100K...

  19. Electronic and elastic properties of new semiconducting oP12-type RuB2 and OsB2

    International Nuclear Information System (INIS)

    Hao Xianfeng; Xu Yuanhui; Gao Faming

    2011-01-01

    Using first-principles total energy calculations we investigate the structural, elastic and electronic properties of new hypothetical oP 12 -type phase RuB 2 and OsB 2 . The calculations indicate that the oP 12 -type phase RuB 2 and OsB 2 are thermodynamically and mechanically stable. Remarkably, the new phases RuB 2 and OsB 2 are predicted to be semiconductors, and the appearance of band gaps is ascribed to the enhanced B-B covalent hybridization. Compared to metallic oP 6 -type RuB 2 and OsB 2 phases, the new phases possess similar mechanical properties and hardness. The combination of the probability of tunable electronic properties, strong stiffness and high hardness make RuB 2 and OsB 2 attractive and interesting for advanced applications.

  20. Electronic and elastic properties of new semiconducting oP(12)-type RuB(2) and OsB(2).

    Science.gov (United States)

    Hao, Xianfeng; Xu, Yuanhui; Gao, Faming

    2011-03-30

    Using first-principles total energy calculations we investigate the structural, elastic and electronic properties of new hypothetical oP(12)-type phase RuB(2) and OsB(2). The calculations indicate that the oP(12)-type phase RuB(2) and OsB(2) are thermodynamically and mechanically stable. Remarkably, the new phases RuB(2) and OsB(2) are predicted to be semiconductors, and the appearance of band gaps is ascribed to the enhanced B-B covalent hybridization. Compared to metallic oP(6)-type RuB(2) and OsB(2) phases, the new phases possess similar mechanical properties and hardness. The combination of the probability of tunable electronic properties, strong stiffness and high hardness make RuB(2) and OsB(2) attractive and interesting for advanced applications. © 2011 IOP Publishing Ltd

  1. Active Protection of an MgB2 Test Coil

    Science.gov (United States)

    Park, Dong Keun; Hahn, Seungyong; Bascuñán, Juan; Iwasa, Yukikazu

    2011-01-01

    This paper presents results of a study, experimental and computational, of a detect-and-activate-the-heater protection technique applied to a magnesium diboride (MgB2) test coil operated in semi-persistent mode. The test coil with a winding ID of 25 cm and wound with ~500-m long reacted MgB2 wire was operated at 4.2 K immersed in a bath of liquid helium. In this active technique, upon the initiation of a “hot spot” of a length ~10 cm, induced by a “quench heater,” a “protection heater” (PH) of ~600-cm long planted within the test coil is activated. The normal zone created by the PH is large enough to absorb the test coil’s entire initial stored energy and still keeps the peak temperature within the winding below ~260 K. PMID:22081754

  2. Observation of pseudogap in MgB2

    Science.gov (United States)

    Patil, S.; Medicherla, V. R. R.; Ali, Khadiza; Singh, R. S.; Manfrinetti, P.; Wrubl, F.; Dhar, S. K.; Maiti, Kalobaran

    2017-11-01

    We investigate the electronic structure of a specially prepared highly dense conventional high temperature superconductor, MgB2, employing high resolution photoemission spectroscopy. The spectral evolution close to the Fermi energy is commensurate to BCS descriptions as expected. However, the spectra in the wider energy range reveal the emergence of a pseudogap much above the superconducting transition temperature indicating an apparent departure from the BCS scenario. The energy scale of the pseudogap is comparable to the energy of the E2g phonon mode responsible for superconductivity in MgB2 and the pseudogap can be attributed to the effect of electron-phonon coupling on the electronic structure. These results reveal a scenario of the emergence of the superconducting gap within an electron-phonon coupling induced pseudogap and have significant implications in the study of high temperature superconductors.

  3. Investigation of pinning in MgB2 superconductors

    International Nuclear Information System (INIS)

    Mohammad, S.; Reissner, M.; Steiner, W.; Bauer, E.; Giovannini, M.

    2006-01-01

    Full text: The pinning behaviour of bulk MgB 2 superconductors is peculiar in many respects. Pinning seems to be stronger than in classical high T C materials and there seems to be no weak link problem in these compounds, giving hope to produce bulk samples and wires with current densities appropriate for technical applications. But, although many studies concerning the pinning behaviour in this compound appeared in recent years, the results are still contradictory. In the present work we present results of an investigation of the pinning behaviour by magnetic relaxation measurements of three MgB 2 samples: a pure one, a sample with 8 at% Al substitution and a sample with 10 wt% of SiC admixture. A comparison of different analyses methods is given. (author)

  4. COSIMA B2B - sales automation for e-procurement

    OpenAIRE

    Döring, Sven

    2004-01-01

    COSIMA B2B - sales automation for e-procurement / W. Kießling, S. Fischer, S. Döring. - In: International Conference on E-Commerce Technology : Proceedings / IEEE International Conference on E-Commerce Technology, CEC 2004 : 6 - 9 July 2004, San Diego, California / ed. by Martin Bichler ... - Los Alamitos, Calif. [u.a.] : IEEE Computer Society, 2004. - S. 59-68

  5. Customer satisfaction in B2B cloud services

    OpenAIRE

    Turunen, Helinä

    2013-01-01

    Tutkimuksen tavoitteena on kirjallisuuskatsauksen kautta esitellä B2B-pilvipalveluiden asiakastyytyväisyyteen vaikuttavia seikkoja, ja kuinka näitä seikkoja tulisi ottaa huomioon asiakastyytyväisyyden parantamisessa. Tässä tutkimuksessa verkkopohjaiseen liiketoimintaan liittyvää asiakastyytyväisyyden tutkimusta käytettiin pohjana etsiessä asiakastyytyväisyyteen vaikuttavia seikkoja pilvipalveluissa. Tutkimuksessa vertaillaan asiakastyytyväisyyteen vaikuttavia seikkoja vertailemalla tyytyväisy...

  6. Mass Customized Technical Textiles in the B2B Sector

    Science.gov (United States)

    Gebhardt, R.; Barteld, M.; Grafmüller, L.; Mosig, T.; Weiß, M.

    2017-10-01

    Mass Customization is a great opportunity for textile companies for both staying competitive in high-wage countries and offering inexpensive, customized products. Within the area of Technical Textiles, this study focuses on the B2B sector and shows the status quo, potentials and strengths. Both management and technological issues are addressed. For the former, business models and the value co-creation process are dealt with, for the latter, the focus is on modelling.

  7. Superconducting and Normal State Properties of OsB2*

    Science.gov (United States)

    Singh, Yogesh; Niazi, A.; Zong, X.; Suh, B. J.; Vannette, M. W.; Prozorov, R.; Johnston, D. C.

    2007-03-01

    OsB2 is a layered superhard metallic material that was found to superconduct below Tc= 2.1 K.^1 We report the first detailed measurements of the static and dynamic magnetic susceptibilities χ, electrical resistivity, heat capacity Cp, penetration depth, and ^11B NMR on OsB2 to characterize its superconducting and normal state properties. The results confirm that OsB2 is a bulk superconductor below Tc= 2.1 K@. Its properties can be described by a close to weak-coupling s-wave BCS model with an electron-phonon coupling constant λ= 0.4--0.5, δ(0)/(kBTc) 1.9, a small Ginzburg-Landau parameter κ of order 5 or less, and a small zero-temperature critical magnetic field of roughly 500 Oe. The ^11B NMR measurements in the normal state show a nuclear spin-lattice relaxation time T1= 2.1 s at room temperature and a Korringa law with T1T = 610 s.K at lower T, and a correspondingly small T-independent Knight shift. These results indicate a small s character of the conduction electron wave function at the B site at the Fermi level. Our results will be compared to corresponding data for MgB2.1. J. K. Vandenberg et al., Mater. Res. Bull. 10, 889 (1975).^*Supported by the USDOE under Contract No. W-7405-Eng-82. Permanent address: Dept. Phys., The Catholic Univ. Korea.

  8. $1$-string $B_2$-VPG representation of planar graphs

    Directory of Open Access Journals (Sweden)

    Therese Biedl

    2016-09-01

    Full Text Available In this paper, we prove that every planar graph has a 1-string $B_2$-VPG representation—a string representation using paths in a rectangular grid that contain at most two bends. Furthermore, two paths representing vertices $u,v$ intersect precisely once whenever there is an edge between $u$ and $v$. We also show that only a subset of the possible curve shapes is necessary to represent $4$-connected planar graphs.

  9. Agent-based services for B2B electronic commerce

    Science.gov (United States)

    Fong, Elizabeth; Ivezic, Nenad; Rhodes, Tom; Peng, Yun

    2000-12-01

    The potential of agent-based systems has not been realized yet, in part, because of the lack of understanding of how the agent technology supports industrial needs and emerging standards. The area of business-to-business electronic commerce (b2b e-commerce) is one of the most rapidly developing sectors of industry with huge impact on manufacturing practices. In this paper, we investigate the current state of agent technology and the feasibility of applying agent-based computing to b2b e-commerce in the circuit board manufacturing sector. We identify critical tasks and opportunities in the b2b e-commerce area where agent-based services can best be deployed. We describe an implemented agent-based prototype system to facilitate the bidding process for printed circuit board manufacturing and assembly. These activities are taking place within the Internet Commerce for Manufacturing (ICM) project, the NIST- sponsored project working with industry to create an environment where small manufacturers of mechanical and electronic components may participate competitively in virtual enterprises that manufacture printed circuit assemblies.

  10. Strength anomaly in B2 FeAl single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Yoshimi, K.; Hanada, S.; Yoo, M.H. [Oak Ridge National Lab., TN (United States); Matsumoto, N. [Tohoku Univ. (Japan). Graduate School

    1994-12-31

    Strength and deformation microstructure of B2 Fe-39 and 48%Al single crystals (composition given in atomic percent), which were fully annealed to remove frozen-in vacancies, have been investigated at temperatures between room temperature and 1073K. The hardness of as-homogenized Fe-48Al is higher than that of as-homogenized Fe-39Al while after additional annealing at 698K the hardness of Fe-48Al becomes lower than that of Fe-39Al. Fe-39Al single crystals slowly cooled after homogenizing at a high temperature were deformed in compression as a function of temperature and crystal orientation. A peak of yield strength appears around 0.5T{sub m} (T{sub m} = melting temperature). The orientation dependence of the critical resolved shear stress does not obey Schmid`s law even at room temperature and is quite different from that of b.c.c. metals and B2 intermetallics at low temperatures. At the peak temperature slip transition from <111>-type to <001>-type is found to occur macroscopically and microscopically, while it is observed in TEM that some of the [111] dislocations decompose into [101] and [010] on the (1096I) plane below the peak temperature. The physical sources for the positive temperature dependence of yield stress of B2 FeAl are discussed based on the obtained results.

  11. Vitamina D y cáncer: acción antineoplásica de la 1α, 25(OH2 -vitamina D3 Vitamin D and cancer: antineoplastic effects of 1α,25(OH2-vitamin D3

    Directory of Open Access Journals (Sweden)

    Verónica González Pardo

    2012-04-01

    Full Text Available La forma hormonalmente activa de la vitamina D, 1α,25(OH2-vitamina D3 (1α,25(OH2D3, además de desempeñar un rol crucial en el mantenimiento de la homeostasis de calcio en el cuerpo, también regula el crecimiento y la diferenciación de diferentes tipos celulares, incluyendo células cancerosas. Actualmente hay numerosos estudios que investigan los efectos de la hormona en estas células, debido al interés en el uso terapéutico del 1α,25(OH2D3 y de análogos con menor actividad calcémica para el tratamiento o prevención del cáncer. En este trabajo de revisión se describe el sistema endocrino de la vitamina D, su mecanismo de acción, su acción antineoplásica y se provee información sobre los últimos avances en el estudio de nuevos análogos de la hormona con menos actividad calcémica para el tratamiento del cáncer.The hormonal form of vitamin D, 1α,25(OH2-vitamin D3 (1α,25(OH2D3, in addition of playing a central role in the control of calcium homeostasis in the body, regulates the growth and differentiation of different cell types, including cancer cells. At present several epidemiologic and clinical studies investigate the effect of the hormone in these cells due to the interest in the therapeutic use of 1α,25(OH2D3 and analogues with less calcemic activity for prevention or treatment of cancer. This review describes vitamin D endocrine system, its mechanism of action, its antineoplastic activity and provides information about the latest advances in the study of new hormone analogues with less calcemic activity for cancer treatment.

  12. Estudo morfológico do efeito radioprotetor da vitamina E (dl-alfa-tocoferil na reparação tecidual em ratos

    Directory of Open Access Journals (Sweden)

    Manzi Flávio Ricardo

    2003-01-01

    Full Text Available Esta pesquisa teve por finalidade avaliar a ação da vitamina E como radioprotetora no processo de reparação tecidual em ratos, após sofrerem um procedimento cirúrgico, que consistiu da produção de uma ferida na região dorsal anterior. Os animais foram divididos em cinco grupos: grupo CO (controle - constituído de animais em que foi produzida somente a ferida; grupo VE - pré-tratamento com vitamina E (90 UI; grupo IR - irradiação três dias após a cirurgia; grupo VEIR - pré-tratamento com 90 UI de vitamina E e irradiação de suas bordas três dias após a cirurgia; grupo OIR - pré-tratamento com óleo de oliva e irradiação de suas bordas três dias após a cirurgia. A ação radioprotetora da vitamina E foi avaliada pela coloração por hematoxilina-eosina para análise morfológica do tecido de granulação, aos 4, 7, 14 e 21 dias após a cirurgia. A análise dos resultados mostrou que o retardo no processo de reparação tecidual causado por 6 Gy de radiação de elétrons com feixe de 6 MeV não ocorreu no grupo de animais que recebeu vitamina E, mostrando-se esta substância efetiva como radioprotetora.

  13. Estudio comparativo de la pérdida de vitamina C en chalarina (Casimiroa edulis por cuatro métodos de deshidratación

    Directory of Open Access Journals (Sweden)

    Judith Castañeda

    2010-01-01

    Full Text Available El objetivo de este estudio fue comparar la pérdida de vitamina C de la chalarina después de aplicar cuatro métodos de deshidratación: deshidratación osmótica a vacío combinada con secado convectivo, secado convectivo, deshidratación osmótica a vacío combinada con liofilización, y liofilización. La chalarina fresca fue acondicionada en forma de cubos de 1 cm de arista; se determinó el contenido de vitamina C y otras propiedades químicas de la pulpa. Los polvos obtenidos fueron caracterizados: contenido de vitamina C, contenido de humedad, aw, densidad, ángulo de fluencia y compresibilidad. La pulpa de chalarina fresca presentó un contenido de vitamina C de 29.75 mg/100g. La deshidratación osmótica a vacío redujo este contenido hasta 15.75 mg/100g, que combinado con secado convectivo se llega a 9.31 mg/100g; en tanto, combinado con liofilización se obtuvo 14.98 mg/100g. Aplicando sólo secado convectivo se obtuvo 7.05 mg de vitaminaC/100g de polvo de chalarina, mientras que aplicando sólo liofilización se obtuvo 23.63 mg/100g. Se concluye que el polvo obtenido por deshidratación osmótica a vacío-secado convectivo presenta mejores características fisicoquímicas que los polvos obtenidos con los otros métodos de deshidratación.

  14. Efecto de la suplementación con una dosis masiva de vitamina A en niños de 6 a 36 meses de edad

    Directory of Open Access Journals (Sweden)

    Robles-Sardin Alma E.

    1998-01-01

    Full Text Available Objetivo. Evaluar el impacto de la suplementación con una dosis masiva de vitamina A en el estado nutricio de dicha vitamina y del hierro, en niños de zonas urbanas marginadas de Hermosillo, Sonora, México. Material y métodos. Se seleccionaron 60 niños (6-36 meses, a los que se les administró una dosis de 100 000 UI (6-12 meses y 200 000 UI (12-36 meses de vitamina A en el Día Nacional de Salud de la Secretaría de Salud (junio de 1994. Se midieron niveles séricos de retinol, carotenoides, hierro, transferrina y ferritina, en tres fases: basal, a las dos semanas y después de tres meses. Resultados. En la primera fase, la mediana de retinol fue 0.7µmol/l; en la segunda aumentó a 0.97µmol/l (p 0.05. Un 6.3% de los niños presentó deficiencia severa de vitamina A al inicio, y no se encontró ningún caso en las fases posteriores a la suplementación. En la fase basal, 42% de los casos presentaron deficiencia moderada y la mayoría fue normal en las siguientes fases. No hubo diferencias en los niveles de hierro y transferrina (p > 0.05, pero sí en ferritina (p < 0.001, lo que indica un mejoramiento en las reservas de hierro a los tres meses. Conclusiones. Las campañas de distribución de dosis masivas pueden tener un impacto importante en el estado nutricio de vitamina A y hierro.

  15. Teor de vitamina C e características físicas do camu-camu em dois estádios de maturação

    OpenAIRE

    Sousa, Rita de Cássia Pereira de

    2011-01-01

    O Camu-Camu é uma das frutas amazônicas que está merecendo atenção pelos teores de vitamina C e sua introdução recente nos mercados mundiais. Desperta interesse de setores industriais como fármaco, cosmético, conservante natural, alimentício e da casca extrai-se corante natural (antocianinas). Considerando a importância do camu-camu como alimento, da vitamina C na dieta humana, realizou-se o presente trabalho com o objetivo de determinar o teor de vitamina C em frutos de camu-camu colhidos em...

  16. MgB2 and Mg1-xAlxB2 single crystals: high pressure growth and physical properties

    International Nuclear Information System (INIS)

    Karpinski, J.; Kazakov, S.M.; Jun, J.; Zhigadlo, N.D.; Angst, M.; Puzniak, R.; Wisniewski, A.

    2004-01-01

    Single crystals of MgB 2 have been grown with a high pressure cubic anvil technique. They grow via the peritectic decomposition of the MgNB 9 ternary nitride. The crystals are of a size up to 2 x 1 x 0.1 mm 3 with a weight up to 230 μg. Typically they have transition temperatures between 38 and 38.6 K with a width of 0.3-0.5 K. Investigations of the P-T phase diagram prove that the MgB 2 phase is stable at least up to 2190 deg. C at high hydrostatic pressure in the presence of Mg vapor under high pressure. Substitution of aluminum for magnesium in single crystals leads to stepwise decrease of T c . This indicates a possible appearance of superstructures or phases with different T c 's. The upper critical field decreases with Al doping

  17. Enhancement of bradykinin and resensitization of its B2 receptor.

    Science.gov (United States)

    Marcic, B; Deddish, P A; Jackman, H L; Erdös, E G

    1999-03-01

    We studied the enhancement of the effects of bradykinin B2 receptor agonists by agents that react with active centers of angiotensin-converting enzyme (ACE) independent of enzymatic inactivation. The potentiation and the desensitization and resensitization of B2 receptor were assessed by measuring [3H]arachidonic acid release and [Ca2+]i mobilization in Chinese hamster ovary cells transfected to express human ACE and B2 receptor, or in endothelial cells with constitutively expressed ACE and receptor. Administration of bradykinin or its ACE-resistant analogue desensitized the receptor, but it was resensitized (arachidonic acid release or [Ca2+]i mobilization) by agents such as enalaprilat (1 micromol/L). Enalaprilat was inactive in the absence of ACE expression. La3+ (100 micromol/L) inhibited the apparent resensitization, probably by blocking the entry of extracellular calcium. Enalaprilat resensitized the receptor via ACE to release arachidonic acid by bradykinin at a lower concentration (5 nmol/L) than required to mobilize [Ca2+]i (1 micromol/L). Monoclonal antibodies inhibiting the ACE N-domain active center and polyclonal antiserum potentiated bradykinin. The snake venom peptide BPP5a and metabolites of angiotensin and bradykinin (angiotensin-[1-9], angiotensin-[1-7], bradykinin-[1-8]; 1 micromol/L) enhanced arachidonic acid release by bradykinin. Angiotensin-(1-9) and -(1-7) also resensitized the receptor. Enalaprilat potentiated the bradykinin effect in cells expressing a mutant ACE with a single N-domain active site. Agents that reacted with a single active site, on the N-domain or on the C-domain, potentiated bradykinin not by blocking its inactivation but by inducing crosstalk between ACE and the receptor. Enalaprilat enhanced signaling via ACE by Galphai in lower concentration than by Galphaq-coupled receptor.

  18. On heavy carbon doping of MgB2

    International Nuclear Information System (INIS)

    Kasinathan, Deepa; Lee, K.-W.; Pickett, W.E.

    2005-01-01

    Heavy carbon doping of MgB 2 is studied by first principles electronic structure studies of two types, an ordered supercell (Mg(B 1-x C x ) 2 , x 0.0833) and also the coherent potential approximation method that incorporates effects of B-C disorder. For the ordered model, the twofold degenerate σ-bands that are the basis of the high temperature superconductivity are split by 60 meV (i.e. 7 meV/% C) and the σ Fermi cylinders contain 0.070 holes/cell, compared to 0.11 for MgB 2 . A virtual crystal treatment tends to overestimate the rate at which σ holes are filled by substitutional carbon. The coherent potential approximation (CPA) calculations give the same rate of band filling as the supercell method. The occupied local density of states of C is almost identical to that of B in the upper 2 eV of the valence bands, but in the range -8 eV to -2 eV, C has a considerably larger density of states. The calculations indicate that the σ Fermi surface cylinders pinch off at the zone center only above the maximum C concentration x ∼ 0.10. These results indicate that Mg(B 1-x C x ) 2 as well as Mg 1-x Al x B 2 is a good system in which to study the evolution of the unusual electron-phonon coupling character and strength as the crucial σ hole states are filled

  19. B2B-verkkokaupan markkinointiviestintäsuunnitelma

    OpenAIRE

    Luoma, Hanna

    2015-01-01

    Opinnäytetyön aiheena oli luoda markkinointiviestintäsuunnitelma Yritys Oy:n kehitteillä olevalle verkkokaupalle. Työn tavoitteena oli markkinointiviestintäsuunnitelman avulla selvittää miten Yritys Oy:n B2B-verkkokauppa saadaan osaksi myyntitoimia ja miten se mahdollisimman tehokkaasti tuodaan asiakkaiden tietoisuuteen. Yritys Oy on vuonna 2003 perustettu perheyritys, jonka toiminta on kiinnitystekniikan tukkumyynti alan ammattilaisille. Yritys Oy:llä on useampi toimipiste ympäri Suomea...

  20. Strategic Insights from Mystery Shopping in B2B Relationships

    DEFF Research Database (Denmark)

    Mattsson, Jan

    2012-01-01

    This paper describes how mystery shopping can be used to gain valuable strategic input in B2B service relationships. We account for a longitudinal case study framed as a natural experiment (duration 18 months) in a Swedish group of consultancy companies offering a wide selection of industrial...... guideline covering the themes of map, smoke and mirror as metaphors) has been extended to comprise a larger group of engineers and may be taken up in a company-wide way. The experiment was deemed effective in developing both a procedure for mystery shopping and a new way to train the consultants....

  1. Properties of hot pressed MgB2/Ti tapes

    International Nuclear Information System (INIS)

    Kovac, P.; Husek, I.; Melisek, T.; Fedor, J.; Cambel, V.; Morawski, A.; Kario, A.

    2009-01-01

    Hot axial and hot isostatic pressing was applied for single-core MgB 2 /Ti tapes. Differences in transport current density, n-exponents and critical current anisotropy are discussed and related to the grain connectivity influenced by pressing. The magnetic Hall probe scanning measurements allowed observing the isolated regions for axially hot pressed sample attributed to the longitudinally oriented cracks introduced by pressing. The highest current densities were measured for the tape subjected to hot isostatic pressing due to improved connectivity.

  2. Specific heat of MgB_2 after irradiation

    OpenAIRE

    Wang, Yuxing; Bouquet, Frederic; Sheikin, Ilya; Toulemonde, Pierre; Revaz, Bernard; Eisterer, Michael; Weber, Harald W.; Hinderer, Joerg; Junod, Alain

    2002-01-01

    We studied the effect of disorder on the superconducting properties of polycrystalline MgB_2 by specific-heat measurements. In the pristine state, these measurements give a bulk confirmation of the presence of two superconducting gaps with 2 Delta 0 / k_B T_c = 1.3 and 3.9 with nearly equal weights. The scattering introduced by irradiation suppresses T_c and tends to average the two gaps although less than predicted by theory. We also found that by a suitable irradiation process by fast neutr...

  3. Bu-2470, a new peptide antibiotic complex. II. Structure determination of Bu-2470 A, B1, B2a and B2b.

    Science.gov (United States)

    Sugawara, K; Yonemoto, T; Konishi, M; Matsumoto, K; Miyaki, T; Kawaguchi, H

    1983-06-01

    The structures of Bu-2470 A, B1, B2a, and B2b have been determined. Bu-2470 A is a simple octapeptide having no fatty acid moiety, while Bu-2470 B1, B2a and B2b are octapeptides that have been acylated with a beta-hydroxy C11 or C10 fatty acid. The octapeptide structure of Bu-2470 components was found identical with that of octapeptin C1, hence generic names of octapeptin C0, C2, C3 and C4 are proposed for Bu-2470 A, B1, B2a and B2b, respectively.

  4. Prevalencia del déficit de vitamina B12 en mayores de 60 años hospitalizados. Estudio del polimorfismo C677T de la enzima 5-10 MTHFR en pacientes con déficit de vitamina B12

    OpenAIRE

    Alonso Ortiz, María Belén

    2014-01-01

    Programa de doctorado: Avances en Medicina Interna. [ES] El déficit de Vitamina B12 es frecuente en los pacientes mayores. Sin embargo, son escasos los trabajos realizados en el ámbito hospitalario. Este déficit se asocia frecuentemente con elevación de la homocisteína plasmática, conocido factor de riesgo cardiovascular. Además la mutación C677T del gen de la enzima MTHFR se relaciona con hiperhomocistenemia, que puede coexistir con déficit de Vitamina B12, cuya frecuencia y consecuencias...

  5. The purification step is not crucial in EIA measurements of thromboxane B2 and 11-dehydrothromboxane B2 in human plasma.

    Science.gov (United States)

    Sadilkova, Lenka; Paluch, Zoltan; Mottlova, Jirina; Bednar, Frantisek; Alusik, Stefan

    2012-01-01

    Thromboxane B2 (TxB2) and particularly 11-dehydrothromboxane B2 (11-dTxB2) are widely used as prognostic risk markers of platelet activation in cardiovascular diseases. The main errors in TxB2 and 11-dTxB2 determination include either low concentrations of circulating TxB2 (1 - 2 pg/mL) and 11-dTxB2 (0.9 - 4.3 pg/mL) or rather high transiency (mean TxB2 half-life is approximately 5 minutes) as well as an incorrect pre-analytical phase set up. The aim of this study was to investigate the impact of a widely used purification step on the results of enzyme immunosorbent assay (EIA)--based measurement of the two selected thromboxanes. For the purpose of this study, 20 plasma samples (10 healthy donors, 10 patients under treatment with acetylsalicylic acid) were screened for TxB2 and 11-dTxB2 concentrations using commercial competitive EIA kits (Cayman Chemicals, Tallinn, Estonia; Neogen, Lexington, KY, USA) with or without the introduction of the purification procedure. The purification step does not significantly affect the results of EIA measurements of the two of TxA2 metabolites (TxB2, 11-dTxB2) in human plasma. The levels of TxB2 and 11-dTxB2 determined in the plasma samples were not significantly changed (p < 0.05) when the purification step was omitted compared to the purified samples. This study establishes a protocol allowing for reliable and reproducible plasma TxB2 and 11-dTxB2 EIA measurement for routine basic screening of platelet function.

  6. EFECTO DE PASTEURIZACIÓN SOBRE CARACTERÍSTICAS SENSORIALES Y CONTENIDO DE VITAMINA C EN JUGOS DE FRUTAS

    Directory of Open Access Journals (Sweden)

    YESENIA VILLAREAL D.

    2013-12-01

    Full Text Available En esta investigaciónse evaluó el efecto de distintos tratamientos de pasteurización sobre las características sensoriales y el contenido de vitamina C de cuatro jugos de fruta: mora de castilla (MC, mango costeño (MAC, naranja Valencia (NVy tomate de árbol tamarillo (TA.Los resultados mostraron que el proceso de pasteurización adecuado, definido como aquel que mostrara ausencia de actividad de peroxidasa (POD medida cualitativamentepara cada jugo fue 80ºC por 120 segundos (MC, 80ºC por 90 segundos (MAC, 75ºC por 90 segundos (NV y 80°C por 90 segundos (TA; el efecto del procesamiento sobre el color, olor y sabor de los jugos se evaluó mediante análisis sensorial por un panel entrenado y reveló que no hubo diferencias significativas (p<0,05 entre las características evaluadas antes y después del tratamiento térmico. Las pérdidas de vitamina C provocadas por el tratamiento de pasteurización, se cuantificaron mediante el método de Mohr encontrándose valores de 84,67% (MC, 89,82% (MAC, 99,43% (NV y 87,72% (TA. El tratamiento aplicado prolongó la vida útil de los jugos de 10 a 12 días a temperatura de refrigeración, sin cambios apreciables en sus características sensoriales

  7. MgB2-based superconductors for fault current limiters

    Science.gov (United States)

    Sokolovsky, V.; Prikhna, T.; Meerovich, V.; Eisterer, M.; Goldacker, W.; Kozyrev, A.; Weber, H. W.; Shapovalov, A.; Sverdun, V.; Moshchil, V.

    2017-02-01

    A promising solution of the fault current problem in power systems is the application of fast-operating nonlinear superconducting fault current limiters (SFCLs) with the capability of rapidly increasing their impedance, and thus limiting high fault currents. We report the results of experiments with models of inductive (transformer type) SFCLs based on the ring-shaped bulk MgB2 prepared under high quasihydrostatic pressure (2 GPa) and by hot pressing technique (30 MPa). It was shown that the SFCLs meet the main requirements to fault current limiters: they possess low impedance in the nominal regime of the protected circuit and can fast increase their impedance limiting both the transient and the steady-state fault currents. The study of quenching currents of MgB2 rings (SFCL activation current) and AC losses in the rings shows that the quenching current density and critical current density determined from AC losses can be 10-20 times less than the critical current determined from the magnetization experiments.

  8. Magnesium diboride(MgB2) wires for applications

    International Nuclear Information System (INIS)

    Patel, Dipak; Kim, Jung Ho

    2016-01-01

    Field and temperature dependence of the critical current density, Jc, were measured for both un-doped and carbon doped MgB 2 /Nb/Monel wires manufactured by Hyper Tech Research, Inc. In particular, carbon incorporation into the MgB 2 structure using malic acid additive and a chemical solution method can be advantageous because of the highly uniform mixing between the carbon and boron powders. At 4.2 K and 10 T, Jc was estimated to be 25,000 - 25,300 Acm -2 for the wire sintered at 600 degrees C for 4 hours. The irreversibility field, Birr, of the malic acid doped wire was approximately 21.0 - 21.8 T, as obtained from a linear extrapolation of the J-B characteristic. Interestingly enough, the Jc of the malic acid doped sample exceeds 10 5 Acm -2 at 6 T and 4.2 K, which is comparable to that of commercial Nb-Ti wires

  9. USING UML SCENARIOS IN B2B SYSTEMS

    Directory of Open Access Journals (Sweden)

    A. Jakimi

    2010-05-01

    Full Text Available Scenarios has become a popular technique for requirements elicitation and specification building. Since scenarios capture only partial descriptions of the system behavior, an approach for scenario composition and/or integration is needed to produce more complete specifications. The Unified Modeling Language (UML, which has become a standard notation for object-oriented modeling, provides a suitable framework for scenario acquisition using Use Case diagrams and Sequence or Collaboration diagrams. In this paper, we suggest an algorithmic and tool support for composing and integrating scenarios that are represented in form of sequence diagrams. We suggest four operators (;: sequential operator, ||: concurrent operator, ?: conditional operator and  * :iteration operator to compose a set of scenarios that describe a use case of a given system. In this paper, we suggest also to apply the scenario approach to B2B systems (Business to Business. We propose to develop B2B systems as a three activities process deriving formal specifications and code skeletons from UML scenarios. Activities of this proposed process are generally automatic and are supported by a set of developed algorithms and tools.

  10. B2FH, the Cosmic Microwave Background and Cosmology*

    Science.gov (United States)

    Burbidge, G.

    In this talk I shall start by describing how we set about and carried out the work that led to the publication of Burbidge et al. (1957, hereafter B2FH). I then shall try and relate this work and the circumstances that surrounded it to the larger problem of the origin and formation of the universe. Here it is necessary to look back at the way that ideas developed and how, in many situations, astronomers went astray. Of course this is a personal view, though I very strongly believe that if he were still here, it is the approach that Fred Hoyle would take. I start by describing the problems originally encountered by Gamow and his associates in trying to decide where the helium was made. This leads me to a modern discussion of the origin of 2D, 3He, 4He and 7Li, originally described by B2FH as due to the x-process. While it is generally argued, following Gamow, Alpher, and Herman, that these isotopes were synthesised in a big bang I shall show that it is equally likely that these isotopes were made in active galactic nuclei, as was the cosmic microwave background (CMB), in a cyclic universe model. The key piece of observational evidence is that the amount of energy released in the conversion of hydrogen to helium in the universe is very close to the energy carried by the CMB, namely ~4.5 × 10-13 erg cm-3.

  11. Vortex lattice structures in YNi2B2C

    International Nuclear Information System (INIS)

    Yethiraj, M.; Paul, D.M.; Tomy, C.V.; Forgan, E.M.

    1997-01-01

    The authors observe a flux lattice with square symmetry in the superconductor YNi 2 B 2 C when the applied field is parallel to the c-axis of the crystal. A square lattice observed previously in the isostructural magnetic analog ErNi 2 B 2 C was attributed to the interaction between magnetic order in that system and the flux lattice. Since the Y-based compound does not order magnetically, it is clear that the structure of the flux lattice is unrelated to magnetic order. In fact, they show that the flux lines have a square cross-section when the applied field is parallel to the c-axis of the crystal, since the measured penetration depth along the 100 crystal direction is larger than the penetration depth along the 110 by approximately 60%. This is the likely reason for the square symmetry of the lattice. Although they find considerable disorder in the arrangement of the flux lines at 2.5T, no melting of the vortex lattice was observed

  12. Nível sérico da vitamina A em crianças portadoras de leishmaniose visceral Vitamin A serum level in children with visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Kleber Giovanni Luz

    2001-01-01

    Full Text Available A vitamina A tem sido considerada uma vitamina anti-infecciosa e sua deficiência está associada a um maior risco de infecções graves, como ocorre por exemplo no sarampo. Nos países em desenvolvimento a hipovitaminose A é um grave problema de saúde pública. O objetivo deste estudo é quantificar o nível sérico da vitamina A em pacientes pediátricos portadores da leismaniose visceral (LV. Amostras de sangue foram coletadas de 22 crianças portadoras de LV, estocadas em freezer e posteriormente, quantificado o nível de vitamina A usando-se a cromatrografia líquída de alta eficiência, nove irmãos assintomáticos dos pacientes foram usados como controles. A média do nível sérico da vitamina A nos portadores de LV foi de 21,38µg/100ml e no grupo controle foi de 31,39µg/100ml. Entre os pacientes estudados com LV a média do nível sérico de vitamina A encontrado foi significativamente menor, utilizando-se o teste t de Student para um pVitamin A is considered an anti-infectious disease vitamin, and its deficiency is associated with severe infections such as in measles. In developing countries the low concentrations of vitamin A are a public health problem. The aim of this study is to describe serum vitamin A concentrations among children with visceral leishmaniasis (VL. Blood sample was collected from 22 children with VL, and stored in a freezer, 9 siblings, with no clinical signs of the VL patients had their blood collected for a control group. Samples were assayed by high performance liquid chromatography. The median vitamin A concentration in the LV group was 21.38µg/100ml and in the control group it was 31.39µg/100. The mean in the LV was statistically lower than in the control group, using Student's t test, p<0.01.

  13. Níveis séricos de vitamina D e periodontite crônica em pacientes com doença renal crônica

    Directory of Open Access Journals (Sweden)

    Jessica do Amaral Bastos

    2013-03-01

    Full Text Available INTRODUÇÃO A concomitância de periodontite crônica (PC em pacientes com doença renal crônica (DRC tem sido associada a desfechos adversos. A deficiência de vitamina D (25(OHD parece desempenhar papel importante na PC e níveis inadequados de vitamina D têm sido descritos em pacientes com DRC. OBJETIVO: Examinar a relação entre níveis séricos de vitamina D e PC em pacientes com DRC pré-dialítica. MÉTODO: Estudo de caso-controle, definidos, respectivamente, como pacientes com DRC e PC e DRC sem PC. Os dados demográficos, de exame físico e laboratoriais foram obtidos no dia da consulta. A DRC foi definida e estagiada segundo a NKF QDOKI TM. Os níveis séricos de 25(OH D foram dosados por quimioluminescência quando da avaliação da PC, a qual foi caracterizada segundo os critérios de Academia Americana de Periodontologia (1999. Os resultados de 25(OHD foram estratificados em deficiência ( 30 ηg/mL. RESULTADOS: Um total de 29 pacientes foram estudados, 15 no grupo caso e 14 no grupo controle. Os pacientes casos apresentaram mediana de 25(OH D inferior a dos pacientes controles (22,6 vs. 28,6 ηg/mL; p < 0,01. A frequência de pacientes casos com insuficiência/deficiência de vitamina D foi maior do que entre os pacientes controles (93,3% vs. 57,1%, p < 0,004. Por outro lado, o percentual de pacientes com suficiência de vitamina D foi maior entre os controles se comparados aos integrantes do grupo casos (42,9% vs. 6,7%, p < 0,004. CONCLUSÃO: Em pacientes com DRC, a deficiência de vitamina D se associa com PC.

  14. Estado de los micronutrientes hierro y vitamina A, factores de riesgo para las deficiencias y valoración antropométrica en niños preescolares del municipio de Funza, Colombia

    Directory of Open Access Journals (Sweden)

    Elpidia Poveda

    2007-03-01

    Conclusión. Existe la necesidad de fortalecer programas fundamentados en las condiciones existentes para mejorar la situación nutricional de los preescolares del municipio de Funza. Es importante indagar si se presenta anemia nutricional relacionada con ácido fólico y vitamina B12, así como sobre otros factores de riesgo asociados con la deficiencia nutricional por hierro y vitamina A.

