WorldWideScience

Sample records for ri baseline a1c

  1. Should Studies of Diabetes Treatment Stratification Correct for Baseline HbA1c?

    Science.gov (United States)

    Jones, Angus G.; Lonergan, Mike; Henley, William E.; Pearson, Ewan R.; Hattersley, Andrew T.; Shields, Beverley M.

    2016-01-01

    Aims Baseline HbA1c is a major predictor of response to glucose lowering therapy and therefore a potential confounder in studies aiming to identify other predictors. However, baseline adjustment may introduce error if the association between baseline HbA1c and response is substantially due to measurement error and regression to the mean. We aimed to determine whether studies of predictors of response should adjust for baseline HbA1c. Methods We assessed the relationship between baseline HbA1c and glycaemic response in 257 participants treated with GLP-1R agonists and assessed whether it reflected measurement error and regression to the mean using duplicate ‘pre-baseline’ HbA1c measurements not included in the response variable. In this cohort and an additional 2659 participants treated with sulfonylureas we assessed the relationship between covariates associated with baseline HbA1c and treatment response with and without baseline adjustment, and with a bias correction using pre-baseline HbA1c to adjust for the effects of error in baseline HbA1c. Results Baseline HbA1c was a major predictor of response (R2 = 0.19,β = -0.44,pHbA1c were associated with response, however these associations were weak or absent after adjustment for baseline HbA1c. Bias correction did not substantially alter associations. Conclusions Adjustment for the baseline HbA1c measurement is a simple and effective way to reduce bias in studies of predictors of response to glucose lowering therapy. PMID:27050911

  2. Presence of pRI1:

    DEFF Research Database (Denmark)

    Migura, Lourdes Garcia; Hasman, Henrik; Jensen, Lars Bogø

    2009-01-01

    This study focused on the molecular characterization of a small cryptic, mobilizable plasmid (6038 bp) sequenced from an E. faecium 9631160-1 of poultry origin. Sequence analysis of pRI1 revealed seven open reading frames. pRI1 contained an IS 100% identical to ISEfa4. This insertion element...... almost identical to the repA from the pEFNP1 and pKQ10 plasmids from E. faecium was also identified. Presence of the pRI1 replication initiation gene (rep) was analyzed in a panel of 159 E. faecium isolates of human and animal origin from different European countries, of which 60 tested positive...

  3. Data of evolutionary structure change: 1DEAA-2RI1A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DEAA-2RI1A 1DEA 2RI1 A A -MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLG.../line> ASP CA 284 PHE CA 347 SER CA 228 1DEA... A 1DEAA ALVEMHKAGQVSFK 1DEA A 1DEAA GLU CA 160 ASP CA 224 VAL CA 284 1DEA

  4. CryoSat SAR/SARin Level1b products: assessment of BaselineC and improvements towards BaselineD

    Science.gov (United States)

    Scagliola, Michele; Fornari, Marco; Bouffard, Jerome; Parrinello, Tommaso

    2017-04-01

    CryoSat was launched on the 8th April 2010 and is the first European ice mission dedicated to the monitoring of precise changes in the thickness of polar ice sheets and floating sea ice. Cryosat carries an innovative radar altimeter called the Synthetic Aperture Interferometric Altimeter (SIRAL), that transmits pulses at a high pulse repetition frequency thus making the received echoes phase coherent and suitable for azimuth processing. This allows to reach a significantly improved along track resolution with respect to traditional pulse-width limited altimeters. CryoSat is the first altimetry mission operating in SAR mode and continuous improvements in the Level1 Instrument Processing Facility (IPF1) are being identified, tested and validated in order to improve the quality of the Level1b products. The current IPF, Baseline C, was released in operation in April 2015 and the second CryoSat reprocessing campaign was jointly initiated, taking benefit of the upgrade implemented in the IPF1 processing chain but also of some specific configurations for the calibration corrections. In particular, the CryoSat Level1b BaselineC products generated in the framework of the second reprocessing campaign include refined information for what concerns the mispointing angles and the calibration corrections. This poster will thus detail thus the evolutions that are currently planned for the CryoSat BaselineD SAR/SARin Level1b products and the corresponding quality improvements that are expected.

  5. Effect of once-weekly dulaglutide on glycated haemoglobin (HbA1c) and fasting blood glucose in patient subpopulations by gender, duration of diabetes and baseline HbA1c.

    Science.gov (United States)

    Gallwitz, Baptist; Dagogo-Jack, Samuel; Thieu, Vivian; Garcia-Perez, Luis-Emilio; Pavo, Imre; Yu, Maria; Robertson, Kenneth E; Zhang, Nan; Giorgino, Francesco

    2018-02-01

    To evaluate the efficacy and safety of dulaglutide 1.5 and 0.75 mg in patients with type 2 diabetes by subgroups of gender, duration of diabetes and baseline glycated haemoglobin (HbA1c) in the dulaglutide clinical development programme (AWARD-1 to -6 and -8 clinical trials). Change in HbA1c was analysed by gender, duration of diabetes (baseline HbA1c (baseline in weight, hypoglycaemia and gastrointestinal adverse events were evaluated for individual trials. In the pooled analysis of patients treated with dulaglutide 1.5 mg at 6 months, the reductions in HbA1c from baseline were similar across gender (men: least squares [LS] mean -1.26% [95% confidence interval {CI} -1.36, -1.16]; women: LS mean -1.33% [95% CI -1.43, -1.24]) and among duration of diabetes subgroups (baseline HbA1c ≥8.5% had greater HbA1c reductions than patients with baseline HbA1c baseline HbA1c subgroups, respectively; women had a numerically greater weight loss or less weight gain than men with both dulaglutide doses. There was no clinically meaningful difference in hypoglycaemia trends by gender or duration of diabetes. Hypoglycaemia incidence and rate were generally lower in patients with baseline HbA1c ≥8.5% than in those with baseline HbA1c, with greater HbA1c and FBG reductions in patients with a higher baseline HbA1c. Dulaglutide was well tolerated, with a safety profile similar to other glucagon-like peptide-1 receptor agonists. © 2017 John Wiley & Sons Ltd.

  6. Bronchopulmonary C-fibers' IL1RI contributes to the prolonged apneic response to intra-atrial injection of capsaicin by prenatal nicotinic exposure in rat pups

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Lei; Zhuang, Jianguo; Xu, Fadi, E-mail: fxu@lrri.org

    2016-07-15

    Prenatal nicotinic exposure (PNE) as a SIDS model reportedly sensitizes bronchopulmonary C-fibers (PCFs), contributing to the prolonged PCF-mediated apnea in rat pups, but the relevant mechanisms are not fully understood. Pulmonary IL-1β upregulated by cigarette smoke is known to stimulate or sensitize PCFs acting via IL-1 type I receptor (IL1RI) and inhibit inspiration frequency. Because of its upregulation observed in SIDS victims, we hypothesized that PNE increased pulmonary IL-1β release and IL1RI expression in pulmonary C-neurons via action on α7 nicotinic acetylcholine receptors (α7nAChR) to induce the prolonged PCF-mediated apnea. IL-1β in BALF and IL1RI in the nodose/jugular (N/J) ganglion and vagal pulmonary C-neurons retrogradely-traced were compared between Ctrl (saline) and PNE pups and among the vehicle-treated Ctrl and PNE and methyllycaconitine (a selective α7nAChR antagonist)-treated PNE pups. The effect of IL-1RI blockade (IL-1Ra) on the PCF-mediated apnea was also compared between Ctrl and PNE pups. PNE significantly elevated IL-1β in BALF and upregulated IL1RI gene and protein expression in N/J ganglia and gene in vagal pulmonary C-neurons. All of these responses were eliminated by pretreatment with blockade of α7nAChR. In addition, the prolonged PCF-mediated apnea in PNE pups was significantly shortened by right atrial bolus injection of IL-1Ra. We conclude that PNE enhances pulmonary IL-1β release and PCF IL1RI expression acting via α7nAChR in contributing to sensitization of PCFs and prolongation of the PCF-mediated apneic response. - Highlights: • PNE increased pulmonary IL-1β release and IL1R1 expression in the N/J ganglia. • PNE elevated IL1R1 mRNA in vagal pulmonary C-neurons. • Blockage of peripheral IL1R1 reduced the PNE-induced PCF sensitization. • PNE induced the changes in IL-1β and IL1R1 dependent on action of α7nAChR.

  7. Endogenous IL-1 in cognitive function and anxiety: a study in IL-1RI-/- mice.

    Directory of Open Access Journals (Sweden)

    Carol L Murray

    Full Text Available Interleukin-1 (IL-1 is a key pro-inflammatory cytokine, produced predominantly by peripheral immune cells but also by glia and some neuronal populations within the brain. Its signalling is mediated via the binding of IL-1α or IL-1β to the interleukin-1 type one receptor (IL-1RI. IL-1 plays a key role in inflammation-induced sickness behaviour, resulting in depressed locomotor activity, decreased exploration, reduced food and water intake and acute cognitive deficits. Conversely, IL-1 has also been suggested to facilitate hippocampal-dependent learning and memory: IL-1RI(-/- mice have been reported to show deficits on tasks of visuospatial learning and memory. We sought to investigate whether there is a generalised hippocampal deficit in IL-1RI(-/- animals. Therefore, in the current study we compared wildtype (WT mice to IL-1RI(-/- mice using a variety of hippocampal-dependent learning and memory tasks, as well as tests of anxiety and locomotor activity. We found no difference in performance of the IL-1RI(-/- mice compared to WT mice in a T-maze working memory task. In addition, the IL-1RI(-/- mice showed normal learning in various spatial reference memory tasks including the Y-maze and Morris mater maze, although there was a subtle deficit in choice behaviour in a spatial discrimination, beacon watermaze task. IL-1RI(-/- mice also showed normal memory for visuospatial context in the contextual fear conditioning paradigm. In the open field, IL-1RI(-/- mice showed a significant increase in distance travelled and rearing behaviour compared to the WT mice and in the elevated plus-maze spent more time in the open arms than did the WT animals. The data suggest that, contrary to prior studies, IL-1RI(-/- mice are not robustly impaired on hippocampal-dependent memory and learning but do display open field hyperactivity and decreased anxiety compared to WT mice. The results argue for a careful evaluation of the roles of endogenous IL-1 in hippocampal

  8. Structure of RiVax: a recombinant ricin vaccine

    International Nuclear Information System (INIS)

    Legler, Patricia M.; Brey, Robert N.; Smallshaw, Joan E.; Vitetta, Ellen S.; Millard, Charles B.

    2011-01-01

    The X-ray crystal structure (at 2.1 Å resolution) of an immunogen under development as part of a ricin vaccine for humans is presented and structure-based analysis of the results was conducted with respect to related proteins and the known determinants for inducing or suppressing the protective immune response. RiVax is a recombinant protein that is currently under clinical development as part of a human vaccine to protect against ricin poisoning. RiVax includes ricin A-chain (RTA) residues 1–267 with two intentional amino-acid substitutions, V76M and Y80A, aimed at reducing toxicity. Here, the crystal structure of RiVax was solved to 2.1 Å resolution and it was shown that it is superposable with that of the ricin toxin A-chain from Ricinus communis with a root-mean-square deviation of 0.6 Å over 258 C α atoms. The RiVax structure is also compared with the recently determined structure of another potential ricin-vaccine immunogen, RTA 1–33/44–198 R48C/T77C. Finally, the locations and solvent-exposure of two toxin-neutralizing B-cell epitopes were examined and it was found that these epitopes are within or near regions predicted to be involved in catalysis. The results demonstrate the composition of the RiVax clinical material and will guide ongoing protein-engineering strategies to develop improved immunogens

  9. Effective removal of a range of Ti/Ri plasmids using a pBBR1-type vector having a repABC operon and a lux reporter system.

    Science.gov (United States)

    Yamamoto, Shinji; Sakai, Ayako; Agustina, Vita; Moriguchi, Kazuki; Suzuki, Katsunori

    2018-02-01

    Ti and Ri plasmids of pathogenic Agrobacterium strains are stably maintained by the function of a repABC operon and have been classified into four incompatibility groups, namely, incRh1, incRh2, incRh3, and incRh4. Removal of these plasmids from their bacterial cells is an important step in determining strain-specific virulence characteristics and to construct strains useful for transformation. Here, we developed two powerful tools to improve this process. We first established a reporter system to detect the presence and absence of Ti/Ri plasmids in cells by using an acetosyringone (AS)-inducible promoter of the Ti2 small RNA and luxAB from Vibrio harveyi. This system distinguished a Ti/Ri plasmid-free cell colony among plasmid-harboring cell colonies by causing the latter colonies to emit light in response to AS. We then constructed new "Ti/Ri eviction plasmids," each of which carries a repABC from one of four Ti/Ri plasmids that belonged to incRh1, incRh2, incRh3, and incRh4 groups in the suicidal plasmid pK18mobsacB and in a broad-host-range pBBR1 vector. Introduction of the new eviction plasmids into Agrobacterium cells harboring the corresponding Ti/Ri plasmids led to Ti/Ri plasmid-free cells in every incRh group. The Ti/Ri eviction was more effective by plasmids with the pBBR1 backbone than by those with the pK18mobsacB backbone. Furthermore, the highly stable cryptic plasmid pAtC58 in A. tumefaciens C58 was effectively evicted by the introduction of a pBBR1 vector containing the repABC of pAtC58. These results indicate that the set of pBBR1-repABC plasmids is a powerful tool for the removal of stable rhizobial plasmids.

  10. Contribution of IL-1RI Signaling to Protection against Cryptococcus neoformans 52D in a Mouse Model of Infection

    Directory of Open Access Journals (Sweden)

    Mitra Shourian

    2018-01-01

    Full Text Available Interleukin-1 alpha (IL-1α and interleukin-1 beta (IL-1β are pro-inflammatory cytokines that are induced after Cryptococcus neoformans infection and activate the interleukin-1 receptor type I (IL-1RI. To establish the role of IL-1RI signaling in protection against cryptococcal infection, we analyzed wild-type (WT and IL-1RI-deficient (IL-1RI−/− mice on the BALB/c background. IL-1RI−/− mice had significantly reduced survival compared to WT mice after intratracheal challenge with C. neoformans 52D. Microbiological analysis showed a significant increase in the lung and brain fungal burden of IL-1RI−/− compared to WT mice beginning at weeks 1 and 4 postinfection, respectively. Histopathology showed that IL-1RI−/− mice exhibit greater airway epithelial mucus secretion and prominent eosinophilic crystals that were absent in WT mice. Susceptibility of IL-1RI−/− mice was associated with significant induction of a Th2-biased immune response characterized by pulmonary eosinophilia, M2 macrophage polarization, and recruitment of CD4+ IL-13+ T cells. Expression of pro-inflammatory [IL-1α, IL-1β, TNFα, and monocyte chemoattractant protein 1 (MCP-1], Th1-associated (IFNγ, and Th17-associated (IL-17A cytokines was significantly reduced in IL-1RI−/− lungs compared to WT. WT mice also had higher expression of KC/CXCL1 and sustained neutrophil recruitment to the lung; however, antibody-mediated depletion of these cells showed that they were dispensable for lung fungal clearance. In conclusion, our data indicate that IL-1RI signaling is required to activate a complex series of innate and adaptive immune responses that collectively enhance host defense and survival after C. neoformans 52D infection in BALB/c mice.

  11. CryoSat Level1b SAR/SARin BaselineC: Product Format and Algorithm Improvements

    Science.gov (United States)

    Scagliola, Michele; Fornari, Marco; Di Giacinto, Andrea; Bouffard, Jerome; Féménias, Pierre; Parrinello, Tommaso

    2015-04-01

    CryoSat was launched on the 8th April 2010 and is the first European ice mission dedicated to the monitoring of precise changes in the thickness of polar ice sheets and floating sea ice. Cryosat carries an innovative radar altimeter called the Synthetic Aperture Interferometric Altimeter (SIRAL), that transmits pulses at a high pulse repetition frequency thus making the received echoes phase coherent and suitable for azimuth processing. This allows to reach a significantly improved along track resolution with respect to traditional pulse-width limited altimeters. CryoSat is the first altimetry mission operating in SAR mode and continuous improvements in the Level1 Instrument Processing Facility (IPF1) are being identified, tested and validated in order to improve the quality of the Level1b products. The current IPF, Baseline B, was released in operation in February 2012. A reprocessing campaign followed, in order to reprocess the data since July 2010. After more than 2 years of development, the release in operations of Baseline C is expected in the first half of 2015. BaselineC Level1b products will be distributed in an updated format, including for example the attitude information (roll, pitch and yaw) and, for SAR/SARIN, the waveform length doubled with respect to Baseline B. Moreveor, various algorithm improvements have been identified: • a datation bias of about -0.5195 ms will be corrected (SAR/SARIn) • a range bias of about 0.6730 m will be corrected (SAR/SARIn) • a roll bias of 0.1062 deg and a pitch bias of 0.0520 deg • Surface sample stack weighting to filter out the single look echoes acquired at highest look angle, that results in a sharpening of the 20Hz waveforms With the operational release of BaselineC, the second CryoSat reprocessing campaign will be initiated, taking benefit of the upgrade implemented in the IPF1 processing chain but also at IPF2 level. The reprocessing campaign will cover the full Cryosat mission starting on 16th July 2010

  12. Matriz binária RiC: classificação filogenética da informação arquivística

    OpenAIRE

    Macedo, Laureano Secundino Ascensão de

    2017-01-01

    Ascensão de Macedo, L. S., 2017, "Matriz binária RiC: classificação filogenética da informação arquivística", doi:10.7910/DVN/ERE8HL, Harvard Dataverse, V1 Constam três folhas: 1 - matriz binária com propriedades RiC e taxa (tipologias documentais); 2 - matriz binária simples (processamento em DendroUPGMA); 3 - 3 outputs de DendroUPGMA: matriz bicaudal de similaridade, de distâncias e formato Newick. (2017-01-18)

  13. Real-world Clinical Outcomes Among Patients With Type 2 Diabetes Receiving Canagliflozin at a Specialty Diabetes Clinic: Subgroup Analysis by Baseline HbA1c and Age.

    Science.gov (United States)

    Johnson, June Felice; Parsa, Rahul; Bailey, Robert A

    2017-06-01

    Canagliflozin, a sodium glucose co-transporter 2 inhibitor developed for the treatment of type 2 diabetes mellitus (T2DM), has demonstrated effectiveness in patients with T2DM receiving care at a specialty diabetes clinic. We report the outcomes in these patients in subgroups classified by baseline hemoglobin A 1c (HbA 1c ) and age. This subgroup analysis was based on a review of data from the electronic health records of adults with T2DM who were prescribed canagliflozin at a specialty diabetes clinic and who returned for ≥1 follow-up office visit. Mean changes from baseline to the first and second follow-up office visits in HbA 1c , body weight, and systolic and diastolic blood pressure (BP) were calculated in each subgroup classified by baseline HbA 1c (≥7.0%, ≥8.0%, and >9.0%) and age (baseline HbA 1c ≥7.0%, ≥8.0%, and >9.0%, respectively; 396 and 66 patients were aged baseline HbA 1c and age experienced clinically and statistically significant reductions from baseline in HbA 1c , body weight, and systolic BP that were sustained over 2 office visits; diastolic BP was also reduced across baseline HbA 1c and age subgroups. Greater reductions in HbA 1c were seen among the canagliflozin-treated patients with higher baseline HbA 1c and among younger versus older patients. These findings from clinical practice demonstrate real-world effectiveness of canagliflozin in lowering HbA 1c , body weight, and systolic BP among patients with T2DM, regardless of baseline HbA 1c levels or age. Copyright © 2017 Elsevier HS Journals, Inc. All rights reserved.

  14. CryoSat Level1b SAR/SARin: quality improvements towards BaselineC

    Science.gov (United States)

    Scagliola, Michele; Fornari, Marco; Bouzinac, Catherine; Tagliani, Nicolas; Parrinello, Tommaso

    2014-05-01

    CryoSat was launched on the 8th April 2010 and it is the first European ice mission dedicated to monitoring precise changes in the thickness of polar ice sheets and floating sea ice over a 3-year period. Cryosat carries an innovative radar altimeter called the Synthetic Aperture Interferometric Altimeter (SIRAL), that transmits pulses at a high pulse repetition frequency thus making the received echoes phase coherent and suitable for azimuth processing. This allows to reach a significantly improved along track resolution with respect to traditional pulse-width limited altimeters. CryoSat is the first altimetry mission operating in SAR mode and continuous improvement in the Level1 Instrument Processing Facility (IPF1) are being identified, tested and validated in order to improve the quality of the Level1b products. Towards the release of the BaselineC of the CryoSat Level1b SAR/SARin products, that is expected during 2014, several improvements have been identified: • a datation bias of about -0.5195 ms will be corrected • a range bias of about -0.6730 m will be corrected • the waveform length in the Level1b product will be doubled with respect to BaselineB • improved processing for 1Hz echoes to have sharper waveforms • surface sample stack weighting to filter out the single look echoes acquired at highest look angle, that results in a sharpening of the 20Hz waveforms This poster details the main improvements that are foreseen to be included in the CryoSat Level1b SAR/SARin products in BaselineC.

  15. 76 FR 50770 - Submission for Review: Financial Resources Questionnaire (RI 34-1, RI 34-17, and RI 34-18) and...

    Science.gov (United States)

    2011-08-16

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: Financial Resources Questionnaire (RI 34- 1...) 3206-0167, Financial Resources Questionnaire and Notice of Amount Due Because of Annuity Overpayment... techniques or other forms of information technology, e.g., permitting electronic submissions of responses...

  16. Stack Characterization in CryoSat Level1b SAR/SARin Baseline C

    Science.gov (United States)

    Scagliola, Michele; Fornari, Marco; Di Giacinto, Andrea; Bouffard, Jerome; Féménias, Pierre; Parrinello, Tommaso

    2015-04-01

    CryoSat was launched on the 8th April 2010 and is the first European ice mission dedicated to the monitoring of precise changes in the thickness of polar ice sheets and floating sea ice. CryoSat is the first altimetry mission operating in SAR mode and it carries an innovative radar altimeter called the Synthetic Aperture Interferometric Altimeter (SIRAL), that transmits pulses at a high pulse repetition frequency thus making the received echoes phase coherent and suitable for azimuth processing. The current CryoSat IPF (Instrument Processing Facility), Baseline B, was released in operation in February 2012. After more than 2 years of development, the release in operations of the Baseline C is expected in the first half of 2015. It is worth recalling here that the CryoSat SAR/SARin IPF1 generates 20Hz waveforms in correspondence of an approximately equally spaced set of ground locations on the Earth surface, i.e. surface samples, and that a surface sample gathers a collection of single-look echoes coming from the processed bursts during the time of visibility. Thus, for a given surface sample, the stack can be defined as the collection of all the single-look echoes pointing to the current surface sample, after applying all the necessary range corrections. The L1B product contains the power average of all the single-look echoes in the stack: the multi-looked L1B waveform. This reduces the data volume, while removing some information contained in the single looks, useful for characterizing the surface and modelling the L1B waveform. To recover such information, a set of parameters has been added to the L1B product: the stack characterization or beam behaviour parameters. The stack characterization, already included in previous Baselines, has been reviewed and expanded in Baseline C. This poster describes all the stack characterization parameters, detailing what they represent and how they have been computed. In details, such parameters can be summarized in: - Stack

  17. Baseline HbA1c to Identify High-Risk Gestational Diabetes: Utility in Early vs Standard Gestational Diabetes.

    Science.gov (United States)

    Sweeting, Arianne N; Ross, Glynis P; Hyett, Jon; Molyneaux, Lynda; Tan, Kris; Constantino, Maria; Harding, Anna Jane; Wong, Jencia

    2017-01-01

    The increasing prevalence of gestational diabetes mellitus (GDM) necessitates risk stratification directing limited antenatal resources to those at greatest risk. Recent evidence demonstrates that an early pregnancy glycated hemoglobin (HbA1c ≥5.9% (41 mmol/mol) predicts adverse pregnancy outcomes. To determine the optimal HbA1c threshold for adverse pregnancy outcomes in GDM in a treated multiethnic cohort and whether this differs in women diagnosed HbA1c (single-laboratory) measurement at the time of GDM diagnosis. Maternal clinical and pregnancy outcome data were collected prospectively. The association between baseline HbA1c and adverse pregnancy outcomes in early vs standard GDM. HbA1c was measured at a median of 17.6 ± 3.3 weeks' gestation in early GDM (n = 844) and 29.4 ± 2.6 weeks' gestation in standard GDM (n = 2254). In standard GDM, HbA1c >5.9% (41 mmol/mol) was associated with the greatest risk of large-for-gestational-age (odds ratio [95% confidence interval] = 2.7 [1.5-4.9]), macrosomia (3.5 [1.4-8.6]), cesarean section (3.6 [2.1-6.2]), and hypertensive disorders (2.6 [1.1-5.8]). In early GDM, similar HbA1c associations were seen; however, lower HbA1c correlated with the greatest risk of small-for-gestational-age (P trend = 0.004) and prevalence of neonatal hypoglycemia. Baseline HbA1c >5.9% (41 mmol/mol) identifies an increased risk of large-for-gestational-age, macrosomia, cesarean section, and hypertensive disorders in standard GDM. Although similar associations are seen in early GDM, higher HbA1c levels do not adequately capture risk-limiting utility as a triage tool in this cohort. Copyright © 2017 by the Endocrine Society

  18. Basophil FcεRI Expression in Chronic Spontaneous Urticaria: A Potential Immunological Predictor of Response to Omalizumab Therapy.

    Science.gov (United States)

    Deza, Gustavo; Bertolín-Colilla, Marta; Pujol, Ramon M; Curto-Barredo, Laia; Soto, Dulce; García, Maribel; Hernández, Pilar; Gimeno, Ramon; Giménez-Arnau, Ana M

    2017-06-09

    Although the efficacy of omalizumab has been clearly demonstrated in the treatment of chronic spontaneous urticaria (CSU), its mechanism of action, which results in improvement in CSU symptoms, is not entirely understood. This study investigated the effect of omalizumab on expression of the high-affinity IgE receptor (FcεRI) on blood basophils from patients with active CSU, and its association with the clinical response. Patients exhibiting significant clinical improvement showed a sharp reduction in the levels of basophil FcεRI after 4 weeks, which was maintained throughout the total duration of the treatment. Such evolution was not observed in non-responder patients. Furthermore, non-responders showed significantly lower baseline levels of FcεRI than responders. Baseline basophil FcεRI expression was found to be a potential immunological predictor of response to omalizumab (100% sensitivity and 73.2% specificity). The results of this study contribute to our knowledge of the therapeutic benefit and mechanism of action of anti-IgE therapy in CSU.