  15. Phase and Microstructural Correlation of Spark Plasma Sintered HfB2-ZrB2 Based Ultra-High Temperature Ceramic Composites

    Directory of Open Access Journals (Sweden)

    Ambreen Nisar

    2017-07-01

    Full Text Available The refractory diborides (HfB2 and ZrB2 are considered as promising ultra-high temperature ceramic (UHTCs where low damage tolerance limits their application for the thermal protection system in re-entry vehicles. In this regard, SiC and CNT have been synergistically added as the sintering aids and toughening agents in the spark plasma sintered (SPS HfB2-ZrB2 system. Herein, a novel equimolar composition of HfB2 and ZrB2 has shown to form a solid-solution which then allows compositional tailoring of mechanical properties (such as hardness, elastic modulus, and fracture toughness. The hardness of the processed composite is higher than the individual phase hardness up to 1.5 times, insinuating the synergy of SiC and CNT reinforcement in HfB2-ZrB2 composites. The enhanced fracture toughness of CNT reinforced composite (up to a 196% increment surpassing that of the parent materials (ZrB2/HfB2-SiC is attributed to the synergy of solid solution formation and enhanced densification (~99.5%. In addition, the reduction in the analytically quantified interfacial residual tensile stress with SiC and CNT reinforcements contribute to the enhancement in the fracture toughness of HfB2-ZrB2-SiC-CNT composites, mandatory for aerospace applications.

  16. Matchmaking Framework for B2B E-Marketplaces

    Directory of Open Access Journals (Sweden)

    Fekete ZOLTAN ALPAR

    2010-01-01

    Full Text Available In the recent years trading on the Internet become more popular. Online businesses gradually replace more and more from the conventional business. Much commercial information is exchanged on the internet, especially using the e-marketplaces. The demand and supply matching process becomes complex and difficult on last twenty years since the e-marketplaces play an important role in business management. Companies can achieve significant cost reduction by using e-marketplaces in their trade activities and by using matchmaking systems on finding the corresponding supply for their demand and vice versa. In the literature were proposed many approaches for matchmaking. In this paper we present a conceptual framework of matchmaking in B2B e-marketplaces environment.

  17. Relationship Quality as Predictor of B2B Customer Loyalty

    Directory of Open Access Journals (Sweden)

    Shaimaa S. B. Ahmed Doma

    2013-02-01

    Full Text Available Relationship marketing has become extremely important recently due to the fierce competition in today's marketplace. Companies are required to build long-term profitable relationship with customers and to achieve customer loyalty. Also, switching behaviors frequently occur among most of targeted customers. Fewer studies, however, discuss the effects of relationship quality efforts on customer loyalty. Therefore, this study is aimed to investigate the impact of relationship quality on customer loyalty in B2B context in the Egyptian shipping services sector. Building on prior research, we propose relationship quality as a higher construct comprising trust, commitment and satisfaction. An analytical model is developed as a guideline to test the relationships between relationship quality dimensions and customer loyalty.

  18. Model of the Sgr B2 radio source

    International Nuclear Information System (INIS)

    Gosachinskij, I.V.; Khersonskij, V.K.

    1981-01-01

    The dynamical model of the gas cloud around the radio source Sagittarius B2 is suggested. This model describes the kinematic features of the gas in this source: contraction of the core and rotation of the envelope. The stability of the cloud at the initial stage is supported by the turbulent motion of the gas, turbulence energy dissipates due to magnetic viscosity. This process is occurring more rapidly in the dense core and the core begins to collapse but the envelope remains stable. The parameters of the primary cloud and some parameters (mass, density and size) of the collapse are calculated. The conditions in the core at the moment of its fragmentation into masses of stellar order are established [ru

  19. Widespread Occurrence of the Mycotoxin Fumonisin B-2 in Wine

    DEFF Research Database (Denmark)

    Mogensen, Jesper Mølgaard; Larsen, Thomas Ostenfeld; Nielsen, Kristian Fog

    2010-01-01

    Fumonisins are important mycotoxins because they are suspected to cause human and animal toxicoses by the consumption of contaminated corn-based food and feeds. However, with the discovery of fumonisin production in grapes by Aspergillus niger, wine may also be a fumonisin-containing commodity....... In the present study, we have developed a simple and quantitative cation-exchange-based purification method for the subsequent isotope dilution liquid chromatography tandem mass spectrometry (LC-MS/MS) determination of fumonisins in wine. A comparative study of seven different solid-phase extraction (SPE......) columns showed that polymeric mixed-mode reversed-phase (RP) cation-exchange columns were superior to classic silica-based cation and mixed-mode cation-exchange columns. A total of 77 wine samples from 13 countries were subsequently tested, and surprisingly, 18 (23%) were found to contain fumonisin B-2...

  20. Directional scanning tunneling spectroscopy in MgB2

    International Nuclear Information System (INIS)

    Iavarone, M.; Karapetrov, G.; Koshelev, A.E.; Kwok, W.K.; Crabtree, G.W.; Hinks, D.G.; Cook, R.; Kang, W.N.; Choi, E.M.; Kim, H.J.; Lee, S.I.

    2003-01-01

    The superconductivity in MgB 2 has a two-band character with the dominating band having a 2D character and the second band being isotropic in the three dimensions. We use tunneling microscopy and spectroscopy to reveal the two distinct energy gaps at Δ 1 =2.3 meV and Δ 2 =7.1 meV. Different spectral weights of the partial superconducting density of states are a reflection of different tunneling directions in this multi-band system. The results are consistent with the existence of two-band superconductivity in the presence of strong interband superconducting pair interaction and quasiparticle scattering. The temperature evolution of the tunneling spectra shows both gaps vanishing at the bulk T c

  1. Diatomic substitutionals in superconducting Nb(1-x)B2

    International Nuclear Information System (INIS)

    Farrell, H.H.; LaViolette, Randall A.; Lillo, T.M.

    2006-01-01

    Using first-principles, density functional theory calculations, we have shown that the increase in superconducting critical temperature to above 9 K experimentally observed for B-rich, off-stoichiometry NbB 2 material is associated with the formation of B-dimers on Nb sites rather than with the formation of Nb vacancies, as previously proposed. Our calculations show that certain of these B-dimer configurations have lower binding energies than do the vacancy structures. This result is pressure independent in the range between 0 and 10 GPa, and above. Further, the dimer-containing materials have a higher electronic density of states at the Fermi level than do the vacancy structures. Finally, the presence of B-dimers results in the splitting off of phonon normal modes. These last two factors are relevant to the improved superconducting properties

  2. Specific heat of MgB2 after irradiation

    International Nuclear Information System (INIS)

    Wang Yuxing; Bouquet, Frederic; Sheikin, Ilya; Toulemonde, Pierre; Revaz, Bernard; Eisterer, Michael; Weber, Harald W; Hinderer, Joerg; Junod, Alain

    2003-01-01

    We studied the effect of disorder on the superconducting properties of polycrystalline MgB 2 by specific-heat measurements. In the pristine state, these measurements give a bulk confirmation of the presence of two superconducting gaps with 2Δ 0 /k B T c =1.3 and 3.9 with nearly equal weights. The scattering introduced by irradiation suppresses T c and tends to average the two gaps although less than predicted by theory. We also found that by a suitable irradiation process by fast neutrons, a substantial bulk increase of dH c2 /dT at T c can be obtained without sacrificing more than a few degrees in T c . The upper critical field of the sample after irradiation exceeds 28 T at T→0

  3. Podwójna negacja w B 2 poematu Parmenidesa

    Directory of Open Access Journals (Sweden)

    Kazimierz MRÓWKA

    2012-12-01

    Full Text Available In our article we focus on an analysis of the structure of double negation in the poem of Parmenides,paying attention to the fragment B 2. The starting point for the analysis is the classificationof varieties of negation contained in Diogenes Laertius (VII.69-70: negation, denial,privation and double negation. We provide an example of double negation as given by Diogenes: “Not (is not a day ↔ it is a day”. In terms of the poetic expression the law of double negationserves to strengthen the goddess’ speech. However, in the context of Parmenides’ ontology, thelaw of double negation serves as an affirmation of “is”. Our goal is to give a detailed analysis ofthe structure of double negation. In the next step we introduce Euclid’s proofs by comparison.We show that all four forms of negation indicated by Diogenes occur in the Elements and thereis a richer set of the linguistic forms used as an expression of negation, including that of doublenegation. Finally, we show that Parmenides applies consciously the law of double negation,and the poem is the first philosophical text confirming the use of this law. In short, doublenegation can be summarized as follows: for the Stoics, in Diogenes Laertius (VII.69-70: “not(is not a day ↔ is a day”; for Euclid: “not (is not-equal ↔ is equal” (Elements, I.6. “is notlike that (.... is not around ... ↔ is around” (Elements VI.26; and in Parmenides: “is ↔ not(is not to be” (B 2, v. 3.

  4. Lípidos bioactivos en productos lácteos

    OpenAIRE

    Rodríguez Alcalá, Luis M.; Calvo, Maria V.; Villar-Tajadura, M. Antonia; Castro-Gómez, Pilar; Holgado, Francisca; Juárez, Manuela; Fontecha, F. Javier

    2010-01-01

    En la actualidad, las recomendaciones dietéticas reconocen que la leche y los productos lácteos son una excelente fuente de nutrientes esenciales (ej: calcio, potasio, magnesio, zinc, riboflavina, vitamina A, folato, vitamina D y proteínas de elevada calidad nutricional), así como un vehículo ideal de componentes bioactivos que pueden aportar beneficios para la salud humana.

  5. Absorção da vitamina B12 nas mieloses funiculares: Estudo da absorção da radiocianocobalamina em 16 casos

    Directory of Open Access Journals (Sweden)

    Horacio M. Canelas

    1961-03-01

    Full Text Available Os autores estudam a absorção intestinal da vitamina B12 (teste de Schilling em 16 casos com sintomatologia neurológica característica de mielose funicular, com deficiência da secreção cloridropéptica de origem constitucional ou adquirida (pós-gastrectomia. Não foi verificada correlação entre a absorção de vitamina B12, de um lado, e a intensidade da sintomatologia neurológica global ou dos distúrbios da sensibilidade vibratória. Entretanto, nos pacientes com deficiente absorção predominou a síndrome piramidal; no grupo com absorção normal prevaleceu a síndrome periférica, relativamente aos sinais de lesão dos tratos corticospinais.

  6. INFLUENCIA DE PROHEXADIONA-CA Y PROMOTORES DE OXIDACIÓN SOBRE EL RENDIMIENTO, CAPSAICINA Y VITAMINA C EN CHILE JALAPEÑO

    Directory of Open Access Journals (Sweden)

    H. Ramírez

    2009-01-01

    M. El estudio se realizó en invernadero y en laboratorio de la Universidad Autónoma Agraria Antonio Narro en 2007. Los tratamientos consistieron en la aplicación a semilla, plántula y planta de P-Ca, AB, AS y agua (testigo. Las variables de estudio fueron cuantificar las concentraciones de capsaicina y vitamina C en frutos maduros y su rendimiento. El nivel de capsaicina y rendimiento por planta mostraron incrementos estadísticos en las tres etapas referidas con aplicación de P-Ca (100, 150 y 200 mg¿litro-1 en forma individual o en combinación con AB y AS (1x10-6 M. El contenido de vitamina C aumentó significativamente en semilla con el tratamiento P-Ca 100 mg.litro-1.

  7. Estudio comparativo de la pérdida de vitamina C en chalarina (Casimiroa edulis) por cuatro métodos de deshidratación

    OpenAIRE

    Judith Castañeda; Hubert Arteaga; Raúl Siche; Gilbert Rodriguez

    2010-01-01

    El objetivo de este estudio fue comparar la pérdida de vitamina C de la chalarina después de aplicar cuatro métodos de deshidratación: deshidratación osmótica a vacío combinada con secado convectivo, secado convectivo, deshidratación osmótica a vacío combinada con liofilización, y liofilización. La chalarina fresca fue acondicionada en forma de cubos de 1 cm de arista; se determinó el contenido de vitamina C y otras propiedades químicas de la pulpa. Los polvos obtenidos fueron caracterizados:...

  8. CONCENTRACIONES PLASMÁTICAS DE 25-OH-VITAMINA D EN SANGRE DE CORDÓN UMBILICAL TRAS LOS MESES DE VERANO

    Directory of Open Access Journals (Sweden)

    Cristina Manzano Varo

    2017-01-01

    Full Text Available Los niveles de vitamina D (25(OHD del recién nacido dependen de los depósitos maternos. En los últimos años se han publicado estudios que muestran una elevada prevalencia de deficiencia de vitamina D en mujeres embarazadas, viéndose en algunos diferencias estacionales. El objetivo del presente estudio fue determinar los valores de 25(OHD en sangre de cordón después de los meses de verano y determinar su relación con diferentes variables. Métodos: Se seleccionó a 103 mujeres en el momento del parto durante los meses de octubre, noviembre y principios de diciembre, cuyas gestaciones tuvieron lugar durante meses de máxima exposición solar. Se determinaron las concentraciones de 25(OHD en sangre de cordón umbilical y se recogieron datos perinatales, ingesta de vitamina D y calcio y exposición solar mediante cuestionario. Se realizó el análisis estadístico mediante el programa SPSS. Las comparaciones se realizaron mediante test de Kruskal- Wallis y U de Mann-Whitney, aplicando corrección por comparaciones múltiples de Bonferroni. Se consideró estadísticamente significativa una p<0,05 y de 0,0083 para comparaciones múltiples. Resultados: El valor medio de 25(OHD en sangre de cordón fue 12,36±7,2 ng/ml. El 83,4% de las mujeres presentaron niveles deficitarios. Se observó una correlación estadísticamente significativa entre los niveles bajos de vitamina D y la baja ingesta de vitamina D (coeficiente de correlación 0,29; la etnia, presentando el valor más alto la etnia caucásica (17,9 ± 5,83 ng/ml y el menor la etnia indopakistaní (6,68 ± 4,2 ng/ml; el uso de indumentaria tradicional (5,64 ± 3,09 ng/ml; la baja exposición solar y el fototipo cutáneo oscuro con un coeficiente de correlación de 0,67 y -0,48 respectivamente. Conclusiones: Existe una elevada prevalencia de deficiencia de vitamina D en sangre de cordón umbilical independiente de la exposición solar. Se observó una correlación entre niveles bajos de

  9. Effects of HfB2 and HfN Additions on the Microstructures and Mechanical Properties of TiB2-Based Ceramic Tool Materials

    Science.gov (United States)

    An, Jing; Song, Jinpeng; Liang, Guoxing; Gao, Jiaojiao; Xie, Juncai; Cao, Lei; Wang, Shiying; Lv, Ming

    2017-01-01

    The effects of HfB2 and HfN additions on the microstructures and mechanical properties of TiB2-based ceramic tool materials were investigated. The results showed that the HfB2 additive not only can inhibit the TiB2 grain growth but can also change the morphology of some TiB2 grains from bigger polygons to smaller polygons or longer ovals that are advantageous for forming a relatively fine microstructure, and that the HfN additive had a tendency toward agglomeration. The improvement of flexural strength and Vickers hardness of the TiB2-HfB2 ceramics was due to the relatively fine microstructure; the decrease of fracture toughness was ascribed to the formation of a weaker grain boundary strength due to the brittle rim phase and the poor wettability between HfB2 and Ni. The decrease of the flexural strength and Vickers hardness of the TiB2-HfN ceramics was due to the increase of defects such as TiB2 coarse grains and HfN agglomeration; the enhancement of fracture toughness was mainly attributed to the decrease of the pore number and the increase of the rim phase and TiB2 coarse grains. The toughening mechanisms of TiB2-HfB2 ceramics mainly included crack bridging and transgranular fracture, while the toughening mechanisms of TiB2-HfN ceramics mainly included crack deflection, crack bridging, transgranular fracture, and the core-rim structure. PMID:28772821

  10. Effects of HfB2 and HfN Additions on the Microstructures and Mechanical Properties of TiB2-Based Ceramic Tool Materials

    Directory of Open Access Journals (Sweden)

    Jing An

    2017-04-01

    Full Text Available The effects of HfB2 and HfN additions on the microstructures and mechanical properties of TiB2-based ceramic tool materials were investigated. The results showed that the HfB2 additive not only can inhibit the TiB2 grain growth but can also change the morphology of some TiB2 grains from bigger polygons to smaller polygons or longer ovals that are advantageous for forming a relatively fine microstructure, and that the HfN additive had a tendency toward agglomeration. The improvement of flexural strength and Vickers hardness of the TiB2-HfB2 ceramics was due to the relatively fine microstructure; the decrease of fracture toughness was ascribed to the formation of a weaker grain boundary strength due to the brittle rim phase and the poor wettability between HfB2 and Ni. The decrease of the flexural strength and Vickers hardness of the TiB2-HfN ceramics was due to the increase of defects such as TiB2 coarse grains and HfN agglomeration; the enhancement of fracture toughness was mainly attributed to the decrease of the pore number and the increase of the rim phase and TiB2 coarse grains. The toughening mechanisms of TiB2-HfB2 ceramics mainly included crack bridging and transgranular fracture, while the toughening mechanisms of TiB2-HfN ceramics mainly included crack deflection, crack bridging, transgranular fracture, and the core-rim structure.

  11. Nanostructure characterization of Ni and B layers as artificial pinning centers in multilayered MgB2/Ni and MgB2/B superconducting thin films

    International Nuclear Information System (INIS)

    Sosiati, H.; Hata, S.; Doi, T.; Matsumoto, A.; Kitaguchi, H.; Nakashima, H.

    2013-01-01

    Highlights: ► Nanostructure characterization of Ni and B layers as artificial pinning centers (APCs). ► Relationship between nanostructure and J c property. ► Enhanced J c in parallel field by parallel APCs within the MgB 2 film. -- Abstract: Research on the MgB 2 /Ni and MgB 2 /B multilayer films fabricated by an electron beam (EB) evaporation technique have been extensively carried out. The critical current density, J c of MgB 2 /Ni and MgB 2 /B multilayer films in parallel fields has been suggested to be higher than that of monolayer MgB 2 film due to introducing the artificial pinning centers of nano-sized Ni and B layers. Nanostructure characterization of the artificial pinning centers in the multilayer films were examined by transmission electron microscopy (TEM) and scanning TEM (STEM-energy dispersive X-ray spectroscopy (STEM-EDS))–EDS to understand the mechanism of flux pinning. The growth of columnar MgB 2 grains along the film-thickness direction was recognized in the MgB 2 /Ni multilayer film, but not in the MgB 2 /B multilayer film. Nano-sized Ni layers were present as crystalline epitaxial layers which is interpreted that Ni atoms might be incorporated into the MgB 2 lattice to form (Mg,Ni)B 2 phase. On the other hand, nano-sized B layers were amorphous layers. Crystalline (Mg,Ni)B 2 layers worked more effectively than amorphous B-layers, providing higher flux-pinning force that resulted in higher J c of the MgB 2 /Ni multilayer film than the MgB 2 /B multilayer film

  12. Getting started with Oracle SOA B2B Integration a hands-on tutorial

    CERN Document Server

    Bhatia, Krishnaprem; Perlovsky, Alan

    2013-01-01

    This hands on tutorial gives you the best possible start you could hope for with Oracle B2B. Learn using real life scenarios and examples to give you a solid footing of B2B.This book is for B2B architects, consultants and developers who would like to design and develop B2B integrations using Oracle B2B. This book assumes no prior knowledge of Oracle B2B and explains all concepts from scratch using illustrations, real world examples and step-by-step instructions. The book covers enough depth and details to be useful for both beginner and advanced B2B users.

  13. Produtos de acerola: estudo da estabilidade de vitamina C West indian cherry products: study of vitamin C stability

    Directory of Open Access Journals (Sweden)

    Fábio Yamashita

    2003-04-01

    Full Text Available A acerola é um fruto altamente perecível e que contém altos teores de vitamina C, sendo este o seu principal atrativo em termos nutricionais. A atual legislação brasileira prevê uma variação de, no máximo, 20% do teor dos nutrientes especificados no rótulo. Devido a essa exigência seria importante que os fabricantes considerassem tanto o teor inicial de vitamina C quanto a perda ao longo da armazenagem dos produtos de acerola. Neste trabalho, foi feito o acompanhamento da estabilidade da vitamina C em polpa pasteurizada e acerola in natura congeladas, ambas armazenadas a -12ºC e -18ºC, e em suco de acerola pasteurizado engarrafado, mantido a temperatura ambiente, ao longo de 4 meses de armazenagem. As polpas congeladas não apresentaram degradação significativa durante este período, já as in natura apresentaram cinética de degradação de 1ª ordem e o suco de ordem zero. Após 4 meses de armazenagem as acerolas armazenadas a -12ºC e -18ºC apresentaram teores de 869±12 e 1.223±148 mg vit.C/100g, representando uma perda de 43% e 19%, respectivamente, em relação ao teor inicial. Polpas a -12ºC e -18ºC apresentaram teores de 1.314±6 e 1.322±2 mg vit.C/100g, respectivamente, representando uma perda de, aproximadamente, 3% e o suco apresentou uma perda de 32%, correspondendo a um teor final de 673±17mg vit.C/100g.West indian cherry is a very perishable fruit and its vitamin C content is its principal nutritional appeal. Brazilian legislation admits a 20% variation in the nutrient content from the one specified on the label. Due to this requirement the initial vitamin C content and losses during storage should be known in products. Vitamin C stability in pasteurized pulp and west indian cherry in natura, both frozen and stored at -12ºC e -18ºC and of the pasteurized juice stored at room temperature, were determined during four months. Frozen pulps had no significant vitamin C degradation during this period and fruits in

  14. High temperature microhardness of ZrB2 single crystals

    International Nuclear Information System (INIS)

    Yi Xuan; Chen Chunhua; Otani, Shigeki

    2002-01-01

    Vickers microhardness of (0001), (101-bar 0) and (112-bar 0) planes of ZrB 2 single crystal prepared by the floating zone method has been investigated at various temperatures and loading times. As the temperature increases from 25 deg. C to 1000 deg. C, hardness drops from ∼20.9 GN m -2 of all planes to ∼7.85 GN m -2 for (0001) plane and ∼4.91 GN m -2 for (101-bar 0) and (112-bar 0) planes. The hardness of (101-bar 0) and (112-bar 0) planes exhibits almost same tendency and is always lower than that of (0001) plane by about 35%. The thermal softening coefficients of all three planes strongly depends on the temperature range with clear inflections at 400 deg. C and 700 deg. C. The loading time dependence of hardness is used to calculate the activation energy for creep. In addition, a relationship was found that shows the variation of hardness with temperature to be proportional to the variation with the loading time in a specific temperature range. (rapid communication)

  15. Lightweight MgB2 superconducting 10 MW wind generator

    Science.gov (United States)

    Marino, I.; Pujana, A.; Sarmiento, G.; Sanz, S.; Merino, J. M.; Tropeano, M.; Sun, J.; Canosa, T.

    2016-02-01

    The offshore wind market demands a higher power rate and more reliable turbines in order to optimize capital and operational costs. The state-of-the-art shows that both geared and direct-drive conventional generators are difficult to scale up to 10 MW and beyond due to their huge size and weight. Superconducting direct-drive wind generators are considered a promising solution to achieve lighter weight machines. This work presents an innovative 10 MW 8.1 rpm direct-drive partial superconducting generator using MgB2 wire for the field coils. It has a warm iron rotor configuration with the superconducting coils working at 20 K while the rotor core and the armature are at ambient temperature. A cooling system based on cryocoolers installed in the rotor extracts the heat from the superconducting coils by conduction. The generator's main parameters are compared against a permanent magnet reference machine, showing a significant weight and size reduction. The 10 MW superconducting generator concept will be experimentally validated with a small-scale magnetic machine, which has innovative components such as superconducting coils, modular cryostats and cooling systems, and will have similar size and characteristics as the 10 MW generator.

  16. Lightweight MgB2 superconducting 10 MW wind generator

    International Nuclear Information System (INIS)

    Marino, I; Pujana, A; Sarmiento, G; Sanz, S; Merino, J M; Tropeano, M; Sun, J; Canosa, T

    2016-01-01

    The offshore wind market demands a higher power rate and more reliable turbines in order to optimize capital and operational costs. The state-of-the-art shows that both geared and direct-drive conventional generators are difficult to scale up to 10 MW and beyond due to their huge size and weight. Superconducting direct-drive wind generators are considered a promising solution to achieve lighter weight machines. This work presents an innovative 10 MW 8.1 rpm direct-drive partial superconducting generator using MgB 2 wire for the field coils. It has a warm iron rotor configuration with the superconducting coils working at 20 K while the rotor core and the armature are at ambient temperature. A cooling system based on cryocoolers installed in the rotor extracts the heat from the superconducting coils by conduction. The generator’s main parameters are compared against a permanent magnet reference machine, showing a significant weight and size reduction. The 10 MW superconducting generator concept will be experimentally validated with a small-scale magnetic machine, which has innovative components such as superconducting coils, modular cryostats and cooling systems, and will have similar size and characteristics as the 10 MW generator. (paper)

  17. Bond deformation paths and electronic instabilities of ultraincompressible transition metal diborides: Case study of OsB2 and IrB2

    Science.gov (United States)

    Zhang, R. F.; Legut, D.; Wen, X. D.; Veprek, S.; Rajan, K.; Lookman, T.; Mao, H. K.; Zhao, Y. S.

    2014-09-01

    The energetically most stable orthorhombic structure of OsB2 and IrB2 is dynamically stable for OsB2 but unstable for IrB2. Both diborides have substantially lower shear strength in their easy slip systems than their metal counterparts. This is attributed to an easy sliding facilitated by out-of-plane weakening of metallic Os-Os bonds in OsB2 and by an in-plane bond splitting instability in IrB2. A much higher shear resistance of Os-B and B-B bonds than Os-Os ones is found, suggesting that the strengthened Os-B and B-B bonds are responsible for hardness enhancement in OsB2. In contrast, an in-plane electronic instability in IrB2 limits its strength. The electronic structure of deformed diborides suggests that the electronic instabilities of 5d orbitals are their origin of different bond deformation paths. Neither IrB2 nor OsB2 can be intrinsically superhard.

  18. The conserved nhaAR operon is drastically divergent between B2 and non-B2 Escherichia coli and is involved in extra-intestinal virulence.

    Science.gov (United States)

    Lescat, Mathilde; Reibel, Florence; Pintard, Coralie; Dion, Sara; Glodt, Jérémy; Gateau, Cecile; Launay, Adrien; Ledda, Alice; Cruveiller, Stephane; Cruvellier, Stephane; Tourret, Jérôme; Tenaillon, Olivier

    2014-01-01

    The Escherichia coli species is divided in phylogenetic groups that differ in their virulence and commensal distribution. Strains belonging to the B2 group are involved in extra-intestinal pathologies but also appear to be more prevalent as commensals among human occidental populations. To investigate the genetic specificities of B2 sub-group, we used 128 sequenced genomes and identified genes of the core genome that showed marked difference between B2 and non-B2 genomes. We focused on the gene and its surrounding region with the strongest divergence between B2 and non-B2, the antiporter gene nhaA. This gene is part of the nhaAR operon, which is in the core genome but flanked by mobile regions, and is involved in growth at high pH and high sodium concentrations. Consistently, we found that a panel of non-B2 strains grew faster than B2 at high pH and high sodium concentrations. However, we could not identify differences in expression of the nhaAR operon using fluorescence reporter plasmids. Furthermore, the operon deletion had no differential impact between B2 and non-B2 strains, and did not result in a fitness modification in a murine model of gut colonization. Nevertheless, sequence analysis and experiments in a murine model of septicemia revealed that recombination in nhaA among B2 strains was observed in strains with low virulence. Finally, nhaA and nhaAR operon deletions drastically decreased virulence in one B2 strain. This effect of nhaAR deletion appeared to be stronger than deletion of all pathogenicity islands. Thus, a population genetic approach allowed us to identify an operon in the core genome without strong effect in commensalism but with an important role in extra-intestinal virulence, a landmark of the B2 strains.

  19. Structural, mechanical, and electronic properties of TaB2, TaB, IrB2, and IrB: First-principle calculations

    International Nuclear Information System (INIS)

    Zhao Wenjie; Wang Yuanxu

    2009-01-01

    First-principle calculations were performed to investigate the structural, elastic, and electronic properties of TaB 2 , TaB, IrB 2 , and IrB. The calculated equilibrium structural parameters, shear modulus, and Young's modulus of TaB 2 are well consistent with the available experimental data, and TaB 2 with P6/mmm space group has stronger directional bonding between ions than WB 2 , OsB 2 , IrN 2 , and PtN 2 . For TaB 2 , the hexagonal P6/mmm structure is more stable than the orthorhombic Pmmn one, while for IrB 2 the orthorhombic Pmmn structure is the most stable one. The high shear modulus of P6/mmm phase TaB 2 is mainly due to the strong covalent π-bonding of B-hexagon in the (0001) plane. Such a B-hexagon network can strongly resist against an applied [112-bar0] (0001) shear deformation. Correlation between the hardness and the elastic constants of TaB 2 was discussed. The band structure shows that P6/mmm phase TaB 2 and Pmmn phase IrB 2 are both metallic. The calculations show that both TaB and IrB are elastically stable with the hexagonal P6 3 /mmc structure. - Elastic constant c 44 of TaB 2 is calculated to be 235 GPa. This value is exceptionally high, exceeding those of WB 2 , OsB 2 , WB 4 , OsN 2 , IrN 2 , and PtN 2 .

  20. Necrose cutânea induzida por antagonistas da vitamina K Skin necrosis induced by vitamin K antagonists

    Directory of Open Access Journals (Sweden)

    Jose Manoel da Silva Silvestre

    2009-12-01

    Full Text Available Os anticoagulantes orais que atuam através do antagonismo à vitamina K são utilizados na prática clínica há muito tempo, porém ainda há dificuldades no seu manejo e na condução das complicações. Entre as complicações, as mais conhecidas são os transtornos hemorrágicos, mas outras também devem ser reconhecidas, tais como a necrose induzida por varfarina. Esta é uma grave, porém rara complicação, cuja fisiopatologia é ainda obscura e cujas causas são indefinidas. Dentre as possíveis causas, as mais prováveis são a deficiência de proteína C e de proteína S, reações de hipersensibilidade e deficiência de fator VII. Há maior incidência desta complicação entre mulheres de meia-idade, acometendo preferencialmente mamas e glúteos. As medidas mais importantes para o tratamento são: suspensão imediata da droga, uso de heparina não fracionada ou de baixo peso molecular em doses terapêuticas, emprego da vitamina K e, eventualmente, infusão de plasma fresco congelado ou de proteína C ativada recombinante.Oral anticoagulants acting via vitamin K antagonists have long been employed in the clinical practice. However, difficulties related to the management of treatment regimens and complications still persist. Among the complications, bleeding disorders are widely known, but others should also be taken into consideration, such as warfarin-induced skin necrosis. The pathophysiology of this rare but severe complication is still obscure, and its causes remain to be defined. Among possible causes, protein C and protein S deficiency, hypersensitivity reactions and VII factor deficiency are the most probable ones. There is an increased incidence of warfarin-induced skin necrosis among middle-aged women, usually affecting breasts and buttocks. The most important treatment measures are immediate discontinuation of the drug, use of unfractionated or low-molecular-weight heparin at therapeutic doses, use of vitamin K and

  1. Microstructural characterization of LaB6-ZrB2 eutectic composites

    International Nuclear Information System (INIS)

    Wang Shengchang; Wei, W.J.; Zhang Litong

    2003-01-01

    Detail microstructure of LaB 6 -ZrB 2 composites has been characterized by TEM and HRTEM. The directionally solidified ZrB 2 fibers in LaB 6 matrix near LaB 6 -ZrB 2 eutectics present at least three growing relationship systems. In addition to previous report of [001]LaB 6 / [0001]ZrB 2 relationship, [0 anti 11]LaB 6 / [0001]ZrB 2 and [1 anti 20]LaB 6 / [0001]ZrB 2 . were identified. Different with [001]LaB 6 / [0001]ZrB 2 system, the interfaces of [0 anti 11]LaB 6 / [0001]ZrB 2 and [1 anti 20]LaB 6 / [0001]ZrB 2 . show non-coherent and clean interfaces. There is neither glassy phase nor reaction products found at the interfaces (orig.)

  2. The CVD ZrB2 as a selective solar absorber

    Science.gov (United States)

    Randich, E.; Allred, D. D.

    Coatings of ZrB2 and TiB2 for photothermal solar absorber applications were prepared using chemical vapor deposition (CVD) techniques. Oxidation tests suggest a maximum temperature limit for air exposure of 600 K for TiB2 and 800 K for Z4B2. Both materials exhibit innate spectral selectivity with emittance at 375 K ranging from 0.06 to 0.09 and solar absorptance for ZrB2 ranging from 0.67 to 0.77 and solar absorptance for TiB2 ranging from 0.46 to 0.58. ZrB2 has better solar selectivity and more desirable oxidation behavior than TiB2. A 0.071 micrometer antireflection coating of Si3N4 deposited on the ZrB2 coating leads to an increase in absorptance from 0.77 to 0.93, while the emittance remains unchanged.

  3. Beyond the exchange--the future of B2B.

    Science.gov (United States)

    Wise, R; Morrison, D

    2000-01-01

    Using the Internet to facilitate business-to-business commerce promises many benefits, such as dramatic cost reductions and greater access to buyers and sellers. Yet little is known about how B2B e-commerce will evolve. The authors argue that changes in the financial services industry over the past two decades provide important clues. Exchanges, they say, are not the primary source of value in information-intensive markets; value tends to accumulate among a diverse group of specialists that focus on such tasks as packaging, standard setting, arbitrage, and information management. Because scale and liquidity are vitally important to efficient trading, today's exchanges will consolidate into a relatively small set of mega-exchanges. Originators will handle the origination and aggregation of complex transactions before sending them on to mega-exchanges for execution. E-speculators, seeking to capitalize on an abundance of market information, will tend to concentrate where relatively standardized products can be transferred easily among a large group of buyers. In many markets, a handful of independent solution providers with well-known brand names and solid reputations will thrive alongside mega-exchanges. Sell-side asset exchanges will create the networks and provide the tools to allow suppliers to trade orders among themselves, sometimes after initial transactions with customers are made on the mega-exchanges. For many companies, traditional skills in such areas as product development, manufacturing, and marketing may become relatively less important, while the ability to understand and capitalize on market dynamics may become considerably more important.

  4. Thermal Vacuum Integrated System Test at B-2

    Science.gov (United States)

    Kudlac, Maureen T.; Weaver, Harold F.; Cmar, Mark D.

    2012-01-01

    The National Aeronautics and Space Administration (NASA) Glenn Research Center (GRC) Plum Brook Station (PBS) Space Propulsion Research Facility, commonly referred to as B-2, is NASA s third largest thermal vacuum facility. It is the largest designed to store and transfer large quantities of liquid hydrogen and liquid oxygen, and is perfectly suited to support developmental testing of chemical propulsion systems as well as fully integrated stages. The facility is also capable of providing thermal-vacuum simulation services to support testing of large lightweight structures, Cryogenic Fluid Management (CFM) systems, electric propulsion test programs, and other In-Space propulsion programs. A recently completed integrated system test demonstrated the refurbished thermal vacuum capabilities of the facility. The test used the modernized data acquisition and control system to monitor the facility during pump down of the vacuum chamber, operation of the liquid nitrogen heat sink (or cold wall) and the infrared lamp array. A vacuum level of 1.3x10(exp -4)Pa (1x10(exp -6)torr) was achieved. The heat sink provided a uniform temperature environment of approximately 77 K (140deg R) along the entire inner surface of the vacuum chamber. The recently rebuilt and modernized infrared lamp array produced a nominal heat flux of 1.4 kW/sq m at a chamber diameter of 6.7 m (22 ft) and along 11 m (36 ft) of the chamber s cylindrical vertical interior. With the lamp array and heat sink operating simultaneously, the thermal systems produced a heat flux pattern simulating radiation to space on one surface and solar exposure on the other surface. The data acquired matched pretest predictions and demonstrated system functionality.

  5. Microwave surface impedance of MgB2 thin film

    International Nuclear Information System (INIS)

    Jin, B B; Klein, N; Kang, W N; Kim, Hyeong-Jin; Choi, Eun-Mi; Lee, Sung-I K; Dahm, T; Maki, K

    2003-01-01

    The microwave surface impedance Z s = R s + jωμ 0 λ was measured with dielectric resonator techniques for two c-axis-oriented MgB 2 thin films. The temperature dependence of the penetration depth λ measured with a sapphire resonator at 17.93 GHz can be well fitted from 5 K close to T c by the standard BCS integral expression assuming the reduced energy gap Δ(0)/kT c to be as low as 1.13 and 1.03 for the two samples. From these fits the penetration depth at zero temperatures was determined to be 102 nm and 107 nm, respectively. The results clearly indicate the s-wave nature of the order parameter. The temperature dependence of surface resistance R s , measured with a rutile dielectric resonator, shows an exponential behaviour below about T c /2 with a reduced energy gap being consistent with the one determined from the λ data. The R s value at 4.2 K was found to be as low as 19 μΩ at 7.2 GHz, which is comparable with that of a high-quality high-temperature thin film of YBa 2 Cu 3 O 7 . A higher-order mode at 17.9 GHz was employed to determine the frequency f dependence of R s ∝ f n(T) . Our results revealed a decrease of n with increasing temperature ranging from n = 2 below 8 K to n 1 from 13 to 34 K

  6. Folato, vitamina B12 e ferritina sérica e defeitos do tubo neural Folate, vitamin B12, serum ferritin and defects of the neural tube

    Directory of Open Access Journals (Sweden)

    Gizele Thame

    1998-09-01

    Full Text Available Objetivo: verificar os níveis de folatos, vitamina B12 e ferritina em pacientes cujos fetos apresentaram defeitos de tubo neural (DTN. O folato sangüíneo e a vitamina B12 atuam como cofatores para as enzimas envolvidas na biossíntese do DNA. A interrupção deste processo pode impedir o fechamento do tubo neural. A suplementação vitamínica contendo folato pode reduzir as taxas de ocorrência de defeitos de tubo neural, embora exista a preocupação de que esta prevenção possa mascarar a deficiência de vitamina B12. Métodos: dosagens de vitamina B12 e ferritina pelo método de enzimaimunoensaio com micropartículas e a dosagens de ácido fólico pelo método de captura iônica (IMx ABBOTT. Resultados: a porcentagem de gestantes com deficiência de vitamina B12 (níveis séricos Purpose: to determine folate, vitamin B12 and ferritin levels in patients whose fetuses presented neural-tube defects (NTD. Blood folate and vitamin B12 act as cofactors of enzymes involved in DNA biosynthesis. Interruption of this process may block neural-tube closing. Vitamin supplementation with folate may reduce occurrence rates and recurrence of NTD, although there is concern about the fact that this prevention may mask vitamin B12 deficiency. Methods: vitamin B12 and ferritin determinations by enzyme immunoassay with microparticles and folic acid determination using the ion capture method (IMx ABBOTT. Results: the percentage of pregnant women with vitamin B12 deficirncy (serum levels < 150 pg/ml was 11.8%. There was no case of folate deficiency (serum levels < 3.0 ng/ml and prevalence of pregnant women with iron store deficiency was 47.1% (serum levels < ng/mg. Conclusions: occording to the results obtained in this study (prevalence of 11.8% of vitamin B12 and 0% of folate deficient pregnant women we suggest that supplementation should be administered after serum vitamin B12 determination.