  19. Basophil FcεRI Expression in Chronic Spontaneous Urticaria: A Potential Immunological Predictor of Response to Omalizumab Therapy

    Directory of Open Access Journals (Sweden)

    Gustavo Deza

    2017-03-01

    Full Text Available Although the efficacy of omalizumab has been clearly demonstrated in the treatment of chronic spontaneous urticaria (CSU, its mechanism of action, which results in improvement in CSU symptoms, is not entirely understood. This study investigated the effect of omalizumab on expression of the high-affinity IgE receptor (FcεRI on blood basophils from patients with active CSU, and its association with the clinical response. Patients exhibiting significant clinical improvement showed a sharp reduction in the levels of basophil FcεRI after 4 weeks, which was maintained throughout the total duration of the treatment. Such evolution was not observed in non-responder patients. Furthermore, non-responders showed significantly lower baseline levels of FcεRI than responders. Baseline basophil FcεRI expression was found to be a potential immunological predictor of response to omalizumab (100% sensitivity and 73.2% specificity. The results of this study contribute to our knowledge of the therapeutic benefit and mechanism of action of anti-IgE therapy in CSU.

  20. Glycemic excursions are positively associated with HbA1c reduction from baseline after treatment with acarbose in patients with type 2 diabetes on metformin monotherapy.

    Science.gov (United States)

    Wang, Jun-Sing; Lee, I-Te; Lee, Wen-Jane; Lin, Shi-Dou; Su, Shih-Li; Tu, Shih-Te; Tseng, Yao-Hsien; Lin, Shih-Yi; Sheu, Wayne Huey-Herng

    2017-03-01

    The aim of the present study was to examine the association between glycemic excursions before treatment and HbA1c reduction after treatment intensification with acarbose or glibenclamide in patients with type 2 diabetes (T2D). Patients receiving single or dual oral antidiabetic drug treatment with an HbA1c of 7.0-11.0 % (53-97 mmol/mol) were switched to metformin monotherapy (500 mg, t.i.d.) for 8 weeks, followed by randomization to either acarbose (100 mg, t.i.d.) or glibenclamide (5 mg, t.i.d.) as add-on treatment for 16 weeks. Glycemic excursions were assessed as mean amplitude of glycemic excursions (MAGE) with 72-h ambulatory continuous glucose monitoring. Treatment efficacy was evaluated as relative HbA1c reduction (%), calculated as (baseline HbA1c - post-treatment HbA1c)/baseline HbA1c × 100. Fifty patients (mean [±SD] age 53.5 ± 8.2 years, 48 % men, mean baseline HbA1c 8.4 ± 1.2 %) were analyzed. Baseline MAGE was positively correlated with relative HbA1c reduction from baseline in patients treated with acarbose (r = 0.421, P = 0.029) but not glibenclamide (r = 0.052, P = 0.813). Linear regression analysis revealed that the association between baseline MAGE and relative HbA1c reduction from baseline (β = 0.125, P = 0.029) in patients treated with acarbose remained significant after adjustment for several confounders (P HbA1c reduction from baseline after treatment with acarbose, but not glibenclamide. These findings highlight the importance of glycemic excursions in individualized treatment for patients with T2D. © 2016 Ruijin Hospital, Shanghai JiaoTong University School of Medicine (SJTU), Chinese Society of Endocrinology and Chinese Endocrinologist Association and John Wiley & Sons Australia, Ltd.

  1. RI/MOM and RI/SMOM renormalization of overlap quark bilinears on domain wall fermion configurations

    Science.gov (United States)

    Bi, Yujiang; Cai, Hao; Chen, Ying; Gong, Ming; Liu, Keh-Fei; Liu, Zhaofeng; Yang, Yi-Bo; χ QCD Collaboration

    2018-05-01

    Renormalization constants (RCs) of overlap quark bilinear operators on 2 +1 -flavor domain wall fermion configurations are calculated by using the RI/MOM and RI/SMOM schemes. The scale independent RC for the axial vector current is computed by using a Ward identity. Then the RCs for the quark field and the vector, tensor, scalar, and pseudoscalar operators are calculated in both the RI/MOM and RI/SMOM schemes. The RCs are converted to the MS ¯ scheme and we compare the numerical results from using the two intermediate schemes. The lattice size is 4 83×96 and the inverse spacing 1 /a =1.730 (4 ) GeV .

  2. Interaction of the regulatory subunit of the cAMP-dependent protein kinase with PATZ1 (ZNF278)

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Weng-Lang [Long Island Jewish Medical Center, North Shore University Hospital, Manhasset, NY 11030 (United States); Ravatn, Roald [Department of Medicine, University of Toledo, College of Medicine, Toledo, OH 43614 (United States); Kudoh, Kazuya [Department of Medicine, University of Toledo, College of Medicine, Toledo, OH 43614 (United States); Department of Obstetrics and Gynecology, National Defense Medical College, Tokorozawa, Saitama (Japan); Alabanza, Leah [Department of Medicine, University of Toledo, College of Medicine, Toledo, OH 43614 (United States); Chin, Khew-Voon, E-mail: khew-voon.chin@utoledo.edu [Department of Medicine, University of Toledo, College of Medicine, Toledo, OH 43614 (United States)

    2010-01-15

    The effects of cAMP in cell are predominantly mediated by the cAMP-dependent protein kinase (PKA), which is composed of two genetically distinct subunits, catalytic (C) and regulatory (R), forming a tetrameric holoenzyme R{sub 2}C{sub 2}. The only known function for the R subunit is that of inhibiting the activity of the C subunit kinase. It has been shown that overexpression of RI{alpha}, but not the C subunit kinase, is associated with neoplastic transformation. In addition, it has also been demonstrated that mutation in the RI{alpha}, but not the C subunit is associated with increased resistance to the DNA-damaging anticancer drug cisplatin, thus suggesting that the RI{alpha} subunit of PKA may have functions independent of the kinase. We show here that the RI{alpha} subunit interacts with a BTB/POZ domain zinc-finger transcription factor, PATZ1 (ZNF278), and co-expression with RI{alpha} results in its sequestration in the cytoplasm. The cytoplasmic/nuclear translocation is inducible by cAMP. C-terminus deletion abolishes PATZ1 interaction with RI{alpha} and results in its localization in the nucleus. PATZ1 transactivates the cMyc promoter and the presence of cAMP and co-expression with RI{alpha} modulates its transactivation. Moreover, PATZ1 is aberrantly expressed in cancer. Taken together, our results showed a potentially novel mechanism of cAMP signaling mediated through the interaction of RI{alpha} with PATZ1 that is independent of the kinase activity of PKA, and the aberrant expression of PATZ1 in cancer point to its role in cell growth regulation.

  3. Fer and Fps/Fes participate in a Lyn-dependent pathway from FcepsilonRI to platelet-endothelial cell adhesion molecule 1 to limit mast cell activation.

    Science.gov (United States)

    Udell, Christian M; Samayawardhena, Lionel A; Kawakami, Yuko; Kawakami, Toshiaki; Craig, Andrew W B

    2006-07-28

    Mast cells express the high affinity IgE receptor FcepsilonRI, which upon aggregation by multivalent antigens elicits signals that cause rapid changes within the mast cell and in the surrounding tissue. We previously showed that FcepsilonRI aggregation caused a rapid increase in phosphorylation of both Fer and Fps/Fes kinases in bone marrow-derived mast cells. In this study, we report that FcepsilonRI aggregation leads to increased Fer/Fps kinase activities and that Fer phosphorylation downstream of FcepsilonRI is independent of Syk, Fyn, and Gab2 but requires Lyn. Activated Fer/Fps readily phosphorylate the C terminus of platelet-endothelial cell adhesion molecule 1 (Pecam-1) on immunoreceptor tyrosine-based inhibitory motifs (ITIMs) and a non-ITIM residue (Tyr(700)) in vitro and in transfected cells. Mast cells devoid of Fer/Fps kinase activities display a reduction in FcepsilonRI aggregation-induced tyrosine phosphorylation of Pecam-1, with no defects in recruitment of Shp1/Shp2 phosphatases observed. Lyn-deficient mast cells display a dramatic reduction in Pecam-1 phosphorylation at Tyr(685) and a complete loss of Shp2 recruitment, suggesting a role as an initiator kinase for Pecam-1. Consistent with previous studies of Pecam-1-deficient mast cells, we observe an exaggerated degranulation response in mast cells lacking Fer/Fps kinases at low antigen dosages. Thus, Lyn and Fer/Fps kinases cooperate to phosphorylate Pecam-1 and activate Shp1/Shp2 phosphatases that function in part to limit mast cell activation.

  4. Association Between Baseline LDL-C Level and Total and Cardiovascular Mortality After LDL-C Lowering: A Systematic Review and Meta-analysis.

    Science.gov (United States)

    Navarese, Eliano P; Robinson, Jennifer G; Kowalewski, Mariusz; Kolodziejczak, Michalina; Andreotti, Felicita; Bliden, Kevin; Tantry, Udaya; Kubica, Jacek; Raggi, Paolo; Gurbel, Paul A

    2018-04-17

    Effects on specific fatal and nonfatal end points appear to vary for low-density lipoprotein cholesterol (LDL-C)-lowering drug trials. To evaluate whether baseline LDL-C level is associated with total and cardiovascular mortality risk reductions. Electronic databases (Cochrane, MEDLINE, EMBASE, TCTMD, ClinicalTrials.gov, major congress proceedings) were searched through February 2, 2018, to identify randomized clinical trials of statins, ezetimibe, and PCSK9-inhibiting monoclonal antibodies. Two investigators abstracted data and appraised risks of bias. Intervention groups were categorized as "more intensive" (more potent pharmacologic intervention) or "less intensive" (less potent, placebo, or control group). The coprimary end points were total mortality and cardiovascular mortality. Random-effects meta-regression and meta-analyses evaluated associations between baseline LDL-C level and reductions in mortality end points and secondary end points including major adverse cardiac events (MACE). In 34 trials, 136 299 patients received more intensive and 133 989 received less intensive LDL-C lowering. All-cause mortality was lower for more vs less intensive therapy (7.08% vs 7.70%; rate ratio [RR], 0.92 [95% CI, 0.88 to 0.96]), but varied by baseline LDL-C level. Meta-regression showed more intensive LDL-C lowering was associated with greater reductions in all-cause mortality with higher baseline LDL-C levels (change in RRs per 40-mg/dL increase in baseline LDL-C, 0.91 [95% CI, 0.86 to 0.96]; P = .001; absolute risk difference [ARD], -1.05 incident cases per 1000 person-years [95% CI, -1.59 to -0.51]), but only when baseline LDL-C levels were 100 mg/dL or greater (P baseline LDL-C level. Meta-regression showed more intensive LDL-C lowering was associated with a greater reduction in cardiovascular mortality with higher baseline LDL-C levels (change in RRs per 40-mg/dL increase in baseline LDL-C, 0.86 [95% CI, 0.80 to 0.94]; P baseline LDL-C levels were 100

  5. Cryosat Level1b SAR/Sarin: Improving the Quality of the Baseline C Products

    Science.gov (United States)

    Scagliola, M.; Fornari, M.; Tagliani, N.; Frommknecht, B.; Bouffard, J.; Parrinello, T.

    2014-12-01

    CryoSat was launched on the 8th April 2010 and it is the first European ice mission dedicated to monitoring precise changes in the thickness of polar ice sheets and floating sea ice over a 3-year period. Cryosat carries an innovative radar altimeter called the Synthetic Aperture Interferometric Altimeter (SIRAL), that transmits pulses at a high pulse repetition frequency thus making the received echoes phase coherent and suitable for azimuth processing. This allows to reach a significantly improved along track resolution with respect to traditional pulse-width limited altimeters. CryoSat is the first altimetry mission operating in SAR mode and continuous improvement in the Level1 Instrument Processing Facility (IPF1) are being identified, tested and validated in order to improve the quality of the Level1b products. Towards the release of the BaselineC of the CryoSat Level1b SAR/SARin products, that is expected at the end of 2014, several improvements have been identified: a datation bias of about -0.5195 ms will be corrected a range bias of about 0.6730 m will be corrected The range window size will be doubled with respect to BaselineB, so that the in Level1b products the waveforms will be doubled too Improved processing for 1Hz echoes to have sharper waveforms Surface sample stack weighting to filter out the single look echoes acquired at highest look angle, that results in a sharpening of the 20Hz waveforms Additional auxiliary information related to the mispointing angles of the instrument as well as to the stacks of single look echoes will be added This poster details the main quality improvements that are foreseen to be included in the CryoSat Level1b SAR/SARin products in BaselineC.

  6. NEW BV(RI)C PHOTOMETRY FOR PRAESEPE: FURTHER TESTS OF BROADBAND PHOTOMETRIC CONSISTENCY

    International Nuclear Information System (INIS)

    Joner, Michael D.; Taylor, Benjamin J.; Laney, C. David; Van Wyk, Francois

    2011-01-01

    New BV(RI) C measurements of Praesepe made at the South African Astronomical Observatory (SAAO) are presented. When those measurements are combined with those reported in previous papers in this series, it is found that they support previously determined V zero points for Praesepe, M67, and the Hyades. Support is also found for joint (V – R) C and (R – I) C zero points established previously for Praesepe and NGC 752. For the SAAO system of standard stars, a B – V correction to the Johnson system of about –9 mmag appears to be reasonably well established. The preferred (though not definitive) V correction is about +7 mmag. For the Landolt V system, zero-point identity with the Johnson system at a 2σ level of 4.8 mmag is found, and no color term as large as 4 mmag (mag) –1 is detected. Updated CDS data files for Praesepe are briefly described.

  7. Validation and determination of a reference interval for canine HbA1c using an immunoturbidimetric assay.

    Science.gov (United States)

    Goemans, Anne F; Spence, Susanna J; Ramsey, Ian K

    2017-06-01

    Hemoglobin A1c (HbA1c) provides a reliable measure of glycemic control over 2-3 months in human diabetes mellitus. In dogs, presence of HbA1c has been demonstrated, but there are no validated commercial assays. The purpose of the study was to validate a commercially available automated immunoturbidimetric assay for canine HbA1c and determine an RI in a hospital population. The specificity of the assay was assessed by inducing glycosylation in vitro using isolated canine hemoglobin, repeatability by measuring canine samples 5 times in succession, long term inter-assay imprecision by measuring supplied control materials, stability using samples stored at 4°C over 5 days and -20°C over 8 weeks, linearity by mixing samples of known HbA1c in differing proportions, and the effect of anticoagulants with paired samples. An RI was determined using EDTA-anticoagulated blood samples from 60 nondiabetic hospitalized animals of various ages and breeds. Hemoglobin A1c was also measured in 10 diabetic dogs. The concentration of HbA1c increased proportionally with glucose concentration in vitro. For repeat measurements, the CV was 4.08% (range 1.16-6.10%). Samples were stable for 5 days at 4°C. The assay was linear within the assessed range. Heparin- and EDTA-anticoagulated blood provided comparable results. The RI for HbA1c was 9-18.5 mmol/mol. There was no apparent effect of age or breed on HbA1c. In diabetic dogs, HbA1c ranged from 14 to 48 mmol/mol. The assay provides a reliable method for canine HbA1c measurement with good analytic performance. © 2017 American Society for Veterinary Clinical Pathology.

  8. 77 FR 5581 - Submission for Review: Financial Resources Questionnaire (RI 34-1, RI 34-17) and Notice of Amount...

    Science.gov (United States)

    2012-02-03

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: Financial Resources Questionnaire (RI 34- 1... opportunity to comment on a revised information collection request (ICR) 3206-0167, Financial Resources... collection techniques or other forms of information technology, e.g., permitting electronic submissions of...

  9. Baseline NS5A resistance associated substitutions may impair DAA response in real-world hepatitis C patients.

    Science.gov (United States)

    Carrasco, Itzíar; Arias, Ana; Benítez-Gutiérrez, Laura; Lledó, Gemma; Requena, Silvia; Cuesta, Miriam; Cuervas-Mons, Valentín; de Mendoza, Carmen

    2018-03-01

    Oral DAA have demonstrated high efficacy as treatment of hepatitis C. However, the presence of resistance-associated substitutions (RAS) at baseline has occasionally been associated with impaired treatment response. Herein, we examined the impact of baseline RAS at the HCV NS5A gene region on treatment response in a real-life setting. All hepatitis C patients treated with DAA including NS5A inhibitors at our institution were retrospectively examined. The virus NS5A gene was analyzed using population sequencing at baseline and after 24 weeks of completing therapy in all patients that failed. All changes recorded at positions 28, 29, 30, 31, 32, 58, 62, 92, and 93 were considered. A total of 166 patients were analyzed. HCV genotypes were as follows: G1a (31.9%), G1b (48.2%), G3 (10.2%), and G4 (9.6%). Overall, 69 (41.6%) patients were coinfected with HIV and 46.7% had advanced liver fibrosis (Metavir F3-F4). Sixty (36.1%) patients had at least one RAS at baseline, including M28A/G/T (5), Q30X (12), L31I/F/M/V (6), T58P/S (25), Q/E62D (1), A92 K (7), and Y93C/H (15). Overall, 4.8% had two or more RAS, being more frequent in G4 (12.5%) followed by G1b (6.3%) and G1a (1.9%). Of 10 (6%) patients that failed DAA therapy, five had baseline NS5A RAS. No association was found for specific baseline RAS, although changes at position 30 were more frequent in failures than cures (22.2% vs 6.4%, P = 0.074). Moreover, the presence of two or more RAS at baseline was more frequent in failures (HR: 7.2; P = 0.029). Upon failure, six patients showed emerging RAS, including Q30C/H/R (3), L31M (1), and Y93C/H (2). Baseline NS5A RAS are frequently seen in DAA-naïve HCV patients. Two or more baseline NS5A RAS were found in nearly 5% and were significantly associated to DAA failure. Therefore, baseline NS5A testing should be considered when HCV treatment is planned with NS5A inhibitors. © 2017 Wiley Periodicals, Inc.

  10. Human pro. cap alpha. 1)(I) collagen: cDNA sequence for the C-propeptide domain

    Energy Technology Data Exchange (ETDEWEB)

    Maekelae, J K; Raassina, M; Virta, A; Vuorio, E

    1988-01-11

    The authors have previously constructed a cDNA clone pHCAL1, covering most of the C-terminal propeptide domain of human pro..cap alpha..1(I) collagen mRNA,by inserting a 678 bp EcoRI-XhoI fragment of cDNA into pBR322. Since the XhoI/SalI ligation prevented removal of the insert, they used the same strategy to obtain a similar clone in pUC8. RNA was isolated from fetal calvarial bones. The cDNA was digested with EcoRI and XhoI and fractionated on a 1 % agarose gel. Fragments of 650-700 bp were cloned in pUC8 at the polylinker site, which now permits easy removal of the insert. The new clone was named pHCAL1U since the RNA was isolated from another individual. The approach outlined is useful for studies on individual variation which is important to recognize when searching for disease-related mutations in type I collagen.

  11. Szathmári, a great documentary artist

    Directory of Open Access Journals (Sweden)

    Ionescu, Adrian-Silvan

    2014-01-01

    Full Text Available Carol Pop de Szathmári was born in Cluj, Transylvania, on 11 January 1812. His talent for painting shone out from an early age. Being a passionate traveller, Szathmári journeyed through Europe and often crossed the Carpathian Mountains to visit Wallachia and its capital, Bucharest, where he eventually settled in 1843. An accomplished landscape and portrait painter, at ease with both watercolours and oil paints, Szathmári obtained commissions from the wealthy Wallachian boyars. Szathmári kept up constant, good relations with the successive ruling princes of Wallachia for whom he painted portraits and various other compositions. By 1848, Szathmári began to experiment with photography. The outbreak of the Russian-Ottoman War in late June 1853 saw the Romanian principalities occupied by the Russian army. In April 1854, Szathmári filled a van with his cameras and glass plates and went to the Danube to document the fighting between the Russian and Turkish armies.The result of Szathmári's bravery and hard work was a photographic album. His album, containing some two hundred images, became famous due to its presentation at the 1855 Paris World's Fair and Szathmári was awarded the Second Class Medal for his work.From that time on, photography, painting and lithography were always closely connected in Szathmári's career. In 1864 he became a member of the Société Française de Photographie in Paris and in 1870 of the one in Vienna. In 1863, he was appointed Court Painter and Photographer, a position he held for the rest of his life. In that capacity, he followed his patron, Prince Carol I, on the battlefield during the Russian-Romanian-Ottoman War of 1877, which was waged south of the Danube. Alongside martial compositions and albums, Szathmári had long been attracted by folk types and produced a large series of pictures of peasants, gypsies, postillions, merchants and artisans. He toured the fairs and the crowded streets of the town in search

  12. Baseline incidence and severity of renal insufficiency evaluated by estimated glomerular filtration rates in patients scheduled for contrast-enhanced CT

    Energy Technology Data Exchange (ETDEWEB)

    Utsunomiya, Daisuke; Yanaga, Yumi; Oda, Seitaro; Namimoto, Tomohiro; Yamashita, Yasuyuki (Dept. of Diagnostic Radiology, Faculty of Life Sciences, Kumamoto Univ., Kumamoto (Japan)), email: utsunomi@kumamoto-u.ac.jp; Awai, Kazuo (Dept. of Diagnostic Radiology, Graduate School of Biomedical Sciences, Hiroshima Univ., Hiroshima (Japan)); Funama, Yoshinori (Dept. of Medical Physics, Faculty of Life Sciences, Kumamoto Univ., Kumamoto (Japan))

    2011-06-15

    Background Although pre-existing renal insufficiency (RI) is the most important risk factor for contrast-induced nephropathy (CIN), the background distribution of baseline renal function has not been investigated thoroughly in patients scheduled for contrast-enhanced CT. Purpose To investigate the incidence and severity of baseline RI evaluated by estimated glomerular filtration rates (eGFR) in patients who underwent contrast-enhanced CT at an academic center. Material and Methods A total of 6586 patients (3630 men and 2956 women; mean age 57.0 +- 11.9 years) who underwent contrast-enhanced CT between January and December 2008 were retrospectively studied. Of these, 829 had cardiovascular diseases (CVD), 5116 had oncologic diseases, 178 had diabetes mellitus (DM), and 1572 had chronic liver disease (CLD). The eGFR (mL/min/1.73 m2) was calculated from their serum creatinine level. Mild, moderate-a, moderate-b, and severe RI were recorded at 60 < =eGFR < 90, 45 < =eGFR < 60, 30 < =eGFR < 45 and eGFR < 30, respectively. Results Of the 6586 patients, 1.6%, 3.7%, 13.7%, and 54.2% were judged to present with severe, moderate-b, moderate-a, and mild RI, respectively. While moderate-b-to-severe RI was recorded in 133 (3.2%) of 4161 patients aged 70 years or less, it was observed in 218 (9.0%) of the 2425 patients who were 71 years or older. Among the 829 CVD patients, 9.9% manifested moderate-b-to-severe- and 73.0% mild-to-moderate-a RI. The corresponding rates were 4.4% and 68.9% for oncologic disease, 16.9% and 61.2% for DM, and 4.8% and 71.5% for CLD patients. By univariate analysis, there was a significant association between moderate-b-to-severe RI and the advanced age, CVD, DM, and non-oncologic disease. Multivariate analysis showed that the advanced age, DM, and non-oncologic disease were statistically associated with moderate-b-to-severe RI. Conclusion The incidence of RI of eGFR < 45mL/min/1.73 m2 at baseline was high in patients with advanced age, CVD and DM and

  13. Riigi äriühingu juhtorgani liige: kas ametiisik või ärijuht? / Jüri Raidla, Toomas Vaher, Kristel Urke

    Index Scriptorium Estoniae

    Raidla, Jüri, 1957-

    2017-01-01

    Riigi äriühingu põhijoontest, riigi äriühingu juhtorgani liikme kohustustest ja nõuetest juhtorgani liikmetele. Riigi äriühingute juhtorganite liikmete pidamisest ametiisikuteks korruptsioonivastase seaduse § 2 lõike 1 ja karistusseadustiku § 288 lõike 1 mõttes. Sisaldab asjakohast kohtupraktikat

  14. Sirt1 negatively regulates FcεRI-mediated mast cell activation through AMPK- and PTP1B-dependent processes.

    Science.gov (United States)

    Li, Xian; Lee, Youn Ju; Jin, Fansi; Park, Young Na; Deng, Yifeng; Kang, Youra; Yang, Ju Hye; Chang, Jae-Hoon; Kim, Dong-Young; Kim, Jung-Ae; Chang, Young-Chae; Ko, Hyun-Jeong; Kim, Cheorl-Ho; Murakami, Makoto; Chang, Hyeun Wook

    2017-07-25

    Sirt1, a key regulator of metabolism and longevity, has recently been implicated in the regulation of allergic reactions, although the underlying mechanism remains unclear. Here we show that Sirt1 negatively regulates FcεRI-stimulated mast cell activation and anaphylaxis through two mutually regulated pathways involving AMP-activated protein kinase (AMPK) and protein tyrosine phosphatase 1B (PTP1B). Mast cell-specific knockout of Sirt1 dampened AMPK-dependent suppression of FcεRI signaling, thereby augmenting mast cell activation both in vitro and in vivo. Sirt1 inhibition of FcεRI signaling also involved an alternative component, PTP1B, which attenuated the inhibitory AMPK pathway and conversely enhanced the stimulatory Syk pathway, uncovering a novel role of this phosphatase. Moreover, a Sirt1 activator resveratrol stimulated the inhibitory AMPK axis, with reciprocal suppression of the stimulatory PTP1B/Syk axis, thus potently inhibiting anaphylaxis. Overall, our results provide a molecular explanation for the beneficial role of Sirt1 in allergy and underscore a potential application of Sirt1 activators as a new class of anti-allergic agents.

  15. Dicty_cDB: Contig-U16439-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cDNA clon... 50 6e-16 3 ( FK739797 ) av01001d15r1.1 Symbiotic sea anemone (Anemonia vi... 84 4e-15 2 ( D872... ( CB933531 ) ri31b11.y1 Meloidogyne chitwoodi egg pAMP1 v1 Mel... 64 4e-11 2 ( FK729638 ) av02130e15r1.1 Symbiotic

  16. CryoSat Ice Processor: High-Level Overview of Baseline-C Data and Quality-Control

    Science.gov (United States)

    Mannan, R.; Webb, E.; Hall, A.; Bouffard, J.; Femenias, P.; Parrinello, T.; Bouffard, J.; Brockley, D.; Baker, S.; Scagliola, M.; Urien, S.