  7. Experiences and Future Expectations towards Online Courses--An Empirical Study of the B2C-and B2B-Segments

    Science.gov (United States)

    Krämer, Andreas; Böhrs, Sandra

    2016-01-01

    This article explores the future potential for the development of online courses. The findings are based on an empirical study with 3 sample groups: (1) B2C segment in Germany, (2) B2C segment in the United States, and (3) B2B segment (international). In the first step the status quo of the use of e-learning in general and online courses in…

  8. Vitamin B12 in metformin-treated diabetic patients: a cross-sectional study in Brazil Vitamina B12 em pacientes diabéticos usando metformina: um corte transversal no Brasil

    Directory of Open Access Journals (Sweden)

    Monique Nervo

    2011-02-01

    Full Text Available OBJECTIVE: The objective of this study was to evaluate the presence of vitamin B12 deficiency and the factors associated with serum vitamin B12 levels in a sample of metformin-treated Brazilian diabetic patients. METHOD: Cross-sectional study. RESULTS: 144 patients were included. Serum vitamin B12 levels were low (OBJETIVO: O objetivo deste estudo foi avaliar a prevalência de deficiência de vitamina B12 em pacientes diabéticos brasileiros tratados com metformina e os fatores associados aos níveis séricos de vitamina B12. MÉTODO: Corte transversal. RESULTADOS: 144 pacientes foram incluídos. Os níveis séricos de vitamina B12 foram baixos (< 125 pmol/L em 10 pacientes (6,9% e possivelmente baixos (125 - 250pmol/L em 53 pacientes (36,8%. Os níveis séricos de vitamina B12 foram associados negativamente à idade (B = -3,17; β = -0,171; p = 0,037 e à duração do uso de metformina (B = -33,36; β= -0,161; p = 0,048 e positivamente com a ingestão estimada de vitamina B12 (B = 67,96; β = 0,249; p = 0,002. CONCLUSÃO: Estes resultados sugerem alta prevalência de deficiência de vitamina B12 em pacientes diabéticos tratados com metformina. Pacientes mais velhos, em uso de metformina há muito tempo e com ingestão baixa de vitamina B12 estão provavelmente mais predispostos a essa deficiência.

  9. Study on Logistics Distribution Centers for B2C Online Shopping%B2C网购物流配送中心研究

    Institute of Scientific and Technical Information of China (English)

    侯凌燕; 尹军琪

    2011-01-01

    分析了我国B2C网购物流配送的现状,对其特点和难点作了分析,并提出了相应的B2C网购物流配送中心设计解决方案.%The paper analyzes the current status of the logistics and distribution operations for B2C online shopping in China, analyzes its characteristics and existing issues, and puts forth solutions for the design of logistics and distribution centers for B2C online shopping.

  10. Clinical relevance of ErbB-2/HER2 nuclear expression in breast cancer

    International Nuclear Information System (INIS)

    Schillaci, Roxana; Charreau, Eduardo H; Maronna, Esteban; Roa, Juan C; Elizalde, Patricia V; Guzmán, Pablo; Cayrol, Florencia; Beguelin, Wendy; Díaz Flaqué, María C; Proietti, Cecilia J; Pineda, Viviana; Palazzi, Jorge; Frahm, Isabel

    2012-01-01

    The biological relevance of nuclear ErbB-2/HER2 (NuclErbB-2) presence in breast tumors remains unexplored. In this study we assessed the clinical significance of ErbB-2 nuclear localization in primary invasive breast cancer. The reporting recommendations for tumor marker prognostic studies (REMARK) guidelines were used as reference. Tissue microarrays from a cohort of 273 primary invasive breast carcinomas from women living in Chile, a Latin American country, were examined for membrane (MembErbB-2) and NuclErbB-2 expression by an immunofluorescence (IF) protocol we developed. ErbB-2 expression was also evaluated by immunohistochemistry (IHC) with a series of antibodies. Correlation between NuclErbB-2 and MembErbB-2, and between NuclErbB-2 and clinicopathological characteristics of tumors was studied. The prognostic value of NuclErbB-2 in overall survival (OS) was evaluated using Kaplan-Meier method, and Cox model was used to explore NuclErbB-2 as independent prognostic factor for OS. The IF protocol we developed showed significantly higher sensitivity for detection of NuclErbB-2 than IHC procedures, while its specificity and sensitivity to detect MembErbB-2 were comparable to those of IHC procedures. We found 33.6% NuclErbB-2 positivity, 14.2% MembErbB-2 overexpression by IF, and 13.0% MembErbB-2 prevalence by IHC in our cohort. We identified NuclErbB-2 positivity as a significant independent predictor of worse OS in patients with MembErbB-2 overexpression. NuclErbB-2 was also a biomarker of lower OS in tumors that overexpress MembErbB-2 and lack steroid hormone receptors. We revealed a novel role for NuclErbB-2 as an independent prognostic factor of poor clinical outcome in MembErbB-2-positive breast tumors. Our work indicates that patients presenting NuclErbB-2 may need new therapeutic strategies involving specific blockage of ErbB-2 nuclear migration

  11. Clinical relevance of ErbB-2/HER2 nuclear expression in breast cancer

    Directory of Open Access Journals (Sweden)

    Schillaci Roxana

    2012-02-01

    Full Text Available Abstract Background The biological relevance of nuclear ErbB-2/HER2 (NuclErbB-2 presence in breast tumors remains unexplored. In this study we assessed the clinical significance of ErbB-2 nuclear localization in primary invasive breast cancer. The reporting recommendations for tumor marker prognostic studies (REMARK guidelines were used as reference. Methods Tissue microarrays from a cohort of 273 primary invasive breast carcinomas from women living in Chile, a Latin American country, were examined for membrane (MembErbB-2 and NuclErbB-2 expression by an immunofluorescence (IF protocol we developed. ErbB-2 expression was also evaluated by immunohistochemistry (IHC with a series of antibodies. Correlation between NuclErbB-2 and MembErbB-2, and between NuclErbB-2 and clinicopathological characteristics of tumors was studied. The prognostic value of NuclErbB-2 in overall survival (OS was evaluated using Kaplan-Meier method, and Cox model was used to explore NuclErbB-2 as independent prognostic factor for OS. Results The IF protocol we developed showed significantly higher sensitivity for detection of NuclErbB-2 than IHC procedures, while its specificity and sensitivity to detect MembErbB-2 were comparable to those of IHC procedures. We found 33.6% NuclErbB-2 positivity, 14.2% MembErbB-2 overexpression by IF, and 13.0% MembErbB-2 prevalence by IHC in our cohort. We identified NuclErbB-2 positivity as a significant independent predictor of worse OS in patients with MembErbB-2 overexpression. NuclErbB-2 was also a biomarker of lower OS in tumors that overexpress MembErbB-2 and lack steroid hormone receptors. Conclusions We revealed a novel role for NuclErbB-2 as an independent prognostic factor of poor clinical outcome in MembErbB-2-positive breast tumors. Our work indicates that patients presenting NuclErbB-2 may need new therapeutic strategies involving specific blockage of ErbB-2 nuclear migration.

  12. Seguridad alimentaria, crecimiento y niveles de vitamina A, hemoglobina y zinc en ninos preescolares del nordeste de Brasil

    Directory of Open Access Journals (Sweden)

    Dixis Figueroa Pedraza

    2014-02-01

    Full Text Available El presente estudio buscó analizar la asociación entre la (inseguridad alimentaria y el estado nutricional de niños preescolares asistidos en jardines infantiles. La seguridad alimentaria fue evaluada a través de la Escala Brasileña de Inseguridad Alimentaria (EBIA. El estado nutricional se evaluó a través del peso/edad, talla/edad, hemoglobina, retinol sérico y zinc sérico. Fueron encontradas prevalencias de déficit de estatura (6,2%, déficit de peso/edad (2,1%, deficiencia de vitamina A (24,4%, anemia (15,5% y deficiencia de zinc (15,0%. La inseguridad alimentaria familiar fue caracterizada en 64,2% de las familias predominando la forma leve (32,6%. El estudio concluye que la inseguridad alimentaria estimada por la EBIA no se asoció a los Escore-z de crecimiento ni a las concentraciones de retinol sérico, hemoglobina y zinc sérico.

  13. Alloy Design Data Generated for B2-Ordered Compounds

    Science.gov (United States)

    Noebe, Ronald D.; Bozzolo, Guillermo; Abel, Phillip B.

    2003-01-01

    Developing alloys based on ordered compounds is significantly more complicated than developing designs based on disordered materials. In ordered compounds, the major constituent elements reside on particular sublattices. Therefore, the addition of a ternary element to a binary-ordered compound is complicated by the manner in which the ternary addition is made (at the expense of which binary component). When ternary additions are substituted for the wrong constituent, the physical and mechanical properties usually degrade. In some cases the resulting degradation in properties can be quite severe. For example, adding alloying additions to NiAl in the wrong combination (i.e., alloying additions that prefer the Al sublattice but are added at the expense of Ni) will severely embrittle the alloy to the point that it can literally fall apart during processing on cooling from the molten state. Consequently, alloying additions that strongly prefer one sublattice over another should always be added at the expense of that component during alloy development. Elements that have a very weak preference for a sublattice can usually be safely added at the expense of either element and will accommodate any deviation from stoichiometry by filling in for the deficient component. Unfortunately, this type of information is not known beforehand for most ordered systems. Therefore, a computational survey study, using a recently developed quantum approximate method, was undertaken at the NASA Glenn Research Center to determine the preferred site occupancy of ternary alloying additions to 12 different B2-ordered compounds including NiAl, FeAl, CoAl, CoFe, CoHf, CoTi, FeTi, RuAl, RuSi, RuHf, RuTi, and RuZr. Some of these compounds are potential high temperature structural alloys; others are used in thin-film magnetic and other electronic applications. The results are summarized. The italicized elements represent the previous sum total alloying information known and verify the computational

  14. Tumor Suppressor Activity of the EphB2 Receptor in Prostate Cancer

    National Research Council Canada - National Science Library

    Pasquale, Elena B

    2007-01-01

    Mutations have been recently identified in the EphB2 receptor gene in prostate cancer suggesting that EphB2, a member of the large Eph receptor tyrosine kinase family, is a tumor suppressor in prostate cancer...

  15. Tumor Suppressor Activity of the EphB2 Receptor in Prostate Cancer

    National Research Council Canada - National Science Library

    Pasquale, Elena B

    2006-01-01

    Mutations have been recently identified in the EphB2 receptor gene in prostate cancer suggesting that EphB2, a member of the large Eph receptor tyrosine kinase family, is a tumor suppressor in prostate cancer...

  16. Li2b2-Façade: Simulation of i2b2 Data Warehouse Server and Client for Interaction with Other Systems.

    Science.gov (United States)

    Majeed, Raphael W; Xu, Tingyan; Stöhr, Mark R; Röhrig, Rainer

    2017-01-01

    Since its release in 2004, the i2b2 data warehouse software has become a valuable tool for clinical researchers. Physicians can use its browser-based query frontend intuitively without additional training or reading through documentation. While the i2b2 software describes it's API as "REST", it is neither stateless nor does it follow the common guidelines for RESTful APIs. Thus, interfacing other software with i2b2's custom RPC-style XML-API is a very cumbersome process. To overcome these issues, we developed a lightweight software abstraction layer "lightweight i2b2 façade" (li2b2-façade).

  17. 17 CFR 240.13b2-1 - Falsification of accounting records.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Falsification of accounting records. 240.13b2-1 Section 240.13b2-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Required Reports § 240.13b2-1 Falsification of accounting records. No person shall directly or indirectly...

  18. 26 CFR 1.669(b)-2 - Manner of exercising election.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Manner of exercising election. 1.669(b)-2 Section 1.669(b)-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED... Years Beginning Before January 1, 1969 § 1.669(b)-2 Manner of exercising election. (a) By whom election...

  19. Managing Innovation Through Social Media in B2B SME-Context

    DEFF Research Database (Denmark)

    Lutz, Salla; Madsen, Svend Ole; Brink, Tove

    2015-01-01

    This paper shed light on how social media application can enhance innovation management in SME B2B context. Our study employs a qualitative case study approach with four B2B SMEs for in-depth research in the period from October 2013 to October 2014. The B2B SME managers aim for open business mode...

  20. Lectin receptor kinase LecRK-b2 localizes to plasma membrane and ...

    African Journals Online (AJOL)

    -b2, has been characterized. Confocal microscopy images showed that the LecRK-b2-GFP fusion protein is localized to plasma membrane. The results of yeast 2 hybrid showed that lectin domain of LecRK-b2 had selfinteraction, while the ...

  1. Nd: YAG laser treatment of aluminium-TiB2 coated: optimization of corrosion properties

    CSIR Research Space (South Africa)

    Popoola, PAI

    2011-06-01

    Full Text Available . Eutectics of TiB2/Al and TiB2/Ti were observed. The results of the tests indicate that TiB2 reinforcement does not give significant increase in microhardness of aluminium. The corrosion resistance of a single laser trackline MMC in a 3.65 % NaCl solution...

  2. 17 CFR 240.15b2-2 - Inspection of newly registered brokers and dealers.

    Science.gov (United States)

    2010-04-01

    ... brokers and dealers. 240.15b2-2 Section 240.15b2-2 Commodity and Securities Exchanges SECURITIES AND... Regulations Under the Securities Exchange Act of 1934 Registration of Brokers and Dealers § 240.15b2-2 Inspection of newly registered brokers and dealers. (a) Definition. For the purpose of this section the term...

  3. A new approach to MgB2 superconducting magnet fabrication

    International Nuclear Information System (INIS)

    Miyazoe, A; Ando, T; Wada, H; Abe, H; Hirota, N; Sekino, M

    2008-01-01

    Fabrication of MgB 2 -based superconducting magnets has been attempted by a new approach using film coated on symmetric tubes. Superconducting MgB 2 films have been prepared on iron substrates by electroplating in molten electrolytes. The critical current (I c ) of the MgB 2 electroplating films at 4.2 K and at self-field was 15 A on the basis of 1 μV/cm of I c criterion. A model calculation has shown that MgB 2 -based superconducting magnets based on MgB 2 electroplating films have the potential to generate magnetic fields over 0.5 T

  4. Microstructure and mechanical properties investigation of in situ TiB2 and ZrB2 reinforced Al-4Cu composites

    Science.gov (United States)

    Lutfi Anis, Ahmad; Ramli, Rosmamuhammadani; Darham, Widyani; Zakaria, Azlan; Talari, Mahesh Kumar

    2016-02-01

    Conventional Al-Cu alloys exhibit coarse grain structure leading to inferior mechanical properties in as-cast condition. Expensive thermo-mechanical treatments are needed to improve microstructure and corresponding mechanical properties. In situ Al-based composites were developed to improve mechanical properties by dispersion strengthening and grain refinement obtained by the presence of particulates in the melt during solidification. In this work Al-4Cu - 3TiB2 and Al-4Cu-3ZrB2 in situ composites were prepared by liquid casting method. XRD, electron microscopy and mechanical tests were performed on suitably sectioned and metallographically prepared surfaces to investigate the phase distribution, hardness and tensile properties. It was found that the reinforcement particles were segregated along the grain boundaries of Al dendrites. Tensile fracture morphology for both Al-4Cu - 3TiB2 and Al-4Cu-3ZrB2 were analyzed and compared to determine the fracture propagation mechanism in the composites. Al-4Cu-3ZrB2 in situ composites displayed higher strength and hardness compared to Al-4Cu-3TiB2 which could be ascribed to the stronger interfacial bonding between the Al dendrites and ZrB2 particulates as evidenced from fractographs.

  5. Transport properties and exponential n-values of Fe/MgB2 tapes with various MgB2 particle sizes

    International Nuclear Information System (INIS)

    Lezza, P.; Abaecherli, V.; Clayton, N.; Senatore, C.; Uglietti, D.; Suo, H.L.; Fluekiger, R.

    2004-01-01

    Fe/MgB 2 tapes have been prepared starting with pre-reacted binary MgB 2 powders. As shown by resistive and inductive measurements, the reduction of particle size to a few microns by ball milling has little influence on B c2 , while the superconducting properties of the individual MgB 2 grains are essentially unchanged. Reducing the particle size causes an enhancement of B irr from 14 to 16 T, while J c has considerably increased at high fields, its slope J c (B) being reduced. At 4.2 K, values of 5.3 x 10 4 and 1.2 x 10 3 A/cm 2 were measured at 3.5 and 10 T, respectively, suggesting a dominant role of the conditions at the grain interfaces. A systematic variation of these conditions at the interfaces is undertaken in order to determine the limit of transport properties for Fe/MgB 2 tapes. The addition of 5% Mg to MgB 2 powder was found to affect neither J c nor B c2 . For the tapes with the highest J c values, very high exponential n factors were measured: n=148, 89 and 17 at 3.5, 5 and 10 T, respectively and measurements of critical current versus applied strain have been performed. The mechanism leading to high transport critical current densities of filamentary Fe/MgB 2 tapes based on MgB 2 particles is discussed

  6. Desempenho produtivo de tambacus alimentados com dietas suplementadas com vitamina E Productive performance of tambacus fed diets supplemented with vitamin E

    Directory of Open Access Journals (Sweden)

    Antônio Carlos Silveira Gonçalves

    2010-09-01

    Full Text Available O objetivo deste trabalho foi avaliar os efeitos da suplementação da dieta de tambacus com concentrações de vitamina E sobre variáveis de desempenho e hematológicas, bem como determinar a relação da atividade da glutationa peroxidase com a inclusão de vitamina E e selênio na dieta. Foram utilizados 250 juvenis de tambacu, divididos em 25 aquários. A dieta basal constituiu-se de ração peletizada com 32% de proteína bruta e 3.300 kcal kg-1 de energia digestível, e inclusão de 0,40 mg kg-1 de Se. As dietas-teste - isoprotéicas e isoenergéticas - foram compostas da dieta basal com diferentes concentrações de vitamina E (0, 100, 200, 300, 400 mg kg-1, em delineamento inteiramente ao acaso, com cinco tratamentos e cinco repetições. Não foi observado efeito significativo da suplementação com vitamina E sobre o comprimento total, volume corpuscular médio, concentração de hemoglobina corpuscular média e número de eritrócitos, nem sobre a atividade da glutationa peroxidase. Peso final e conversão alimentar aparente, no entanto, sofreram efeito dos tratamentos suplementados. O teor de 400 mg kg-1 de vitamina E melhorou o comprimento padrão e ganho de peso. A suplementação da dieta com vitamina E resulta em melhor desempenho produtivo de tambacus.The objective of this work was to evaluate the effects of tambacu vitamin E dietary supplementation on performance and hematological variables, and determine the relationship of glutathione peroxidase activity with vitamin E and selenium suplementation. Two hundred and fifty juvenile tambacus were used, divided into 25 aquaria. The basal diet was pelleted with 32% of crude protein and 3,300 kcal kg-1 of digestible energy, with 0.40 mg kg-1 Se. Test diets - isoproteic and isocaloric - were composed of the basal diet with increasing vitamin E concentrations (0, 100, 200, 300, 400 mg kg-1, in a completely randomized design, with five treatments and five replications. No significant

  7. O carvedilol potencializa o efeito antioxidante das vitaminas E e C na cardiopatia chagásica crônica

    Directory of Open Access Journals (Sweden)

    Patrícia Budni

    2013-10-01

    Full Text Available FUNDAMENTO: A doença de Chagas continua a ser uma importante doença endêmica no país, sendo o acometimento cardíaco a sua manifestação mais grave. OBJETIVO: Verificar se o uso concomitante de carvedilol potencializará o efeito antioxidante das vitaminas E e C na atenuação do estresse oxidativo sistêmico na cardiopatia chagásica crônica. MÉTODOS: Foram estudados 42 pacientes com cardiopatia chagásica, agrupados de acordo com a classificação modificada de Los Andes, em quatro grupos: 10 pacientes no grupo IA (eletrocardiograma e ecocardiograma normais: sem envolvimento do coração, 20 pacientes do grupo IB (eletrocardiograma normal e ecocardiograma anormal: ligeiro envolvimento cardíaco, oito pacientes no grupo II (eletrocardiograma e ecocardiograma anormais, sem insuficiência cardíaca: moderado envolvimento cardíaco e quatro pacientes no grupo III (eletrocardiograma e ecocardiograma anormais com insuficiência cardíaca: grave envolvimento cardíaco. Os marcadores de estresse oxidativo foram medidos no sangue, antes e após um período de seis meses de tratamento com carvedilol e após seis meses de terapia combinada com vitaminas E e C. Os marcadores foram: atividades da superóxido dismutase, catalase, glutationa peroxidase, glutationa S-transferase e redutase, mieloperoxidase e adenosina deaminase, e os níveis de glutationa reduzida, de espécies reativas do ácido tiobarbitúrico, proteína carbonilada, vitamina E e óxido nítrico. RESULTADOS: Após o tratamento com carvedilol, todos os grupos apresentaram diminuições significativas dos níveis de proteína carbonilada e glutationa reduzida, enquanto os níveis de óxido nítrico e atividade da adenosina aumentaram significativamente apenas no grupo menos acometido (IA. Além disso, a maioria das enzimas antioxidantes mostrou atividades diminuídas nos grupos menos acometidos (IA e IB. Com a adição das vitaminas ao carvedilol houve diminuição dos danos em prote

  8. Ball-milling and AlB2 addition effects on the hydrogen sorption properties of the CaH2 + MgB2 system

    International Nuclear Information System (INIS)

    Schiavo, B.; Girella, A.; Agresti, F.; Capurso, G.; Milanese, C.

    2011-01-01

    Research highlights: → Calcium hydride + magnesium-aluminum borides as candidates for hydrogen storage. → Long time ball milling improves hydrogen sorption kinetics of the CaH 2 +MgB 2 system. → Coexistence of MgB 2 and AlB 2 does not improve hydrogen sorption performances. → Total substitution of MgB 2 with AlB 2 improves the system kinetics and reversibility. → Below 400 deg. C almost the full hydrogen capacity of the CaH 2 + AlB 2 system is reached. - Abstract: Among the borohydrides proposed for solid state hydrogen storage, Ca(BH 4 ) 2 is particularly interesting because of its favourable thermodynamics and relatively cheap price. Composite systems, where other species are present in addition to the borohydride, show some advantages in hydrogen sorption properties with respect to the borohydrides alone, despite a reduction of the theoretical storage capacity. We have investigated the milling time influence on the sorption properties of the CaH 2 + MgB 2 system from which Ca(BH 4 ) 2 and MgH 2 can be synthesized by hydrogen absorption process. Manometric and calorimetric measurements showed better kinetics for long time milled samples. We found that the total substitution of MgB 2 with AlB 2 in the starting material can improve the sorption properties significantly, while the co-existence of both magnesium and aluminum borides in the starting mixture did not cause any improvement. Rietveld refinements of the X-ray powder diffraction spectra were used to confirm the hypothesized reactions.

  9. Efecto del Escaldado sobre el Color y Cinética de Degradación Térmica de la Vitamina C de la Pulpa de Mango de Hilacha (Mangífera indica var magdalena river)

    OpenAIRE

    Mendoza-Corvis, Fernando A; Hernández, Elvis J; Ruiz, Luis E

    2015-01-01

    El objetivo de esta investigación fue determinar la cinética de degradación de la vitamina C y el efecto del escaldado sobre el color de la pulpa de mango de hilacha edulcorada con 20% de sacarosa. La determinación de la vitamina C se realizó empleando el método 2.6 Diclorofenol indofenol y el color mediante Colorímetro HunterLab. Los parámetros cinéticos se determinaron por el método de los mínimos cuadrados y el análisis estadístico mediante el software Desing expert 6.0. La vitamina C sigu...

  10. Administración oral de preparado parenteral de vitamina K en anticoagulación excesiva por warfarina

    Directory of Open Access Journals (Sweden)

    Yoleima Lozada

    2012-04-01

    Full Text Available La warfarina es frecuentemente usada en la terapia anticoagulante actual, su acción debe ser monitorizada usando el tiempo de protrombina expresado como International Normalized Ratio (INR; cuando se excede el rango de seguridad se puede administrar vitamina K (Vit-K, preferentemente por vía oral. Dicha presentación no está disponible en Venezuela. Se realizó un ensayo clínico, doble ciego, donde a 20 pacientes, edad 18-60 años, sin sangrado e INR inicial de 6 a 10 inclusive; les fue suspendida la warfarina e inmediatamente agrupados al azar a recibir dosis única de Vit-K (oral 1.25mg de Vit-K fraccionada de una presentación parenteral o placebo. El punto final primario, INR < 3.5 a las 24 horas de administrar la dosis, se alcanzó en 70% de los pacientes en Vit-K y 20% en placebo. La reducción absoluta del riesgo y su intervalo de confianza de 95%: RAR (IC95% = 50% (14.4 a 85.6 ρ = 0.028; NNT (IC95% = 2(1.3 a 6.9; no se registraron eventos adversos, ni INR < 2 luego de 24 horas de tratamiento. Los resultados obtenidos son consistentes con estudios donde se administró Vit-K en preparación específica para vía oral. Así la Vit-K en presentación parenteral, administrada por vía oral, es más efectiva y segura que simplemente detener la administración de warfarina para revertir la excesiva anticoagulación, en donde no exista presentación específica oral de Vit-K o ésta sea muy costosa.

  11. Observaciones histopatologicas de juveniles penaeus vannamei sometidos a dietas artificiales con diferentes concentraciones de una sal de ácido ascórbico (vitamina c)

    OpenAIRE

    Vera Muñoz, L.

    1995-01-01

    Observaciones histopatologicas de juveniles Penaeus Vannamei sometidos a dietas artificiales con diferentes concentraciones de una sal de ácido ascórbico (vitamina C) Se realizaron análisis histológicos y comprobación mediante métodos histoquímicos de la presencia de melanina, a juveniles Penaeus vannamei sometidos a cinco dietas experimentales con diferentes concentraciones de una sal de L-Ascorbato-2-Fosfato de Mg (APM) usada como fuente de ácido ascórbico (AA).

  12. Deficiencia de Vitamina A y Estado Nutricional Antropométrico en niños MarginalesUrbanos y Rurales en el Estado Zulia, Venezuela

    OpenAIRE

    Amaya-Castellanos, Daisy; Viloria-Castejón, Haydée; Ortega, Pablo; Gómez, Gisela; Urrieta, Jesús R; Lobo, Pablo; Estévez, Jesús

    2002-01-01

    El presente estudio transversal fue realizado para estimar la prevalencia de deficiencia de vitamina A (DVA) y desnutrición proteico-energética en una población infantil (24 a 85 meses) de tres barrios marginales urbanos de Maracaibo Estado Zulia, Venezuela (n=173) y de una zona rural (n=34), vecina a Maracaibo, por medio del análisis del retinol sérico y mediciones antropométricas, aplicando puntuación Z a los indicadores Talla//Edad (ZT//E); Peso//Edad (ZP//E) y Peso//Talla (ZP//T), compara...

  13. Seguridad alimentaria, crecimiento y niveles de vitamina A, hemoglobina y zinc en niños preescolares del nordeste de Brasil

    OpenAIRE

    Pedraza,Dixis Figueroa; Queiroz,Daiane de; Paiva,Adriana de Azevedo; Cunha,Maria Auxiliadora Lins da; Lima,Zilka Nanes

    2014-01-01

    El presente estudio buscó analizar la asociación entre la (in)seguridad alimentaria y el estado nutricional de niños preescolares asistidos en jardines infantiles. La seguridad alimentaria fue evaluada a través de la Escala Brasileña de Inseguridad Alimentaria (EBIA). El estado nutricional se evaluó a través del peso/edad, talla/edad, hemoglobina, retinol sérico y zinc sérico. Fueron encontradas prevalencias de déficit de estatura (6,2%), déficit de peso/edad (2,1%), deficiencia de vitamina A...

  14. Estabilidade térmica das vitaminas A e E em rações e premixes vitamínicos para camarões

    OpenAIRE

    Prado,João Paulo de Sousa; Cavalheiro,José Marcelino Oliveira; Silva,Fernanda Vanessa Gomes da; Queiroga Neto,Vicente; Bora,Pushkar Singh; Cavalheiro,Thiago Brandão

    2011-01-01

    O trabalho teve como objetivo avaliar a estabilidade térmica das vitaminas A e E em diferentes rações e premixes vitamínicos utilizados na carcinicultura. Foram utilizadas no experimento três rações comerciais peletilizadas e desintegradas em diferentes diâmetros e dois premixes vitamínicos. As amostras de cada dieta e de premixes foram acondicionadas em recipientes plásticos e armazenadas nas seguintes condições: ambiente refrigerado (6°C±2°C), ambiente climatizado (20°C&p...

  15. Cinética de degradación térmica de vitamina C en frutos de guayaba (Psidium guajava L.)

    OpenAIRE

    Ordóñez-Santos, Luis Eduardo; Ospina Portilla, María Alejandra; Rodríguez Rodríguez, Diana Ximena

    2013-01-01

    Resumen Introducción. La vitamina C es un micronutriente esencial en la alimentación del hombre al estar asociada a la síntesis de diferentes moléculas de importancia en la salud humana, y a su efecto antioxidante relacionado con la reducción del riesgo de contraer diferentes tipos de cáncer, como lo evidencian diferentes estudios epidemiológicos. Su concentración final es considerada como indicador de calidad nutricional durante el procesamiento y almacenamiento de los alimentos. Objetivo. E...

  16. Cinética de la degradación de la vitamina c en el jugo concentrado y congelado de maracuyá

    OpenAIRE

    Castillo Soto, Priscila; Miranda Sanchez, Luis

    2009-01-01

    La presente tesis tiene como objetivo determinar si las pérdidas de Vitamina C durante la elaboración industrial de jugo concentrado y congelado de maracuyá, sobrepasan o no los valores teóricos obtenidos mediante modelos matemáticos y de ser así las recomendaciones necesarias a fin de mantener la calidad nutricional de este importante producto de exportación. Para lo cual determinaré los parámetros de estudio (temperatura y tiempo) y el número de muestras necesarias para establecer la cinét...

  17. La influencia del calcio, vitamina D y magnesio en la osteoporosis y sus efectos en la densidad ósea: revisión sistemática

    OpenAIRE

    Torralbo Ruiz, Pablo

    2014-01-01

    RESUMEN: Objetivo: conocer la influencia de la nutrición (calcio, vitamina D y magnesio) en la prevención y el tratamiento de la osteoporosis en mayores de 18 años, y cómo afecta a la densidad mineral ósea (DMO). Métodos: Se realizó la búsqueda sistemática en las bases de datos PubMed, PEDro y Medline en busca de ensayos controlados aleatorizados desde el año 2009 hasta julio de 2014. Los criterios de inclusión fueron: sujetos mayores de 18 años, sometidos a intervenciones nutricionales...

  18. Adición de vitaminas y minerales a harinas de maíz y de trigo en México

    OpenAIRE

    Rosado Jorge L.; Camacho-Solís Rafael; Bourges Héctor

    1999-01-01

    En México la deficiencia marginal de algunas vitaminas y minerales afecta la salud y la funcionalidad de un número elevado de mexicanos, por lo que la Secretaría de Salud ha iniciado un programa para promover la adición de nutrimentos a las harinas de trigo y de maíz que se procesan industrialmente. El presente documento expone las bases científicas y tecnológicas para dicha adición. El objetivo primordial es restaurar los nutrimentos que se pierden durante el proceso de obtención de las hari...

  19. Contenido de vitamina C en frutos de camu camu Myrciaria dubia (H.B.K Mc Vaugh, en cuatro estados de maduración, procedentes de la Colección de Germoplasma del INIA Loreto, Perú

    Directory of Open Access Journals (Sweden)

    Sixto Imán Correa

    2011-01-01

    Full Text Available El objetivo del presente trabajo, fue determinar el contenido de vitamina C en diferentes partes d el fruto; pulpa, cáscara y pulpa más cáscara, en cuatro estados de maduración: verde, pintón, maduro y sobremaduro. Los frutos fueron obtenidos de la Colección de Germoplasma de la Estación Experimental Agraria San Roque del INIA Loreto, Perú. La técnica u tilizada para la determinación de contenido de vitamina C fue Cromatografía Líquida de Alta Eficiencia (HPLC con columna de fase reversa. Los resultados indican que los mayores contenidos de vitamina C se encuentran en la cáscara del fruto en estados de m aduración sobremaduro y maduro. E l contenido de vitamina C según estados de maduración se ajustan a una curva de regresión cúbica, tanto para pulpa, cáscara y pulpa más cáscara con 87%, 90% y 98 % de efectividad; respectivamente. Cuando se pasa de un estad o de maduración a otro, el contenido de vitamina C se incrementa en 515.43 mg en cada 100 g de muestra de cáscara. Los resultados obtenidos indican que e l camu camu es una fuente potencial de vitamina C, concentrada principalmente en la cáscara del fruto.

  20. First-principles studies for the stability of a graphene-like boron layer on CrB2(0001) and MoB2(0001)

    International Nuclear Information System (INIS)

    Qin Na; Liu Shiyu; Li Zhen; Zhao Hui; Wang Sanwu

    2011-01-01

    With extensive first-principles density-functional-theory calculations, we investigate the stability and the atomic and electronic structures of the CrB 2 (0001) and MoB 2 (0001) surfaces, each with two different terminations. It is found that the boron-terminated surface is energetically more favorable over the wide range of thermodynamically allowed chemical potentials than the metal-terminated surface for both CrB 2 (0001) and MoB 2 (0001), suggesting a stable layer of graphene-like boron on the surfaces. Our results also show the similarities and the differences in relaxation and in bonding characteristics between the boron-terminated and metal-terminated surfaces.

  1. Nuevas estrategias sintéticas para la obtención de análogos de la vitamina D, con potencial actividad biólógica

    OpenAIRE

    Martinez Dominguez, Andrea

    2017-01-01

    Las funciones que realiza la vitamina D3 pueden tener lugar a través de la interacción con su receptor nuclear (respuestas genómicas) o con un receptor de membrana (respuestas no genómicas). Los estudios realizados hasta la fecha no han aclarado el mecanismo por el que transcurren las funciones no genómicas. Sin embargo, existe un conocimiento mayor de aquellas actividades que tienen lugar a través del receptor de la vitamina D (VDR) y esto ha servido como base para varias apli...

  2. Análise da vitamina C sérica e ingerida e estresse oxidativo em crianças e adolescentes infectados pelo vírus da imunodeficiência humana

    Directory of Open Access Journals (Sweden)

    Karoline Faria de Oliveira

    2011-12-01

    Full Text Available OBJETIVOS: Verificar adequação do consumo de vitamina C em crianças e adolescentes infectados pelo vírus da imunodeficiência humana (HIV, avaliar níveis séricos da vitamina e indicadores de estresse oxidativo, comparar ao grupo não infectado, correlacionar a vitamina sérica ao estresse oxidativo e associá-los segundo os valores de referência. MÉTODOS: Estudo seccional transversal comparativo. Dois grupos com 27 crianças e adolescentes cada, de 3 a 19 anos, sendo G1 infectados pelo HIV por transmissão vertical atendidos em ambulatório regional e G2 indivíduos convidados sem histórico de infecção pelo HIV. Foram pareados por sexo, idade e condição socioeconômica. Avaliou-se: antropometria (índice de massa corporal para idade, ingestão e consumo do micronutriente, análise sérica da vitamina C, proteína C reativa e albumina. RESULTADOS: Idade média encontrada de 12 anos, prevalência do sexo feminino (17 - 63% e da classe econômica C (27 - 50%. Diagnóstico nutricional prevalente foi eutrofia em 20 (74,1% em G1 e 21 (77,8% em G2. O consumo de vitamina C foi significativamente maior em G1 (p = 0,006; t = 2,987 pelo método recordatório 24 horas. Houve diferença significativa da dosagem sérica de vitamina C, sendo menor em G1 (p = 0,000; t = -7,309. Em relação ao estresse oxidativo, os valores da proteína C reativa em G1 foram significativamente maiores (p = 0,007; t = 2,958. Não houve relação entre deficiência da vitamina, proteína C reativa e albumina. CONCLUSÃO: Os resultados encontrados mostram que indivíduos infectados pelo HIV apresentam baixos valores da vitamina C, não relacionados à alimentação, uma vez que o consumo desse micronutriente foi superior ao grupo comparativo, que não apresentou essa depleção. Existem peculiaridades nos indivíduos infectados que aumentam o estresse oxidativo, evidenciado pelo aumento da proteína C reativa.

  3. Contenido de vitamina C en frutos de camu camu Myrciaria dubia (H.B.K) Mc Vaugh, en cuatro estados de maduración, procedentes de la Colección de Germoplasma del INIA Loreto, Perú

    OpenAIRE

    Sixto Imán Correa; Luz Bravo Zamudio; Víctor Sotero Solís; Carlos Oliva Cruz

    2011-01-01

    El objetivo del presente trabajo, fue determinar el contenido de vitamina C en diferentes partes d el fruto; pulpa, cáscara y pulpa más cáscara, en cuatro estados de maduración: verde, pintón, maduro y sobremaduro. Los frutos fueron obtenidos de la Colección de Germoplasma de la Estación Experimental Agraria San Roque del INIA Loreto, Perú. La técnica u tilizada para la determinación de contenido de vitamina C fue Cromatografía Líquida de Alta Eficiencia (HPLC) con columna de fase reversa. Lo...

  4. Impacto nutricio del consumo de una leche entera adicionada con vitaminas y minerales en niños Nutritional impact of a full strenght milk with added vitamins and minerals in children

    OpenAIRE

    Irene Maulen-Radovan; Sandra Villagómez; Esther Soler; Rolando Villicaña; Lizbeth Hernández-Ronquillo; Jorge L. Rosado

    1999-01-01

    OBJETIVO: Determinar el impacto nutricio del consumo de leche entera fortificada con vitaminas y minerales en niños. MATERIAL Y MÉTODOS: Se hizo un estudio prospectivo, longitudinal, en 227 niños de entre 8 a 60 meses de edad. Se ofreció a los menores 500 ml diarios de leche entera fortificada por 90 días. Se registró ingestión, aceptación, peso, talla, hemoglobina (Hb), hierro (Fe), vitamina B12 y folatos séricos. El análisis estadístico se realizó con medidas de tendencia central y dispersi...

  5. [[Length polymorphism of minisatellite repeat B2-VNTR of the bradykinin B2 receptor gene in healthy Russians and in patients with coronary heart disease].

    Science.gov (United States)

    Suchkova, I O; Pavlinova, L I; Larionova, E E; Alenina, N V; Solov'ev, K V; Baranova, T V; Belotserkovskaia, E V; Sasina, L K; Bader, M; Denisenko, A D; Mustafina, O E; Khusnutdinova, E K; Patkin, E L

    2014-01-01

    Bradykinin B2 receptor is involved in many processes, including the regulation of blood pressure and smooth muscle contraction, vasodilation, inflammation, edema, cell proliferation, pain. It is suggested that this receptor may be one of the factors that have cardioprotective and infarct-limiting effects. It is assumed that certain genetic variants in both coding and non-coding regions ofBDKRB2 gene may influence its expression. In the 3'-untranslated region of BDKRB2 exon 3 the minisatellite repeat B2-VNTR is located. B2-VNTR has previously been shown to affect the BDKRB2 mRNA stability. Therefore, it is important to perform the molecular genetic analysis of this minisatellite in patients with different forms of coronary heart disease in order to reveal possible associations between specific B2-VNTR alleles and certain clinical forms of coronary heart disease. In the present study, a comparative analysis of the allele and genotype frequencies of B2-VNTR was carried out in groups of healthy individuals and patients with two clinical forms of coronary heart disease (angina pectoris and myocardial infarction), ethnically Russian. The results of the B2-VNTR length polymorphism analysis indicate that this tandem repeat may be attributed to a class of low polymorphic and non-hypervariable minisatellite. In all analyzed groups we revealed three B2-VNTR alleles, consisting of 43, 38 and 33 repeat units. Alleles of 43 and 33 repeats were major in all investigated groups. No statistically significant differences were found in the B2-VNTR allele and genotype frequencies between men and women in control group, and also between healthy men and men with angina pectoris and myocardial infarction. Thus, B2-VNTR length polymorphism was not associated with these clinical forms of coronary heart disease in Russian men. However, we do not exclude the possibility of association between the B2-VNTR short alleles (38 and 33 repeats) and cardioprotective effects of bradykinin B2 receptor

  6. Effects of TiB2 Particle and Short Fiber Sizes on the Microstructure and Properties of TiB2-Reinforced Composite Coatings

    Science.gov (United States)

    Lin, Yinghua; Yao, Jianhua; Wang, Liang; Zhang, Qunli; Li, Xueqiao; Lei, Yongping; Fu, Hanguang

    2018-03-01

    In this study, particle and short fiber-reinforced titanium matrix composite coatings are prepared via laser in situ technique using (0.5 and 50 μm) TiB2 and Ti powder as cladding materials. The microstructure and properties of the composite coatings are studied, and the changing mechanism of the microstructure is discussed. The results reveal that particle agglomeration is prone to appear with using fine TiB2 particles. Decomposition of the particles preferentially occurs with using coarse TiB2 particles. The cracks and pores on the surface of the coating are formed at a lower laser energy density. With the increase in the laser energy density, cracking on the surface of the coating diminishes, but the coating exhibits depression behavior. The depression extent of the coating using fine TiB2 particle as the reinforcement is much less than that of the coating using coarse TiB2 particle. Moreover, the size of the aggregate and the tendency of cracking can be reduced with the increase in Ti addition. Meanwhile, short TiB fiber bundles are formed by the diffusion mechanism of rod aggregate, and randomly oriented TiB short fibers are formed mainly by the dissolution-precipitation mechanism of fine TiB2 particles. Moreover, the growth of short TiB fibers can be in an alternating manner between B27 and Bf structures. The micro-hardness and wear resistance of the coatings are evidently higher than that of the titanium alloy substrate. The wear resistance of the large size TiB2 coating is higher than that of the small size TiB2 coating under the condition of low load.

  7. Note: Progress on the use of MgB2 superconducting joint technique for the development of MgB2 magnets for magnetic resonance imaging (MRI).

    Science.gov (United States)

    Kim, Y G; Song, J B; Kim, J C; Kim, J M; Yoo, B H; Yun, S B; Hwang, D Y; Lee, H G

    2017-08-01

    This note presents a superconducting joint technique for the development of MgB 2 magnetic resonance imaging (MRI) magnets. The MgB 2 superconducting joint was fabricated by a powder processing method using Mg and B powders to establish a wire-bulk-wire connection. The joint resistance measured using a field-decay method was magnets operating in the persistent current mode.

  8. Cloning and Expression of ORFV B2L Gene%羊口疮病毒B2L基因克隆及表达

    Institute of Scientific and Technical Information of China (English)

    赵文博; 李瑞航; 贺鹏亮; 李朋娅; 王梦醒; 杨春华; 于永忠; 崔玉东

    2015-01-01

    为了获得羊口疮病毒囊膜蛋白。以羊口疮病毒基因组为模板,利用羊口疮病毒B2L基因特异性引物,进行PCR扩增,回收以及纯化PCR产物,连接到PMD18-T载体上,测序结果表明B2L基因全长1137 bp,编码379个氨基酸。再将B2L基因克隆至pET-30a,构建原核表达载体pET30a-B2L。经菌液PCR、酶切鉴定以及SDS-PAGE等方法表明成功构建原核表达载体,这将为今后的单抗制备以及羊口疮病毒的疫苗研究打下基础。%To obtain ORFV envelope protein and take ORFV genome as template,ORFV B2L gene was used as specific primers to amplify PCR and recovery and purify PCR products. Connected PCR products to PMD18-T vector,the sequence result showed that full-length of B2L gene was 1137 bp,and Encoding was 379 amino acids. B2L gene was cloned into pET-30a to construct prokaryotic expression vector pET30a-B2L. Prokaryotic expression vector was constructed by the methods of bacterium liquid PCR, enzyme identification and SDS-PAGE,which would provide the research basis of monoclonal antibody and ORFV vaccine in the future.

  9. Role of Erbin in ErbB2-dependent breast tumor growth

    Science.gov (United States)

    Tao, Yanmei; Shen, Chengyong; Luo, Shiwen; Traoré, Wilfried; Marchetto, Sylvie; Santoni, Marie-Josée; Xu, Linlin; Wu, Biao; Shi, Chao; Mei, Jinghong; Bates, Ryan; Liu, Xihui; Zhao, Kai; Xiong, Wen-Cheng; Borg, Jean-Paul; Mei, Lin

    2014-01-01

    ErbB2 (v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2), a receptor tyrosine kinase of the ErbB family, is overexpressed in around 25% of breast cancers. In addition to forming a heterodimer with other ErbB receptors in response to ligand stimulation, ErbB2 can be activated in a ligand-independent manner. We report here that Erbin, an ErbB2-interacting protein that was thought to act as an antitumor factor, is specifically expressed in mammary luminal epithelial cells and facilitates ErbB2-dependent proliferation of breast cancer cells and tumorigenesis in MMTV-neu transgenic mice. Disruption of their interaction decreases ErbB2-dependent proliferation, and deletion of the PDZ domain in Erbin hinders ErbB2-dependent tumor development in MMTV-neu mice. Mechanistically, Erbin forms a complex with ErbB2, promotes its interaction with the chaperon protein HSP90, and thus prevents its degradation. Finally, ErbB2 and Erbin expression correlates in human breast tumor tissues. Together, these observations establish Erbin as an ErbB2 regulator for breast tumor formation and progression. PMID:25288731

  10. Preparation and Microstructure of Porous ZrB2 Ceramics Using Reactive Spark Plasma Sintering Method

    Institute of Scientific and Technical Information of China (English)

    YUAN Huiping; LI Junguo; SHEN Qiang; ZHANG Lianmeng

    2015-01-01

    Zirconium oxide (ZrO2) and boron carbide (B4C) were added to ZrB2 raw powders to prepare ZrB2 porous ceramics by reactive spark plasma sintering (RSPS). The reactions between ZrO2 and B4C which produce ZrB2 and gas (such as CO and B2O3) result in pore formation. X-Ray Diffraction results indicated that the products phase was ZrB2 and the reaction was completed after the RSPS process. The porosity could be controlled by changing the ratio of synthesized ZrB2 to raw ZrB2 powders. The porosity of porous ceramics with 20 wt% and 40 wt% synthsized ZrB2 are 0.185 and 0.222, respectivly. And dense ZrB2-SiC ceramic with a porosity of 0.057 was prepared under the same conditions for comparison. The pores were homogeneously distributed within the microstructure of the porous ceramics. The results indicate a promising method for preparing porous ZrB2-based ceramics.

  11. Microhardness and microstructure evolution of TiB2 reinforced Inconel 625/TiB2 composite produced by selective laser melting

    Science.gov (United States)

    Zhang, Baicheng; Bi, Guijun; Nai, Sharon; Sun, Chen-nan; Wei, Jun

    2016-06-01

    In this study, micron-size TiB2 particles were utilized to reinforce Inconel 625 produced by selective laser melting. Exceptional microhardness 600-700 HV0.3 of the composite was obtained. In further investigation, the microstructure and mechanical properties of Inconel 625/TiB2 composite can be significantly influenced by addition of TiB2 particles during SLM. It was found that the long directional columnar grains observed from SLM-processed Inconel 625 were totally changed to fine dendritic matrix due to the addition of TiB2 particles. Moreover, with laser energy density (LED) of 1200 J/m, a Ti, Mo rich interface around TiB2 particles with fine thickness can be observed by FESEM and EDS. The microstructure evolution can be determined by different laser energy density (LED): under 1200 J/m, γ phase in dendrite grains; under 600 J/m, γ phase in combination of dendritic and acicular grains; under 400 J/m, γ phase acicular grains. Under optimized LED 1200 J/m, the dynamic nanohardness (8.62 GPa) and elastic modulus (167 GPa) of SLM-processed Inconel 625/TiB2 composite are higher compared with those of SLM-processed Inconel 625 (3.97 GPa and 135 GPa, respectively).

  12. Lattice Thermal Conductivity of Ultra High Temperature Ceramics (UHTC) ZrB2 and HfB2 from Atomistic Simulations

    Science.gov (United States)

    Lawson, John W.; Daw, Murray S.; Bauschlicher, Charles W.

    2012-01-01

    Ultra high temperature ceramics (UHTC) including ZrB2 and HfB2 have a number of properties that make them attractive for applications in extreme environments. One such property is their high thermal conductivity. Computational modeling of these materials will facilitate understanding of fundamental mechanisms, elucidate structure-property relationships, and ultimately accelerate the materials design cycle. Progress in computational modeling of UHTCs however has been limited in part due to the absence of suitable interatomic potentials. Recently, we developed Tersoff style parameterizations of such potentials for both ZrB2 and HfB2 appropriate for atomistic simulations. As an application, Green-Kubo molecular dynamics simulations were performed to evaluate the lattice thermal conductivity for single crystals of ZrB2 and HfB2. The atomic mass difference in these binary compounds leads to oscillations in the time correlation function of the heat current, in contrast to the more typical monotonic decay seen in monoatomic materials such as Silicon, for example. Results at room temperature and at elevated temperatures will be reported.

  13. MgB2 thin films by hybrid physical-chemical vapor deposition

    International Nuclear Information System (INIS)

    Xi, X.X.; Pogrebnyakov, A.V.; Xu, S.Y.; Chen, K.; Cui, Y.; Maertz, E.C.; Zhuang, C.G.; Li, Qi; Lamborn, D.R.; Redwing, J.M.; Liu, Z.K.; Soukiassian, A.; Schlom, D.G.; Weng, X.J.; Dickey, E.C.; Chen, Y.B.; Tian, W.; Pan, X.Q.; Cybart, S.A.; Dynes, R.C.

    2007-01-01

    Hybrid physical-chemical vapor deposition (HPCVD) has been the most effective technique for depositing MgB 2 thin films. It generates high magnesium vapor pressures and provides a clean environment for the growth of high purity MgB 2 films. The epitaxial pure MgB 2 films grown by HPCVD show higher-than-bulk T c due to tensile strain in the films. The HPCVD films are the cleanest MgB 2 materials reported, allowing basic research, such as on magnetoresistance, that reveals the two-band nature of MgB 2 . The carbon-alloyed HPCVD films demonstrate record-high H c2 values promising for high magnetic field applications. The HPCVD films and multilayers have enabled the fabrication of high quality MgB 2 Josephson junctions

  14. Preubiquitinated chimeric ErbB2 is constitutively endocytosed and subsequently degraded in lysosomes

    Energy Technology Data Exchange (ETDEWEB)

    Vuong, Tram Thu [Institute of Clinical Medicine, University of Oslo, Rikshospitalet, 0027 Oslo (Norway); Berger, Christian [Department of Pathology, Oslo University Hospital, Rikshospitalet, P.O. Box 4950 Nydalen, 0424 Oslo (Norway); Bertelsen, Vibeke; Rødland, Marianne Skeie [Institute of Clinical Medicine, University of Oslo, Rikshospitalet, 0027 Oslo (Norway); Stang, Espen [Department of Pathology, Oslo University Hospital, Rikshospitalet, P.O. Box 4950 Nydalen, 0424 Oslo (Norway); Madshus, Inger Helene, E-mail: i.h.madshus@medisin.uio.no [Institute of Clinical Medicine, University of Oslo, Rikshospitalet, 0027 Oslo (Norway); Department of Pathology, Oslo University Hospital, Rikshospitalet, P.O. Box 4950 Nydalen, 0424 Oslo (Norway)

    2013-02-01

    The oncoprotein ErbB2 is endocytosis-deficient, probably due to its interaction with Heat shock protein 90. We previously demonstrated that clathrin-dependent endocytosis of ErbB2 is induced upon incubation of cells with Ansamycin derivatives, such as geldanamycin and its derivative 17-AAG. Furthermore, we have previously demonstrated that a preubiquitinated chimeric EGFR (EGFR-Ub{sub 4}) is constitutively endocytosed in a clathrin-dependent manner. We now demonstrate that also an ErbB2-Ub{sub 4} chimera is endocytosed constitutively and clathrin-dependently. Upon expression, the ErbB2-Ub{sub 4} was further ubiquitinated, and by Western blotting, we demonstrated the formation of both Lys48-linked and Lys63-linked polyubiquitin chains. ErbB2-Ub{sub 4} was constitutively internalized and eventually sorted to late endosomes and lysosomes where the fusion protein was degraded. ErbB2-Ub{sub 4} was not cleaved prior to internalization. Interestingly, over-expression of Ubiquitin Interaction Motif-containing dominant negative fragments of the clathrin adaptor proteins epsin1 and Eps15 negatively affected endocytosis of ErbB2. Altogether, this argues that ubiquitination is sufficient to induce clathrin-mediated endocytosis and lysosomal degradation of the otherwise plasma membrane localized ErbB2. Also, it appears that C-terminal cleavage is not required for endocytosis. -- Highlights: ► A chimera containing ErbB2 and a tetra-Ubiquitin chain internalizes constitutively. ► Receptor fragmentation is not required for endocytosis of ErbB2. ► Ubiquitination is sufficient to induce endocytosis and degradation of ErbB2. ► ErbB2-Ub4 is internalized clathrin-dependently.

  15. Evolution, development, and communication of branding in B2B markets

    OpenAIRE

    Seyedghorban, Zahra

    2017-01-01

    While, branding was traditionally viewed as having limited significance in business-to-business (B2B) markets, existing research not only acknowledges its existence, but emphasises its strategic importance in enhancing organisations’ competitive positions and financial performance. Given the fragmented research on B2B branding, there is a need to first provide a comprehensive review of B2B branding literature as a field of study by conducting a bibliometric investigation (Essay 1). The result...

  16. Preubiquitinated chimeric ErbB2 is constitutively endocytosed and subsequently degraded in lysosomes

    International Nuclear Information System (INIS)

    Vuong, Tram Thu; Berger, Christian; Bertelsen, Vibeke; Rødland, Marianne Skeie; Stang, Espen; Madshus, Inger Helene

    2013-01-01

    The oncoprotein ErbB2 is endocytosis-deficient, probably due to its interaction with Heat shock protein 90. We previously demonstrated that clathrin-dependent endocytosis of ErbB2 is induced upon incubation of cells with Ansamycin derivatives, such as geldanamycin and its derivative 17-AAG. Furthermore, we have previously demonstrated that a preubiquitinated chimeric EGFR (EGFR-Ub 4 ) is constitutively endocytosed in a clathrin-dependent manner. We now demonstrate that also an ErbB2-Ub 4 chimera is endocytosed constitutively and clathrin-dependently. Upon expression, the ErbB2-Ub 4 was further ubiquitinated, and by Western blotting, we demonstrated the formation of both Lys48-linked and Lys63-linked polyubiquitin chains. ErbB2-Ub 4 was constitutively internalized and eventually sorted to late endosomes and lysosomes where the fusion protein was degraded. ErbB2-Ub 4 was not cleaved prior to internalization. Interestingly, over-expression of Ubiquitin Interaction Motif-containing dominant negative fragments of the clathrin adaptor proteins epsin1 and Eps15 negatively affected endocytosis of ErbB2. Altogether, this argues that ubiquitination is sufficient to induce clathrin-mediated endocytosis and lysosomal degradation of the otherwise plasma membrane localized ErbB2. Also, it appears that C-terminal cleavage is not required for endocytosis. -- Highlights: ► A chimera containing ErbB2 and a tetra-Ubiquitin chain internalizes constitutively. ► Receptor fragmentation is not required for endocytosis of ErbB2. ► Ubiquitination is sufficient to induce endocytosis and degradation of ErbB2. ► ErbB2-Ub4 is internalized clathrin-dependently.

  17. Al-doped MgB_2 materials studied using electron paramagnetic resonance and Raman spectroscopy

    International Nuclear Information System (INIS)

    Bateni, Ali; Somer, Mehmet; Erdem, Emre; Repp, Sergej; Weber, Stefan

    2016-01-01

    Undoped and aluminum (Al) doped magnesium diboride (MgB_2) samples were synthesized using a high-temperature solid-state synthesis method. The microscopic defect structures of Al-doped MgB_2 samples were systematically investigated using X-ray powder diffraction, Raman spectroscopy, and electron paramagnetic resonance. It was found that Mg-vacancies are responsible for defect-induced peculiarities in MgB_2. Above a certain level of Al doping, enhanced conductive properties of MgB_2 disappear due to filling of vacancies or trapping of Al in Mg-related vacancy sites.

  18. Electronic and structural properties of TiB2: Bulk, surface, and nanoscale effects

    International Nuclear Information System (INIS)

    Volonakis, George; Tsetseris, Leonidas; Logothetidis, Stergios

    2011-01-01

    Titanium diboride (TiB 2 ), is a widely used hard material that comprises graphene-like layers of B and intercalated Ti atoms. Here we report the results of extensive first-principles calculations on key properties of bulk TiB 2 , TiB 2 surfaces, and TiB 2 nanocrystals (NCs). The computational approach is first validated based on the agreement between calculated structural and electronic properties of bulk TiB 2 and available experimental and theoretical data. We then obtain the formation energies for several surface cuts and use these values to construct TiB 2 NCs based on the Wulff theorem. Finally, we demonstrate by studying the adsorption of small molecules that hydrogen and oxygen adatoms can be attached through strongly exothermic chemisorption reactions on TiB 2 surfaces. Likewise, water molecules bind on various TiB 2 surfaces and NC facets, with an energetic preference for the latter. The results are relevant to applications that depend on reactivity-related TiB 2 properties, for example resistance to corrosion and interactions with water-based solutions.

  19. Study of preparation of TiB2 by TiC in Al melts

    International Nuclear Information System (INIS)

    Ding Haimin; Liu Xiangfa; Nie Jinfeng

    2012-01-01

    TiB 2 particles are prepared by TiC in Al melts and the characteristics of them are studied. It is found that TiC particles are unstable when boron exists in Al melts with high temperature and will transform to TiB 2 and Al 4 C 3 . Most of the synthesized TiB 2 particles are regular hexagonal prisms with submicron size. The diameter of the undersurfaces of these prisms is ranging from 200 nm to 1 μm and the height is ranging from 100 nm to 300 nm. It is considered that controlling the transformation from TiC to TiB 2 is an effective method to prepare small and uniform TiB 2 particles. - Highlights: ► TiC can easily transform into TiB 2 in Al melts. ► TiB 2 formed by TiC will grow into regular hexagonal prisms with submicron size. ► Controlling the transformation from TiC to TiB 2 is an effective method to prepare small and uniform TiB 2 particles.

  20. First-principles calculations for elastic properties of OsB2 under pressure

    International Nuclear Information System (INIS)

    Yang Junwei; Chen Xiangrong; Luo Fen; Ji Guangfu

    2009-01-01

    The structure, elastic properties and elastic anisotropy of orthorhombic OsB 2 are investigated by density functional theory method with the ultrasoft pseudopotential scheme in the frame of the generalized gradient approximation (GGA) as well as local density approximation (LDA). The obtained structural parameters, elastic constants, elastic anisotropy and Debye temperature for OsB 2 under pressure are consistent with the available experimental data and other theoretical results. It is found that the elastic constants, bulk modulus and Debye temperature of OsB 2 tend to increase with increasing pressure. It is predicted that OsB 2 is not a superhard material from our calculations.

  1. First-principles calculations for elastic properties of OsB 2 under pressure

    Science.gov (United States)

    Yang, Jun-Wei; Chen, Xiang-Rong; Luo, Fen; Ji, Guang-Fu

    2009-11-01

    The structure, elastic properties and elastic anisotropy of orthorhombic OsB 2 are investigated by density functional theory method with the ultrasoft pseudopotential scheme in the frame of the generalized gradient approximation (GGA) as well as local density approximation (LDA). The obtained structural parameters, elastic constants, elastic anisotropy and Debye temperature for OsB 2 under pressure are consistent with the available experimental data and other theoretical results. It is found that the elastic constants, bulk modulus and Debye temperature of OsB 2 tend to increase with increasing pressure. It is predicted that OsB 2 is not a superhard material from our calculations.

  2. Chemically vapor-deposited ZrB2 as a selective solar absorber

    International Nuclear Information System (INIS)

    Randich, E.; Allred, D.D.

    1981-01-01

    Coatings of ZrB 2 and TiB 2 for photothermal solar absorber applications were prepared using chemical vapor deposition (CVD) techniques. Oxidation tests suggest a maximum temperature limit for air exposure of 600 K for TiB 2 and 800 K for ZrB 2 . Both materials exhibit innate spectral selectivity with an emittance at 375 K ranging from 0.06 to 0.09, a solar absorptance for ZrB 2 ranging from 0.67 to 0.77 and a solar absorptance for TiB 2 ranging from 0.46 to 0.59. ZrB 2 has better solar selectivity and more desirable oxidation behavior than TiB 2 . A 0.071 μm antireflection coating of Si 3 N 4 deposited onto the ZrB 2 coating leads to an increase in absorptance from 0.77 to 0.93, while the emittance remains unchanged. (Auth.)

  3. Structural, optical, and thermal properties of MAX-phase Cr2AlB2

    Science.gov (United States)

    Li, Xiao-Hong; Cui, Hong-Ling; Zhang, Rui-Zhou

    2018-04-01

    First-principles calculations of the structural, optical, and thermal properties of Cr2AlB2 are performed using the pseudopotential plane-wave method within the generalized gradient approximation (GGA). Calculation of the elastic constant and phonon dispersion indicates that Cr2AlB2 is mechanically and thermodynamically stable. Analysis of the band structure and density of states indicates that Cr2AlB2 is metallic. The thermal properties under increasing temperature and pressure are investigated using the quasi-harmonic Debye model. The results show that anharmonic effects on Cr2AlB2 are important at low temperature and high pressure. The calculated equilibrium primitive cell volume is 95.91 Å3 at T = 300 K, P = 0 GPa. The ability of Cr2AlB2 to resist volume changes becomes weaker with increasing temperature and stronger with increasing pressure. Analysis of optical properties of Cr2AlB2 shows that the static dielectric function of Cr2AlB2 is 53.1, and the refractive index n 0 is 7.3. If the incident light has a frequency exceeding 16.09 eV, which is the plasma frequency of Cr2AlB2, Cr2AlB2 changes from metallic to dielectric material.

  4. The grain refinement behavior of TiB2 particles prepared with in situ technology

    International Nuclear Information System (INIS)

    Wang Chunlei; Wang Mingxing; Yu Benhai; Chen Dong; Qin Ping; Feng Minghai; Dai Qirun

    2007-01-01

    The grain-refining behavior of TiB 2 particles was investigated by the method of adding Al-4B master alloy into the melt of electrolytic low-titanium aluminum (ELTA). The results indicate that TiB 2 particles will be formed when the Al-4B master alloy is added into the melt of ELTA. These TiB 2 particles are produced by in situ technology, thus their surface properties are preserved and do not alter. At the bottom of the melt, the TiB 2 particles are pushed to the grain boundaries because of the absence of enough titanium atoms, which indicates that TiB 2 particles alone are not potent nuclei of α-Al. Though some TiB 2 particles settle down at the bottom, there are still numbers of fine TiB 2 particles suspended. These TiB 2 particles, together with the titanium atoms left, will form much more heterogeneous nucleation sites during the solidification of the melt, resulting in the grain-refining efficiency of the ELTA with Al-4B addition being improved obviously. To investigate the grain-refining mechanism of aluminum, this method has its advantages in comparison with that of adding synthetic TiB 2 particles into the melt of aluminum

  5. ErbB-2 nuclear function in breast cancer growth, metastasis and resistance to therapy.

    Science.gov (United States)

    Elizalde, Patricia V; Cordo Russo, Rosalía I; Chervo, Maria F; Schillaci, Roxana

    2016-12-01

    Approximately 15-20% of breast cancers (BC) show either membrane overexpression of ErbB-2 (MErbB-2), a member of the ErbBs family of receptor tyrosine kinases, or ERBB2 gene amplification. Until the development of MErbB-2-targeted therapies, this BC subtype, called ErbB-2-positive, was associated with increased metastatic potential and poor prognosis. Although these therapies have significantly improved overall survival and cure rates, resistance to available drugs is still a major clinical issue. In its classical mechanism, MErbB-2 activates downstream signaling cascades, which transduce its effects in BC. The fact that ErbB-2 is also present in the nucleus of BC cells was discovered over twenty years ago. Also, compelling evidence revealed a non-canonical function of nuclear ErbB-2 as a transcriptional regulator. As a deeper understanding of nuclear ErbB-2 actions would be crucial to the disclosure of its role as a biomarker and a target of therapy in BC, we will here review its function in BC, in particular, its role in growth, metastatic spreading and response to currently available MErbB-2-positive BC therapies. © 2016 Society for Endocrinology.

  6. Usability perspective on social media sites' adoption in the B2B context

    OpenAIRE

    Lacka, Ewelina; Chong, Alain

    2016-01-01

    While social media sites have been successfully adopted and used in the B2C context, they are perceived to be irrelevant in B2B marketing. This is due to marketers' perception of poor usability of these sites in the B2B sector. This study investigates the usability of social media sites when adopted for B2B marketing purposes in the one of world's largest social media market: China. Specifically, by extending the Technology Acceptance Model with Nielsen's Model of Attributes of System Accepta...

  7. Vitaminas antioxidantes e prevenção da arteriosclerose na infância Antioxidant vitamins and prevention of atherosclerosis in childhood

    Directory of Open Access Journals (Sweden)

    Adriana Boni

    2010-12-01

    Full Text Available OBJETIVO: Revisar os potenciais efeitos antioxidantes das vitaminas A, C e E na prevenção do desenvolvimento da arteriosclerose na infância, com ênfase na prevenção da dislipidemia. FONTES DE DADOS: Pesquisa bibliográfica em revistas científicas, livros técnicos e publicações de órgãos oficiais dos últimos 20 anos. Utilizaram-se as bases de dados Lilacs, SciELo e Medline em português, inglês e espanhol, com as palavras-chave: "antioxidantes", "arteriosclerose", "dislipidemias", "peroxidação de lipídeos", "infância", "vitamina A", "vitamina C" e "vitamina E". SÍNTESE DE DADOS: A prevalência de dislipidemia na infância e na adolescência mostra frequência crescente, provavelmente relacionada às mudanças dos hábitos alimentares e à redução na prática de atividades físicas. O elevado nível plasmático da lipoproteína de baixa densidade (LDL-c é fator de risco para o desenvolvimento da arteriosclerose. O consumo de frutas, verduras e legumes, ricos em antioxidantes, é um dos fatores de maior importância na prevenção da peroxidação lipídica. A baixa ingestão dessas fontes naturais de antioxidantes sugere a necessidade de intervenção nutricional para atingir as metas diárias de consumo de vitaminas A, C e E, não sendo preconizada a sua suplementação medicamentosa. CONCLUSÕES: O pediatra e o nutricionista devem orientar as famílias sobre o consumo de alimentos saudáveis, principalmente frutas, verduras e legumes, por seu potencial efeito antioxidante, especialmente nos primeiros anos de vida.OBJECTIVE: To review the potential antioxidant effects of vitamins A, C and E in the prevention of atherosclerosis development during childhood, emphasizing the prevention of dyslipidemia. DATA SOURCES: Bibliographic search in scientific journals, technical books and official publications of the last 20 years. Lilacs, SciElo and Medline databases were searched for articles in Portuguese, Spanish and English using a

  8. Vitamina K: metabolismo, fontes e interação com o anticoagulante varfarina Vitamin K: metabolism, sources and interaction with the anticoagulant warfarin

    Directory of Open Access Journals (Sweden)

    Karin Klack

    2006-12-01

    Full Text Available A vitamina K é lipossolúvel, principalmente, na coagulação sanguínea. Se apresenta sob as formas de filoquinona (K1-predominante, dihidrofiloquinona (dK, menaquinona (K2 e menadiona (K3. Os fatores que interferem em sua absorção são: má absorção gastrintestinal, secreção biliar, ingestão insuficiente e uso de anticoagulantes, entre outros. As principais fontes de vitamina K são os vegetais e óleos, sendo esses os responsáveis pelo aumento da absorção da filoquinona. Os alimentos folhosos verde escuro, os preparados à base de óleo, oleaginosas e frutas como o kiwi, abacate, uva, ameixa e figo contêm teores significantes de vitamina K, enquanto que os cereais, grãos, pães e laticínios possuem teores discretos. A ingestão diária de aproximadamente 1µg por quilo de peso é considerada a mais segura, inclusive para a utilização de anticoagulantes orais, em que a concentração estável da vitamina proporciona a eficácia no tratamento. A droga anticoagulante oral geralmente utilizada é a varfarina, administrada como profilática e para tratamento de fenômenos tromboembólicos. Essa intervenção medicamentosa é monitorada pelo tempo de protrombina expresso pela razão normalizada internacional, tendo como objetivo estabelecer a faixa terapêutica entre 2 e 3, minimizando o risco de hemorragias. O efeito anticoagulante pode ser reduzido por fatores como ganho de peso, diarréia, vômito, idade menor que 40 anos e consumo excessivo de vitamina K na dieta alimentar.Vitamin K is a fat-soluble substance, mainly involved in the blood coagulation. It is presented as Phylloquinone (K1-predominant, Dihydrophyloquinone (dK, Menaquinone (K2, and Menadione (K3. The factors that interfere with its absorption are: gastrointestinal malabsorption, biliary secretion, inadequate ingestion and anticoagulant use, among others. The main vitamin K sources are vegetables and organic lipids, that are involved in the increased absorption of

  9. Vitamina A en gestantes evaluadas mediante encuesta dietética e impresión citológica conjuntival

    Directory of Open Access Journals (Sweden)

    Jesús Diego de la Campa

    1996-06-01

    Full Text Available Se realizó un estudio descriptivo de carácter prospectivo longitudinal con el fin de establecer el status de vitamina A de las gestantes del Policlínico "Dr. Joaquín Albarrán" mediante una encuesta dietética y citología de impresión conjuntival; se tomó como universo la totalidad de las embarazadas captadas en el primer trimestre de 1994 (71 pacientes, a las que se aplicó el formulario de la encuesta, se les tomó una muestra citológica conjuntival entre las 8 y las 12 semanas de gestación, y se les determinó el peso y la talla. Igual procedimiento se repitió entre las 28 y las 32 semanas. Encontramos alteración de la citología conjuntival en una paciente al tomar la primera muestra para el 1,4 %. No hubo alteraciones conjuntivales en la segunda muestra (la gestante que presentó anomalías citológicas conjuntivales en la primera muestra, consumía limitadamente alimentos ricos en vitamina A, fue suplementada con el neovitamín II, cuando se tomó la segunda muestra ya había recobrado el patrón normal, lo que demuestra que no existe déficit de vitamina A como problema nutricional en las gestantes de nuestra área de salud en el grupo evaluado. Los resultados del estudio indican que aunque en las encuestas dietéticas se registran moderadas frecuencias de consumo de alimentos ricos en vitamina A, no se detectan deficiencias a nivel de órgano efector, ello posiblemente se deba a que la suma de los aportes alimentarios, más las dosificaciones que tienen los suplementos vitamínicos, satisfacen el nivel de seguridad de mantenimiento de reservas hepáticas, y por lo tanto, proveen la vitamina A más allá del umbral donde aparecen los signos de carencias.A descriptive study of longitudinal prospective character was carried out aimed at establishing the vitamin A status of pregnant women at the "Dr. Joaquín Albarrán" Polyclinic by means of a dietetic survey and a conjunctival impression cytology. All pregnant women treated

  10. Níveis de vitamina C e ferro para tilápia do nilo (Oreochromis niloticus Levels of vitamin C and iron for nile tilapia (Oreochromis niloticus

    Directory of Open Access Journals (Sweden)

    Margarida Maria Barros

    2002-11-01

    Full Text Available Os efeitos de diferentes níveis de vitamina C e ferro no desempenho produtivo e parâmetros fisiológicos da tilápia do Nilo (Oreochromis niloticus foram avaliados por um período de 73 dias. O delineamento foi inteiramente casualizado, com tratamentos dispostos em esquema fatorial com três níveis de vitamina C (125; 375 e 1115 mg/kg e três níveis de ferro (30, 90 e 270 mg/kg, mais um tratamento adicional (0 mg/kg de suplementação de vitamina C e ferro, com quatro repetições cada tratamento, totalizando 10 grupos experimentais. Utilizaram-se 240 alevinos revertidos com peso médio inicial de 7,46 ± 0,49 g, distribuídos aleatoriamente em 40 aquários de 250 L, numa lotação de 6 peixes/aquário. Confeccionou-se dieta purificada com 32,0% de proteína bruta e 3300 kcal/kg de energia digestível. A ausência de vitamina C e ferro nas dietas propiciou o aparecimento de anemia microcítica e hipocrômica aos alevinos. A presença dessa vitamina em dosagens elevadas estimulou a liberação de eritrócitos imaturos na corrente sangüínea. Determinou-se, também, que níveis desses acima das exigências nutricionais descritas para a espécie não determinaram efeito detrimental no desempenho produtivo, na produção de proteínas plasmáticas ou nos aspectos morfológicos do fígado.The effects of different levels of vitamin C and iron on growth performance and physiological parameters on Nile tilapia (Oreochromis niloticus were evaluated for 73 days. A factorial experiment with three levels of vitamin C (125; 375 e 1115 mg/kg and three levels of iron (30, 90 e 270 mg/kg, plus an additional treatment (with 0 mg/kg of vitamin C and iron, was considered on a completely randomized design, with four replicates for each experimental group. It was randomly stocked 240 reverted fingerlings, an average weight of 7.46 ± 0.49 g, into 40, 250L, aquaria at a density of 6 fish/aquarium. A albumin-gelatin-diet was formulated to contain 32.0% of crude

  11. Control perioperatorio de la anticoagulación con antagonistas de la vitamina K en cirugía electiva

    Directory of Open Access Journals (Sweden)

    José I Revigliono

    2014-10-01

    Full Text Available Los pacientes anticoagulados crónicamente que son sometidos a cirugías electivas requieren la suspensión temporaria de los antagonistas de vitamina K. El objetivo del presente trabajo fue evaluar la incidencia de eventos tromboembólicos y hemorrágicos en pacientes anticoagulados sometidos a un procedimiento invasivo, aplicando un protocolo de manejo de anticoagulación en el perioperatorio. Se realizó un estudio descriptivo, con datos obtenidos de manera prospectiva, donde se incluyeron mayores de 18 años que ingresaron para la realización de una cirugía electiva. Recibieron sustitución con enoxaparina aquellos con fibrilación auricular(FA de moderado y alto riesgo de evento tromboembólico, pacientes con reemplazo con válvula cardíaca mecánica(VCM de moderado y alto riesgo de evento tromboembólico y con tromboembolismo venoso(TEV de alto riesgo de evento tromboembólico. Se evaluaron los eventos embólicos y hemorrágicos en el perioperatorio. Setenta y ocho recibieron sustitución con enoxaparina en el perioperatorio, edad promedio de 69.4 ± 11.9 años. Veintiocho tenían FA (36.4%, 12 TEV (15.6% y 37 VCM (48.1%. En el postoperatorio hubo un evento embólico (1.6% y 12 eventos hemorrágicos (15.4% de los cuales 10 fueron menores (12.8% y 2mayores (2.6%. La seguridad de la sustitución con enoxaparina aún es cuestionable, y se deberán esperar estudios aleatorizados, comparando diferentes estrategias de sustitución con heparinas versus la suspensión del tratamiento anticoagulante en el período perioperatorio para una conclusión definitiva.

  12. VALORACIÓN DE ATRIBUTOS DE CALIDAD EN PEPINO (Cucumis sativus L. FORTIFICADO CON VITAMINA E VALORAÇÃO DE ATRIBUTOS DE QUALIDADE EM PEPINO (Cucumis sativus L. FORTIFICADO COM VITAMINA E VALUATION OF QUALITY ATTRIBUTES IN CUCUMBER (Cucumis sativus L. FORTIFIED WITH VITAMIN E

    Directory of Open Access Journals (Sweden)

    MISAEL CORTÉS

    2011-06-01

    Full Text Available El objetivo de este trabajo fue desarrollar un producto mínimamente procesado fortificado con vitamina E, a partir de pepino (Cucumis sativus L, utilizando la ingeniería de matrices. Rodajas impregnadas al vacío (IV con DL-α-tocoferol acetato emulsificado en una fase acuosa isotónica al pepino (NaCl al 1%, son evaluadas en cuanto a propiedades fisicoquímicas, color, textura, estabilidad de la vitamina E y sensorialmente, por influencia del proceso, tiempo de almacenamiento y envasado (con y sin vacío. La vitamina E se cuantifica por HPLC (% del valor diario recomendado (VDR/100 g de pepino fresco, según la norma Colombiana. La respuesta IV alcanza niveles de 6.05±1.49%, correspondiente a 33.3±5.8 mg vitamina E y 110.5±19.1% VDR en 100 g de pepino fresco. Durante el almacenamiento en 9 días se presenta una pérdida aproximadamente del 50%, debido a la poca retención de la emulsión en el interior de la matriz. Los parámetros fisicoquímicos, el color y la textura son afectados por la IV, el tiempo y el envasado, siendo durante el almacenamiento más oscuras y más resistentes que el producto fresco. La ingeniería de matrices representa una metodología efectiva para fortificar el pepino con vitamina E.O objetivo deste estudo foi desenvolver um produto mínimamente processado fortificado com vitamina E, a partir de pepino (Cucumis sativus L, utilizando a engenharia de matrizes. Fatias de pepino foram impregnadas a vácuo (IV com DL-α- acetato de tocoferol emulsificado numa fase aquosa isotónica (NaCl a 1%, e foram avaliadas quanto às propiedades fisico-químicas, cor, textura, estabilidade da vitamina E e sensorialmente, tendo em consideração os factores: processo, tempo de armazenamento e envasado (com e sem vácuo. A vitamina E quantificou-se por HPLC (% do Valor Diario Recomendado (VDR/100 g de pepino fresco, de acordo com a norma Colombiana. A resposta à IV alcanzou niveis de 6.05±1.49%, correspondente a 33.3±5.8 mg

  13. Neutron diffraction studies of magnetic ordering in superconducting ErNi2B2C and TmNi2B2C in an applied magnetic field

    DEFF Research Database (Denmark)

    Toft, Katrine Nørgaard

    The field-induced magnetic structures of ErNi2B2C and TmNi2B2C in are especially interesting because the field suppresses the superconducting order parameter and therefore the magnetic properties can be studied while varying the strength ofsuperconductivity. ErNi2B2C: For magnetic fields along all.......483,0,0). The appearance of the QN phase wasinitially believed to be caused by the suppression of superconductivity. This suppression should make it favorable to create a magnetic order with a Q-vector determined by the maximum in the magnetic susceptibility at the Fermi surface nesting vector QN.The phase diagram...... three symmetry directions, the observed magnetic structures have a period corresponding to the Fermi surface nesting structure. The phase diagrams present all the observed magnetic structures.Two results remain unresolved: 1. When applying the magnetic field along [010], the minority domain (QNB = (0,Q...