    2016-08-01

    Since April 2015, the CryoSat ice products have been generated with the new Baseline-C Instrument Processing Facilities (IPFs). This represents a major upgrade to the CryoSat ice IPFs and is the baseline for the second CryoSat Reprocessing Campaign. Baseline- C introduces major evolutions with respect to Baseline- B, most notably the release of freeboard data within the L2 SAR products, following optimisation of the SAR retracker. Additional L2 improvements include a new Arctic Mean Sea Surface (MSS) in SAR; a new tuneable land ice retracker in LRM; and a new Digital Elevation Model (DEM) in SARIn. At L1B new attitude fields have been introduced and existing datation and range biases reduced. This paper provides a high level overview of the changes and evolutions implemented at Baseline-C in order to improve CryoSat L1B and L2 data characteristics and exploitation over polar regions. An overview of the main Quality Control (QC) activities performed on operational Baseline-C products is also presented.

  17. IL-1RI (Interleukin-1 Receptor Type I Signalling is Essential for Host Defence and Hemichannel Activity During Acute Central Nervous System Bacterial Infection

    Directory of Open Access Journals (Sweden)

    Juan Xiong

    2012-03-01

    Full Text Available Staphylococcus aureus is a common aetiological agent of bacterial brain abscesses. We have previously established that a considerable IL-1 (interleukin-1 response is elicited immediately following S. aureus infection, where the cytokine can exert pleiotropic effects on glial activation and blood–brain barrier permeability. To assess the combined actions of IL-1α and IL-1β during CNS (central nervous system infection, host defence responses were evaluated in IL-1RI (IL-1 receptor type I KO (knockout animals. IL-1RI KO mice were exquisitely sensitive to intracerebral S. aureus infection, as demonstrated by enhanced mortality rates and bacterial burdens within the first 24 h following pathogen exposure compared with WT (wild-type animals. Loss of IL-1RI signalling also dampened the expression of select cytokines and chemokines, concomitant with significant reductions in neutrophil and macrophage infiltrates into the brain. In addition, the opening of astrocyte hemichannels during acute infection was shown to be dependent on IL-1RI activity. Collectively, these results demonstrate that IL-1RI signalling plays a pivotal role in the genesis of immune responses during the acute stage of brain abscess development through S. aureus containment, inflammatory mediator production, peripheral immune cell recruitment, and regulation of astrocyte hemichannel activity. Taken in the context of previous studies with MyD88 (myeloid differentiation primary response gene 88 and TLR2 (Toll-like receptor 2 KO animals, the current report advances our understanding of MyD88-dependent cascades and implicates IL-1RI signalling as a major antimicrobial effector pathway during acute brain-abscess formation.

  18. 75 FR 63452 - ONEOK Gas Storage, L.L.C.; Notice of Baseline Filing

    Science.gov (United States)

    2010-10-15

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR11-67-001] ONEOK Gas Storage, L.L.C.; Notice of Baseline Filing October 7, 2010. Take notice that on October 1, 2010, ONEOK Gas Storage, L.L.C. submitted a revised baseline filing of its Statement of Operating Conditions for services...

  19. Motivational Interviewing and Medication Review in Coronary Heart Disease (MIMeRiC): Intervention Development and Protocol for the Process Evaluation.

    Science.gov (United States)

    Östbring, Malin Johansson; Eriksson, Tommy; Petersson, Göran; Hellström, Lina

    2018-01-30

    Trials of complex interventions are often criticized for being difficult to interpret because the effects of apparently similar interventions vary across studies dependent on context, targeted groups, and the delivery of the intervention. The Motivational Interviewing and Medication Review in Coronary heart disease (MIMeRiC) trial is a randomized controlled trial (RCT) of an intervention aimed at improving pharmacological secondary prevention. Guidelines for the development and evaluation of complex interventions have recently highlighted the need for better reporting of the development of interventions, including descriptions of how the intervention is assumed to work, how this theory informed the process evaluation, and how the process evaluation relates to the outcome evaluation. This paper aims to describe how the intervention was designed and developed. The aim of the process evaluation is to better understand how and why the intervention in the MIMeRiC trial was effective or not effective. The research questions for evaluating the process are based on the conceptual model of change processes assumed in the intervention and will be analyzed by qualitative and quantitative methods. Quantitative data are used to evaluate the medication review in terms of drug-related problems, to describe how patients' beliefs about medicines are affected by the intervention, and to evaluate the quality of motivational interviewing. Qualitative data will be used to analyze whether patients experienced the intervention as intended, how cardiologists experienced the collaboration and intervention, and how the intervention affected patients' overall experience of care after coronary heart disease. The development and piloting of the intervention are described in relation to the theoretical framework. Data for the process evaluation will be collected until March 2018. Some process evaluation questions will be analyzed before, and others will be analyzed after the outcomes of the

  20. Baseline incidence and severity of renal insufficiency evaluated by estimated glomerular filtration rates in patients scheduled for contrast-enhanced CT

    International Nuclear Information System (INIS)

    Utsunomiya, Daisuke; Yanaga, Yumi; Oda, Seitaro; Namimoto, Tomohiro; Yamashita, Yasuyuki; Awai, Kazuo; Funama, Yoshinori

    2011-01-01

    Background Although pre-existing renal insufficiency (RI) is the most important risk factor for contrast-induced nephropathy (CIN), the background distribution of baseline renal function has not been investigated thoroughly in patients scheduled for contrast-enhanced CT. Purpose To investigate the incidence and severity of baseline RI evaluated by estimated glomerular filtration rates (eGFR) in patients who underwent contrast-enhanced CT at an academic center. Material and Methods A total of 6586 patients (3630 men and 2956 women; mean age 57.0 ± 11.9 years) who underwent contrast-enhanced CT between January and December 2008 were retrospectively studied. Of these, 829 had cardiovascular diseases (CVD), 5116 had oncologic diseases, 178 had diabetes mellitus (DM), and 1572 had chronic liver disease (CLD). The eGFR (mL/min/1.73 m 2 ) was calculated from their serum creatinine level. Mild, moderate-a, moderate-b, and severe RI were recorded at 60 2 at baseline was high in patients with advanced age, CVD and DM and in patients without oncologic disease

  1. Dicty_cDB: SHK686 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 27420.1 LscoSEQ7816 Leucosporidium scottii pBluescript (EcoRI-XhoI) Leucosporidium scott...ii cDNA clone LscoSEQ7816, mRNA sequence. 54 3e-07 2 EB021565 |EB021565.1 LscoSEQ13808 Leucosporidium scott...ii pBluescript (EcoRI-XhoI) Leucosporidium scottii cDNA clone LscoSEQ13808, mRNA sequence. 54 3e-07 2 ...EB020998 |EB020998.1 LscoSEQ13129 Leucosporidium scottii pBluescript (EcoRI-XhoI) Leucosporidium scott...ii cDNA clone LscoSEQ13129, mRNA sequence. 54 3e-07 2 EB018390 |EB018390.1 LscoSEQ10064 Leucosporidium scott

  2. Association of Hemoglobin A1c and Wound Healing in Diabetic Foot Ulcers.

    Science.gov (United States)

    Fesseha, Betiel K; Abularrage, Christopher J; Hines, Kathryn F; Sherman, Ronald; Frost, Priscilla; Langan, Susan; Canner, Joseph; Likes, Kendall C; Hosseini, Sayed M; Jack, Gwendolyne; Hicks, Caitlin W; Yalamanchi, Swaytha; Mathioudakis, Nestoras

    2018-04-16

    This study evaluated the association between hemoglobin A 1c (A1C) and wound outcomes in patients with diabetic foot ulcers (DFUs). We conducted a retrospective analysis of an ongoing prospective, clinic-based study of patients with DFUs treated at an academic institution during a 4.7-year period. Data from 270 participants and 584 wounds were included in the analysis. Cox proportional hazards regression was used to assess the incidence of wound healing at any follow-up time in relation to categories of baseline A1C and the incidence of long-term (≥90 days) wound healing in relation to tertiles of nadir A1C change and mean A1C change from baseline, adjusted for potential confounders. Baseline A1C was not associated with wound healing in univariate or fully adjusted models. Compared with a nadir A1C change from baseline of -0.29 to 0.0 (tertile 2), a nadir A1C change of 0.09 to 2.4 (tertile 3) was positively associated with long-term wound healing in the subset of participants with baseline A1C healing was seen with the mean A1C change from baseline in this group. Neither nadir A1C change nor mean A1C change were associated with long-term wound healing in participants with baseline A1C ≥7.5%. There does not appear to be a clinically meaningful association between baseline or prospective A1C and wound healing in patients with DFUs. The paradoxical finding of accelerated wound healing and increase in A1C in participants with better baseline glycemic control requires confirmation in further studies. © 2018 by the American Diabetes Association.

  3. Spallation RI beam facility and heavy element nuclear chemistry

    Energy Technology Data Exchange (ETDEWEB)

    Nagame, Yuichiro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1997-11-01

    An outline of the spallation RI (Radioactive Ion) beam facility is presented. Neutron-rich nuclides are produced in the reaction of high intensity (10-1000 {mu}A) protons with energy of 1.5 GeV and an uranium carbide target. Produced nuclides are ionized in an isotope separator on-line (ISOL) and accelerated by the JAERI tandem and the booster linac. Current progress and a future project on the development of the RI beam facility are given. Studies of transactinide elements, including the synthesis of superheavy elements, nuclear structure far from stability, and RI-probed material science are planned with RI beams. An outlook of the transactinide nuclear chemistry studies using neutron-rich RI beams is described. (author)

  4. Effects of Temperature on Sensitivity of Bacilus licheniformis RI 75-1 Vegetative Cells at Gamma Quantum

    International Nuclear Information System (INIS)

    Fernandez-Larrea Vega, O.; Rios Brito, F.; Marquez Alvarez, M.; Padron Soler, E.

    1986-01-01

    It is known that strains of E. Coli with wild genotype for reparation, when are irradiated at temperature between 42 0 C and 45 0 C, shown an increase of radioresistance. At the given temperature the number of double strands breaks of DNA decrease. Some authors report that the radioresistance increased is due to the elevation of the irradiation temperature is related to the cell membrane status. The paper includes reports on the effects of increased temperature on the sensitivity - at gamma quantum - of Bacillus licheniformis RI 75-1 vegetative cells. Temperatures of 42 0 C and 60 0 C during irradiation were employed. An increase in radioresistance was found when the temperature of irradiation was increased to 42 0 C. However, a decrease in viability was observed. Heat treatment prior to irradiation showed an increase in the number of radioresistance colonies when compared. (author)

  5. Experience of Ko-Ri Unit 1 water chemistry

    International Nuclear Information System (INIS)

    Tae Il Lee

    1983-01-01

    The main focus is placed on operational experience in secondary system water chemistry (especially the steam generator) of the Ko-Ri nuclear power plant Unit 1, Republic of Korea, but primary side chemistry is also discussed. The major concern of secondary water chemistry in a PWR is that the condition of the steam generator be well maintained. Full flow deep bed condensate polishers have recently been installed and operation started in July 1982. Boric acid treatment of the steam generator was stopped and only the all volatile treatment method was used thereafter. A review of steam generator integrity, the chemistry control programme, secondary water quality, etc. is considered to be of great value regarding the operation of Unit 1 and future units now under startup testing or construction in the Republic of Korea. (author)

  6. Genetic transformation of Begonia tuberhybrida by Ri rol genes.

    Science.gov (United States)

    Kiyokawa, S; Kikuchi, Y; Kamada, H; Harada, H

    1996-04-01

    We have developed an Agrobacterium -mediated transformation system for commercial Begonia species. The leaf explants of Begonia semperflorens, Begonia x hiemalis and B. tuberhybrida were inoculated with Agrobacterium tumefaciens LBA4404 harboring a binary vector pBI121 which contains rolA, B and C genes of an agropine type Ri plasmid (pRiA4b). Kanamycin resistant shoots of B. tuberhybrida were obtained on MS agar medium supplemented with 0.1 mg/l NAA, 0.5 mg/l BA, 500 mg/l claforan and 100 mg/l kanamycin. These shoots exhibited GUS activity and Southern analysis showed a single copy insertion into the genome. When the transgenic plants were transferred to soil, they displayed the phenotype specific to the transgenic plants by A. rhizogenes such as dwarfness, delay of flowering, and wrinkled leaves and petals.

  7. Effects of dapagliflozin on insulin-requirement, glucose excretion and ß-hydroxybutyrate levels are not related to baseline HbA1c in youth with type 1 diabetes.

    Science.gov (United States)

    Biester, Torben; Aschemeier, Baerbel; Fath, Maryam; Frey, Marcel; Scheerer, Markus F; Kordonouri, Olga; Danne, Thomas

    2017-11-01

    Youth with type 1 diabetes (T1D) infrequently achieve HbA1c targets. Therefore, this placebo-controlled, randomized, crossover study was set up to assess the safety, effect and pharmacokinetics of a single dose of 10 mg dapagliflozin (DAPA) as add-on to insulin in relationship to HbA1c in youth. A total of 33 youths (14 males, median age 16 years, diabetes duration 8 years) were included and stratified into 3 baseline HbA1c categories (9.0; n = 11 each). During the study period of 24 hours, intravenous insulin administration and glucose-infusion kept blood glucose levels at 160 to 220 mg/dL. DAPA reduced mean insulin dose by 13.6% ( P  HbA1c. Six independent episodes in 6 patients with plasma ß-hydroxybutyrate levels between ≥0.6 and HbA1c levels, for adjunct SGLT2-inhibitor therapy in the paediatric age group by lowering insulin dose and increasing glucose excretion. © 2017 John Wiley & Sons Ltd.