  14. Low-temperature synthesis of ZrB2 powder from oxides using Na

    Directory of Open Access Journals (Sweden)

    Haruhiko Morito

    2017-12-01

    Full Text Available ZrB2 was synthesized by heating a mixture of ZrO2, B2O3, and Na in a molar ratio of 1:1:5 at 873–1273 K. While unreacted ZrO2 remained in the sample synthesized at 873 K, single phase ZrB2 powders were obtained at temperatures ≥1073 K. The diameters of the ZrB2 particles obtained at 1073 and 1273 K were 0.1–20 and 10–100 μm, respectively. Single phase ZrB2 was also obtained at 873 K when the starting material was rich in B2O3 and Na (ZrO2:B2O3:Na = 1:5:15. This route yielded fine particle aggregates of ZrB2, which were found to be <0.1 μm in size.

  15. 22 CFR 9b.2 - Press correspondents employed by United States media organizations.

    Science.gov (United States)

    2010-04-01

    ... media organizations. 9b.2 Section 9b.2 Foreign Relations DEPARTMENT OF STATE GENERAL REGULATIONS... employed by United States media organizations must: (a) Present to the Office of Press Relations... news media organizations; (3) Date of birth; (4) Place of birth; (5) Sex; (6) Citizenship; (7) Social...

  16. SerpinB2 is critical to Th2 immunity against enteric nematode infection

    Science.gov (United States)

    SerpinB2, a member of the serine protease inhibitor family, is expressed by macrophages and up-regulated significantly by inflammation. Recent studies implicated a role for SerpinB2 in the control of Th1 and Th2 immune responses, but the mechanisms of these effects are unknown. In the current study...

  17. Formation of MgB2 at ambient temperature with an electrochemical process: a plausible mechanism

    International Nuclear Information System (INIS)

    Jadhav, A B; Subhedar, K M; Hyam, R S; Talaptra, A; Sen, Pintu; Bandyopadhyay, S K; Pawar, S H

    2005-01-01

    The binary intermetallic MgB 2 superconductor has been synthesized by many research groups. However, the mechanism of its formation is not clearly understood. In this communication, a comprehensive mechanism of the formation of MgB 2 from Le Chatelier's principle of equilibrium reaction has been explained both for solid-state reaction and electrodeposition methods. (rapid communication)

  18. In situ synthesis of NiAl–NbB2 composite powder through combustion synthesis

    International Nuclear Information System (INIS)

    Shokati, Ali Akbar; Parvin, Nader; Sabzianpour, Naser; Shokati, Mohammad; Hemmati, Ali

    2013-01-01

    Highlights: ► A Novel NiAl matrix composite powder with 0–40 wt.% NbB 2 was synthesized. ► Composite powders were synthesized by thermal explosion reaction of Ni–Al–Nb–B system. ► Microhardness of NiAl considerably increased with raising NbB 2 content. ► Synthesized composite powders is a good candidate as precursor for thermal barrier application. - Abstract: Synthesis of a novel NiAl matrix composite powder reinforced with 0–40 wt.% NbB 2 by combustion synthesis in thermal explosion mode was investigated. The elemental powders of Ni, Al, Nb, and amorphous boron were used as starting material. For all compositions final products consisted of only the NiAl and NbB 2 phases. Coarser NbB 2 with a relatively uniform distribution in NiAl matrix was formed with rising NbB 2 content. Microhardness of NiAl considerably increased from 377 ± 13 HV 0.05 to 866 ± 81 HV 0.05 for NiAl with 40 wt.% NbB 2 . High microhardness, proper size and distribution of NbB 2 in NiAl matrix make it a good candidate as precursor for thermal spray application.

  19. Neutron diffraction studies of Ho1-xYxNi2B2C compounds

    DEFF Research Database (Denmark)

    Chang, L.J.; Tomy, C.V.; Paul, D.M.K.

    1996-01-01

    Neutron diffraction measurements have been carried out to investigate the nature of magnetic ordering in Ho(1-x)Y(x)Ni(2)B(2)C (x = 0, 0.1 and 0.2) compounds. HoNi(2)B(2)C shows a complex type of magnetic ordering below the superconducting transition, with a commensurate antiferromagnetic ordering...

  20. Tissue-specific alternative splicing and expression of ATP1B2 gene ...

    African Journals Online (AJOL)

    After heat-stress, the expression levels of the different transcripts were lower in different tissues; however, the expression of the ATP1B2-complete transcript increased in heart and lung tissues. The results of this research provide some useful information for further studies into the function of the bovine ATP1B2 gene.

  1. Measurement of the anisotropy ratios in MgB2 single crystals

    International Nuclear Information System (INIS)

    Kim, Heon-Jung; Kang, Byeongwon; Lee, Hyun-Sook; Lee, Sung-Ik

    2006-01-01

    We present our recent measurements on the anisotropy ratios of MgB 2 single crystals. Our measurements indicate that the anisotropy ratios of the penetration depth and of the upper critical field have different magnitudes and temperature dependences, as predicted by theoretical calculations. These results imply that the two-gap nature can strongly influence the superconducting properties of MgB 2

  2. Theoretical study of superconductivity in MgB 2 and its alloys

    Indian Academy of Sciences (India)

    total density of states (DOS) and; the partial DOS around the Fermi energy, F, clearly show the importance of B -electrons for superconductivity. For BeB2 and NaB2, our results indicate qualitative similarities but significant quantitative differences in their electronic structure due to differences in the number of valence ...

  3. 26 CFR 1.6031(b)-2T - REMIC reporting requirements (temporary). [Reserved

    Science.gov (United States)

    2010-04-01

    ... requirements (temporary). [Reserved] ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false REMIC reporting requirements (temporary). [Reserved] 1.6031(b)-2T Section 1.6031(b)-2T Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE...

  4. 29 CFR 783.26 - The section 6(b)(2) minimum wage requirement.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false The section 6(b)(2) minimum wage requirement. 783.26... The section 6(b)(2) minimum wage requirement. Section 6(b), with paragraph (2) thereof, requires the... prescribed by” paragraph (1) of the subsection is the minimum wage rate applicable according to the schedule...

  5. 17 CFR 270.24b-2 - Filing copies of sales literature.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Filing copies of sales literature. 270.24b-2 Section 270.24b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... literature. Copies of material filed with the Commission for the sole purpose of complying with section 24(b...

  6. Automated Report Generation for Research Data Repositories: From i2b2 to PDF.

    Science.gov (United States)

    Thiemann, Volker S; Xu, Tingyan; Röhrig, Rainer; Majeed, Raphael W

    2017-01-01

    We developed an automated toolchain to generate reports of i2b2 data. It is based on free open source software and runs on a Java Application Server. It is sucessfully used in an ED registry project. The solution is highly configurable and portable to other projects based on i2b2 or compatible factual data sources.

  7. Social Media within a B2B context : A qualitative study about how industrial corporations can use social media to maintain B2B relationships

    OpenAIRE

    Andersén, Sophia; Bengtsson, Annie; Gilén, Sandra

    2014-01-01

    The last thirty years there has been a dramatic change in relationship marketing. The use of computers connected to the Internet at work places has increased over time and social media is widely used in marketing strategies. Social media is a new phenomenon to communicate with each other, it enables market information based on individual consumer’s experiences. Therefore managers are seeking a way to incorporate social media into their strategies, but this is more common within B2C than B2B. ...

  8. Suplementación de ácido fólico con o sin vitamina B12 para prevenir el deterioro cognitivo en sujetos de edad avanzada: análisis crítico de la literatura

    Directory of Open Access Journals (Sweden)

    Raúl Alberto Aguilera-Eguía

    2016-01-01

    Full Text Available La demencia es un síndrome que interfiere en funciones corticales de la persona, posiblemente causado por déficit de vitamina B12. Se cree que la suplementación de ácido fólico con o sin vitamina B12 puede prevenir el deterioro cognitivo o disminuirlo en sujetos sanos de edad avanzada que presentan altos niveles de homocisteína en plasma. El objetivo de este trabajo fue comprobar la validez y aplicabilidad de los resultados con respecto a la efectividad de la suplementación de ácido fólico con o sin vitamina B12 en sujetos de edad avanzada con niveles elevados de homocisteína y responder al siguiente interrogante: en sujetos sanos de edad avanzada con niveles altos de homocisteína, ¿puede la suplementación de ácido fólico con o sin vitamina B12 prevenir o disminuir el deterioro de las funciones cognitivas? Se analizó la revisión sistemática Cochrane “Ácido fólico con o sin vitamina B12 para la prevención y el tratamiento de personas sanas de edad avanzada con demencia”, de Malouf et al. (2008. La administración de ácido fólico por tres años con o sin vitamina B12 en sujetos sanos de edad avanzada con un alto nivel de homocisteína en plasma, podrían mejorar significativamente la función cognitiva global, presentando una diferencia media ponderada de 0,05 (IC 95%; 0,004 a 0,096. A pesar de las limitaciones metodológicas y la escasa cantidad de estudios primarios incluidos en la revisión sistemática analizada, encontramos razonable el uso de ácido fólico con o sin vitamina B12 para mejorar la función cognitiva en personas sanas de edad avanzada con niveles elevados de homocisteína.

  9. Effects of vitamin D in the prevention of acute viral bronchiolitis: systematic review = Efeitos da vitamina D na prevenção da bronquiolite viral aguda: revisão sistemática

    Directory of Open Access Journals (Sweden)

    Rueda, Angélica Maria Barba

    2015-01-01

    Full Text Available Objetivos: Evidências publicadas sugerem que a suplementação da vitamina D pode ter efeito protetor nas infecções do trato respiratório inferior. O objetivo desta revisão foi avaliar os efeitos da ingestão de vitamina D na prevenção da bronquiolite viral aguda em crianças. Métodos: Foram feitas buscas nas bases de dados Medline, EMBASE, Web of Science, LILACS e Cochrane Central Register of Controlled Trials, até dezembro de 2014, usando os descritores "Vitamin D" ou cholecalciferol ou ergocalciferol e "bronchiolitis, viral" ou "viral bronchiolitis" ou "bronchiolitides, viral" ou "viral bronchiolitides". Foram incluídos estudos que avaliaram o efeito da ingesta da vitamina D na prevenção da bronquiolite viral aguda em crianças. Estudos com intervenção menor que duas semanas e artigos de revisão foram excluídos. Resultados: A busca identificou 241 artigos, entre os quais 20 artigos foram selecionados para leitura na íntegra e dois artigos foram incluídos na revisão sistemática, incluindo 296 crianças. Nenhum estudo mediu os níveis séricos de vitamina D. Um dos estudos incluídos foi um ensaio clinico, no qual o número de episódios de bronquiolite foi significativamente menor nas crianças suplementadas com vitamina D (Grupo I: média 0, 6±0, 7 Grupo II: média 1, 4 ±0, 9; P =0, 001. No outro, um estudo de casos e controles, não se encontrou relação significativa entre casos de bronquiolite viral aguda e ingesta de vitamina D (odds ratio 1, 7 – intervalo de confiança 95% 0, 7 - 4, 0. Conclusões: As evidências científicas atuais são insuficientes para comprovar os benefícios clínicos da vitamina D na prevenção da bronquiolite viral aguda

  10. Dirac State in the FeB2 Monolayer with Graphene-Like Boron Sheet.

    Science.gov (United States)

    Zhang, Haijun; Li, Yafei; Hou, Jianhou; Du, Aijun; Chen, Zhongfang

    2016-10-12

    By introducing the commonly utilized Fe atoms into a two-dimensional (2D) honeycomb boron network, we theoretically designed a new Dirac material of FeB 2 monolayer with a Fermi velocity in the same order of graphene. The electron transfer from Fe atoms to B networks not only effectively stabilizes the FeB 2 networks but also leads to the strong interaction between the Fe and B atoms. The Dirac state in FeB 2 system primarily arises from the Fe d orbitals and hybridized orbital from Fe-d and B-p states. The newly predicted FeB 2 monolayer has excellent dynamic and thermal stabilities and is also the global minimum of 2D FeB 2 system, implying its experimental feasibility. Our results are beneficial to further uncovering the mechanism of the Dirac cones and providing a feasible strategy for Dirac materials design.

  11. Nonlinear Elasticity of Borocarbide Superconductor YNi2B2C: A First-Principles Study

    Directory of Open Access Journals (Sweden)

    Lili Liu

    2017-01-01

    Full Text Available First-principles calculations combined with homogeneous deformation methods are used to investigate the second- and third-order elastic constants of YNi2B2C with tetragonal structure. The predicted lattice constants and second-order elastic constants of YNi2B2C agree well with the available data. The effective second-order elastic constants are obtained from the second- and third-order elastic constants for YNi2B2C. Based on the effective second-order elastic constants, Pugh’s modulus ratio, Poisson’s ratio, and Vickers hardness of YNi2B2C under high pressure are further investigated. It is shown that the ductility of YNi2B2C increases with increasing pressure.

  12. Towards a Cryogen-Free MgB2-Based Superconducting Radio Frequency Accelerating Cavities

    Science.gov (United States)

    Nassiri, Alireza

    Studies on the application of Magnesium diboride (MgB2) superconducting films have shown promise for use with the radio-frequency (SRF) accelerating cavities. MgB2\\ coating is a potential candidate to replace bulk niobium (Nb) SRF cavities. The ultimate goal of our research is to demonstrate MgB2 coating on copper cavities to allow operation at about 20 K or so as a result of the high transition temperature (Tc) of MgB2 and taking advantage of the excellent thermal conductivity of copper. Here, we will report on our recent experimental results of applying hybrid physical-chemical vapor deposition (HPCVD) to grow MgB2 films on 2-inch diameter copper discs as well as on a 2.8 GHz resonator cavity *Work supported by the U.S. Department of Energy, Office of Science, under Contract No. DE-AC02-06H11357.

  13. c-erbB-2 expression and benefit from adjuvant chemotherapy and radiotherapy of breast cancer

    International Nuclear Information System (INIS)

    Staal, O.; Sullivan, S.; Wingren, S.; Skoog, L.; Rutqvist, L.E.; Nordenskjoeld, B.; Carstensen, J.M.

    1995-01-01

    Frozen tissue from primary tumours of 152 premenopausal breast cancer patients, who participated in a trial comparing radiotherapy with adjuvant chemotherapy (cyclophosphamide, methotrexate, 5-fluorouracil, CMF), was analysed for c-erbB-2 protein expression, measured by flow cytometry. The relative risk of distant recurrence or death in the chemotherapy group as compared with the radiotherapy group was 3.0 (95% confidence interval (CI) 1.1-7.8) for patients whose tumours showed high c-erbB-2 levels and 0.87 (95% CI 0.43-1.7) for those with tumours with low levels of c-erbB-2 protein. Patients with highly proliferative tumours that did not overexpress c-erbB-2 benefited most, in terms of survival, from CMF. In addition, we found an increased risk of locoregional recurrence for tumours overexpressing c-erbB-2 when radiotherapy was replaced by chemotherapy. (author)

  14. Effects of sintering conditions on critical current properties and microstructures of MgB2 bulks

    International Nuclear Information System (INIS)

    Yamamoto, Akiyasu; Shimoyama, Jun-ichi; Ueda, Shinya; Katsura, Yukari; Iwayama, Isao; Horii, Shigeru; Kishio, Kohji

    2005-01-01

    The effects of heating conditions on critical current properties and microstructures of undoped MgB 2 bulks were systematically studied. Strong correlation was observed between J c and microstructures. The network structure with an excellent inter-grain connectivity of MgB 2 grains contributed to high-J c under low magnetic fields, and small grain size of MgB 2 enhanced the grain boundary flux pinning. Long time heating at low temperatures below the melting point of magnesium was discovered to be most effective for synthesis of MgB 2 bulks having strongly connected MgB 2 network structure with small grains. The sample heated at 550 deg. C for 1200 h recorded a high-J c of 4.02 x 10 5 A cm -2 at 20 K in self-field, while high-temperature and long time heating brought a significant grain growth which resulted in low J c

  15. Thermoluminescence kinetic parameters of different amount La-doped ZnB2O4

    International Nuclear Information System (INIS)

    Kucuk, Nil; Gozel, Aziz Halit; Yüksel, Mehmet; Dogan, Tamer; Topaksu, Mustafa

    2015-01-01

    The kinetic parameters of 1%, 2%, 3% and 4% La-doped ZnB 2 O 4 phosphors (i.e. ZnB 2 O 4 :0.01La, ZnB 2 O 4 :0.02La, ZnB 2 O 4 :0.03La and ZnB 2 O 4 :0.04La) synthesized by nitric acid method have been calculated. Thermoluminescence (TL) glow curves of ZnB 2 O 4 :La phosphors after beta-irradiation showed a very well defined main peak having the maximum temperature at around 200 °C and a shoulder peak at around 315 °C with a constant heating rate of 5 °C/s. The kinetic parameters of ZnB 2 O 4 :La phosphors TL glow peaks (i.e. order of kinetics (b), activation energies (E a ) and frequency factors (s)) have been determined and evaluated by Computerized Glow Curve Deconvolution (CGCD), and Peak Shape (PS) methods using the glow curve data. From the results, it can conclude that the values of E a obtained with these methods for ZnB 2 O 4 :La phosphors are consistent with each other, but the s values differ considerably. - Highlights: • Calculation of TL kinetic parameters for La-doped ZnB 2 O 4 . • La-doped ZnB 2 O 4 was synthesized by nitric acid method. • Well defined main peak at about 200 °C

  16. LytB1 and LytB2 of Mycobacterium tuberculosis Are Not Genetically Redundant.

    Directory of Open Access Journals (Sweden)

    Amanda Claire Brown

    Full Text Available Mycobacterium tuberculosis synthesises isoprenoid precursors via the MEP/DOXP pathway and at least five enzymes in the pathway (Dxs1, Dxr/IspC, IspD, IspF, and GcpE/IspG are required for growth in vitro. We investigated the role of LytB (IspH in M. tuberculosis; M. tuberculosis is unusual in that it has two homologs-LytB1 and LytB2. We were unable to delete the lytB2 gene unless we provided an additional copy elsewhere, demonstrating that this is the essential homolog. We expressed lytB1 from the lytB2 promoter and confirmed that this could not complement for loss of function of lytB2, despite LytB1 possessing all the previously described conserved critical residues. Interestingly the sole LytB homolog of Mycobacterium smegmatis was able to compensate for loss of LytB2 in M. tuberculosis. We tested translational fusions of LytB1 and LytB2 for functionality in M. tuberculosis, but only a fusion with 90% N-terminal LytB2 and 10% C-terminal LytB1 was functional. In order to identify the key difference between the two proteins, site directed mutagenesis was used to change LytB2 residues into their counterparts in LytB1. None of these amino acid substitutions was essential for function and all lytB2 mutant alleles were functional. In contrast, mutation of the key residues for [Fe4S4] cluster formation, as well as a catalytic residue in LytB1 did not result in functional complementation. Thus, although LytB1 and LytB2 are not genetically redundant, this is not dependent on small amino acid changes, but is likely to be a result of major overall structural differences.

  17. Adoption of the B2SAFE EUDAT replication service by the EPOS community

    Science.gov (United States)

    Cacciari, Claudio; Fares, Massimo; Fiameni, Giuseppe; Michelini, Alberto; Danecek, Peter; Wittenburg, Peter

    2014-05-01

    B2SAFE is the EUDAT service for moving and replicating data between sites and storage systems for different purposes. The goal of B2SAFE is to keep the data from a repository safe by replicating it across different geographical and administrative zones according to a set of well-defined policies. It is also a way to store large volumes of data permanently at those sites which are providing powerful on-demand data analysis facilities. In particular, B2SAFE operates on the domain of registered data where data objects are referable via persistent identifiers (PIDs). B2SAFE is more than just copying data because the PIDs must be carefully managed when data objects are moved or replicated. The EUDAT B2SAFE Service offers functionality to replicate datasets across different data centres in a safe and efficient way while maintaining all information required to easily find and query information about the replica locations. The information about the replica locations and other important information is stored in PID records, each managed in separate administrative domains. The B2SAFE Service is implemented as an iRODS module providing a set of iRODS rules or policies to interface with the EPIC handle API and uses the iRODS middleware to replicate datasets from a source data (or community) centre to a destination data centre. The definition of the dataset(s) to replicate is flexible and up to the communities using the B2SAFE service. While the B2SAFE is internally using the EPIC handle API, communities have the choice to use any PID system they prefer to assign PIDs to their digital objects. A reference to one or more EUDAT B2SAFE PIDs is returned by the B2SAFE service when a dataset is replicated. The presentation will introduce the problem space of B2SAFE, presents the achievements that have been made during the last year for enabling communities to make use of the B2SAFE service, demonstrates a EPOS use cases, outlines the commonalities and differences between the policies

  18. Características produtivas de novilhas submetidas à restrição alimentar e dieta suplementada com vitaminas D e E

    Directory of Open Access Journals (Sweden)

    Marina Parrili

    2011-08-01

    Full Text Available O objetivo deste trabalho foi avaliar os efeitos da restrição alimentar e de dieta de suplementação com vitaminas D e E sobre o desempenho e características de carcaça de novilhas Canchim. Vinte e quatro fêmeas, com peso vivo inicial médio de 251,95±18,49 kg, foram distribuídas em quatro tratamentos: alimentação em quantidade restrita e não restrita, com e sem suplementação de vitaminas D e E. Utilizou-se o delineamento inteiramente casualizado, em arranjo fatorial 2x2, com seis repetições. Os animais com alimentação restrita receberam, por 48 dias, 70% da dieta fornecida ao grupo de alimentação não restrita. Após o período de restrição (peso médio de 300,10 kg, eles voltaram a receber ração à vontade por mais 77 dias, até atingirem peso de abate de 380 kg. As avaliações foram feitas ao final dos períodos de restrição e de realimentação. Não foi observado efeito da restrição alimentar sobre o desempenho animal. Novilhas que não receberam suplementação vitamínica apresentaram maiores índices de fragmentação miofibrilar, luminosidade e mastigabilidade, e menor força de cisalhamento. A restrição alimentar não afeta o desempenho nem as características de carcaça das novilhas Canchim, e a suplementação com vitaminas D e E não melhora a qualidade da carne.

  19. Prevalência de deficiência de vitamina A e fatores associados em pré-escolares de Teresina, Piauí, Brasil

    Directory of Open Access Journals (Sweden)

    Paiva Adriana de Azevedo

    2006-01-01

    Full Text Available A deficiência de vitamina A constitui um problema de saúde pública no Nordeste brasileiro. O objetivo deste estudo foi determinar a prevalência da deficiência de vitamina A e os fatores associados em pré-escolares de Teresina, Piauí, Brasil. Os níveis de retinol sérico foram determinados por HPLC, e foram investigadas as características sócio-econômicas e demográficas de 631 crianças com idade de 36 a 83 meses. Investigou-se a associação entre os níveis de retinol e as variáveis de interesse por análise de regressão linear uni e multivariada. O nível médio de retinol foi de 1,21mmol/L (IC95%: 1,17-1,25µmol/L, independente do sexo (p = 0,259. A hipovitaminose A (retinol < 0,69µmol/L foi observada em 15,4% das crianças (IC95%: 12,7-18,4, com tendência à diminuição com o avanço da idade; 29% das crianças (IC95%: 25,2-32,4 tinham valores aceitáveis de retinol, mas não adequados (0,70 a 1,04µmol/L. Encontrou-se associação positiva entre níveis de retinol e idade, renda per capita, suplementação prévia com vitamina A e escolaridade materna. A prevalência de hipovitaminose A representa um problema moderado de saúde pública, ressaltando a importância das estratégias de combate a essa carência na região.

  20. Mastite clínica em vacas leiteiras suplementadas com selênio e vitamina E Clinical mastitis in dairy cows supplemented with selenium and vitamin E

    Directory of Open Access Journals (Sweden)

    Juliana Jorge Paschoal

    2005-10-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito do selênio e da vitamina E sobre a prevalência de mastite clínica em vacas da raça Holandesa. Oitenta vacas foram distribuídas em quatro tratamentos: controle e suplementação com 2,5 mg selênio dia-1 , com 1.000 UI vitamina E dia-1 e com 2,5 mg selênio + 1.000 UI vitamina E dia-1 . A suplementação foi iniciada 30 dias antes da provável data de parição, prolongando-se até o parto. Amostras do volumoso e do concentrado foram colhidas, quinzenalmente, para análise bromatológica completa e levantamento dos níveis de selênio. O sangue foi colhido antes do início da suplementação, no parto, 30 e 60 dias após o parto, para determinação dos níveis de selênio. O teste de Tamis e a análise clínica do úbere foram realizados semanalmente, para detecção de mastite até a décima segunda semana de lactação. Um mês após a suplementação, as vacas que receberam selênio apresentaram níveis séricos superiores (pThe aim of this work was to evaluate the effect of selenium and vitamin E on incidence of mastitis in Holstein cows. Eighty cows were allocated into four treatments: control, supplementation with 2.5 mg Se day-1, supplementation with 1,000 UI vitamin E day-1 , and supplementation with 2.5 mg Se day-1 + 1,000 UI vitamin E day-1 . The supplementation started 30 days prior to probable parturition date until parturition. Forage and concentrate samples were taken every 15 days for chemical and selenium analyses. Blood samples were taken before starting supplementation, right after parturition, 30 and 60 days after it to determine the selenium serum levels. Tamis test and udder analysis were weekly performed to detect clinical mastitis. Selenium supplemented cows had higher serum selenium concentration compared with control group (P<0.05. Vitamin E and selenium did not decrease the prevalence of clinical mastitis up to 12th week and there was no interaction between those

  1. Prevalencia de deficiencia de vitamina a y anemia en niños menores de cinco años de Perú

    Directory of Open Access Journals (Sweden)

    Jaime Pajuelo

    Full Text Available Objetivos. Determinar la prevalencia de deficiencia de vitamina A (DVA y anemia nutricional (AN, en menores de cinco años en Perú. Materiales y métodos. Estudio transversal con muestreo probabilístico, estratificado y multietápico realizado entre noviembre de 2007 y abril de 2010. Se incluyó 2736 niños para AN y 1465 para DVA. Se definió AN a valores de Hb <11 g/dL. La DVA fue identificada por retinol sérico con valores < 20 µg/dL. Se estudiaron variables sociodemográficas relacionadas con el niño y la madre, además de su participación en programas de control de crecimiento y desarrollo, programa integral nutrición y suplementación con hierro y vitamina A. Se realizó el análisis para muestras complejas, se calculó estadísticas descriptivas y de regresión logística con un IC del 95% y un nivel de significación de p<0,05. Resultados. La prevalencia de DVA fue de 11,7% (IC 95%: 9,4-14,4, las prevalencias más altas fueron en niños menores de cinco meses (44,6%, y que viven en áreas rurales (19,5%. La prevalencia de AN fue de 33% (IC 95%: 29,9-36,1, siendo mayor en los niños menores de 11 meses (68,2% e hijos de madres con 13 a 19 años de edad (55,4%. Conclusiones. La DVA es un problema de salud pública que se mantiene, siendo los más afectados los niños que viven en las áreas rurales y en la selva. La prevalencia de AN muestra una ligera mejora. Es necesario mejorar la eficiencia e impacto de los programas de suplementación con vitamina A y hierro

  2. The response of young and adult rats to the riboflavin supplementation

    Directory of Open Access Journals (Sweden)

    Camille Feitoza França

    2010-08-01

    Full Text Available The aim of this article was to study the response of young and adult rats on the supplementation of diet with riboflavin. Twenty-four young and adult normotensives (Wistar male rats, subdivided into two groups: treated (10mg riboflavin/Kg of body weight and control (receiving vehicle were daily evaluated for physical and behavioural aspects. Systolic blood pressure was determined twice a week and liver toxicity was investigated it the end of treatment. Data were evaluated using one-way ANOVA and pO processo do envelhecimento e alguns transtornos, incluindo hipertensão, foram estreitamente associados ao estresse oxidativo. Em relação à riboflavina (vitamina B2, existe uma possibilidade de que suas propriedades antioxidantes podem contribuir para controlar esse evento. Assim, esse estudo utilizou vinte e quatro ratos machos jovens e velhos normotensos (Wistar, sendo subdivididos em dois grupos: tratado (riboflavina 10 mg / kg de peso corporal e o controle (recebendo veículo. Foram avaliados diariamente aspectos físicos e comportamentais. A pressão arterial sistólica foi determinada duas vezes por semana e a toxicidade hepática foi investigada no final do tratamento. Os dados foram avaliados usando ANOVA one-way e p <0,05. A suplementação não alterou os aspectos de saúde geral dos ratos tratados, no entanto, a suplementação provocou uma significativa (p <0,05 redução da pressão arterial sistólica.

  3. Aspirin Hydrolysis in Plasma Is a Variable Function of Butyrylcholinesterase and Platelet-activating Factor Acetylhydrolase 1b2 (PAFAH1b2)*

    Science.gov (United States)

    Zhou, Gang; Marathe, Gopal K.; Hartiala, Jaana; Hazen, Stanley L.; Allayee, Hooman; Tang, W. H. Wilson; McIntyre, Thomas M.

    2013-01-01

    Aspirin is rapidly hydrolyzed within erythrocytes by a heterodimer of PAFAH1b2/PAFAH1b3 but also in plasma by an unidentified activity. Hydrolysis in both compartments was variable, with a 12-fold variation in plasma among 2226 Cleveland Clinic GeneBank patients. Platelet inhibition by aspirin was suppressed in plasma that rapidly hydrolyzed aspirin. Plasma aspirin hydrolysis was significantly higher in patients with coronary artery disease compared with control subjects (16.5 ± 4.4 versus 15.1 ± 3.7 nmol/ml/min; p = 3.4 × 10−8). A genome-wide association study of 2054 GeneBank subjects identified a single locus immediately adjacent to the BCHE (butyrylcholinesterase) gene associated with plasma aspirin hydrolytic activity (lead SNP, rs6445035; p = 9.1 × 10−17). However, its penetrance was low, and plasma from an individual with an inactivating mutation in BCHE still effectively hydrolyzed aspirin. A second aspirin hydrolase was identified in plasma, the purification of which showed it to be homomeric PAFAH1b2. This is distinct from the erythrocyte PAFAH1b2/PAFAH1b3 heterodimer. Inhibitors showed that both butyrylcholinesterase (BChE) and PAFAH1b2 contribute to aspirin hydrolysis in plasma, with variation primarily reflecting non-genetic variation of BChE activity. Therefore, aspirin is hydrolyzed in plasma by two enzymes, BChE and a new extracellular form of platelet-activating factor acetylhydrolase, PAFAH1b2. Hydrolytic effectiveness varies widely primarily from non-genetic variation of BChE activity that affects aspirin bioavailability in blood and the ability of aspirin to inhibit platelet aggregation. PMID:23508960

  4. Aspirin hydrolysis in plasma is a variable function of butyrylcholinesterase and platelet-activating factor acetylhydrolase 1b2 (PAFAH1b2).

    Science.gov (United States)

    Zhou, Gang; Marathe, Gopal K; Hartiala, Jaana; Hazen, Stanley L; Allayee, Hooman; Tang, W H Wilson; McIntyre, Thomas M

    2013-04-26

    Aspirin is rapidly hydrolyzed within erythrocytes by a heterodimer of PAFAH1b2/PAFAH1b3 but also in plasma by an unidentified activity. Hydrolysis in both compartments was variable, with a 12-fold variation in plasma among 2226 Cleveland Clinic GeneBank patients. Platelet inhibition by aspirin was suppressed in plasma that rapidly hydrolyzed aspirin. Plasma aspirin hydrolysis was significantly higher in patients with coronary artery disease compared with control subjects (16.5 ± 4.4 versus 15.1 ± 3.7 nmol/ml/min; p = 3.4 × 10(-8)). A genome-wide association study of 2054 GeneBank subjects identified a single locus immediately adjacent to the BCHE (butyrylcholinesterase) gene associated with plasma aspirin hydrolytic activity (lead SNP, rs6445035; p = 9.1 × 10(-17)). However, its penetrance was low, and plasma from an individual with an inactivating mutation in BCHE still effectively hydrolyzed aspirin. A second aspirin hydrolase was identified in plasma, the purification of which showed it to be homomeric PAFAH1b2. This is distinct from the erythrocyte PAFAH1b2/PAFAH1b3 heterodimer. Inhibitors showed that both butyrylcholinesterase (BChE) and PAFAH1b2 contribute to aspirin hydrolysis in plasma, with variation primarily reflecting non-genetic variation of BChE activity. Therefore, aspirin is hydrolyzed in plasma by two enzymes, BChE and a new extracellular form of platelet-activating factor acetylhydrolase, PAFAH1b2. Hydrolytic effectiveness varies widely primarily from non-genetic variation of BChE activity that affects aspirin bioavailability in blood and the ability of aspirin to inhibit platelet aggregation.

  5. Half-metallic magnetism in Ti3Co5-xFexB2

    Directory of Open Access Journals (Sweden)

    Rohit Pathak

    2017-05-01

    Full Text Available Bulk alloys and thin films of Fe-substituted Ti3Co5B2 have been investigated by first-principle density-functional calculations. The series, which is of interest in the context of alnico magnetism and spin electronics, has been experimentally realized in nanostructures but not in the bulk. Our bulk calculations predict paramagnetism for Ti3Co5B2, Ti3Co4FeB2 and Ti3CoFe4B2, whereas Ti3Fe5B2 is predicted to be ferromagnetic. The thin films are all ferromagnetic, indicating that moment formation may be facilitated at nanostructural grain boundaries. One member of the thin-film series, namely Ti3CoFe4B2, is half-metallic and exhibits perpendicular easy-axis magnetic anisotropy. The half-metallicity reflects the hybridization of the Ti, Fe and Co 3d orbitals, which causes a band gap in minority spin channel, and the limited equilibrium solubility of Fe in bulk Ti3Co5B2 may be linked to the emerging half-metallicity due to Fe substitution.

  6. SrBeB2O5: Growth, crystal structure and optical properties

    International Nuclear Information System (INIS)

    Yao, Wenjiao; Wang, Xiaoshan; Huang, Hongwei; Xu, Tao; Jiang, Xingxing; Wang, Xiaoyang; Lin, Zheshuai; Chen, Chuangtian

    2014-01-01

    Graphical abstract: The crystal displays a layered configuration along c axis with the wrinkled infinite (BeB 2 O 5 ) ∞ layers. Display Omitted - Highlights: • A new beryllium borate SrBeB 2 O 5 was synthesized. • A layered structure (BeB 2 O 5 ) ∞ was formed by BO 3 triangles and B/BeO 4 tetrahedrons. • SrBeB 2 O 5 has a very wide transparency range of wavelengths from 200 nm to 1800 nm. • A-site ions impact greatly on the structures of beryllium borates. - Abstract: A novel beryllium borate SrBeB 2 O 5 is discovered for the first time through traditional solid state reaction and high temperature solution method. The framework of the structure is composed by two-dimensional [BeB 2 O 5 ] layers determined from single-crystal X-ray diffraction data. The further structural analysis of beryllium borates reveals that the arrangement of anionic groups attributes to the structural stability. Moreover, the influences of the A-site cations on the structural features of fundamental building blocks in the alkaline or alkaline earth beryllium borates are discussed. The UV–Vis–NIR diffuse-reflectance pattern reveals that this compound has a very wide transparency range of wavelengths down to 200 nm. In addition, the properties of SrBeB 2 O 5 were also characterized by powder X-ray diffraction, differential scanning calorimetry, and IR spectroscopy

  7. MgB2 thick films on three-dimensional structures fabricated by HPCVD

    Science.gov (United States)

    Guo, Zhengshan; Cai, Xingwei; Liao, Xuebin; Chen, Yiling; Yang, Can; Niu, Ruirui; Luo, Wenhao; Huang, Zigeng; Feng, Qingrong; Gan, Zizhao

    2018-06-01

    Magnetic shielding has been a key factor in the measurement of ultra-weak magnetic fields, especially for shielding from low frequency electromagnetic noise. With the recent development of superconducting quantum interference devices, superconducting magnetic shielding has become an important area of research. MgB2 has shown great potential in magnetic shielding for its remarkable superconducting properties, the feasibility of its use in this capacity having been demonstrated by MgB2 bulk samples. However, the potential for application of such bulk samples is limited. In this work, we have investigated the possibility of the fabrication of MgB2 films on three-dimensional (3D) structures using a hybrid physical‑chemical vapor deposition system. MgB2 films 10 μm thick have been fabricated on the outer surface of a polycrystalline Al2O3 cylinder. The deposited film showed a transition temperature (TC) of 39 K and J C of 5.1 × 105 A · cm‑2, which are comparable to those of planar MgB2 films. This work shows the feasibility of depositing MgB2 films onto a 3D structure, and sheds light on the potential use of MgB2 films in superconducting magnetic shielding.

  8. Platelet thromboxane B2-formation in end-stage kidney disease and after kidney transplantation

    International Nuclear Information System (INIS)

    Stefanovic, V.; Lecic, N.

    1986-01-01

    The aim of this work was to analyse TxB 2 formation by platelets in endstage kidney disease patients and in kidney graft recipients. Four groups of patients were studied: 12 preterminal chronic renal failure patients, 42 patients on maintenance hemodialysis, 8 patients on CAPD and 11 grafted patients. TxB 2 production by platelets was determined in serum following spontaneous blood clotting for 1/2 h at 37 0 C. Hemodialysis patients generated 80.7 ± 9.6 ng/ml (mean ± S.E.M.) of TxB 2 which was significantly (p 2 formation in hemodialysis patients had no relationship with the residual kidney function. Patients on CAPD produced 65.0 ± 12.7 ng/ml of TxB 2 . Very low TxB 2 generation was obtained also in preterminal chronic renal failure patients (57.0 ± 11.8 ng/ml). Kidney graft recipients had a mean TxB 2 production of 81.6 ± 24.2 ng/ml with a range from 12.5-200 ng/ml. Very low TxB 2 was formed in grafted patients with renal failure. (orig.) [de

  9. Antitumor and angiostatic activities of the antimicrobial peptide dermaseptin B2.

    Science.gov (United States)

    van Zoggel, Hanneke; Carpentier, Gilles; Dos Santos, Célia; Hamma-Kourbali, Yamina; Courty, José; Amiche, Mohamed; Delbé, Jean

    2012-01-01

    Recently, we have found that the skin secretions of the Amazonian tree frog Phyllomedusa bicolor contains molecules with antitumor and angiostatic activities and identified one of them as the antimicrobial peptide dermaseptin (Drs) B2. In the present study we further explored the in vitro and in vivo antitumor activity of this molecule and investigated its mechanism of action. We showed that Drs B2 inhibits the proliferation and colony formation of various human tumor cell types, and the proliferation and capillary formation of endothelial cells in vitro. Furthermore, Drs B2 inhibited tumor growth of the human prostate adenocarcinoma cell line PC3 in a xenograft model in vivo. Research on the mechanism of action of Drs B2 on tumor PC3 cells demonstrated a rapid increasing amount of cytosolic lactate dehydrogenase, no activation of caspase-3, and no changes in mitochondrial membrane potential. Confocal microscopy analysis revealed that Drs B2 can interact with the tumor cell surface, aggregate and penetrate the cells. These data together indicate that Drs B2 does not act by apoptosis but possibly by necrosis. In conclusion, Drs B2 could be considered as an interesting and promising pharmacological and therapeutic leader molecule for the treatment of cancer.

  10. Antitumor and angiostatic activities of the antimicrobial peptide dermaseptin B2.

    Directory of Open Access Journals (Sweden)

    Hanneke van Zoggel

    Full Text Available Recently, we have found that the skin secretions of the Amazonian tree frog Phyllomedusa bicolor contains molecules with antitumor and angiostatic activities and identified one of them as the antimicrobial peptide dermaseptin (Drs B2. In the present study we further explored the in vitro and in vivo antitumor activity of this molecule and investigated its mechanism of action. We showed that Drs B2 inhibits the proliferation and colony formation of various human tumor cell types, and the proliferation and capillary formation of endothelial cells in vitro. Furthermore, Drs B2 inhibited tumor growth of the human prostate adenocarcinoma cell line PC3 in a xenograft model in vivo. Research on the mechanism of action of Drs B2 on tumor PC3 cells demonstrated a rapid increasing amount of cytosolic lactate dehydrogenase, no activation of caspase-3, and no changes in mitochondrial membrane potential. Confocal microscopy analysis revealed that Drs B2 can interact with the tumor cell surface, aggregate and penetrate the cells. These data together indicate that Drs B2 does not act by apoptosis but possibly by necrosis. In conclusion, Drs B2 could be considered as an interesting and promising pharmacological and therapeutic leader molecule for the treatment of cancer.

  11. ErbB2 resembles an autoinhibited invertebrate epidermal growth factor receptor

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado, Diego; Klein, Daryl E.; Lemmon, Mark A.; (UPENN-MED)

    2009-09-25

    The orphan receptor tyrosine kinase ErbB2 (also known as HER2 or Neu) transforms cells when overexpressed, and it is an important therapeutic target in human cancer. Structural studies have suggested that the oncogenic (and ligand-independent) signalling properties of ErbB2 result from the absence of a key intramolecular 'tether' in the extracellular region that autoinhibits other human ErbB receptors, including the epidermal growth factor (EGF) receptor. Although ErbB2 is unique among the four human ErbB receptors, here we show that it is the closest structural relative of the single EGF receptor family member in Drosophila melanogaster (dEGFR). Genetic and biochemical data show that dEGFR is tightly regulated by growth factor ligands, yet a crystal structure shows that it, too, lacks the intramolecular tether seen in human EGFR, ErbB3 and ErbB4. Instead, a distinct set of autoinhibitory interdomain interactions hold unliganded dEGFR in an inactive state. All of these interactions are maintained (and even extended) in ErbB2, arguing against the suggestion that ErbB2 lacks autoinhibition. We therefore suggest that normal and pathogenic ErbB2 signalling may be regulated by ligands in the same way as dEGFR. Our findings have important implications for ErbB2 regulation in human cancer, and for developing therapeutic approaches that target novel aspects of this orphan receptor.

  12. Anticonvulsant activity of B2, an adenosine analog, on chemical convulsant-induced seizures.

    Directory of Open Access Journals (Sweden)

    Min Li

    Full Text Available Epilepsy is a chronic neurological disorder characterized by recurrent seizures. However, approximately one-third of epilepsy patients still suffer from uncontrolled seizures. Effective treatments for epilepsy are yet to be developed. N (6-(3-methoxyl-4-hydroxybenzyl adenine riboside (B2 is a N(6-substitued adenosine analog. Here we describe an investigation of the effects and mechanisms of B2 on chemical convulsant-induced seizures. Seizures were induced in mice by administration of 4-aminopyridine (4-AP, pentylenetetrazol (PTZ, picrotoxin, kainite acid (KA, or strychnine. B2 has a dose-related anticonvulsant effect in these chemical-induced seizure models. The protective effects of B2 include increased latency of seizure onset, decreased seizure occurrence, shorter seizure duration and reduced mortality rate. Radioligand binding and cAMP accumulation assays indicated that B2 might be a functional ligand for both adenosine A1 and A2A receptors. Furthermore, DPCPX, a selective A1 receptor antagonist, but not SCH58261, a selective A2A receptor antagonist, blocked the anticonvulsant effect of B2 on PTZ-induced seizure. c-Fos is a cellular marker for neuronal activity. Immunohistochemical and western blot analyses indicated that B2 significantly reversed PTZ-induced c-Fos expression in the hippocampus. Together, these results indicate that B2 has significant anticonvulsant effects. The anticonvulsant effects of B2 may be attributed to adenosine A1 receptor activation and reduced neuronal excitability in the hippocampus. These observations also support that the use of adenosine receptor agonist may be a promising approach for the treatment of epilepsy.

  13. Procyanidin dimer B2-mediated IRAK-M induction negatively regulates TLR4 signaling in macrophages

    Energy Technology Data Exchange (ETDEWEB)

    Sung, Nak-Yun [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Yang, Mi-So [Department of Microbiology, Infection Signaling Network Research Center, College of Medicine, Chungnam National University, Daejeon (Korea, Republic of); Song, Du-Sub [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); School of life sciences and Biotechnology, Korea University 5-ka, Anam-Dong, Sungbuk-ku, Seoul 136-701 (Korea, Republic of); Kim, Jae-Kyung; Park, Jong-Heum; Song, Beom-Seok; Park, Sang-Hyun; Lee, Ju-Woon [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Park, Hyun-Jin [School of life sciences and Biotechnology, Korea University 5-ka, Anam-Dong, Sungbuk-ku, Seoul 136-701 (Korea, Republic of); Kim, Jae-Hun [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Byun, Eui-Baek, E-mail: ebbyun80@kaeri.re.kr [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Byun, Eui-Hong, E-mail: ehbyun80@kongju.ac.k [Department of Food Science and Technology, Kongju National University, Yesan 340-800 (Korea, Republic of)

    2013-08-16

    Highlights: •Pro B2 elevated the expression of IRAK-M, a negative regulator of TLR signaling. •LPS-induced expression of cell surface molecules was inhibited by Pro B2. •LPS-induced production of pro-inflammatory cytokines was inhibited by Pro B2. •Pro B2 inhibited LPS-induced activation of MAPKs and NF-κB through IRAK-M. •Pro B2 inactivated naïve T cells by inhibiting LPS-induced cytokines via IRAK-M. -- Abstract: Polyphenolic compounds have been found to possess a wide range of physiological activities that may contribute to their beneficial effects against inflammation-related diseases; however, the molecular mechanisms underlying this anti-inflammatory activity are not completely characterized, and many features remain to be elucidated. In this study, we investigated the molecular basis for the down-regulation of toll-like receptor 4 (TLR4) signal transduction by procyanidin dimer B2 (Pro B2) in macrophages. Pro B2 markedly elevated the expression of the interleukin (IL)-1 receptor-associated kinase (IRAK)-M protein, a negative regulator of TLR signaling. Lipopolysaccharide (LPS)-induced expression of cell surface molecules (CD80, CD86, and MHC class I/II) and production of pro-inflammatory cytokines (tumor necrosis factor-α, IL-1β, IL-6, and IL-12p70) were inhibited by Pro B2, and this action was prevented by IRAK-M silencing. In addition, Pro B2-treated macrophages inhibited LPS-induced activation of mitogen-activated protein kinases such as extracellular signal-regulated kinase 1/2, p38, and c-Jun N-terminal kinase and the translocation of nuclear factor κB and p65 through IRAK-M. We also found that Pro B2-treated macrophages inactivated naïve T cells by inhibiting LPS-induced interferon-γ and IL-2 secretion through IRAK-M. These novel findings provide new insights into the understanding of negative regulatory mechanisms of the TLR4 signaling pathway and the immune-pharmacological role of Pro B2 in the immune response against the development

  14. B2B-uutiskirjeen visuaalisen ilmeen kehitys — Case Tamtron Solutions Oy

    OpenAIRE

    Salo, Sari

    2014-01-01

    Opinnäytetyön tarkoituksena oli kehittää Tamtron Solutions Oy:n uutiskirjeelle uusi visuaalinen ilme. Yrityksen lähettämästä uutiskirjeestä yritysasiakkaille puhutaan B2B-uutiskirjeenä. Tamtron Solutions Oy halusi B2B-uutiskirjeen avulla tehostaa markkinointia, kasvattaa myyntiä ja luoda uusia asiakassuhteita. Yritys halusi toteuttaa markkinointikampanjan B2B-uutiskirjeen muodossa rakennusalan yrityksille. Yritys valitsi kampanjan kohderyhmäksi rakennusalan yritykset, koska lakimuutos rakennu...

  15. Growth of high quality large area MgB2 thin films by reactive evaporation

    OpenAIRE

    Moeckly, Brian H.; Ruby, Ward S.

    2006-01-01

    We report a new in-situ reactive deposition thin film growth technique for the production of MgB2 thin films which offers several advantages over all existing methods and is the first deposition method to enable the production of high-quality MgB2 films for real-world applications. We have used this growth method, which incorporates a rotating pocket heater, to deposit MgB2 films on a variety of substrates, including single-crystalline, polycrystalline, metallic, and semiconductor materials u...

  16. First principle study of UHTC ternary diboride, Cr2AlB2

    Science.gov (United States)

    Rastogi, Anugya; Rajpoot, Priyanka; Verma, U. P.

    2018-04-01

    In this paper ab-initio study of the structural, electronic and optical properties of ternary metal boride Cr2AlB2 using full potential linear augmented plane wave (FP-LAPW) method based on the density functional theory (DFT). The study of structural properties shows that Cr2AlB2 is metallic in nature and have orthorhombic crystal structure. The optical properties show that it possess anisotropic behavior, which have wide applications in electricity production through concentration of solar power (CSP) technology. To the best of our knowledge, theoretical study of the optical properties of Cr2AlB2 is reported for the first time.

  17. Strategic B2B customer experience management: the importance of outcomes-based measures

    OpenAIRE

    Zolkiewski, Judy; Story, Victoria; Burton, Jamie; Chan, Paul; Gomes, Andre; Hunter-Jones, Philippa; O’Malley, Lisa; Peters, Linda D.; Raddats, Chris; Robinson, William

    2017-01-01

    Purpose\\ud \\ud The purpose of this paper is to critique the adequacy of efforts to capture the complexities of customer experience in a business-to-business (B2B) context using input–output measures. The paper introduces a strategic customer experience management framework to capture the complexity of B2B service interactions and discusses the value of outcomes-based measurement.\\ud Design/methodology/approach\\ud \\ud This is a theoretical paper that reviews extant literature related to B2B cu...

  18. Using service design methods for B2b service brand concept development: Case company

    OpenAIRE

    Molina Escalante, Hugo

    2014-01-01

    A short time before this study was initiated, a small B2b service company had just began op-erating its business without a brand of it’s own. The company owners were looking to design an innovative brand for their business. The purpose of this thesis was to develop the brand for this service Company in the B2b context, using practical service design and Strategic design research methods. This thesis report represents a framework for developing a B2b service brand using research methods c...

  19. Soliton cellular automaton associated with Dn(1)-crystal B2,s

    Science.gov (United States)

    Misra, Kailash C.; Wilson, Evan A.

    2013-04-01

    A solvable vertex model in ferromagnetic regime gives rise to a soliton cellular automaton which is a discrete dynamical system in which site variables take on values in a finite set. We study the scattering of a class of soliton cellular automata associated with the U_q(D_n^{(1)})-perfect crystal B2, s. We calculate the combinatorial R matrix for all elements of B2, s ⊗ B2, 1. In particular, we show that the scattering rule for our soliton cellular automaton can be identified with the combinatorial R matrix for U_q(A_1^{(1)}) oplus U_q(D_{n-2}^{(1)})-crystals.

  20. Improving magnetic properties of MgB_2 bulk superconductors by synthetic engine oil treatment

    International Nuclear Information System (INIS)

    Taylan Koparan, E.; Savaskan, B.; Yanmaz, E.

    2016-01-01

    Highlights: • The effects of synthetic engine oil treatment on magnetic properties of bulk MgB_2 superconductors has been first time investigated and reported. • Synthetic engine oil used as a product which is cheap and a rich carbon source obviously has improved the superconducting magnetic properties of MgB_2. • The critical current density of all of MgB_2 samples immersed at different standby time in engine oil in whole field range has been better than that of the pure MgB_2 sample. • The MgB_2 sample immersed at 300 min standby time in synthetic engine oil has the best performance compared to other samples. - Abstract: The present study focuses on the effects of standby time of the MgB_2 samples immersed in synthetic engine oil on the critical current density ( J_c(H)), magnetic field dependence of the pinning force density f_p(b) and T_c performances of MgB_2 bulk superconductors. Synthetic engine oil was used as a product which is cheap and a rich carbon source. Manufactured MgB_2 pellet samples were immersed at different standby time of 30 min, 120 min, 300 min and 1440 min in synthetic engine oil after the first heating process. Finally, MgB_2 samples immersed in synthetic engine oil were sintered at 1000 °C and kept for 15 min in Ar atmosphere. The critical current density of all of MgB_2 samples immersed at different standby time in engine oil in whole field range was better than that of the pure MgB_2 sample because of the number of the pinning centers. The MgB_2 sample immersed at 300 min standby time in synthetic engine oil has the best performance compared to other samples. The J_c value for the pure sample is 2.0 × 10"3 A/cm"2, whereas for the MgB_2 sample immersed at 300 min standby time in engine oil the J_c is enhanced to 4.8 × 10"3 A/cm"2 at 5 K and 3 T. The superconducting transition temperature (T_c) did not change with the increasing standby time of the samples in synthetic engine oil at all. The best diamagnetic property was

  1. PURIFICAÇÃO DA ASCORBATO-OXIDASE POR ELETROELUIÇÃO PARA DETERMINAÇÃO DE VITAMINA C

    Directory of Open Access Journals (Sweden)

    Ligia Renata FIRMINO

    2009-07-01

    Full Text Available

    O método de eletroeluição revelou-se eficiente, rápido e simples para purificar a enzima ascorbato-oxidase de abobrinha (Cucurbita pepo medulosa A atividade específica da enzima, após a eletroeluição, foi da ordem de 1.421 U/mg de proteína, obtendo-se nessa etapa um fator de purificação de 152,8 vezes. O conteúdo de vitamina C de alimentos e medicamento foi determinado com a enzima purificada e comparado com o método titulométrico que utiliza o DFI.

  2. Vitaminas e antioxidantes na degeneração macular relacionada à idade Vitamins and antioxidants in age-related macular degeneration

    Directory of Open Access Journals (Sweden)

    Pedro Durães Serracarbassa

    2006-06-01

    Full Text Available O autor descreve os efeitos bioquímicos e estruturais das vitaminas e antioxidantes na retina. Apresenta as principais substâncias presentes na dieta alimentar e na suplementação vitamínica envolvidas na gênese da degeneração macular relacionada à idade. Relata ainda os resultados de estudos prospectivos multicêntricos relacionados ao assunto, por meio de revisão bibliográfica.The author describes biochemical and structural effects of vitamins and antioxidants on the retina. The main substances present in diet food and vitamin supplies involved in the genesis of age-related macular degeneration are shown. Also reports on the outcomes of prospective studies related to the subject, by literature review are presented.

  3. Determinación cuantitativa de vitamina C y pigmentos y procesamiento de la papa criolla, variedad yema de huevo (Solanum phureja Juz et Buck

    Directory of Open Access Journals (Sweden)

    Isabel Alvarez G.

    2009-07-01

    Full Text Available Empleando papa pardo'pastusa (Solanum tuberosum como control, se determinó el contenido de Vitamina C total en la papa criolla, variedad Yema de Huevo (Solanum phureja, Juz et Buck y se evaluaron las pérdidas durante la cocción y el freído. Se utilizaron los métodos colorimétrico y densitométrico: el primero dio resultados altos debido a sustancias interferentes; el segundo reportó los siguientes valores: criolla 21 mg/100 g, pardo-pastusa 18 mg/100 g (para muestra fresca. Las pérdidas de Vitamina C de papa criolla con piel fueron durante la cocción {92°C durante 25' de 1 9 % y en el freído (175°C por 3' de 30%. También se analizaron los carotenos y xantofilas dando: carotenos en papa criolla, 1.5 mg/100 g, en pardo-pastusa 0.5 mg/100 g (muestra fresca y xantofilas en papa criolla 0.6 mg/100 g, en pardo-pastusa 0.13 mg/100 g. Se procesó en las siguientes formas no tradicionales: en harinas compuestas aceptadas por ios consumidores, en una sustitución del 2 0% con puré; frita en tajadas con piel y pasabocas de puré. El tiempo de vida fue para frita tres semanas a 16°C V más de una semana a 25°C; para pasabocas cinco semanas y media a 16 C y un mes a 30°C.

  4. Quantificação de vitamina C e capacidade antioxidante de variedades cítricas Quantification of vitamin C and antioxidant capacity of citrus varieties

    Directory of Open Access Journals (Sweden)

    Meylene Aparecida Luzia Couto

    2010-05-01

    Full Text Available A pesquisa teve por objetivo avaliar a variação do teor de vitamina C em diferentes variedades de laranjas e tangerinas de significado comercial no Brasil, como também medir a capacidade antioxidante destes citros. Foram realizadas análises para avaliação do índice de maturação no suco dos citros, como pH, sólidos solúveis totais e acidez total titulável, e foram determinados os teores de vitamina C e capacidade antioxidante, sendo os dados comparados para verificar as diferenças pelo teste de Tukey (p The objective of this research was to evaluate the variation of vitamin C in different commercial varieties of oranges and tangerines in Brazil and to measure the antioxidant capacity of these citrus. The analyses done for the evaluation of the maturity index of the citrus juices were pH, total soluble solids,and total tritimetric acidity. The antioxidant capacity of vitamin C was also quantified. The data obtained was submitted to statistical analysis using the Tukey test (p < 0.05. The tangerines presented lower levels of vitamin C and lower antioxidant capacity than the oranges. The vitamin C content of the the Murcot tangerine and Natal orange varied between 21.47 and 84.03 mg ascorbic acid .100 mL-1 juice, respectively. The Murcot tangerine exhibited the smallest antioxidant capacity (12.78%, and the sweet orange exhibited the largest antioxidant capacity (66.24%. The conclusion was that the different varieties of oranges and tangerines had a significant variation in the variables analyzed, and that the oranges presented the largest levels of vitamin C and the largest antioxidant capacity.

  5. Data of evolutionary structure change: 1CG5B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5B-2ZLWD 1CG5 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK...224 GLY CA 259 2ZLW D 2ZLWD...W D 2ZLWD ELHCDKLHVDP

  6. Data of evolutionary structure change: 1CG8B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG8B-2ZLWD 1CG8 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK... GLY CA 249 2ZLW D 2ZLWD...2ZLW D 2ZLWD ELHCDKLHVDP

  7. Phthalocyanine doping to improve critical current densities in MgB2 tapes

    International Nuclear Information System (INIS)

    Zhang Xianping; Ma Yanwei; Wang Dongliang; Gao Zhaoshun; Wang Lei; Qi Yanpeng; Awaji, Satoshi; Watanabe, Kazuo; Mossang, Eric

    2009-01-01

    Phthalocyanine-doped MgB 2 tapes were prepared by the in situ powder-in-tube method. The relationships between the critical current properties, crystallinity and microstructure were studied as a function of the phthalocyanine doping level. It is found that both H irr and H c2 were improved when MgB 2 samples were doped with phthalocyanine, which are mainly attributed to the effective carbon substitution and enhanced flux pinning strength caused by very fine grain sizes. Furthermore, compared to pure samples, the MgO content remained almost unchanged in all doped tapes, which is very beneficial to having better grain connectivity in MgB 2 . Significantly improved J c was obtained in the phthalocyanine-doped MgB 2 tapes, especially under high magnetic fields.

  8. Tissue-specific alternative splicing and expression of ATP1B2 gene

    African Journals Online (AJOL)

    user6

    2012-05-15

    May 15, 2012 ... retention; these isoforms were found in liver, kidney, muscle and breast tissues. ... lower levels than the complete ATP1B2 gene transcript in all the ... temperature. ... growth, differentiation, and disease (Zhou et al., 2002;.

  9. Progress in the deposition of MgB2 thin films

    International Nuclear Information System (INIS)

    Xi, X X; Pogrebnyakov, A V; Zeng, X H; Redwing, J M; Xu, S Y; Li, Qi; Liu, Zi-Kui; Lettieri, J; Vaithyanathan, V; Schlom, D G; Christen, H M; Zhai, H Y; Goyal, A

    2004-01-01

    An MgB 2 thin film deposition technology is the first critical step in the development of superconducting electronics utilizing the 39 K superconductor. It turned out to be a challenging task due to the volatility of Mg and phase stability of MgB 2 , the low sticking coefficients of Mg at elevated temperatures, and the reactivity of Mg with oxygen. A brief overview of current deposition techniques is provided here from a thermodynamic perspective, with an emphasis on a very successful technique for high quality in situ epitaxial MgB 2 films, the hybrid physical-chemical vapour deposition. Examples of heterostructures of MgB 2 with other materials are also presented

  10. The Importance of Brand on B2B Markets: Expert Interviews with Hilti AG Managers

    Directory of Open Access Journals (Sweden)

    Martin Konečný

    2013-12-01

    Full Text Available This paper investigates the importance of brand building in the business-to-business world. Not only B2C companies must take branding into account and put it among their top priorities in order to survive and succeed on the market. The first part of the article deals with the theoretical background of brand importance and market specifics of B2B markets and results in the setting of two hypotheses. The following research has to find out how the managers of a pure business-to-business company perceive the importance of a brand; moreover, it has to evaluate the importance of eight specific brand building factors. Fourteen expert interviews document the growing of brands in the B2B market and their main aspects. At the end of the article, we will focus on future implications for B2B management.

  11. Molecular-Beam Epitaxially Grown MgB2 Thin Films and Superconducting Tunnel Junctions

    Directory of Open Access Journals (Sweden)

    Jean-Baptiste Laloë

    2011-01-01

    Full Text Available Since the discovery of its superconducting properties in 2001, magnesium diboride has generated terrific scientific and engineering research interest around the world. With a of 39 K and two superconducting gaps, MgB2 has great promise from the fundamental point of view, as well as immediate applications. Several techniques for thin film deposition and heterojunction formation have been established, each with its own advantages and drawbacks. Here, we will present a brief overview of research based on MgB2 thin films grown by molecular beam epitaxy coevaporation of Mg and B. The films are smooth and highly crystalline, and the technique allows for virtually any heterostructure to be formed, including all-MgB2 tunnel junctions. Such devices have been characterized, with both quasiparticle and Josephson tunneling reported. MgB2 remains a material of great potential for a multitude of further characterization and exploration research projects and applications.

  12. Data of evolutionary structure change: 1VL8B-2UVDE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1VL8B-2UVDE 1VL8 2UVD B E VFDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRN...seq1> --MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKL-GSDAIAVRADVANA...D E 2UVDE VNYAGNEQKAN E 2UVDE EIKKL-GSDAI 2 2UVD E 2UVDE

  13. Lectin receptor kinase LecRK-b2 localizes to plasma membrane and ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-07-20

    Jul 20, 2009 ... Furthermore, the recombinant LecRK-b2 protein exhibited autophosphorylation ... absence of ligand (Giranton et al., 2000; Shimosato et al.,. 2007), while some ..... Elicitin and Mediates INF1-induced Cell Death. Planta, 228: ...

  14. Controlled indole-3-acetaldoxime production through ethanol-induced expression of CYP79B2

    DEFF Research Database (Denmark)

    Mikkelsen, M.D.; Fuller, V.L.; Hansen, Bjarne Gram

    2009-01-01

    Indole-3-acetaldoxime (IAOx) is a key branching point between primary and secondary metabolism. IAOx serves as an intermediate in the biosynthesis of indole glucosinolates (I-GLSs), camalexin and the plant hormone indole-3-acetic acid (IAA). The cytochrome P450s CYP79B2 and CYP79B3 catalyze......OH)-inducible CYP79B2 construct into double (cyp79b2 cyp79b3) or triple (cyp79b2 cyp79b3 cyp83b1) mutant lines. We show EtOH-dependent induction of camalexin and identify a number of candidate IAA homeostasis- or defense-related genes by clustered microarray analysis. The transgenic mutant lines are thus promising...

  15. Gibberellic acid, amino acids (glycine and L-leucine), vitamin B2 ...

    African Journals Online (AJOL)

    SAM

    2014-03-14

    Mar 14, 2014 ... vitamin B2 and zinc as factors affecting the production pigments by Monascus ..... in a nitrogen-deficient medium, the B-group vitamins, both single ... citrinin production in the industrial important strain Monascus purpureus ...

  16. Investigations into the PbO-TeO2-B2O3 glass system

    International Nuclear Information System (INIS)

    Basariya, F.P.; Gugushvili, G.M.

    1975-01-01

    Based on the results of investigations of the system A-TeO 2 -B 2 O 3 and from the ternary phase diagram a region is determined of stable nonorganic glasses of the system PbO-TeO 2 -B 2 O 3 noncrystallizable at a temperature of 300 0 C and showing satisfactory chemical stability, as well as satisfactory isolation properties up to 300 0 C. On addition of an optimum amount of tellurium oxide one can obtain low-melting glasses with a temperature interval of 250-300 0 C. It is established that the substitution of PbO by TeO 2 or B 2 O 3 , or TeO 2 by B 2 O 3 leads to a decrease in the glass density. (author)

  17. Novel Peptide/Protein Delivery System Targeting erbB2-Overexpressing Breast Cancer Cells

    National Research Council Canada - National Science Library

    Yu, Dihua

    2002-01-01

    .... During this funding year, we focused on the delivery of erbB2 signal-blocking ESP peptides (objective 2) . Because of the complexity of biotin-penetratin-AHNP-ESP, the synthesis was unsuccessful...

  18. Safety Analysis Report: X17B2 beamline Synchrotron Medical Research Facility

    International Nuclear Information System (INIS)

    Gmuer, N.F.; Thomlinson, W.

    1990-02-01

    This report contains a safety analysis for the X17B2 beamline synchrotron medical research facility. Health hazards, risk assessment and building systems are discussed. Reference is made to transvenous coronary angiography

  19. Pressure induced structural phase transition of OsB 2: First-principles calculations

    Science.gov (United States)

    Ren, Fengzhu; Wang, Yuanxu; Lo, V. C.

    2010-04-01

    Orthorhombic OsB 2 was synthesized at 1000 °C and its compressibility was measured by using the high-pressure X-ray diffraction in a Diacell diamond anvil cell from ambient pressure to 32 GPa [R.W. Cumberland, et al. (2005)]. First-principles calculations were performed to study the possibility of the phase transition of OsB 2. An analysis of the calculated enthalpy shows that orthorhombic OsB 2 can transfer to the hexagonal phase at 10.8 GPa. The calculated results with the quasi-harmonic approximation indicate that this phase transition pressure is little affected by the thermal effect. The calculated phonon band structure shows that the hexagonal P 6 3/ mmc structure (high-pressure phase) is stable for OsB 2. We expect the phase transition can be further confirmed by the experimental work.

  20. 1300 micron continuum observations of the Sagittarius B2 molecular cloud core

    International Nuclear Information System (INIS)

    Goldsmith, P.F.; Snell, R.L.; Lis, D.C.

    1987-01-01

    Observations with 23-arcsec angular resolution are obtained of the continuum emission at 1300 microns wavelength from the central region of the Sgr B2 molecular cloud, which contains the north and middle high-mass star-forming regions and associated radio continuum and maser sources. The spatial resolution of the present data shows that the 1300-micron continuum emission peak is located at Sgr B2(N), in contrast to the midinfrared emission, which is centered on Sgr B2(M). Comparison with 53 micron data having comparable angular resolution suggests that there is optically thick foreground dust which prevents detection of Sgr B2(N) at wavelengths not greater than 100 microns. Within the about 1.5 x 3.5 pc region mapped, the total mass is 500,000 solar masses and the mean H2 density is 300,000/cu cm, somewhat larger than found in previous investigations. 27 references

  1. Successful treatment of hereditary angioedema with bradykinin B2-receptor antagonist icatibant.

    Science.gov (United States)

    Krause, Karoline; Metz, Martin; Zuberbier, Torsten; Maurer, Marcus; Magerl, Markus

    2010-04-01

    The bradykinin B2 receptor antagonist icatibant has recently become available for treating hereditary angioedema. Our observations demonstrate icatibant to be effective and safe for the treatment of both, abdominal and cutaneous attacks in a practice setting beyond clinical studies.

  2. Evidence of diketopiperazine and oxazolone structures for HA b2+ ion.

    Science.gov (United States)

    Perkins, Brittany R; Chamot-Rooke, Julia; Yoon, Sung Hwan; Gucinski, Ashley C; Somogyi, Arpád; Wysocki, Vicki H

    2009-12-09

    Peptide fragmentation can lead to an oxazolone or diketopiperazine b(2)(+) ion structure. IRMPD spectroscopy combined with computational modeling and gas-phase H/D exchange was used to study the structure of the b(2)(+) ion from protonated HAAAA. The experimental spectrum of the b(2)(+) ion matches both the experimental spectrum for the protonated cyclic dipeptide HA (a commercial diketopiperazine) and the theoretical spectrum for a diketopiperazine protonated at the imidazole pi nitrogen. A characteristic band at 1875 cm(-1) and increased abundance of the peaks at 1619 and 1683 cm(-1) indicate a second population corresponding to an oxazolone species. H/D exchange also shows a mixture of two populations consistent with a mixture of b(2)(+) ion diketopiperazine and oxazolone structures.

  3. Development of MgB2 superconductor wire with high critical current

    International Nuclear Information System (INIS)

    Kim, Chan Joong; Jun, Byung Hyuk; Park, Soon Dong; Kim, Nam Kyu; Kim, Yi Jeong; Yi, Ji Hye; Lee, Ji Hyun; Tan, Kai Sin

    2009-07-01

    The MgB 2 superconductor with smaller grain size could improve its critical properties by providing flux pinning centers with high grain boundary density. The effects of C doping such as charcoal, paper ash and glycerin on the superconducting properties was investigated for in situ processed MgB 2 samples using low purity semi-crystalline B powder. The results show a decrease in Tc and an enhancement of Jc at high fields for the C-doped samples as compared to the un-doped samples. A combined process of a mechanical ball milling and liquid glycerin (C 3 H 8 O 3 ) treatment of B powder has been conducted to enhance the superconducting properties of MgB 2 . The mechanical ball milling was effective for grain refinement, and a lattice disorder was easily achieved by glycerin addition. With the combined process, the critical properties was further increased due to a higher grain boundary density and a greater C substitution. To get fine grain structure of MgB 2 with high critical current properties, mechanical milling for as-received B powder and low temperature solid-state reaction of 550 or 600 .deg. C were attempted to in situ powder-in-tube processed MgB 2 /Fe wires. The critical current properties of the MgB 2 wires using the milled B powder were enhanced due to a smaller grain size and an increased volume of the superconducting phase. The solid-state reaction of a low temperature process for the samples using the milled B powder resulted in a poorer crystallinity with a smaller grain size, which improved superconducting properties. We established the system to measure the transport current properties of the MgB 2 wires. The field dependence of the transport Jc was evaluated for the MgB 2 wires heat-treated at different heat treatment conditions using ball-milled and glycerin-treated B powder. The MgB 2 magnet was developed and the AC loss of MgB 2 wire was also investigated. A conduction cooling device to cool the MgB 2 coil down to 4 K has been fabricated and the

  4. Exceptional quantum subgroups for the rank two Lie algebras B2 and G2

    CERN Document Server

    Coquereaux, R.; Tahri, E.H.

    2010-01-01

    Exceptional modular invariants for the Lie algebras B2 (at levels 2,3,7,12) and G2 (at levels 3,4) can be obtained from conformal embeddings. We determine the associated alge bras of quantum symmetries and discover or recover, as a by-product, the graphs describing exceptional quantum subgroups of type B2 or G2 which encode their module structure over the associated fusion category. Global dimensions are given.

  5. Magnetism and superconductivity in ErNi2B2C

    Indian Academy of Sciences (India)

    in modulation vector and harmonic content. Studies of the vortex lattice show the presence of a 45. ◦ reorientation transition and a distorted hexagonal to square transition as a function of applied field. Further distortions of the vortex lattice occur at TN, but no changes are seen at TF. Keywords. (RE)Ni2B2C; ErNi2B2C; vortex ...

  6. Preparation of high quality superconducting thin MgB2 films for electronics

    International Nuclear Information System (INIS)

    Surdu, Andrei; Zdravkov, Vladimir; Sidorenko, Anatolie; Rossolenko, Anna; Ryazanov, Valerii; Bdikin, Igor; Kroemer, Oliver; Nold, Eberhard; Koch, Thomas; Schimmel, Thomas

    2007-01-01

    In this work we report the growth of high-Tc MgB 2 smooth films which are prepared in a two-step process: 1) deposition of the precursor films and 2) their annealing in Mg vapor with a specially designed, reusable reactor. Our method opens perspectives for the use of MgB 2 films in microelectronics, especially for high-frequency applications. (authors)

  7. Drivers of relationships affecting B2B firms in an e-commerce environment

    Directory of Open Access Journals (Sweden)

    Irene Samanta

    2014-09-01

    Full Text Available The advent of the internet has created numerous opportunities for B2B marketing professionals to enhance current marketing practices, including electronic relationships. However, the investigation of e-relationships and the factors that influence e-relationships in an internet environment is scant. Further, there appears to be no investigation of this phenomenon within the context of Greek B2B Medium-sized firms (MSF. Τhe research problem investigated in this research is: “Which drivers in B2B e-commerce use affect inter-firm relationships in medium-sized B2B firms?”. A framework for B2B e-commerce relationships in a changing and globalized environment was synthesised and integrated with the literature about relationship marketing to arrive at the following research issues: “How do relationship marketing drivers affect the management of B2B e-relationships?”. An explanatory quantitative research approach was used and quantitative data was collected from B2B firms in Greece, which represents a case of e-commerce progress during the last six years. Regarding social exchange, some important differences emerge where cooperation between B2B e-commerce firms is concerned. Suppliers engaged in electronic commerce are more committed and oriented to a long-term relationship than buyers, based on both previous and current experience with them. Confidence in the relationships, consistency and honesty with their obligations and the exchange of reliable, trustworthy information and advisory services between firms are important factors in the development and establishment of their e-relationships. The main contribution of this research is the development of a theoretical framework for e-relationships in medium-sized Β2Β firms. That framework is the first rigorously researched step towards understanding the importance of these powerful streams of relationship drivers in total, and the business activity of e-marketing and electronic relationships.

  8. Framing agenda for business model innovation research from the B2B context

    OpenAIRE

    Neupane, Ganesh Prasad; Haugland, Sven A.

    2016-01-01

    This paper reviews the literature on business models in the business-to-business (B2B) context and proposes a research agenda that can be explored by future studies using various management and organizational theories. We outline four research themes and seven research topics for research on business model innovations in the B2B context. Further studies on these topics can make significant contributions to the business model literature.

  9. Dielectric and optical properties of glasses of CdO-B2O3 system

    International Nuclear Information System (INIS)

    Semin, V.N.; Mal'tsev, V.T.; Panich, A.E.

    1986-01-01

    Dielectric and optical properties of glasses of CdO-B 2 O 3 system are investigated. It is shown, that on changing the composition, cadmic-borate glasses undergo structural changes, similar to those, taking place in lead-borate glasses, and the maximum part of the boron atoms in the oxygen tetrahedral coordination is at CdO:B 2 O 3 =3:2

  10. Endothelium-dependent vasorelaxant effect of procyanidin B2 on human internal mammary artery.

    Science.gov (United States)

    Novakovic, Aleksandra; Marinko, Marija; Jankovic, Goran; Stojanovic, Ivan; Milojevic, Predrag; Nenezic, Dragoslav; Kanjuh, Vladimir; Yang, Qin; He, Guo-Wei

    2017-07-15

    The aim of the present study was to investigate and characterize vasorelaxant effect of procyanidin B2 on human internal mammary artery (HIMA) as one of the mechanisms of its protective effect against vascular risk. Procyanidin B2 induced strong concentration-dependent relaxation of HIMA rings pre-contracted by phenylephrine. Pretreatment with L-NAME, a NO synthase inhibitor, hydroxocobalamin, a NO scavenger, and ODQ, an inhibitor of soluble guanylate cyclase, significantly inhibited procyanidin B2-induced relaxation of HIMA, while indomethacin, a cyclooxygenase inhibitor, considerably reduced effects of low concentrations. Among K + channel blockers, iberiotoxin, a selective blocker of large conductance Ca 2+ -activated K + channels (BK Ca ), abolished procyanidin B2-induced relaxation, glibenclamide, a selective ATP-sensitive K + (K ATP ) channels blocker, induced partial inhibition, while 4-aminopyridine, a blocker of voltage-gated K + (K V ) channels, and TRAM-34, an inhibitor of intermediate-conductance Ca 2+ -activated K + (IK Ca ) channels, slightly reduced maximal relaxation of HIMA. Further, procyanidin B2 relaxed contraction induced by phenylephrine in Ca 2+ -free Krebs solution, but had no effect on contraction induced by caffeine. Finally, thapsigargin, a sarcoplasmic reticulum Ca 2+ -ATPase inhibitor, significantly reduced relaxation of HIMA produced by procyanidin B2. These results demonstrate that procyanidin B2 produces endothelium-dependent relaxation of HIMA pre-contracted by phenylephrine. This effect is primarily the result of an increased NO synthesis and secretion by endothelial cells and partially of prostacyclin, although it involves activation of BK Ca and K ATP , as well as K V and IK Ca channels in high concentrations of procyanidin B2. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Prostaglandin E2 and thromboxane B2 release from human monocytes treated with bacterial lipopolysaccharide

    International Nuclear Information System (INIS)

    Nichols, F.C.; Garrison, S.W.; Davis, H.W.