  8. UBV(RI)sub(c) photometry of some standard sequences in the Harvard F regions and in the Magellanic Clouds

    International Nuclear Information System (INIS)

    Menzies, J.W.; Laing, J.D.

    1988-01-01

    This paper presents the results of a photometric programme aimed at improving the UBV(RI)sub(c) standard sequences in the Harvard F regions and in the Small and Large Magellanic Clouds. Magnitudes and colours are given for 99 stars, and they are compared with the current values which were obtained or compiled by a previous author. (author)

  9. RI scintigraphy in myasthenia gravis

    International Nuclear Information System (INIS)

    Kuroda, Yoshikazu; Miyamoto, Mariko; Maki, Masako; Yamazaki, Toshiro.

    1982-01-01

    35 cases of myasthenia gravis were studied with RI scintigraphy. 67 Ga-citrate was used in 34 patients and 76 Se-selenomethionine in 5 patients for thymus scintigraphy. RI scintigram was negative in non-tumorous thymus, regardless of the severity of illness and it was positive in seven of nine patients with thymomas. RI accumulation in thymus was found both in benign and malignant thymomas. RI seems to accumulated in lymphocytic and mixed thymus more than epithelial type. (author)

  10. RI scintigraphy in myasthenia gravis

    Energy Technology Data Exchange (ETDEWEB)

    Kuroda, Yoshikazu; Miyamoto, Mariko (Tokyo Metropolitan Fuchu Hospital (Japan)); Maki, Masako; Yamazaki, Toshiro

    1982-10-01

    35 cases of myasthenia gravis were studied with RI scintigraphy. /sup 67/Ga-citrate was used in 34 patients and /sup 76/Se-selenomethionine in 5 patients for thymus scintigraphy. RI scintigram was negative in non-tumorous thymus, regardless of the severity of illness and it was positive in seven of nine patients with thymomas. RI accumulation in thymus was found both in benign and malignant thymomas. RI seems to accumulated in lymphocytic and mixed thymus more than epithelial type.

  11. Is insulin the preferred treatment for HbA1c >9%?

    Science.gov (United States)

    Bloomgarden, Zachary

    2017-09-01

    The algorithms and guidelines of the American Association of Clinical Endocrinologists and the American Diabetes Association recommend that insulin administration be strongly considered for people with type 2 diabetes (T2D) with HbA1c levels exceeding 9.0% and 10%, respectively. Although the caveat is given in both sets of recommendations that this is particularly appropriate when patients are "symptomatic," referring to urinary frequency with increased thirst and appetite, weight loss, and ketosis, the clinical definition of such presentations may be ill-defined, and it is noteworthy that both documents consider insulin to offer particular benefit under such circumstances. However, with multiple options for glycemic treatment, it is of interest to reconsider this argument for insulin use. It should be recalled that in the UK Prospective Diabetes Study, diet alone was associated with a reduction in HbA1c from 9% to 7%. Drug-naïve people with T2D do often show surprisingly strong reductions in HbA1c with metformin-based dual-agent oral treatment approaches; a recent report showed that even with baseline HbA1c >11%, the combination of metformin with a sulfonylurea, pioglitazone, or sitagliptin was associated with reduction in HbA1c from 11.6% to 6.0%. A 32-week study of the combination of rosiglitazone with metformin in patients with mean baseline HbA1c 8.9% showed a mean HbA1c reduction of 2.3%, and an open-label cohort with baseline HbA1c 11.8% had a reduction in HbA1c to 7.8%. With metformin plus sitagliptin, a mean placebo-adjusted HbA1c reduction of 2.1% from a baseline of 8.8% was reported, with those patients with baseline HbA1c >9% having a 2.6% reduction in HbA1c, and an open-label cohort with baseline HbA1c 11.2% having a 2.9% reduction in HbA1c. Similar 2% HbA1c reductions from baseline levels of 9.1% were seen with metformin in initial combination with the sodium-glucose cotransporter 2 (SGLT2) inhibitor dapagliflozin. Although such dual oral agent

  12. The influence of baseline risk on the relation between HbA1c and risk for new cardiovascular events and mortality in patients with type 2 diabetes and symptomatic cardiovascular disease.

    Science.gov (United States)

    Bots, Sophie H; van der Graaf, Yolanda; Nathoe, Hendrik M W; de Borst, Gert Jan; Kappelle, Jaap L; Visseren, Frank L J; Westerink, Jan

    2016-07-19

    Strict glycaemic control in patients with type 2 diabetes has proven to have microvascular benefits while the effects on CVD and mortality are less clear, especially in high risk patients. Whether strict glycaemic control would reduce the risk of future CVD or mortality in patients with type 2 diabetes and pre-existing CVD, is unknown. This study aims to evaluate whether the relation between baseline HbA1c and new cardiovascular events or mortality in patients with type 2 diabetes and pre-existing cardiovascular disease (CVD) is modified by baseline vascular risk. A cohort of 1096 patients with type 2 diabetes and CVD from the Second Manifestations of ARTerial Disease (SMART) study was followed. The relation between HbA1c at baseline and future vascular events (composite of myocardial infarction, stroke and vascular mortality) and all-cause mortality was evaluated with Cox proportional hazard analyses in a population that was stratified for baseline risk for vascular events as calculated with the SMART risk score. The mean follow-up duration was 6.9 years for all-cause mortality and 6.4 years for vascular events, in which period 243 and 223 cases were reported, respectively. A 1 % increase in HbA1c was associated with a higher risk for all-cause mortality (HR 1.18, 95 % CI 1.06-1.31). This association was also found in the highest SMART risk quartile (HR 1.33, 95 % CI 1.11-1.60). There was no relation between HbA1c and the occurrence of cardiovascular events during follow-up (HR 1.03, 95 % CI 0.91-1.16). The interaction term between HbA1c and SMART risk score was not significantly related to any of the outcomes. In patients with type 2 diabetes and CVD, HbA1c is related to the risk of all-cause mortality, but not to the risk of cardiovascular events. The relation between HbA1c and all-cause mortality in patients with type 2 diabetes and vascular disease is not dependent on baseline vascular risk.

  13. 75 FR 15343 - Regulated Navigation Area: Narragansett Bay, RI and Mount Hope Bay, RI and MA, Including the...

    Science.gov (United States)

    2010-03-29

    ...: Narragansett Bay, RI and Mount Hope Bay, RI and MA, Including the Providence River and Taunton River AGENCY... River and Mount Hope Bay in the vicinity of the two Brightman Street bridges have not been adopted and... Island and Mt. Hope Bay, MA.'' The notice was prompted primarily by two events: (1) The U.S. Army Corps...

  14. 76 FR 18812 - Submission for Review: RI 30-10, Disabled Dependent Questionnaire

    Science.gov (United States)

    2011-04-05

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: RI 30-10, Disabled Dependent Questionnaire... Dependent Questionnaire. As required by the Paperwork Reduction Act of 1995 (Pub. L. 104-13, 44 U.S.C... (202) 606-0910. SUPPLEMENTARY INFORMATION: The RI 30-10, Disabled Dependent Questionnaire, is used to...

  15. 76 FR 36582 - Submission for Review: Disabled Dependent Questionnaire, RI 30-10

    Science.gov (United States)

    2011-06-22

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: Disabled Dependent Questionnaire, RI 30-10... Dependent Questionnaire. As required by the Paperwork Reduction Act of 1995 (Pub. L. 104-13, 44 U.S.C.... SUPPLEMENTARY INFORMATION: RI 30-10, Disabled Dependent Questionnaire, is used to collect sufficient information...

  16. Effective management of regulator RI/FS comments

    International Nuclear Information System (INIS)

    Wolinsky, S.M.; Lojek, D.; George, R.D.; Houser, S.M.; Strimbu, M.J.

    1995-01-01

    This paper describes a successful strategy that facilitates regulatory approval of CERCLA documents required by compliance agreement and CERCLA, based on the experience of Operable Unit 1, Waste Storage Area, of the Fernald Environmental Management Project (FEMP). This strategy, which has become the site standard at the FEMP, was instrumental in obtaining regulator approval of the OU1 RI and FS, and early approval of the Record of Decision during a very tight compliance agreement-driven schedule. This strategy can be applied at any DOE Superfund site, especially where there is need to recover lost schedule, an incentive to meet milestones early, a need to improve the relationship between the DOE and the regulators, or where the regulatory agencies have historically provided a large volume of comments on CERCLA documents. The strategy focuses on early identification and resolution of issues relating to draft RI/FS documents, as raised in regulatory agency review comments. This pro-active strategy has the potential for schedule and cost savings, as well as for improved communication between DOE and the regulators. The strategy includes preparation of a separate comment response document, integration of comment responses with RI/FS documents, development of a database of agency comments and their resolution, and sharing lessons learned with preparers of subsequent RI/FS documents. The paper provides background on the FEMP and describes the FEMP comment response strategy; DOE and regulator interface; the Sitewide Comment Database; networked electronic file management; the process for classifying, analyzing, and responding to comments; integration with base RI/FS documents; and a conclusion

  17. Effective management of regulator RI/FS comments

    Energy Technology Data Exchange (ETDEWEB)

    Wolinsky, S.M.; Lojek, D.; George, R.D.; Houser, S.M.; Strimbu, M.J.

    1995-12-31

    This paper describes a successful strategy that facilitates regulatory approval of CERCLA documents required by compliance agreement and CERCLA, based on the experience of Operable Unit 1, Waste Storage Area, of the Fernald Environmental Management Project (FEMP). This strategy, which has become the site standard at the FEMP, was instrumental in obtaining regulator approval of the OU1 RI and FS, and early approval of the Record of Decision during a very tight compliance agreement-driven schedule. This strategy can be applied at any DOE Superfund site, especially where there is need to recover lost schedule, an incentive to meet milestones early, a need to improve the relationship between the DOE and the regulators, or where the regulatory agencies have historically provided a large volume of comments on CERCLA documents. The strategy focuses on early identification and resolution of issues relating to draft RI/FS documents, as raised in regulatory agency review comments. This pro-active strategy has the potential for schedule and cost savings, as well as for improved communication between DOE and the regulators. The strategy includes preparation of a separate comment response document, integration of comment responses with RI/FS documents, development of a database of agency comments and their resolution, and sharing lessons learned with preparers of subsequent RI/FS documents. The paper provides background on the FEMP and describes the FEMP comment response strategy; DOE and regulator interface; the Sitewide Comment Database; networked electronic file management; the process for classifying, analyzing, and responding to comments; integration with base RI/FS documents; and a conclusion.

  18. Yeast transformation mediated by Agrobacterium strains harboring an Ri plasmid: comparative study between GALLS of an Ri plasmid and virE of a Ti plasmid.

    Science.gov (United States)

    Kiyokawa, Kazuya; Yamamoto, Shinji; Sato, Yukari; Momota, Naoto; Tanaka, Katsuyuki; Moriguchi, Kazuki; Suzuki, Katsunori

    2012-07-01

    Agrobacterium strains containing a Ti plasmid can transfer T-DNA not only to plants but also to fungi, including the yeast Saccharomyces cerevisiae. However, no Agrobacterium strain harboring an Ri plasmid has been evaluated in fungal transformation. Some Ri plasmids have GALLS , instead of virE1 and virE2. GALLS protein can functionally substitute in plant transformation for a structurally different protein VirE2. In this study, we compared the yeast transformation ability among Agrobacterium donors: a strain containing a Ti plasmid, strains harboring either an agropine-type or a mikimopine-type Ri plasmid, and a strain having a modified Ri plasmid supplemented with a Ti plasmid type virE operon. Agrobacterium strains possessing GALLS transformed yeast cells far less efficiently than the strain containing virE operon. Production of GALLS in recipient yeast cells improved the yeast transformation mediated by an Agrobacterium strain lacking neither GALLS nor virE operon. A reporter assay to detect mobilization of the proteins fused with Cre recombinase revealed that VirE2 protein is much more abundant in yeast cells than GALLS. Based on these results, we concluded that the low yeast transformability mediated by Agrobacterium strains having the Ri plasmid is because of low amount of mobilized GALLS in yeast cells. © 2012 The Authors Journal compilation © 2012 by the Molecular Biology Society of Japan/Blackwell Publishing Ltd.

  19. RI management by personal computer

    International Nuclear Information System (INIS)

    Ono, Isamu; Hiyoshi, Katsunori; Ono, Kazuhiko; Morimitsu, Wataru

    1983-01-01

    For RI-handling facilities up to medium scale, it has been studied whether a personal computer is applicable to the practical management of radioisotopes. In the present system, the number of writing in mini floppy disks is 1280 articles per diskette, which is the sufficient capacity for a storage medium for one year in variety of books. The correction of radioactivity decay as well as various totalizations can be made easily, so that the state of RI storage and use for the whole RI-handling facility can be grasped. Further, by the improvement of the output formats, the transfer to the books as obligated to write is possible. From the above reason, a personal computer is practically applicable with the management system and also leads to labor saving in RI management personnel. (Mori, K.)

  20. Mutant RBL mast cells defective in Fc epsilon RI signaling and lipid raft biosynthesis are reconstituted by activated Rho-family GTPases.