    1988-01-01

    We investigated the capacity of counterflow-isolated human monocytes to independently synthesize thromboxane B2 (TxB2) and prostaglandin E2 (PGE2) when stimulated with bacterial lipopolysaccharide (LPS). Independent metabolism was confirmed by establishing different specific activities (dpm/ng) of TxB2 and PGE2 released from LPS-treated cells. For metabolites released during the initial 2-hr treatment period, the specific activity of PGE2 was approximately threefold higher than that of TxB2 regardless of labeling with [3H]arachidonic acid (AA) or [14C]AA. Cells that were pulse-labeled for 2 hr with [3H]AA demonstrated a decreasing PGE2 specific activity over 24 hr, whereas the TxB2 specific activity remained unchanged. In contrast, cells continuously exposed to [14C]AA demonstrated an increasing TxB2 specific activity that approached the level of PGE2 by 24 hr. These results suggest the presence of at least 2 cyclooxygenase metabolic compartments in counterflow-isolated monocytes. Although freshly isolated monocytes have been reported to contain variable numbers of adherent platelets, additional experiments demonstrated that counterflow-isolated platelets are not capable of releasing elevated levels of TxB2 or PGE2 when treated with LPS. It is proposed from these findings that at least two subsets of monocytes exist in peripheral blood that can be distinguished on the basis of independent conversion of AA to TxB2 and PGE2

  12. An ANFIS-based on B2C electronic commerce transaction

    International Nuclear Information System (INIS)

    Lin, Juan; Liu, Chenlian; Guo, Yongning

    2014-01-01

    The purpose of this study is to use an adaptive-network-based fuzzy inference system to model a fuzzy logic-based system (FIS) for supporting decision-making process in B2C electronic commerce transaction. Firstly we introduce FIS in B2C electronic commerce transaction and ANFIS. Then we use ANFIS to model FIS with different membership functions(MF). Lastly we give a conclusion

  13. An ANFIS-based on B2C electronic commerce transaction

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Juan, E-mail: linjuanliucaihong@qq.com [Department of Mathematics and Computer Science, Fuqing Branch of Fujian Normal University, Fuqing 350300 (China); Liu, Chenlian, E-mail: chenglian.liu@gmail.com [School of Mathematics and Computer Science, Long Yan University, Longyan 364012 (China); Guo, Yongning, E-mail: guoyn@163.com [Fuqing Branch of Fujian Normal University, Fuqing 350300 (China)

    2014-10-06

    The purpose of this study is to use an adaptive-network-based fuzzy inference system to model a fuzzy logic-based system (FIS) for supporting decision-making process in B2C electronic commerce transaction. Firstly we introduce FIS in B2C electronic commerce transaction and ANFIS. Then we use ANFIS to model FIS with different membership functions(MF). Lastly we give a conclusion.

  14. An ANFIS-based on B2C electronic commerce transaction

    Science.gov (United States)

    Lin, Juan; Liu, Chenlian; Guo, Yongning

    2014-10-01

    The purpose of this study is to use an adaptive-network-based fuzzy inference system to model a fuzzy logic-based system (FIS) for supporting decision-making process in B2C electronic commerce transaction. Firstly we introduce FIS in B2C electronic commerce transaction and ANFIS. Then we use ANFIS to model FIS with different membership functions(MF). Lastly we give a conclusion.

  15. Structural stability of the square flux line lattice in YNi2B2C and LuNi2B2C studied with small angle neutron scattering

    DEFF Research Database (Denmark)

    Eskildsen, M.R.; Gammel, P.L.; Barber, B.P.

    1997-01-01

    We have studied the flux line lattice in YNi2B2C and LuNi2B2C, the nonmagnetic end members of the borocarbide superconductors using small angle neutron scattering and transport. For fields, H parallel to c, we find a square symmetric lattice which disorders rapidly above H/H-c2 similar to 0.2, well...... below the ''peak effect'' at H/H-c2 = 0.9. The results for H/H-c2 controlled by the tilt modulus c(44). For H/H-c2 > 0.2, the disordering appears to be associated with the field dependence of the shear modulus, C-66....

  16. Incommensurate magnetic modulations in the magnetic superconductor HoNi2B2C

    International Nuclear Information System (INIS)

    Schneider, M.; Zaharko, O.; Keller, L.; Allenspach, P.; Kreyssig, A.; Canfield, P.C.

    2006-01-01

    Full text: The borocarbide HoNi 2 B 2 C is an unconventional superconductor of particular interest, since long-range magnetism coexists and competes with superconductivity on a common energy range [1]. Our study is based on high quality single crystals of 11 B-substituted HoNi 2 B 2 C. The neutron diffraction investigations are devoted to two issues of specific relevance to HoNi 2 B 2 C. Firstly, the near re-entrant phase between 5K 2 B 2 C is more complicated than proposed so fare [2]. Furthermore we performed a spherical neutron polarimetry experiment to determine the two ICM magnetic structures of HoNi 2 B 2 C and neutron spectroscopy investigations to obtain the microscopic magnetic coupling parameters. All these studies resulted in quite a consistent and complete picture of magnetism in HoNi 2 B 2 C, however, we could not find clear evidence for a strong interaction between superconductivity and magnetism. (author)

  17. Design of MgB2 Superconducting coils for the Ignitor Experiment*

    Science.gov (United States)

    Grasso, G.; Penco, R.; Berta, S.; Coppi, B.; Giunchi, G.

    2009-11-01

    A feasibility study for the adoption of MgB2 superconducting cables for the largest (about 5 m in diameter) of the poloidal field coils of the Ignitor machine is being carried out. This initiative was prompted by the progress made in the fabrication of MgB2 long cables, and related superconducting magnets of relatively large dimensions. These magnets will be cryocooled at the operating temperature of 10-15 K that is compatible with the He-gas cryogenic cooling system of Ignitor as well as with the projected superconducting current density of the MgB2 material, at the magnetic field values (˜4-5 T) in which these coils are designed to operate. The optimal cable configuration has been identified that can provide an efficient cooling of the MgB2 conductors over times compatible with the machine duty cycles. MgB2 superconductors hold the promise of becoming suitable for high field magnets by appropriate doping of the material and of replacing gradually the normal conducting coils adopted, by necessity, in high field experiments. Therefore, an appropriate R&D program on the development of improved MgB2 material and related superconducting cabling options has been undertaken, involving different institutions.

  18. Chimeric DNA Vaccines against ErbB2{sup +} Carcinomas: From Mice to Humans

    Energy Technology Data Exchange (ETDEWEB)

    Quaglino, Elena; Riccardo, Federica; Macagno, Marco; Bandini, Silvio; Cojoca, Rodica; Ercole, Elisabetta [Molecular Biotechnology Center, Department of Clinical and Biological Sciences, University of Turin, 10126 Turin (Italy); Amici, Augusto [Department of Molecular Cellular and Animal Biology, University of Camerino, 62032 Camerino (Italy); Cavallo, Federica, E-mail: federica.cavallo@unito.it [2 Department of Molecular Cellular and Animal Biology, University of Camerino, 62032 Camerino (Italy)

    2011-08-10

    DNA vaccination exploits a relatively simple and flexible technique to generate an immune response against microbial and tumor-associated antigens (TAAs). Its effectiveness is enhanced by the application of an electrical shock in the area of plasmid injection (electroporation). In our studies we exploited a sophisticated electroporation device approved for clinical use (Cliniporator, IGEA, Carpi, Italy). As the target antigen is an additional factor that dramatically modulates the efficacy of a vaccine, we selected ErbB2 receptor as a target since it is an ideal oncoantigen. It is overexpressed on the cell membrane by several carcinomas for which it plays an essential role in driving their progression. Most oncoantigens are self-tolerated molecules. To circumvent immune tolerance we generated two plasmids (RHuT and HuRT) coding for chimeric rat/human ErbB2 proteins. Their immunogenicity was compared in wild type mice naturally tolerant for mouse ErbB2, and in transgenic mice that are also tolerant for rat or human ErbB2. In several of these mice, RHuT and HuRT elicited a stronger anti-tumor response than plasmids coding for fully human or fully rat ErbB2. The ability of heterologous moiety to blunt immune tolerance could be exploited to elicit a significant immune response in patients. A clinical trial to delay the recurrence of ErbB2{sup +} carcinomas of the oral cavity, oropharynx and hypopharynx is awaiting the approval of the Italian authorities.

  19. Flux pinning behaviors of Ti and C co-doped MgB2 superconductors

    International Nuclear Information System (INIS)

    Yang, Y.; Zhao, D.; Shen, T.M.; Li, G.; Zhang, Y.; Feng, Y.; Cheng, C.H.; Zhang, Y.P.; Zhao, Y.

    2008-01-01

    Flux pinning behavior of carbon and titanium concurrently doped MgB 2 alloys has been studied by ac susceptibility and dc magnetization measurements. It is found that critical current density and irreversibility field of MgB 2 have been significantly improved by doping C and Ti concurrently, sharply contrasted to the situation of C-only-doped or Ti-only-doped MgB 2 samples. AC susceptibility measurement reveals that the dependence of the pinning potential on the dc applied field of Mg 0.95 Ti 0.05 B 1.95 C 0.05 has been determined to be U(B dc )∝B dc -1 compared to that of MgB 2 U(B dc )∝B dc -1.5 . As to the U(J) behavior, a relationship of U(J) ∝ J -0.17 is found fitting well for Mg 0.95 Ti 0.05 B 1.95 C 0.05 with respect to U(J) ∝ J -0.21 for MgB 2 . All the results reveal a strong enhancement of the high field pinning potential in C and Ti co-doped MgB 2

  20. Phase transformations in the B2 phase of Co-rich Co-Al binary alloys

    International Nuclear Information System (INIS)

    Niitsu, K.; Omori, T.; Nagasako, M.; Oikawa, K.; Kainuma, R.; Ishida, K.

    2011-01-01

    Research highlights: → Bainitic transformation and a martensite-like structure from B2-CoAl were observed depending on quenching rate. → The phase separation into the metastable A2 + B2 structure was found in the as-quenched B2-CoAl. → The two-phase structure of A2 and B2 was found to show some coercive force after aging under a magnetic field. - Abstract: Phase transformations in the β (B2) phase of Co-21 and -23 at.% Al alloys were examined using transmission electron microscopy, energy dispersive X-ray spectroscopy and differential scanning calorimetry. The microstructures obtained from as-quenched specimens were found to be strongly affected by the quenching condition. While relatively thick sheet-specimens with a lower quenching rate showed bainitic plate precipitates with a fcc structure, a martensite-like structure was observed by optical microscopy in relatively thin specimens with a higher quenching rate. Regardless of the quenching condition, a spinodal-like microstructure composed of A2 and B2 phases was also detected and the A2 phase changed to a metastable hcp phase during further aging.

  1. Critical state instability in Nb-clad MgB2 superconducting wires

    International Nuclear Information System (INIS)

    Beilin, V.; Felner, I.; Tsindlekht, M.I.; Dul'kin, E.; Mojaev, E.; Roth, M.

    2008-01-01

    Magnetization hysteresis loops of Cu/MgB 2 , Nb/MgB 2 , Cu/Nb/MgB 2 and Fe/Cu/MgB 2 wires in parallel magnetic fields of up to 5 T were studied in the temperature range from 5 to 35 K. All Nb-clad samples exhibited a thermomagnetic instability (TMI) in the form of magnetization jumps. In a thick wire (about 2 mm in core diameter), the TMI persisted up to the unexpectedly high temperature of 32 K. Thin wires showed low TMI which vanished at T > 10 K. Cu/MgB 2 wires which did not contain a Nb barrier, showed no signs of TMI. The TMI in thin wires exhibited good reproducibility and stability in the jump pattern (JP) (jump amplitudes and positions), while thick wires showed the worst time stability. We found that moderate flat rolling of the round unstable Cu/Nb/MgB 2 wire resulted in negligible TMI at 5 K in the processed flat tape. The TMI amplitudes of studied samples correlated with the adiabatic stability parameter, β -1

  2. Preferential control of basal dendritic protrusions by EphB2.

    Directory of Open Access Journals (Sweden)

    Matthew S Kayser

    2011-02-01

    Full Text Available The flow of information between neurons in many neural circuits is controlled by a highly specialized site of cell-cell contact known as a synapse. A number of molecules have been identified that are involved in central nervous system synapse development, but knowledge is limited regarding whether these cues direct organization of specific synapse types or on particular regions of individual neurons. Glutamate is the primary excitatory neurotransmitter in the brain, and the majority of glutamatergic synapses occur on mushroom-shaped protrusions called dendritic spines. Changes in the morphology of these structures are associated with long-lasting modulation of synaptic strength thought to underlie learning and memory, and can be abnormal in neuropsychiatric disease. Here, we use rat cortical slice cultures to examine how a previously-described synaptogenic molecule, the EphB2 receptor tyrosine kinase, regulates dendritic protrusion morphology in specific regions of the dendritic arbor in cortical pyramidal neurons. We find that alterations in EphB2 signaling can bidirectionally control protrusion length, and knockdown of EphB2 expression levels reduces the number of dendritic spines and filopodia. Expression of wild-type or dominant negative EphB2 reveals that EphB2 preferentially regulates dendritic protrusion structure in basal dendrites. Our findings suggest that EphB2 may act to specify synapse formation in a particular subcellular region of cortical pyramidal neurons.

  3. Development of Ti-sheathed MgB2 wires with high critical current density

    International Nuclear Information System (INIS)

    Liang, G; Fang, H; Hanna, M; Yen, F; Lv, B; Alessandrini, M; Keith, S; Hoyt, C; Tang, Z; Salama, K

    2006-01-01

    Working towards developing lightweight superconducting magnets for future space and other applications, we have successfully fabricated mono-core Ti-sheathed MgB 2 wires by the powder-in-tube method. The wires were characterized by magnetization, electrical resistivity, x-ray diffraction, scanning electron microscopy, and energy dispersive spectrometry measurements. The results indicate that the Ti sheath does not react with the magnesium and boron, and the present wire rolling process can produce MgB 2 wires with a superconducting volume fraction of at least 64% in the core. Using the Bean model, it was found that at 5 K, the magnetic critical current densities, J c , measured in magnetic fields of 0, 5, and 8 T are about 4.2 x 10 5 , 3.6 x 10 4 , and 1.4 x 10 4 A cm -2 , respectively. At 20 K and 0 T, the magnetic J c is about 2.4 x 10 5 A cm -2 . These results show that at zero and low fields, the values of the magnetic J c for Ti-sheathed MgB 2 wires are comparable with the best results available for the Fe-sheathed MgB 2 wires. At high fields, however, the J c for Ti-sheathed MgB 2 wires appears higher than that for the Fe-sheathed MgB 2 wires

  4. Preparation, characterization, and thermal stability of B2O3-ZrO2

    Directory of Open Access Journals (Sweden)

    Theresia Debora Simbolon

    2017-04-01

    Full Text Available Synthesis of the borate-based compound with ZrOCl2 to form B2O3-ZrO2 has been conducted. The compound was characterized by FT-IR spectrophotometer, X-ray diffraction, acidity and thermal stability test. The results showed that the FT-IR main vibration spectrum of B2O3-ZrO2 compound has appeared at wave number 401.2 cm-1 for Zr-O bonding vibration, 617.2 cm-1 for B-O-B bonding vibration and 910.4 cm-1 for B-O bonding vibration. The XRD diffraction pattern shows B2O3-ZrO2 compound has an amorphous structure. The FT-IR spectrum after saturated with ammonia and potentiometric titration indicates that the compound of B2O3-ZrO2 has acidic properties with a strong level of acidity. Thermal stability test shows that the B2O3-ZrO2 compounds have high stability on temperature with increasing crystallinity after the compound was heated at 700 °C. Keywords: B2O3-ZrO2, impregnation, thermal stability.

  5. Occurrence of Ochratoxins, Fumonisin B2 , Aflatoxins (B1 and B2 ), and Other Secondary Fungal Metabolites in Dried Date Palm Fruits from Egypt: A Mini-Survey.

    Science.gov (United States)

    Abdallah, Mohamed F; Krska, Rudolf; Sulyok, Michael

    2018-02-01

    This study was conducted to investigate the natural co-occurrence of 295 fungal and bacterial metabolites in 28 samples of dried date palm fruits collected from different shops distributed in Assiut Governorate, Upper Egypt in 2016. Extraction and quantification of the target analytes were done using the "dilute and shoot" approach followed by liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis. In total, 30 toxic fungal metabolites were detected. Among these metabolites, 4 types of ochratoxins including ochratoxin type A and B were quantified in 3 samples (11%) with a contamination range from 1.48 to 6070 μg/kg for ochratoxin A and from 0.28 to 692 μg/kg for ochratoxin B. In addition, fumonisin B 2 was observed in 2 (7%) samples with contamination levels ranging from 4.99 to 16.2 μg/kg. The simultaneous detection of fumonisin B 2 in the same contaminated samples with ochratoxins indicates the fungal attack by Aspergillus niger species during storage. Only 1 sample was contaminated with aflatoxin B 1 (14.4 μg/kg) and B 2 (2.44 μg/kg). The highest maximum concentration (90400 μg/kg) was for kojic acid that contaminated 43% of the samples. To the best of the authors' knowledge, this is the first report of the natural co-occurrence of fumonisin B 2 and ochratoxin A and B in addition to a wide range of other fungal metabolites in date palm fruits. Mycotoxins are secondary metabolites produced by different fungi. These metabolites pose a potential risk on human health since they contaminate many food commodities. Among these, date palm fruits which are an integral part of diet in several countries. Therefore, detection of mycotoxins is a prerequisite to insure the safety of food. Here, different types of mycotoxins have been detected in levels that may have health hazard. © 2018 Institute of Food Technologists®.

  6. The Power of B2B Brands : A case study of how B2B companies in the forest industry can communicate sustainability through their Brand

    OpenAIRE

    Bålfors, Joakim; Ståhlspets, Johan

    2016-01-01

    Today’s B2B companies operate in a global business world that is characterised by product homogenisation and intense competition. Finding sources for differentiation and consequently competitive advantage is a concern that no company with a long-term horizon can ignore. The development of the brand, recognized as a strategic asset, has created new ways of conducting beneficial marketing management, which can lead to differentiation from competitors and create conditions for company success. T...

  7. Solution structure of the human Grb7-SH2 domain/erbB2 peptide complex and structural basis for Grb7 binding to ErbB2

    International Nuclear Information System (INIS)

    Ivancic, Monika; Daly, Roger J.; Lyons, Barbara A.

    2003-01-01

    The solution structure of the hGrb7-SH2 domain in complex with a ten amino acid phosphorylated peptide ligand representative of the erbB2 receptor tyrosine kinase (pY1139) is presented as determined by nuclear magnetic resonance methods. The hGrb7-SH2 domain structure reveals the Src homology 2 domain topology consisting of a central β-sheet capped at each end by an α-helix. The presence of a four residue insertion in the region between β-strand E and the EF loop and resulting influences on the SH2 domain/peptide complex structure are discussed. The binding conformation of the erbB2 peptide is in a β-turn similar to that found in phosphorylated tyrosine peptides bound to the Grb2-SH2 domain. To our knowledge this is only the second example of an SH2 domain binding its naturally occurring ligands in a turn, instead of extended, conformation. Close contacts between residues responsible for binding specificity in hGrb7-SH2 and the erbB2 peptide are characterized and the potential effect of mutation of these residues on the hGrb7-SH2 domain structure is discussed

  8. Competency-orientated brand cooperations of power supply companies in the B2B sector; Kompetenzorientierte Markenkooperationen von Energieversorgungsunternehmen im B2B-Kundenbereich

    Energy Technology Data Exchange (ETDEWEB)

    Peuser, M.M.

    2008-07-01

    On the basis of an extensive empirical study with B2B electricity users, the author of the book under consideration examines brand co-operations of power supply companies with companies not working in the area of energy production. Based on the view of various co-operation alternatives, impact relations and success-determining factors of influence in the area of B2B customers are identified. The term of the authority of an energy brand is discussed. Beside this, profiles of concrete brands of current power supply companies from the view of B2B customers are pointed out, and recommendations for the organization of brand co-operation and the structure of mark authority in practice are shown. This contribution is written for lecturers and students of the management economics with the emphasis of marketing and management as well as high-level personnel in the energy industry, who wants to develop strong mark authority by brand co-operation.

  9. Suplementação com vitamina A no puerpério: revisão sistemática Suplementación con vitamina A en el puerperio: revisión sistemática Vitamin A supplementation during puerperium: systematic review

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Costa Caminha

    2009-08-01

    Full Text Available Realizou-se revisão sistemática de estudos avaliativos da aplicação de megadoses de vitamina A nas concentrações de retinol no sangue e no leite maternos como medida de curto prazo para a prevenção de hipovitaminose A. Com base na estratégia do Centro Cochrane do Brasil para ensaios clínicos aleatórios foram identificadas 115 publicações no PubMed, entre as quais, por um conjunto de critérios de inclusão/exclusão, foram selecionados 14 artigos publicados entre 1993 a 2007. O efeito das intervenções com três esquemas posológicos (200.000, 300.000 e 400.000 UI de vitamina A foram analisados. Dos 11 experimentos realizados em leite materno, nove apresentaram elevação dos níveis de retinol em comparação com o grupo controle; dos nove que avaliaram sangue materno, quatro mostraram elevação após tempos variados de aplicação de megadoses de vitamina A. Conclui-se que a administração de vitamina A em elevadas doses foi positiva em 82% dos ensaios com leite materno, mas menos notáveis em comparação ao sangue materno. Não foram observadas diferenças significativas quanto à posologia aplicada.Se realizó revisión sistemática de estudios evaluativos de la aplicación de megadosis de vitamina A en las concentraciones de retinol en la sangre y en la leche maternos como medida de corto plazo para la prevención de hipovitaminosis A. Con base en la estratégia del Centro Cochrane de Brasil para ensayos clínicos aleatorios fueron identificadas 115 publicaciones en el PubMed, entre las cuales, por un conjunto de criterios de inclusión/exclusión, fueron seleccionados 14 artículos publicados entre 1993 a 2007. El efecto de las intervenciones con tres esquemas posológicos (200.000. 300.000 y 400.000 UI de vitamina A fueron analizados. De los 11 experimentos realizados en leche materna, nueve presentaron elevación de los niveles de retinol en comparación con el grupo control; de los nueve que evaluaron sangre materna

  10. ASOCIACIÓN ENTRE NIVELES SÉRICOS DE VITAMINA D, RESPUESTA IgE Y VARIANTES GENÉTICAS DEL GEN DEL RECEPTOR DE LA VITAMINA D EN NIÑOS OBESOS DEL CARIBE COLOMBIANO: UN ESTUDIO DE CASOS Y CONTROLES

    Directory of Open Access Journals (Sweden)

    Eduardo A. Egea Bermejo

    2016-07-01

    Full Text Available

    Introducción: Estudios previos han evaluado la relación entre vitamina D y atopía. En pacientes obesos es incierta esta asociación, sin embargo se acepta hoy que polimorfismos en el receptor de vitamina D pueden asociarse con obesidad. Actualmente son escasos los estudios que han buscado esta asociación en grupos en el litoral Caribe.

    Objetivo: Analizar la asociación entre los polimorfismos de los SNPs del receptor de vitamina D con la susceptibilidad para obesidad, su influencia en los niveles séricos de vitamina D e IgE en una población infantil.

    Metodología: Se realizó un estudio analítico de casos (n=120 y controles (n=182 con niños obesos entre los 5 y 17 años de edad, procedentes de la costa caribe colombiana. Los niveles séricos de 25(OH vitamina D e IgE Total se midieron mediante ELISA. Valores de p<0.05 fueron estadísticamente significativos.

    Resultados y conclusiones: Se encontró asociación entre niveles altos de vitamina-D y obesidad infantil. El 48,3% (n=58 de los casos presentaron niveles >100 ng/mL en comparación a un 0,5% (n = 1 de los controles. Ambos grupos presentaron altos niveles de IgE, (317,07±331,5 vs. 280,6±272.7; p = 0,786. Nuestros resultados no mostraron asociación alguna entre las variantes genéticas con los niveles séricos de vitamina-D con IgE total, como tampoco con obesidad. Todos los SNPs estuvieron en equilibrio Hardy-Weingber. Nuestros resultados no muestran asociación de deficiencia de Vitamina D con obesidad en este grupo poblacional, pero sí IgE elevada en la mayoría de la población, sin tener ninguna relación entre ellos. (Rho spearman: 0,023; p = 0,641.

    ASSOCIATION BETWEEN SERUM LEVELS OF VITAMIN D, IgE RESPONSE AND GENETIC VARIANTS OF THE GENE FOR VITAMIN D RECEPTOR IN OBESE CHILDREN IN THE COLOMBIAN CARIBBEAN

  11. Utilização das vitaminas C e E em rações para frangos de corte mantidos em ambiente de alta temperatura Use of vitamins C and E on ration for broilers kept in high temperature environment

    Directory of Open Access Journals (Sweden)

    Marcos Gonçalves de Souza

    2011-10-01

    Full Text Available O experimento foi realizado para avaliar os efeitos da suplementação das vitaminas C ou E na ração sobre o desempenho, as características de carcaça e os parâmetros hematológicos de frangos de corte mantidos em ambiente de alta temperatura. Foram utilizados 450 frangos de corte distribuídos em delineamento inteiramente ao acaso, com cinco tratamentos, cada um com nove repetições de 10 aves (período 1 a 21 dias ou de 7 aves (período de 22 a 42 dias por unidade experimental. Os tratamentos foram: ração basal (RB sem suplementação de vitaminas C e E; RB + 300 ppm de vitamina E; RB + 230 ppm de vitamina C; RB + 300 ppm de vitamina E + 230 ppm de vitamina C; e RB + 150 ppm de vitamina E + 115 ppm de vitamina C. Não houve efeito da suplementação das vitaminas C e E no desempenho zootécnico das aves na fase de 1 a 21 dias de idade. Na fase de 1 a 42 dias, a suplementação das vitaminas C e E influenciou somente a conversão alimentar. Os melhores resultados para os pesos absoluto e relativo de peito foram observados nas aves que receberam a ração basal suplementada com as combinações das vitaminas C e E. A concentração plasmática de triiodotironina, a porcentagem de células sanguíneas, a relação heterófilo/linfócito e os pesos absoluto e relativo do baço aos 21 e 42 dias de idade não foram influenciados pela suplementação vitamínica. A suplementação das vitaminas C e ou E não influi no desempenho zootécnico, no peso do baço e nos parâmetros sanguíneos de frangos de corte mantidos até 42 dias de idade em ambiente de alta temperatura. As combinações das vitaminas C e E promovem melhora nos pesos absoluto e relativo de peito de frangos de corte sob alta temperatura.This experiment was carried out to evaluate the effect of supplementation of vitamins C or E in the diet on performance, carcass characteristics and hematological parameters of broilers kept under high environmental temperature. Four hundred and

  12. Possible multigap type-I superconductivity in the layered boride RuB2

    Science.gov (United States)

    Singh, Jaskaran; Jayaraj, Anooja; Srivastava, D.; Gayen, S.; Thamizhavel, A.; Singh, Yogesh

    2018-02-01

    The structure of the layered transition-metal borides A B2 (A =Os,Ru ) is built up by alternating T and B layers with the B layers forming a puckered honeycomb. Here we report superconducting properties of RuB2 with a Tc≈1.5 K using measurements of the magnetic susceptibility versus temperature T , magnetization M versus magnetic field H , resistivity versus T , and heat capacity versus T at various H . We observe a reduced heat capacity anomaly at Tc given by Δ C /γ Tc≈1.1 suggesting multigap superconductivity. Strong support for this is obtained by the successful fitting of the electronic specific heat data to a two-gap model with gap values Δ1/kBTc≈1.88 and Δ2/kBTc≈1.13 . Additionally, M versus H measurements reveal a behavior consistent with type-I superconductivity. This is confirmed by comparing the experimental critical field ≈122 Oe obtained from extrapolation to T =0 of the H -T phase diagram, with an estimate of the T =0 thermodynamic critical field ≈114 Oe. Additionally, the Ginzburg-Landau parameter was estimated to be κ ≈0.1 -0.66 . These results strongly suggest multigap type-I superconductivity in RuB2. We also calculate the band structure and obtain the Fermi surface for RuB2. The Fermi surface consists of one quasi-two-dimensional sheet and two concentric ellipsoidal sheets very similar to OsB2. An additional small fourth sheet is also found for RuB2. RuB2 could thus be an example of a multigap type-I superconductor.

  13. Assessment of liquid hydrogen cooled MgB2 conductors for magnetically confined fusion

    International Nuclear Information System (INIS)

    Glowacki, B A; Nuttall, W J

    2008-01-01

    Importantly environmental factors are not the only policy-driver for the hydrogen economy. Over the timescale of the development of fusion energy systems, energy security issues are likely to motivate a shift towards both hydrogen production and fusion as an energy source. These technologies combine local control of the system with the collaborative research interests of the major energy users in the global economy. A concept Fusion Island Reactor that might be used to generate H 2 (rather than electricity) is presented. Exploitation of produced hydrogen as a coolant and as a fuel is proposed in conjunction with MgB 2 conductors for the tokomak magnets windings, and electrotechnical devices for Fusion Island's infrastructure. The benefits of using MgB 2 over the Nb-based conductors during construction, operation and decommissioning of the Fusion Island Reactor are presented. The comparison of Nb 3 Sn strands for ITER fusion magnet with newly developed high field composite MgB 2 PIT conductors has shown that at 14 Tesla MgB 2 possesses better properties than any of the Nb 3 Sn conductors produced. In this paper the potential of MgB 2 conductors is examined for tokamaks of both the conventional ITER type and a Spherical Tokamak geometry. In each case MgB 2 is considered as a conductor for a range of field coil applications and the potential for operation at both liquid helium and liquid hydrogen temperatures is considered. Further research plans concerning the application of MgB 2 conductors for Fusion Island are also considered

  14. Grain growth kinetics for B2O3-doped ZnO ceramics

    Directory of Open Access Journals (Sweden)

    Yuksel Berat

    2015-06-01

    Full Text Available Grain growth kinetics in 0.1 to 2 mol % B2O3-added ZnO ceramics was studied by using a simplified phenomenological grain growth kinetics equation Gn = K0 · t · exp(-Q/RT together with the physical properties of sintered samples. The samples, prepared by conventional ceramics processing techniques, were sintered at temperatures between 1050 to 1250 °C for 1, 2, 3, 5 and 10 hours in air. The kinetic grain growth exponent value (n and the activation energy for the grain growth of the 0.1 mol % B2O3-doped ZnO ceramics were found to be 2.8 and 332 kJ/mol, respectively. By increasing B2O3 content to 1 mol %, the grain growth exponent value (n and the activation energy decreased to 2 and 238 kJ/mol, respectively. The XRD study revealed the presence of a second phase, Zn3B2O6 formed when the B2O3 content was > 1 mol %. The formation of Zn3B2O6 phase gave rise to an increase of the grain growth kinetic exponent and the grain growth activation energy. The kinetic grain growth exponent value (n and the activation energy for the grain growth of the 2 mol % B2O3-doped ZnO ceramics were found to be 3 and 307 kJ/mol, respectively. This can be attributed to the second particle drag (pinning mechanism in the liquid phase sintering.

  15. Superconducting and normal-state properties of the layered boride OsB2

    Science.gov (United States)

    Singh, Yogesh; Niazi, A.; Vannette, M. D.; Prozorov, R.; Johnston, D. C.

    2007-12-01

    OsB2 crystallizes in an orthorhombic structure (Pmmn) which contains alternate boron and osmium layers stacked along the c axis. The boron layers consist of puckered hexagons as opposed to the flat graphite-like boron layers in MgB2 . OsB2 is reported to become superconducting below 2.1K . We report results of the dynamic and static magnetic susceptibilities, electrical resistivity, Hall effect, heat capacity, and penetration depth measurements on arc-melted polycrystalline samples of OsB2 to characterize its superconducting and normal-state properties. These measurements confirmed that OsB2 becomes a bulk superconductor below Tc=2.1K . Our results indicate that OsB2 is a moderate-coupling type-II superconductor with an electron-phonon coupling constant λep≈0.4-0.5 , a small Ginzburg-Landau parameter κ˜1-2 , and an upper critical magnetic field Hc2(0.5K)˜420Oe for an unannealed sample and Hc2(1K)˜330Oe for an annealed sample. The temperature dependence of the superfluid density ns(T) for the unannealed sample is consistent with an s -wave superconductor with a slightly enhanced zero temperature gap Δ(0)=1.9kBTc and a zero temperature London penetration depth λ(0)=0.38(2)μm . The ns(T) data for the annealed sample show deviations from the predictions of the single-band s -wave BCS model. The magnetic, transport, and thermal properties in the normal state of isostructural and isoelectronic RuB2 , which is reported to become superconducting below 1.6K , are also reported.

  16. Enhancing the superconducting temperature of MgB2 by SWCNT dilution

    Science.gov (United States)

    Ma, Danhao; Jayasingha, Ruwantha; Hess, Dustin T.; Adu, Kofi W.; Sumanasekera, Gamini U.; Terrones, Mauricio

    2014-02-01

    We report, for the first time, an increase in the superconducting critical temperature, TC of commercial “dirty” MgB2 by a nonsubstitutional hole-doping of the MgB2 structure using minute, single-wall carbon nanotube (SWCNT) inclusions. We varied the SWCNTs concentration from 0.05 wt% to 5 wt% and investigated the temperature-dependent resistivity from 10 K to 300 K. We used micro-Raman spectroscopy, field-emission scanning electron microscopy, and X-ray diffraction to analyze the interfacial interactions between the SWCNTs and the MgB2 grains. We obtained an increase in TC from 33.0 to 37.8 K (ΔTC+=4.8 K), which is attributed to charge transfer from the MgB2 structure to the SWCNT structure. The charge transfer phenomenon is confirmed by micro-Raman analysis of the phonon states of the SWCNT tangential band frequency in the composites. We determined the charge transfer per carbon atom to be 0.0023/C, 0.0018/C and 0.0008/C for 0.05 wt%, 0.5 wt% and 5 wt% SWCNT inclusions, respectively, taking into account the contributions from the softening of the lattice constant and the nonadiabatic (dynamic) effects at the Fermi level. This report provides an experimental, alternative pathway to hole-doping of MgB2 without appealing to chemical substitution.

  17. MgB_{2} nonlinear properties investigated under localized high rf magnetic field excitation

    Directory of Open Access Journals (Sweden)

    Tamin Tai

    2012-12-01

    Full Text Available The high transition temperature and low surface resistance of MgB_{2} attracts interest in its potential application in superconducting radio frequency accelerating cavities. However, compared to traditional Nb cavities, the viability of MgB_{2} at high rf fields is still open to question. Our approach is to study the nonlinear electrodynamics of the material under localized rf magnetic fields. Because of the presence of the small superconducting gap in the π band, the nonlinear response of MgB_{2} at low temperature is potentially complicated compared to a single-gap s-wave superconductor such as Nb. Understanding the mechanisms of nonlinearity coming from the two-band structure of MgB_{2}, as well as extrinsic sources of nonlinearity, is an urgent requirement. A localized and strong rf magnetic field, created by a magnetic write head, is integrated into our nonlinear-Meissner-effect scanning microwave microscope [T. Tai et al., IEEE Trans. Appl. Supercond. 21, 2615 (2011ITASE91051-822310.1109/TASC.2010.2096531]. MgB_{2} films with thickness 50 nm, fabricated by a hybrid physical-chemical vapor deposition technique on dielectric substrates, are measured at a fixed location and show a strongly temperature-dependent third harmonic response. We propose that several possible mechanisms are responsible for this nonlinear response.

  18. Expression of oncogen c-erbB-2 (neu/HER-2) in human breast cancer

    International Nuclear Information System (INIS)

    Michelin, Severino C.; Mayo, Jose

    2000-01-01

    Breast cancer continues to be one of the leading causes of death from cancer among women and represents the most serious challenge to therapeutic control. Amplification and overexpression of the c-erbB-2 proto-oncogene occurs in as many as 30 % of all breast cancers and has been correlated with lymph node metastasis and poor prognosis in breast cancer patients. This gene know as neu, HER-2 or c-erbB-2 in among those most frequently altered in human cancer. It was first identified as a transforming gene activated in chemically induced rat neuroectodermal tumors. Early critical studies linked changes in erbB-2 expression and gene copy number to several human cancer, notably breast, ovarian and gastric cancer. Owing to its accessible location at the cell surface, erbB-2 is now under intensive scrutiny as a therapeutic target. In this review we will summarize the involvement of the c-erbB-2 gene in tumorigenesis. (author)

  19. Evaluations of MgB2 Coatings on 2'' Copper Discs for Superconducting Radio Frequency Applications

    Science.gov (United States)

    Withanage, Wenura; Tan, Teng; Lee, Namhoon; Banjade, Huta; Eremeev, Grigory; Welander, Paul; Valente-Feliciano, Anne-Marie; Kustom, Robert; Wolak, Matthäus; Nassiri, Alireza; Xi, Xiaoxing

    We propose that coating the inner walls of copper RF cavities with superconducting MgB2 (Tc = 39 K) can result in a viable alternative to the already established niobium-based SRF technology. This approach improves the thermal conductivity, allows for operation at higher temperatures, and reduces the need for large helium refrigeration, thereby resulting in lower operational costs. For our studies, we grew MgB2 films via hybrid physical chemical vapor deposition (HPCVD) on 2'' Cu substrates. Since Mg and Cu readily form an alloy at higher temperatures, the HPCVD setup was modified in order to achieve lower deposition temperatures, minimize alloy formation, and provide high quality MgB2 films. This method yielded MgB2 coatings on 2'' Cu discs with transition temperatures around 38 K. The samples were characterized with regards to their RF attributes and showed similar performance in comparison to Nb reference samples. The presented results show that MgB2 coated copper can be a suitable alternative for use in SRF cavities.

  20. Pressure induced structural phase transition of OsB2: First-principles calculations

    International Nuclear Information System (INIS)

    Ren Fengzhu; Wang Yuanxu; Lo, V.C.