    Science.gov (United States)

    Field, K A; Apgar, J R; Hong-Geller, E; Siraganian, R P; Baird, B; Holowka, D

    2000-10-01

    Characterization of defects in a variant subline of RBL mast cells has revealed a biochemical event proximal to IgE receptor (Fc epsilon RI)-stimulated tyrosine phosphorylation that is required for multiple functional responses. This cell line, designated B6A4C1, is deficient in both Fc epsilon RI-mediated degranulation and biosynthesis of several lipid raft components. Agents that bypass receptor-mediated Ca(2+) influx stimulate strong degranulation responses in these variant cells. Cross-linking of IgE-Fc epsilon RI on these cells stimulates robust tyrosine phosphorylation but fails to mobilize a sustained Ca(2+) response. Fc epsilon RI-mediated inositol phosphate production is not detectable in these cells, and failure of adenosine receptors to mobilize Ca(2+) suggests a general deficiency in stimulated phospholipase C activity. Antigen stimulation of phospholipases A(2) and D is also defective. Infection of B6A4C1 cells with vaccinia virus constructs expressing constitutively active Rho family members Cdc42 and Rac restores antigen-stimulated degranulation, and active Cdc42 (but not active Rac) restores ganglioside and GPI expression. The results support the hypothesis that activation of Cdc42 and/or Rac is critical for Fc epsilon RI-mediated signaling that leads to Ca(2+) mobilization and degranulation. Furthermore, they suggest that Cdc42 plays an important role in the biosynthesis and expression of certain components of lipid rafts.

  1. Clinical efficacy of omalizumab in chronic spontaneous urticaria is associated with a reduction of FcεRI-positive cells in the skin.

    Science.gov (United States)

    Metz, Martin; Staubach, Petra; Bauer, Andrea; Brehler, Randolf; Gericke, Janine; Kangas, Michael; Ashton-Chess, Joanna; Jarvis, Philip; Georgiou, Panayiotis; Canvin, Janice; Hillenbrand, Rainer; Erpenbeck, Veit J; Maurer, Marcus

    2017-01-01

    Background. Treatment with omalizumab, a humanized recombinant monoclonal anti-IgE antibody, results in clinical efficacy in patients with Chronic Spontaneous Urticaria (CSU). The mechanism of action of omalizumab in CSU has not been elucidated in detail. Objectives. To determine the effects of omalizumab on levels of high affinity IgE receptor-positive (FcεRI + ) and IgE-positive (IgE + ) dermal cells and blood basophils. Treatment efficacy and safety were also assessed. Study design. In a double-blind study, CSU patients aged 18‑75 years were randomized to receive 300 mg omalizumab (n=20) or placebo (n=10) subcutaneously every 4 weeks for 12 weeks. Changes in disease activity were assessed by use of the weekly Urticaria Activity Score (UAS7). Circulating IgE levels, basophil numbers and levels of expression of FcεRI + and IgE + cells in the skin and in blood basophils were determined. Results. Patients receiving omalizumab showed a significantly greater decrease in UAS7 compared with patients receiving placebo. At Week 12 the mean difference in UAS7 between treatment groups was -14.82 (p=0.0027), consistent with previous studies. Total IgE levels in serum were increased after omalizumab treatment and remained elevated up to Week 12. Free IgE levels decreased after omalizumab treatment. Mean levels of FcεRI + skin cells in patients treated with omalizumab 300 mg were decreased at Week 12 compared with baseline in the dermis of both non-lesional and lesional skin, reaching levels comparable with those seen in healthy volunteers (HVs). There were no statistically significant changes in mean FcɛRI + cell levels in the placebo group. Similar results were seen for changes in IgE + cells, although the changes were not statistically significant. The level of peripheral blood basophils increased immediately after treatment start and returned to Baseline values after the follow-up period. The levels of FcεRI and IgE expression on peripheral blood basophils were

  2. RiArsB and RiMT-11: Two novel genes induced by arsenate in arbuscular mycorrhiza.

    Science.gov (United States)

    Maldonado-Mendoza, Ignacio E; Harrison, Maria J

    Plants associated with arbuscular mycorrhizal fungi (AMF) increase their tolerance to arsenic-polluted soils. This study aims to investigate the genes involved in the AMF molecular response to arsenic pollution. Genes encoding proteins involved in arsenic metabolism were identified and their expression assessed by PCR or RT-qPCR. The As-inducible gene GiArsA (R. irregularis ABC ATPase component of the ArsAB arsenite efflux pump) and two new genes, an arsenate/arsenite permease component of ArsAB (RiArsB) and a methyltransferase type 11 (RiMT-11) were induced when arsenate was added to two-compartment in vitro monoxenic cultures of R. irregularis-transformed carrot roots. RiArsB and RiMT-11 expression in extraradical hyphae in response to arsenate displayed maximum induction 4-6 h after addition of 350 μM arsenate. Their expression was also detected in colonized root tissues grown in pots, or in the root-fungus compartment of two-compartment in vitro systems. We used a Medicago truncatula double mutant (mtpt4/mtpt8) to demonstrate that RiMT-11 and RiArsB transcripts accumulate in response to the addition of arsenate but not in response to phosphate. These results suggest that these genes respond to arsenate addition regardless of non-functional Pi symbiotic transport, and that RiMT-11 may be involved in arsenate detoxification by methylation in AMF-colonized tissues. Copyright © 2017 British Mycological Society. All rights reserved.

  3. Reference manual for toxicity and exposure assessment and risk characterization. CERCLA Baseline Risk Assessment

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-01

    The Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA, 1980) (CERCLA or Superfund) was enacted to provide a program for identifying and responding to releases of hazardous substances into the environment. The Superfund Amendments and Reauthorization Act (SARA, 1986) was enacted to strengthen CERCLA by requiring that site clean-ups be permanent, and that they use treatments that significantly reduce the volume, toxicity, or mobility of hazardous pollutants. The National Oil and Hazardous Substances Pollution Contingency Plan (NCP) (USEPA, 1985; USEPA, 1990) implements the CERCLA statute, presenting a process for (1) identifying and prioritizing sites requiring remediation and (2) assessing the extent of remedial action required at each site. The process includes performing two studies: a Remedial Investigation (RI) to evaluate the nature, extent, and expected consequences of site contamination, and a Feasibility Study (FS) to select an appropriate remedial alternative adequate to reduce such risks to acceptable levels. An integral part of the RI is the evaluation of human health risks posed by hazardous substance releases. This risk evaluation serves a number of purposes within the overall context of the RI/FS process, the most essential of which is to provide an understanding of ``baseline`` risks posed by a given site. Baseline risks are those risks that would exist if no remediation or institutional controls are applied at a site. This document was written to (1) guide risk assessors through the process of interpreting EPA BRA policy and (2) help risk assessors to discuss EPA policy with regulators, decision makers, and stakeholders as it relates to conditions at a particular DOE site.

  4. Reference manual for toxicity and exposure assessment and risk characterization. CERCLA Baseline Risk Assessment

    International Nuclear Information System (INIS)

    1995-03-01

    The Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA, 1980) (CERCLA or Superfund) was enacted to provide a program for identifying and responding to releases of hazardous substances into the environment. The Superfund Amendments and Reauthorization Act (SARA, 1986) was enacted to strengthen CERCLA by requiring that site clean-ups be permanent, and that they use treatments that significantly reduce the volume, toxicity, or mobility of hazardous pollutants. The National Oil and Hazardous Substances Pollution Contingency Plan (NCP) (USEPA, 1985; USEPA, 1990) implements the CERCLA statute, presenting a process for (1) identifying and prioritizing sites requiring remediation and (2) assessing the extent of remedial action required at each site. The process includes performing two studies: a Remedial Investigation (RI) to evaluate the nature, extent, and expected consequences of site contamination, and a Feasibility Study (FS) to select an appropriate remedial alternative adequate to reduce such risks to acceptable levels. An integral part of the RI is the evaluation of human health risks posed by hazardous substance releases. This risk evaluation serves a number of purposes within the overall context of the RI/FS process, the most essential of which is to provide an understanding of ''baseline'' risks posed by a given site. Baseline risks are those risks that would exist if no remediation or institutional controls are applied at a site. This document was written to (1) guide risk assessors through the process of interpreting EPA BRA policy and (2) help risk assessors to discuss EPA policy with regulators, decision makers, and stakeholders as it relates to conditions at a particular DOE site

  5. Dicty_cDB: Contig-U12832-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available N... 44 5.2 1 ( CV571667 ) oe15g07.y1 Human keratoconus cornea, unamplified,... 44 5.2 1 ( AI973283 ) wr54c0...Name: Full=E3 ubiquitin-protein ligase RNF19B; ... 41 0.024 (Q17RB8) RecName: Full=LON peptidase N-terminal ...urpuratus clone R3-3082J12, W... 38 0.34 6 ( EK301514 ) 1095462366289 Global-Ocean-Sampli...RI-214 Salmo salar genomic clone S... 44 5.2 1 ( ER301481 ) 1092343697994 Global-Ocean-Sampli...Y598454_1( AY598454 |pid:none) Danio rerio transcriptional interm... 39 0.070 CR853286_7( CR853286 |pid:none

  6. Structural insights into the interaction of human IgG1 with FcγRI: no direct role of glycans in binding

    Energy Technology Data Exchange (ETDEWEB)

    Oganesyan, Vaheh, E-mail: oganesyanv@medimmune.com; Mazor, Yariv; Yang, Chunning; Cook, Kimberly E.; Woods, Robert M. [MedImmune LLC, 1 MedImmune Way, Gaithersburg, MD 20878 (United States); Ferguson, Andrew [AstraZeneca Pharmaceuticals, 35 Gatehouse Drive, Mailstop E3, Waltham, MA 02451 (United States); Bowen, Michael A.; Martin, Tom; Zhu, Jie; Wu, Herren; Dall’Acqua, William F., E-mail: oganesyanv@medimmune.com [MedImmune LLC, 1 MedImmune Way, Gaithersburg, MD 20878 (United States)

    2015-10-31

    In an effort to identify the critical structural features responsible for the high-affinity interaction of IgG1 Fc with FcγRI, the structure of the corresponding complex was solved at a resolution of 2.4 Å. The three-dimensional structure of a human IgG1 Fc fragment bound to wild-type human FcγRI is reported. The structure of the corresponding complex was solved at a resolution of 2.4 Å using molecular replacement; this is the highest resolution achieved for an unmutated FcγRI molecule. This study highlights the critical structural and functional role played by the second extracellular subdomain of FcγRI. It also explains the long-known major energetic contribution of the Fc ‘LLGG’ motif at positions 234–237, and particularly of Leu235, via a ‘lock-and-key’ mechanism. Finally, a previously held belief is corrected and a differing view is offered on the recently proposed direct role of Fc carbohydrates in the corresponding interaction. Structural evidence is provided that such glycan-related effects are strictly indirect.

  7. BIPM comparison BIPM.RI(II)-K1.Eu-152 of activity measurements of the radionuclide 152Eu for the VNIIM (Russia), the LNE-LNHB (France) and the CNEA (Argentina), with linked results for the COOMET.RI(II)-K2.Eu-152 comparison

    International Nuclear Information System (INIS)

    Michotte, C.; Ratel, G.; Courte, S.; Kharitonov, I.A.; Zanevsky, A.V.; Terechtchenko, E.E.; Moune, M.; Aubineau-Laniece, I.; Bobin, C.; Arenillas, P.; Balpardo, C.

    2014-01-01

    Three new participants in the BIPM.RI(II)-K1.Eu-152 comparison have been added to the previous results and this has produced a revised value for the key comparison reference value (KCRV), calculated using the power-moderated weighted mean. A link has been made to the COOMET.RI(II)-K2.Eu-152 comparison held in 2010 through the VNIIM who participated in both comparisons. Three National Metrology Institutes (NMIs) used the K1 or K2 comparisons to update their degree of equivalence. The degrees of equivalence between each equivalent activity measured in the International Reference System (SIR) and the KCRV have been calculated and the results are given in the form of a table for four NMIs in the BIPM.RI(II)-K1.Eu-152 comparison, three participants in the COOMET.RI(II)-K2.Eu-152 comparison and the 18 other participants in the previous CCRI(II)-K2.Eu-152 comparison. A graphical presentation is also given. (authors)

  8. Use of RI-cone penetrometer in clay foundations

    International Nuclear Information System (INIS)

    Mimura, Mamoru; Shibata, Toru; Shrivastava, A.K.

    1993-01-01

    RI cone penetrometer tests are carried out at four different sites. The foundation grounds discussed here mainly consist of clayey materials. The measured results by RI cone penetrometers are shown for Kyobashi, Hachirougata, Kurihama and Kinkai Bay site. According to comparison of water content and density profiles by RI cone measurement with the conventional testing results, RI cone penetrometers are proved to be versatile tools for site investigation. Settlement assessment by RI cone penetrometer is also discussed by exemplifying the embankment at Kinkai Bay site. Elasto-vis-coplastic finite element analysis correspondingly performed strongly supports the RI cone based assessment. Repeated use of RI cone penetrometer with the advance of construction enables us to assess the consolidation process of the clay foundation. (author)

  9. Predicting refeeding hypophosphataemia: insulin growth factor 1 (IGF-1) as a diagnostic biochemical marker for clinical practice.