    2010-01-01

    Orthorhombic OsB 2 was synthesized at 1000 deg. C and its compressibility was measured by using the high-pressure X-ray diffraction in a Diacell diamond anvil cell from ambient pressure to 32 GPa [R.W. Cumberland, et al. (2005)]. First-principles calculations were performed to study the possibility of the phase transition of OsB 2 . An analysis of the calculated enthalpy shows that orthorhombic OsB 2 can transfer to the hexagonal phase at 10.8 GPa. The calculated results with the quasi-harmonic approximation indicate that this phase transition pressure is little affected by the thermal effect. The calculated phonon band structure shows that the hexagonal P 6 3 /mmc structure (high-pressure phase) is stable for OsB 2 . We expect the phase transition can be further confirmed by the experimental work. - Abstract: Graphical Abstract Legend (TOC Figure): Table of Contents Figure Pressure induced structural phase transition from the orthorhombic structure to the hexagonal one for OsB 2 takes place under 10.8 GPa (0 K), 10.35 GPa (300, 1000 K) by the first-principles predictions.

  1. Energy gap in MgB2 superconductor: Andreev reflection studies

    International Nuclear Information System (INIS)

    Aswal, D.K.

    2003-01-01

    To investigate the nature of energy gap in MgB 2 superconductor, we have performed Andreev-reflection studies on MgB 2 / Ag planar junctions. The differential resistance (dV/dI) versus voltage (V) characteristics were recorded as a function of temperature, magnetic field and junction-type. The dV/dI vs V characteristic recorded at low temperature and zero-field for a clean MgB 2 / Ag planar junction exhibited several interesting features, such as, zero bias anomaly, a distinct double-minima, sharp resonance peaks near the energy gap etc. The data, however, could not be explained using Blonder-Tinkham-Klapwijk theory of isotropic superconductor, which indicated that energy gap in MgB 2 is not consistent with the weak-coupling BCS theory. This is further supported by unusual temperature and magnetic field dependence of the tunneling characteristics. The results indicate several possibilities for the energy gap in MgB 2 , such as, an anisotropic energy gap, two-energy or an unconventional gap scenario. (author)

  2. Prevalência de deficiência de vitamina B12 e ácido fólico e sua associação com anemia em idosos atendidos em um hospital universitário

    OpenAIRE

    Coussirat, Caroline

    2010-01-01

    Objetivos: Descrever a prevalência de deficiência de vitamina B12 e ácido fólico e a sua associação com anemia em idosos atendidos em um ambulatório de geriatria de um hospital universitário.Métodos: Foi realizada uma revisão de prontuários de todos os idosos que tiveram pelo menos um atendimento no Ambulatório de Geriatria do Hospital São Lucas da PUCRS, no período de julho de 2005 a junho de 2010. Para verificar a deficiência de vitamina B12, foram utilizados os seguintes critérios: Vitamin...

  3. Vitamin A metabolic aspects and alcoholic liver disease Aspectos metabólicos da vitamina A e doença hepática alcoólica

    Directory of Open Access Journals (Sweden)

    Tatiana Pereira de Paula

    2006-10-01

    Full Text Available The liver is a strategic organ in the metabolism of macro and micronutrients; when its functioning is compromised, it may cause some change in the nutritional status of vitamin A. The purpose of this article is to review scientific evidence in literature on the liver metabolism of vitamin A, the role of ethanol and retinol interactions on hepatic morphology, besides the alterations in the metabolism of this vitamin in alcoholic liver disease. Data were collected from Medline database. The liver is the main organ responsible for the storage, metabolism and distribution of vitamin A to peripheral tissues. This organ uses retinol for its normal functioning such as cell proliferation and differentiation. This way, vitamin A deficiency seems to alter liver morphology. Patients with alcoholic liver disease have been found to have low hepatic levels of retinol in all stages of their disease. In alcoholic liver disease, vitamin A deficiency may result from decreased ingestion or absorption, reduction in retinoic acid synthesis or increased degradation. Long-term alcohol intake results in reduced levels of retinoic acid, which may promote the development of liver tumor. So, in chronic alcoholic subjects, vitamin A status needs to be closely monitored to avoid its deficiency and clinical effects, however its supplementation must be done with caution since the usual dose may be toxic for those who consume ethanol.O fígado é um órgão estratégico no metabolismo de macro e de micronutrientes e, portanto, é de esperar que o comprometimento de sua função seja acompanhado de alterações no estado nutricional de vitamina A. O objetivo deste artigo é revisar na literatura evidências científicas sobre o metabolismo hepático da vitamina A, o efeito das interações entre a vitamina A e o etanol sobre a morfologia hepática, além das alterações do metabolismo dessa vitamina na doença hepática alcoólica. Os dados foram selecionados na base de dados

  4. Niveis sericos das vitaminas lipossoluveis (A, D e E) em pacientes com atresia biliar e hepatite auto-imune e a relação com o estado nutricional e indicadores clinicos e laboratoriais

    OpenAIRE

    Margareth Lopes Galvão Saron

    2008-01-01

    Resumo: As doenças hepáticas crônicas podem induzir à má-absorção de lipídios e vitaminas lipossolúveis e levar ao comprometimento do estado nutricional. O objetivo da pesquisa foi determinar os níveis séricos de vitaminas lipossolúveis (A, D e E) em crianças e adolescentes com atresia biliar (AB) e hepatite auto-imune (HAI) e verificar a relação com o estado nutricional e indicadores laboratoriais e clínicos. O estudo foi transversal e controlado e foram avaliados os pacientes com HAI (n=25...

  5. Níveis séricos de vitamina D em mulheres e homens submetidos à cirurgia bariátrica : associação com atividade física e circunferência da cintura

    OpenAIRE

    Fernanda Dapper Machado

    2016-01-01

    Introdução: Níveis séricos baixos de 25-OH-vit D estão associados com a obesidade e têm sido descritos após a cirurgia bariátrica. Objetivo: O objetivo desse estudo foi avaliar a prevalência de deficiência de vitamina D em pacientes submetidos à cirurgia bariátrica no período pré e pós-operatório e buscar por possíveis associações com variáveis que estejam relacionas à deficiência de vitamina D. Métodos: Foi realizado um estudo longitudinal, retrospectivo, em 75 pacientes submetidos à cirurgi...

  6. La corrección del déficit de 25-OH-vitamina D mejora el control del hiperparatiroidismo secundario y el estado inflamatorio de pacientes estables en hemodiálisis

    Directory of Open Access Journals (Sweden)

    Raquel Ojeda López

    2018-01-01

    Conclusiones: La corrección del déficit de 25-OH-D en pacientes en HD se asocia a un mejor control del hiperparatiroidismo secundario con menores dosis de análogos de vitamina D y a una mejoría en el estado inflamatorio de estos pacientes. Nuestros resultados apoyan la recomendación de determinar niveles de 25-OH-D y corregir el déficit en pacientes en HD.

  7. Importância da vitamina B12 na avaliação clínica do paciente idoso = Importance of vitamin B12 screening in clinical evaluation of elderly patient

    Directory of Open Access Journals (Sweden)

    Futterleib, Alexandre

    2005-01-01

    Conclusão: A investigação da deficiência de vitamina B12 é um procedimento importante na avaliação clínica do paciente idoso, já que o diagnóstico precoce pode evitar distúrbios neurológicos e hematológicos, bem como proporcionar melhor qualidade de vida ao paciente

  8. Design of MgB2 superconducting dipole magnet for particle beam transport in accelerators

    DEFF Research Database (Denmark)

    Abrahamsen, A.B.; Zangenberg, N.; Baurichter, A.

    2006-01-01

    for the collaborating company Danfysik A/S, which has a strongtradition in building resistive magnets for particle accelerators[4]. A technology transfer project was formulated at the end of 2005 with the purpose to collect the knowledge about the MgB2 superconductor gained in the STVF program and in the European...... in a dipole magnet for guiding particle beams in a small scale accelerator is examined with the purpose to build lighter and smaller than the present resistive magnets. Here the criticalcurrent density of primarily MgB2 will be compared with current density determined by specifications similar to the Tevatron...... accelerator, B = 4:4 Tesla and coil aperture D = 76 mm [6], which has been identified by Danfysik A/S as interesting. It isconcluded that MgB2 is useful for the dipole application and construction of a small test coil of one half of the magnet is planned in 2007....

  9. Microstructure and pinning properties of hexagonal-disc shaped single crystalline MgB2

    Science.gov (United States)

    Jung, C. U.; Kim, J. Y.; Chowdhury, P.; Kim, Kijoon H.; Lee, Sung-Ik; Koh, D. S.; Tamura, N.; Caldwell, W. A.; Patel, J. R.

    2002-11-01

    We synthesized hexagonal-disc-shaped MgB2 single crystals under high-pressure conditions and analyzed the microstructure and pinning properties. The lattice constants and the Laue pattern of the crystals from x-ray micro-diffraction showed the crystal symmetry of MgB2. A thorough crystallographic mapping within a single crystal showed that the edge and c axis of hexagonal-disc shape exactly matched the [101¯0] and the [0001] directions of the MgB2 phase. Thus, these well-shaped single crystals may be the best candidates for studying the direction dependences of the physical properties. The magnetization curve and the magnetic hysteresis curve for these single crystals showed the existence of a wide reversible region and weak pinning properties, which supported our single crystals being very clean.

  10. Composition powders of the system TiC-TiB2

    International Nuclear Information System (INIS)

    Degrave, I.E.; Udalov, Yu.P.

    2000-01-01

    The ceramic composition on TiC-TiB 2 base is proposed for substitution of scarce and expensive tungsten carbide for manufacturing metallo-ceramic articles. The technology of TiC and TiB 2 powder production from the mixture of oxides and carbon-bearing reducing agents is developed. Saccharose is recommended to be used as a reductant. Carbon tetrachloride vapors are introduced into the reaction volume to accelerate the synthesis. The purification of the product from residual carbon is performed in high frequency glow discharge with the use of air as a plasma forming gas. Microstructural studies show that the product obtained constitutes submicron TiC particles in a TiB 2 matrix [ru

  11. Possible superlattice formation in high-temperature treated carbonaceous MgB2 at elevated pressure

    International Nuclear Information System (INIS)

    Tschauner, Oliver; Errandonea, Daniel; Serghiou, George

    2006-01-01

    We report indications of a phase transition in carbonaceous MgB 2 above 9 GPa at 300 K after stress relaxation by laser heating. The transition was detected using Raman spectroscopy and X-ray diffraction. The observed changes are consistent with a second-order structural transition involving a doubling of the unit cell along c and a reduction of the boron site symmetry. Moreover, the Raman spectra suggest a reduction in electron-phonon coupling in the slightly modified MgB 2 structure consistent with the previously proposed topological transition in MgB 2 . However, further attributes including deviatoric stress, lattice defects, and compositional variation may play an important role in the observed phenomena

  12. Vitamin B2 content determination in liver paste by using acid and acid-enzyme hydrolysis

    Directory of Open Access Journals (Sweden)

    Basić Zorica

    2007-01-01

    Full Text Available Background/Aim. Vitamin B2 is available in foodstuff in the form of coenzyme and in free form. For its content determination a few procedures should be performed (deliberation from a complex, extraction of free and deliberated form and detection, identification and quantification. There is a particular problem in determination of vitamin B2 in the meat products. For a determination of total vitamin B2 content in liver paste two preparation procedures are compared: acid and acid-enzymatic hydrolysis. The aim of this study thus, was to compare the effectiveness of these two different procedures for vitamin B2 content determination in liver paste. Methods. High pressure liquid chromatography (HPLC method with fluorescence detector, as specific and adequately sensitive for the foodstuff of a complex composition with a natural vitamin content, was used for determination of vitamin B2 in liver paste. Acid hydrolysis was performed with the application 0.1 M hydrochloric acid in a pressure cooker, and enzymatic hydrolysis was performed with the 10% takadiastase on 45 ºC within four hours. Ten samples of liver paste from the supply of the Serbian Army were examined. Separation was performed on the analytical column Nucleosil 50−5 C18 with mobile phase 450 ml CH3OH + 20 ml 5 mM CH3COONH4, and detection on the fluorescent detector with the variable wave length. Both methods were validated: examining a detection limit, quantification limit, specificity (because of a possible B2 vitamin interference with reagents, linearity of a peak area and standard concentration of B2 vitamin ratio in the range from 0.05 μg/ml to 2 μg/ml, precision for the 0.05 μg/ml concentration and recovery. Results. All the previously examined parameters validated both methods as specific, precise and reproductive, with a high recovery (98.5% for acid and 98.2% for acid - enzymatic hydrolysis, as well as linearity in a range that significantly superseded the expected content in

  13. Direct observation of superconducting gaps in MgB 2 by angle-resolved photoemission spectroscopy

    Science.gov (United States)

    Souma, S.; Machida, Y.; Sato, T.; Takahashi, T.; Matsui, H.; Wang, S.-C.; Ding, H.; Kaminski, A.; Campuzano, J. C.; Sasaki, S.; Kadowaki, K.

    2004-08-01

    High-resolution angle-resolved photoemission spectroscopy has been carried out to clarify the anomalous superconductivity of MgB 2. We observed three bands crossing the Fermi level, which are ascribed to B2p-σ, π and surface bands. We have succeeded for the first time in directly observing the superconducting gaps of these bands separately. We have found that the superconducting-gap sizes of σ and surface bands are 6.5 ± 0.5 and 6.0 ± 0.5 meV, respectively, while that of the π band is much smaller (1.5 ± 0.5 meV). The present experimental result unambiguously demonstrates the validity of the two-band superconductivity in MgB 2.

  14. Direct observation of superconducting gaps in MgB2 by angle-resolved photoemission spectroscopy

    International Nuclear Information System (INIS)

    Souma, S.; Machida, Y.; Sato, T.; Takahashi, T.; Matsui, H.; Wang, S.-C.; Ding, H.; Kaminski, A.; Campuzano, J.C.; Sasaki, S.; Kadowaki, K.

    2004-01-01

    High-resolution angle-resolved photoemission spectroscopy has been carried out to clarify the anomalous superconductivity of MgB 2 . We observed three bands crossing the Fermi level, which are ascribed to B2p-σ, π and surface bands. We have succeeded for the first time in directly observing the superconducting gaps of these bands separately. We have found that the superconducting-gap sizes of σ and surface bands are 6.5 ± 0.5 and 6.0 ± 0.5 meV, respectively, while that of the π band is much smaller (1.5 ± 0.5 meV). The present experimental result unambiguously demonstrates the validity of the two-band superconductivity in MgB 2

  15. B1 to B2 structural phase transition in LiF under pressure

    Science.gov (United States)

    Jain, Aayushi; Dixit, R. C.

    2018-05-01

    In the last few decades the alkali halides emerged as crystals with useful applications and their high-pressure behaviour is the most intensively studied subject in high-pressure physics/chemistry, material science, and geosciences. Most alkali halides follow the B1 (NaCl-type)→B2 (CsCl-type) phase-transition route under pressure. In the present paper, we have investigated the characteristics of structural phase transition that occurred in Lithium Florid compound under high pressure. The transition pressure of B1-B2 was calculated using an effective interionic interaction potential (EIOP). The changes of the characteristics of crystals like, Gibbs free energy, cohesive energy, volume collapse, and lattice constant are calculated for the B1 and B2 structures. These data were compared with the available experimental and theoretical data.

  16. Plexin-B2 negatively regulates macrophage motility, Rac, and Cdc42 activation.

    Directory of Open Access Journals (Sweden)

    Kelly E Roney

    Full Text Available Plexins are cell surface receptors widely studied in the nervous system, where they mediate migration and morphogenesis though the Rho family of small GTPases. More recently, plexins have been implicated in immune processes including cell-cell interaction, immune activation, migration, and cytokine production. Plexin-B2 facilitates ligand induced cell guidance and migration in the nervous system, and induces cytoskeletal changes in overexpression assays through RhoGTPase. The function of Plexin-B2 in the immune system is unknown. This report shows that Plexin-B2 is highly expressed on cells of the innate immune system in the mouse, including macrophages, conventional dendritic cells, and plasmacytoid dendritic cells. However, Plexin-B2 does not appear to regulate the production of proinflammatory cytokines, phagocytosis of a variety of targets, or directional migration towards chemoattractants or extracellular matrix in mouse macrophages. Instead, Plxnb2(-/- macrophages have greater cellular motility than wild type in the unstimulated state that is accompanied by more active, GTP-bound Rac and Cdc42. Additionally, Plxnb2(-/- macrophages demonstrate faster in vitro wound closure activity. Studies have shown that a closely related family member, Plexin-B1, binds to active Rac and sequesters it from downstream signaling. The interaction of Plexin-B2 with Rac has only been previously confirmed in yeast and bacterial overexpression assays. The data presented here show that Plexin-B2 functions in mouse macrophages as a negative regulator of the GTPases Rac and Cdc42 and as a negative regulator of basal cell motility and wound healing.

  17. SoxB2 in sea urchin development: implications in neurogenesis, ciliogenesis and skeletal patterning.

    Science.gov (United States)

    Anishchenko, Evgeniya; Arnone, Maria Ina; D'Aniello, Salvatore

    2018-01-01

    Current studies in evolutionary developmental biology are focused on the reconstruction of gene regulatory networks in target animal species. From decades, the scientific interest on genetic mechanisms orchestrating embryos development has been increasing in consequence to the fact that common features shared by evolutionarily distant phyla are being clarified. In 2011, a study across eumetazoan species showed for the first time the existence of a highly conserved non-coding element controlling the SoxB2 gene, which is involved in the early specification of the nervous system. This discovery raised several questions about SoxB2 function and regulation in deuterostomes from an evolutionary point of view. Due to the relevant phylogenetic position within deuterostomes, the sea urchin Strongylocentrotus purpuratus represents an advantageous animal model in the field of evolutionary developmental biology. Herein, we show a comprehensive study of SoxB2 functions in sea urchins, in particular its expression pattern in a wide range of developmental stages, and its co-localization with other neurogenic markers, as SoxB1 , SoxC and Elav . Moreover, this work provides a detailed description of the phenotype of sea urchin SoxB2 knocked-down embryos, confirming its key function in neurogenesis and revealing, for the first time, its additional roles in oral and aboral ectoderm cilia and skeletal rod morphology. We concluded that SoxB2 in sea urchins has a neurogenic function; however, this gene could have multiple roles in sea urchin embryogenesis, expanding its expression in non-neurogenic cells. We showed that SoxB2 is functionally conserved among deuterostomes and suggested that in S. purpuratus this gene acquired additional functions, being involved in ciliogenesis and skeletal patterning.

  18. Cannabinoids reduce ErbB2-driven breast cancer progression through Akt inhibition

    Directory of Open Access Journals (Sweden)

    Flores Juana M

    2010-07-01

    Full Text Available Abstract Background ErbB2-positive breast cancer is characterized by highly aggressive phenotypes and reduced responsiveness to standard therapies. Although specific ErbB2-targeted therapies have been designed, only a small percentage of patients respond to these treatments and most of them eventually relapse. The existence of this population of particularly aggressive and non-responding or relapsing patients urges the search for novel therapies. The purpose of this study was to determine whether cannabinoids might constitute a new therapeutic tool for the treatment of ErbB2-positive breast tumors. We analyzed their antitumor potential in a well established and clinically relevant model of ErbB2-driven metastatic breast cancer: the MMTV-neu mouse. We also analyzed the expression of cannabinoid targets in a series of 87 human breast tumors. Results Our results show that both Δ9-tetrahydrocannabinol, the most abundant and potent cannabinoid in marijuana, and JWH-133, a non-psychotropic CB2 receptor-selective agonist, reduce tumor growth, tumor number, and the amount/severity of lung metastases in MMTV-neu mice. Histological analyses of the tumors revealed that cannabinoids inhibit cancer cell proliferation, induce cancer cell apoptosis, and impair tumor angiogenesis. Cannabinoid antitumoral action relies, at least partially, on the inhibition of the pro-tumorigenic Akt pathway. We also found that 91% of ErbB2-positive tumors express the non-psychotropic cannabinoid receptor CB2. Conclusions Taken together, these results provide a strong preclinical evidence for the use of cannabinoid-based therapies for the management of ErbB2-positive breast cancer.

  19. [Immunoexpression of c-erbB-2 in intraductal proliferative lesions of the female breast].

    Science.gov (United States)

    Oliveira, Agliberto Barbosa de; De Luca, Laurival Antônio; Carvalho, Grigna Teixeira; Arias, Victor Eduardo Arua; Carvalho, Lídia Raquel de; Assunção, Maria do Carmo

    2004-01-01

    Genetic modifications are related to genesis and development of cancer. Neoplasias in various organs express the c-erbB-2 oncogene. In intraductal proliferations of the breast it has been assessed as a risk factor for subsequent development of carcinoma. The c-erbB-2 immunoexpression in intraductal epithelial proliferations and the relationship with histopathological characteristics of ductal carcinoma in situ (DCIS) were evaluated. File material from 88 women, which were tissue samples formalin-fixed, paraffin-embedded blocks, was used. Of these 51 presented with DCIS and 37 with ductal hyperplasia without atypia. Ages of the women ranged from 35 to 76 years. All cases were reviewed and nuclear grade, presence of necrosis, preponderance of histological subtype and its extension were verified. Specimens were obtained for the c-erB-2 immunohistochemical study of 84 of the women in question. No expression of the oncogene was verified in the hyperplasias without atypias and in tissues adjacent to all tissue samples. Expression of c-erbB-2 was verified in 9 (19.1%) of the DCIS (p = 0.0001). Immunoexpression was not related to the extension of the lesions. The c-erbB-2 immunoexpression in DCIS was correlated to the histological subtype (p = 0.019), necrosis (p = 0.0066), nuclear grade (p = 0.0084) and Van Nuys Classification (p = 0.039). Expression of c-erbB-2 was significant in proliferative lesions with risk (DCIS) and was correlated to histopathological characteristics: high nuclear grade, presence of necrosis and comedy subtype. There was no expression in the hyperplasias without atypias and adjacent tissues.

  20. TiB2 reinforced aluminum based in situ composites fabricated by stir casting

    International Nuclear Information System (INIS)

    Chen, Fei; Chen, Zongning; Mao, Feng; Wang, Tongmin; Cao, Zhiqiang

    2015-01-01

    In this study, a new technique involving mechanical stirring at the salts/aluminum interface was developed to fabricate TiB 2 particulate reinforced aluminum based in situ composites with improved particle distribution. Processing parameters in terms of stirring intensity, stirring duration and stirring start time were optimized according to the microstructure and mechanical properties evaluation. The results show that, the first and last 15 min of the entire 60 min holding are of prime importance to the particle distribution of the final composites. When applying 180 rpm (revolutions per minute) stirring at the salts/aluminum interface in these two intervals, a more uniform microstructure can be achieved and the Al-4 wt% TiB 2 composite thus produced exhibits superior mechanical performance. Synchrotron radiation X-ray computed tomography (SR-CT) was used to give a full-scale imaging of the particle distribution. From the SR-CT results, the in situ Al–xTiB 2 composites (x=1, 4 and 7, all in wt%) fabricated by the present technique are characterized by fine and clean TiB 2 particles distributed uniformly throughout the Al matrix. These composites not only have higher yield strength (σ 0.2 ) and ultimate tensile strength (UTS), but also exhibit superior ductility, with respect to the Al–TiB 2 composites fabricated by the conventional process. The σ 0.2 and UTS of the Al–7TiB 2 composite in the present work, are 260% and 180% higher than those of the matrix. A combined mechanism was also presented to interpret the improvements in yield strength of the composites as influenced by their microstructures and processing history. The predicted values are in good agreement with the experimental results, strongly supporting the strengthening mechanism we proposed. Fractography reveals that the composites thus fabricated, follow ductile fracture mechanism in spite of the presence of stiff reinforcements

  1. Cinética de degradación térmica de betacianinas, betaxantinas y vitamina C en una bebida a base de jugo de remolacha (Beta vulgaris L. y miel de abeja

    Directory of Open Access Journals (Sweden)

    William Sánchez-Chávez

    2015-01-01

    Full Text Available La cinética de degradación de la betacianinas, betaxantinas y vitamina C a 30 °C, 40 °C y 50 ºC fue evaluada en una bebida a base de betarraga y miel de abeja, utilizando los modelos cinéticos de orden cero, primer y segundo orden; así como el modelo de Arrhenius para evaluar la dependencia de la velocidad de degradación con respecto a la temperatura. Se determinó que la degradación de los tres compuestos evaluados en las tres temperaturas ensayadas siguió una cinética de primer orden con una alta correlación (R2 = 0,974; 0,98; 0,979. Se determinó que las betacianinas y la vitamina C presentan un sensibilidad similar a la temperatura; mientras que las betaxantinas fueron más estables. Con referencia a la influencia de la temperatura en la velocidad de degradación se determinaron las energías de activación y los valores Q10 de la reacción los cuales confirman la mayor estabilidad de las betaxantinas con respecto a las betacianinas y la vitamina C en la bebida de remolacha y miel de abeja.

  2. Tolerância à aplicação de megadoses de vitamina A associada à vacinação em crianças no Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Assis Ana Marlúcia Oliveira

    2000-01-01

    Full Text Available Um estudo de seguimento foi desenvolvido em duas localidades do semi-árido do estado da Bahia, Nordeste do Brasil, com o objetivo de identificar a ocorrência e a natureza de possíveis efeitos adversos agudos em conseqüência da suplementação com megadoses de vitamina A (100.000 e 200.000 UI oferecida junto com imunização em massa, a crianças de seis a 59 meses de idade. A amostra do estudo foi composta por 852 crianças; 416 do município de Teofilândia integraram o grupo que recebeu a vitamina A com as vacinas e 436 crianças de Santa Bárbara foram incluídas no grupo que recebeu somente a vacina. Nas 24 horas que antecederam a vacinação, as crianças dos dois grupos referiram similar freqüência de diarréia, febre e vômito; a anorexia foi mais prevalente em Teofilândia e persistiu durante todo o período de seguimento. Os resultados sugerem que nenhum efeito adverso agudo, em especial diarréia, vômito, febre ou anorexia, esteve associado à ingestão da vitamina A combinada à vacinação em massa, particularmente à Sabin, DPT e anti-sarampo.

  3. Low-temperature synthesis of superconducting nanocrystalline MgB2

    International Nuclear Information System (INIS)

    Lu, J.; Xiao, Z.; Lin, Q.; Claus, H.; Fang, Z.Z.

    2010-01-01

    Magnesium diboride (MgB 2 ) is considered a promising material for practical application in superconducting devices, with a transition temperature near 40 K. In the present paper, nanocrystalline MgB 2 with an average particle size of approximately 70 nm is synthesized by reacting LiBH 4 with MgH 2 at temperatures as low as 450 C. This synthesis approach successfully bypasses the usage of either elemental boron or toxic diborane gas. The superconductivity of the nanostructures is confirmed by magnetization measurements, showing a superconducting critical temperature of 38.7 K.

  4. Social media as a support tool for B2B communication

    OpenAIRE

    Thapa Magar, Chandani

    2016-01-01

    This research was commissioned by Oulu University of Applied Sciences and a Finnish tech company Uros Ltd. As social media adoption is growing steadily in the contemporary consumer marketing, not many cases can be found where Social Media has been successfully adopted and used in a B2B scenario. Thus, it has remained as a reserved matter for many B2B companies, which still follow the tried-and-true business principles polished through traditional marketing. This research paper aims to enhanc...

  5. Short syntheses of enantiopure calystegine B-2, B-3, and B-4

    DEFF Research Database (Denmark)

    Skaanderup, Philip Robert; Madsen, Robert

    2001-01-01

    Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps.......Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps....

  6. Extreme ultraviolet spectroscopy of G191-B2B - Direct observation of ionization edges

    Science.gov (United States)

    Wilkinson, Erik; Green, James C.; Cash, Webster

    1992-01-01

    We present the first spectrum of the hot, DA white dwarf G191-B2B (wd 0501 + 527) between 200 and 330 A. The spectrum, which has about 2 A resolution, was obtained with a sounding rocket-borne, grazing incidence spectrograph. The spectrum shows no evidence of He II, the expected primary opacity source in this wavelength region. Three ionization edges and one absorption feature were observed and are suggestive of O III existing in the photosphere of G191-B2B. Also noted is a broad spectral depression that may result from Fe VI in the photosphere.

  7. Crystallinity and flux pinning properties of MgB2 bulks

    International Nuclear Information System (INIS)

    Yamamoto, A.; Shimoyama, J.; Ueda, S.; Katsura, Y.; Iwayama, I.; Horii, S.; Kishio, K.

    2006-01-01

    The relationship between flux pinning properties and crystallinity of MgB 2 bulks was systematically studied. Improved flux pinning properties under high fields were observed for samples with low crystallinity. Increased impurity scattering due to strain and defects in lattice corresponding to the degraded crystallinity was considered to enhance flux pinning strength at grain boundaries. Low-temperature synthesis and carbon substitution were confirmed to be effective for degrading crystallinity of MgB 2 bulks, resulting in high critical current properties under high fields

  8. Sociala Medier som kommunikationskanal för B2B-företag

    OpenAIRE

    Kaddura, Layla; Olsson, Karin

    2010-01-01

    The purpose of this thesis is to show what advantages and opportunities social media offer for B2B-companies (business-to-business), and how they can be used for marketing communications. We have studied how companies can use social media, for example evolving the organization, developing products/services, staying up-to-date, building relations, creating customer loyalty and engagement, building the company’s identity and image, and affecting the buying decisions. We have also studied how B2...

  9. Properties of stabilized MgB2 composite wire with Ti barrier

    International Nuclear Information System (INIS)

    Kovac, P; Husek, I; Melisek, T; Holubek, T

    2007-01-01

    Stabilized four-filament in situ MgB 2 /Ti/Cu/Monel composite wire was produced by the rectangular wire-in-tube (RWIT) technique. 10 wt% of nanosize SiC was added into the Mg-B powder mixture, which was packed into the Ti/Cu and Monel tubes, respectively. The assembled composite was two-axially rolled into wire and/or tape form and sintered at temperatures of 650-850 deg. C/0.5 h. Stabilized MgB 2 wire with Ti barrier is studied in terms of field-dependent transport critical current density, effects of filament size reduction and thermal stability

  10. China's B2C e-commerce development and its future prospects

    OpenAIRE

    Jin, Guming

    2012-01-01

    China’s E-commerce environment is improving all the time. Consumers are getting more and more habituated to this form of consumption mode. The recent trend shows that China’s e- commerce market is booming mainly because of major enterprises’ fierce competition within Business To Customer E-commerce market. People are optimistic about B2C E-commerce which strengthens the China’s B2C E-commerce market. Even though E-commerce business in China is soaring, there still persists a problem, too. ...

  11. Laser-induced thermoelectric voltage in normal state MgB2 thin films

    International Nuclear Information System (INIS)

    Zhao Songqing; Zhou Yueliang; Zhao Kun; Wang Shufang; Chen Zhenghao; Jin Kuijuan; Lue Huibin; Cheng Bolin; Yang Guozhen

    2006-01-01

    Laser-induced voltage has been observed in c-axis oriented MgB 2 thin film at room temperature. The amplitude of the signal is approximately proportional to the film thickness. For the film with the thickness of 150 nm, a very fast response has been detected when the film was irradiated by a 308 nm pulsed laser of 20 ns duration. The rise time and full width at half-maximum of the signal are about 3 and 25 ns, respectively. The physical origin of the laser-induced voltage can be attributed to a transverse thermoelectricity due to the anisotropic thermopower in MgB 2

  12. MgB2 ultrathin films fabricated by hybrid physical chemical vapor deposition and ion milling

    Directory of Open Access Journals (Sweden)

    Narendra Acharya

    2016-08-01

    Full Text Available In this letter, we report on the structural and transport measurements of ultrathin MgB2 films grown by hybrid physical-chemical vapor deposition followed by low incident angle Ar ion milling. The ultrathin films as thin as 1.8 nm, or 6 unit cells, exhibit excellent superconducting properties such as high critical temperature (Tc and high critical current density (Jc. The results show the great potential of these ultrathin films for superconducting devices and present a possibility to explore superconductivity in MgB2 at the 2D limit.

  13. Modelling the B2C Marketplace: Evaluation of a Reputation Metric for e-Commerce

    Science.gov (United States)

    Gutowska, Anna; Sloane, Andrew

    This paper evaluates recently developed novel and comprehensive reputation metric designed for the distributed multi-agent reputation system for the Business-to-Consumer (B2C) E-commerce applications. To do that an agent-based simulation framework was implemented which models different types of behaviours in the marketplace. The trustworthiness of different types of providers is investigated to establish whether the simulation models behaviour of B2C e-Commerce systems as they are expected to behave in real life.

  14. Preparation of MgB2 superconducting microbridges by focused ion beam direct milling

    Science.gov (United States)

    Zhang, Xuena; Li, Yanli; Xu, Zhuang; Kong, Xiangdong; Han, Li

    2017-01-01

    MgB2 superconducting microbridges were prepared by focused ion beam (FIB) direct milling on MgB2 films. The surface topography of the microbridges were observed using SEM and AFM and the superconductivity was measured in this paper. Lots of cracks and holes were found near the milled area. And the superconducting transition temperature was decreased a lot and the bridges prepared were not superconducting due to ion damage after milled with large dose. Through these works, we explored the effect regular of FIB milling and experimental parameters on the performance of microbridges.

  15. Structural and electronic properties of OsB2 : A hard metallic material

    Science.gov (United States)

    Chen, Z. Y.; Xiang, H. J.; Yang, Jinlong; Hou, J. G.; Zhu, Qingshi

    2006-07-01

    We calculate the structural and electronic properties of OsB2 using density functional theory with or without taking into account the spin-orbit (SO) interaction. Our results show that the bulk modulus with and without SO interactions are 364 and 365GPa , respectively, both are in good agreement with experiment (365-395GPa) . The evidence of covalent bonding of Os-B, which plays an important role to form a hard material, is indicated both in charge density, atoms in molecules analysis, and density of states analysis. The good metallicity and hardness of OsB2 might suggest its potential application as hard conductors.

  16. Superconducting and normal state properties of carbon doped and neutron irradiated MgB2

    International Nuclear Information System (INIS)

    Wilke, R.H.T.; Samuely, P.; Szabo, P.; Holanova, Z.; Bud'ko, S.L.; Canfield, P.C.; Finnemore, D.K.

    2007-01-01

    Current research in MgB 2 focuses on the effects various types of perturbations have on the superconducting properties of this novel two-gap superconductor. In this article we summarize the effects of carbon doping and neutron irradiation in bulk MgB 2 . Low levels of carbon doping and light neutron irradiation result in significant enhancements in H c2 . At high fluences, where superconductivity is nearly fully suppressed, superconductivity can be restored through post exposure annealing. However, this results in a change in the interdependencies of the normal state and superconducting properties (ρ 0 , T c , H c2 ), with little or no enhancement in H c2

  17. Linkage of genes for laminin B1 and B2 subunits on chromosome 1 in mouse.

    Science.gov (United States)

    Elliott, R W; Barlow, D; Hogan, B L

    1985-08-01

    We have used cDNA clones for the B1 and B2 subunits of laminin to find restriction fragment length DNA polymorphisms for the genes encoding these polypeptides in the mouse. Three alleles were found for LamB2 and two for LamB1 among the inbred mouse strains. The segregation of these polymorphisms among recombinant inbred strains showed that these genes are tightly linked in the central region of mouse Chromosome 1 between Sas-1 and Ly-m22, 7.4 +/- 3.2 cM distal to the Pep-3 locus. There is no evidence in the mouse for pseudogenes for these proteins.

  18. The preliminary study of the quench protection of an MgB2

    Science.gov (United States)

    Juster, F. P.; Berriaud, C.; Bonelli, A.; Pasquet, R.; Przybilski, H.; Schild, T.; Scola, L.

    2014-01-01

    In the framework of general studies currently carried out at CEA/Saclay in collaboration with Sigmaphi Company on dry MgB2 magnet operating at 10 K and medium range field, 1 T up to 4 T., we plan to build a prototype-coil with a commercial MgB2 wire. This coil, the nominal axial magnetic field of which is 1 tesla, will be placed in a 3 teslas background field generated by a classical NbTi coil. This paper deals with the preliminary quench protection studies including stability and quench propagation modeling.

  19. Amygdala EphB2 Signaling Regulates Glutamatergic Neuron Maturation and Innate Fear.

    Science.gov (United States)

    Zhu, Xiao-Na; Liu, Xian-Dong; Zhuang, Hanyi; Henkemeyer, Mark; Yang, Jing-Yu; Xu, Nan-Jie

    2016-09-28

    The amygdala serves as emotional center to mediate innate fear behaviors that are reflected through neuronal responses to environmental aversive cues. However, the molecular mechanism underlying the initial neuron responses is poorly understood. In this study, we monitored the innate defensive responses to aversive stimuli of either elevated plus maze or predator odor in juvenile mice and found that glutamatergic neurons were activated in amygdala. Loss of EphB2, a receptor tyrosine kinase expressed in amygdala neurons, suppressed the reactions and led to defects in spine morphogenesis and fear behaviors. We further found a coupling of spinogenesis with these threat cues induced neuron activation in developing amygdala that was controlled by EphB2. A constitutively active form of EphB2 was sufficient to rescue the behavioral and morphological defects caused by ablation of ephrin-B3, a brain-enriched ligand to EphB2. These data suggest that kinase-dependent EphB2 intracellular signaling plays a major role for innate fear responses during the critical developing period, in which spinogenesis in amygdala glutamatergic neurons was involved. Generation of innate fear responses to threat as an evolutionally conserved brain feature relies on development of functional neural circuit in amygdala, but the molecular mechanism remains largely unknown. We here identify that EphB2 receptor tyrosine kinase, which is specifically expressed in glutamatergic neurons, is required for the innate fear responses in the neonatal brain. We further reveal that EphB2 mediates coordination of spinogenesis and neuron activation in amygdala during the critical period for the innate fear. EphB2 catalytic activity plays a major role for the behavior upon EphB-ephrin-B3 binding and transnucleus neuronal connections. Our work thus indicates an essential synaptic molecular signaling within amygdala that controls synapse development and helps bring about innate fear emotions in the postnatal

  20. Characterization of metabolites from a strain of Aspergillus flavus accumulating aflatoxin B2

    International Nuclear Information System (INIS)

    Dutton, M.F.

    1985-01-01

    A number of aflatoxins and anthraquinone pigments were isolated from a strain of Aspergillus flavus, several of which were fully characterized. The major metabolites isolated were aflatoxin B 2 and versicolorin C, which are normally only found as minor products from species of the genus Aspergillus. The identification of these products supports the proposal that aflatoxin B 2 can arise independently of aflatoxin B 1 and that, in this case, the branch in the pathway occurs at the versicolorins. Other metabolites charaterized were aflatoxin M 2 , norsolorinic acid, and averufin