    Science.gov (United States)

    Goyale, Atul; Ashley, Sarah L; Taylor, David R; Elnenaei, Manal O; Alaghband-Zadeh, Jamshid; Sherwood, Roy A; le Roux, Carel W; Vincent, Royce P

    2015-01-01

    Refeeding syndrome (RS) is a potentially fatal condition that can occur following the re-introduction of nutrition after a period of starvation. Hypophosphataemia following the reintroduction of nutrition is often the only reliable biochemical marker of RS. Refeeding index (RI) generated from baseline insulin-like growth factor-1 (IGF-1) and leptin has been proposed as a useful biochemical marker for the identification of patients at risk of developing refeeding hypophosphataemia (RH). A prospective study included 52 patients referred for parenteral nutrition (PN). The sensitivity and specificity of IGF-1 measured using a sensitive assay was compared to the RI in predicting the development of RH (a ≥ 30% drop in PO4 during the first 36-h of PN administration). Leptin and IGF-1 were analysed on baseline samples using a quantitative enzyme-linked immunoassay. Daily blood samples were collected from all patients for routine biochemistry for the full duration of PN administration. High sensitivity IGF-1 measurement alone was comparable with the RI, using receiver-operating characteristic (ROC) curve analysis, with areas under the curve being 0.79 and 0.80, respectively, and superior to leptin alone (0.72) for predicting ≥ 30% drop in PO4. The cut-off value for IGF-1 that gave best sensitivity (91% [95% CI 75-98%]) and specificity (65% [95% CI 41-85%]) was 63.7 µg/L, with a likelihood ratio of 2.59. Baseline IGF-1 is an objective, sensitive and specific biochemical marker in identifying patients who are at high risk of developing RH prior to PN administration and therefore may have a role in clinical practice. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  10. The aux1 gene of the Ri plasmid is sufficient to confer auxin autotrophy in tobacco BY-2 cells.

    Science.gov (United States)

    Nemoto, Keiichirou; Hara, Masamitsu; Goto, Shingo; Kasai, Kouji; Seki, Hikaru; Suzuki, Masashi; Oka, Atsuhiro; Muranaka, Toshiya; Mano, Yoshihiro

    2009-05-01

    Tobacco (Nicotiana tabacum) Bright Yellow-2 (BY-2) cells are rapidly proliferating meristematic cells that require auxin for culture in vitro. We have established several transgenic BY-2 cell lines that carry the T-DNA of Agrobacterium rhizogenes 15834, which harbors an agropine-type root-inducing (Ri) plasmid. Two of these lines, BYHR-3 and BYHR-7, were used to test the role of auxin in the proliferation of plant cells. The lines grew rapidly in Linsmaier-Skoog (LS) medium lacking auxin and other phytohormones. The TR-DNA, containing the aux1 (tryptophan monooxygenase) and aux2 (indoleacetamide hydrolase) genes, was present in the genomes of both transgenic lines, whereas the TL-DNA, containing the rolA, B, C and D genes, was present in the genome of BYHR-7 but not BYHR-3. Since the introduction of the rolABCD genes alone did not affect the auxin requirement of BY-2 cells, the aux1 and aux2 genes, but not the rolABCD genes, appear to be relevant to the auxin autotrophy of these transgenic lines. Furthermore, the overexpression of aux1 allowed BY-2 cells to grow rapidly in the absence of auxin, suggesting the existence in plant cells of an unidentified gene whose product is functionally equivalent or similar to that of aux2 of the Ri plasmid.

  11. RI beam factory and its expected pioneering work

    International Nuclear Information System (INIS)

    Yano, Yasushige

    1996-01-01

    The RARF (RIKEN Accelerator Research Facility) houses an intermediate-energy heavy-ion accelerator complex consisting of a K540-MeV ring cyclotron (RRC) and a couple of different types of the injectors: a variable-frequency heavy-ion linac and a K70-MeV AVF cyclotron. One of remarkable features of this facility is capability of supplying light-atomic-mass RI (radioactive isotope) beams with the world-highest level of intensities by the projectile-fragment separator, RIPS. In these several years nuclear physicists have opened up a quite new and fascinating heavy-ion science exploiting such RI beams. In order to further promote this new science, the RARF proposes 'RIKEN RI Beam Factory' as a next facility-expanding project. The factory takes the aim at providing RI beams covering over the whole atomic-mass range with the world-highest intensities in a wide energy range up to several hundreds MeV/nucleon. To realize the 'Factory' a K2500-MeV superconducting ring cyclotron will be built which boosts output energies of the RRC beams up to 400 MeV/nucleon for light ions and up to 100 MeV/nucleon for very heavy ions, preserving their beam intensities (typically 1A). RI beams will be generated by the projectile fragmentation. A new type of experimental installation called 'MUSES' (Multi-USe Experimental Storage rings) will also be constructed. It consists of an accumulator-cooler ring, booster synchrotron ring and double storage rings. With MUSES, various types of unique colliding experiments will become possible: ion-ion merging or head-on collisions; collisions of either electrons or X-rays with ion (stable isotope or RI) beams; internal target experiments; and atomic and molecular physics with cooler electron beams. (author)

  12. Verification of Representative Sampling in RI waste

    International Nuclear Information System (INIS)

    Ahn, Hong Joo; Song, Byung Cheul; Sohn, Se Cheul; Song, Kyu Seok; Jee, Kwang Yong; Choi, Kwang Seop

    2009-01-01

    For evaluating the radionuclide inventories for RI wastes, representative sampling is one of the most important parts in the process of radiochemical assay. Sampling to characterized RI waste conditions typically has been based on judgment or convenience sampling of individual or groups. However, it is difficult to get a sample representatively among the numerous drums. In addition, RI waste drums might be classified into heterogeneous wastes because they have a content of cotton, glass, vinyl, gloves, etc. In order to get the representative samples, the sample to be analyzed must be collected from selected every drum. Considering the expense and time of analysis, however, the number of sample has to be minimized. In this study, RI waste drums were classified by the various conditions of the half-life, surface dose, acceptance date, waste form, generator, etc. A sample for radiochemical assay was obtained through mixing samples of each drum. The sample has to be prepared for radiochemical assay and although the sample should be reasonably uniform, it is rare that a completely homogeneous material is received. Every sample is shredded by a 1 ∼ 2 cm 2 diameter and a representative aliquot taken for the required analysis. For verification of representative sampling, classified every group is tested for evaluation of 'selection of representative drum in a group' and 'representative sampling in a drum'

  13. Evaluation of Serum Cystatin C as a Marker of Early Renal Impairment in Patients with Liver Cirrhosis

    Directory of Open Access Journals (Sweden)

    Mahmoud Omar

    2015-01-01

    Full Text Available Background. Serum cystatin C (CysC was proposed as an effective reflection of the glomerular filtration rate (GFR. However, its role in patients with liver cirrhosis has not been extensively verified especially in the detection of early RI. Patients and Methods. Seventy consecutive potential candidates for living donor liver transplantation with serum creatinine (Cr <1.5 mg/dL were included. CysC, Cr, and estimated GFR [creatinine clearance (CCr, Cockcroft-Gault formula (C-G, MDRD equations with 4 and 6 variables, CKD-EPI-Cr, CKD-EPI-CysC, and CKD-EPI-Cr-CysC] were all correlated to isotopic GFR. Early RI was defined as GFR of 60–89 mL/min/1.73 m2. Results. Patients were 25.7% and 74.3% Child-Pugh classes B and C, respectively. GFR was ≥90, 60–89, and 30–59 mL/min/1.73 m2 in 31.4%, 64.3%, and 4.3% of the patients, respectively. All markers and equations, except C-G, were significantly correlated to GFR with CKD-EPI-Cr-CysC formula having the highest correlation (r = 0.474 and the largest area under the ROC curve (0.808 for discriminating early RI. At a cutoff value of 1.2 mg/L, CysC was 89.6% sensitive and 63.6% specific in detecting early RI. Conclusion. In patients with liver cirrhosis, CysC and CysC-based equations showed the highest significant correlation to GFR and were measures that best discriminated early RI.

  14. Development of RI Target Production Technology

    International Nuclear Information System (INIS)

    Jeong, Do Young; Ko, Kwang Hoon; Kim, Cheol Jung; Kim, Taek Soo; Rho, Si Pyo; Park, Hyun Min; Lim, Gwon; Cha, Yong Ho; Han, Jae Min

    2010-04-01

    This project was accomplished with an aim of productive technical development on the 'enriched target' which is used essentially in radioisotope production. The research was advanced systematically with target production pilot system configuration and core technical development. We composed Yb-176 productive pilot system which equip the chemical purification technique of medical treatment level and proved its capability. Possibilities to separate Zn-67 by the method of using the polarizing light in principle and to separate Zn-70 by the method of using the double optical pumping in theory were also proved. RI target production technologies are recognized excessively with monopolistic techniques of part atomic energy advanced nations such as Russia and US and they are come, but we prepared the opportunity will be able to complete a full cycle of like (RI material production -> RI target production -> RI application) with this project accomplishment. When considering only the direct demand of stable isotope which is used in various industrial, we forecast with the fact that RI target markets will become larger with the approximately 5 billion dollars in 2020 and this technology will contribute in the domestic rising industry creation with high value added

  15. Longitudinal trends of recent HIV-1 infections in Slovenia (1986-2012) determined using an incidence algorithm.

    Science.gov (United States)

    Lunar, Maja M; Matković, Ivana; Tomažič, Janez; Vovko, Tomaž D; Pečavar, Blaž; Poljak, Mario

    2015-09-01

    Resolving dilemma whether the rise in the number of HIV diagnoses represents an actual increase in HIV transmissions or is a result of improved HIV surveillance is crucial before implementing national HIV prevention strategies. Annual proportions of recent infections (RI) among newly diagnosed persons infected with HIV-1 in Slovenia during 27 years (1986-2012) were determined using an algorithm consisting of routine baseline CD4 and HIV viral load measurements and the Aware BED EIA HIV-1 Incidence Test (BED test). The study included the highest coverage of persons diagnosed with HIV during the entire duration of an HIV epidemic in a given country/region (71%). Out of 416 patients, 170 (40.9%) had a baseline CD4 cell count less than 200 cells/mm(3) and/or HIV-1 viral load less than 400 copies/ml and were characterized as having a long-standing infection (LSI). The remaining 246 patients were additionally tested using the BED test. Overall, 23% (97/416) of the patients were labeled RI. The characteristics significantly associated with RI were as follows: younger age, acute retroviral syndrome, CDC class A and other than C, no AIDS defining illnesses, HIV test performed in the past, a higher viral load, and a higher CD4 cell count. An interesting trend in the proportion of RI was observed, with a peak in 2005 (47% of RI) and the lowest point in 2008 (12%) in parallel with a rise in the numbers of new HIV diagnoses. This study could help promote the idea of introducing periodic HIV incidence monitoring using a simple and affordable algorithm. © 2015 Wiley Periodicals, Inc.

  16. Medical RI development plan of KOMAC

    Science.gov (United States)

    Kim, Kye-Ryung; Jung, Myung-Hwan; Yoon, Sang-Pil; Min, Yi-Sub; Cho, Yong-Sub

    2017-12-01

    Many kinds of radioisotopes (RIs) produced by the high energy (100 200 MeV) proton accelerators are developed by the foreign R&D institutes and the worldwide demands are being increased continuously. The RI production using high energy proton beam higher than 50 MeV was not considerable because of the limit of the proton beam energy from existing proton accelerator facilities in Korea before 2013. The available maximum proton energy was 50 MeV from MC-50 cyclotron of Korea Institute of Radiological and Medical Sciences (KIRAMS) at that time. After the construction of a 100 MeV high-current and high-energy proton accelerator and a new irradiation facility for the RI production in 2013 and 2016 by the Korea Multi-purpose Accelerator Complex (KOMAC) at Korea Atomic Energy Research Institute (KAERI), we can make a plan for the new RI production of Cu-67, Sr-82 and so on. In the medical application fields, the worldwide demand of Sr-82 is being increased rapidly during last several years and the domestic demand of Cu-67 is also expected to be increased in near future. And alpha-emitters, such as Ac-225 and Ra-223, are becoming attractive to the users in the medical science fields in the future. The RI development plan of KOMAC was specified recently reflecting the recent environment changes and requirements from the users. In this paper, the results and present status of RI production and R&D facilities, calculation results related to the RI production yields, and future plans is presented.

  17. Diagnostic Validity of RI Angiocardiography in Cardiac Diseases

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kwan Yop; Koh, Chang Soon; Lee, Mun Ho [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    1972-09-15

    The employment of gamma-ray scintillation camera with the use of short-lived radioisotopic pharmaceuticals, such as {sup 99m}Tc sodium pertechnetate, have enabled us to perform RI (radioisotopic) angiocardiography. Although conventional cardiac catheterization or angiocardiography using contrast media have been an important diagnostic tool, they may carry some risks or serious complications. The author investigated on RI angiocardiography in twelve normal and twenty five patients with cardiovascular diseases in an effort to evaluate its diagnostic value. The results obtained with this study are as follows; l. In normal subjects, the scintillation camera transit time of arm-to-right heart was found to be 2.1+-0.67 seconds, right heart-to-lung 1.5+-0.40 seconds and lung-to-left heart 3.5+-0.86 seconds. 2. Transformation or displacement of the heart and the great vessel are easily discriminated by RI angiocardiography. Both in the cases with tricuspid atresia and tetralogy of Fallot, ventricular septal defects are well recognized by sequential RI angiocardiography. 3. It is also helpful in determining the site and extent of obstruction, and estimating the postoperative course both in the cases with superior vena cava syndrome and pulmonary stenosis. 4. Pericarditis with effusion is readily diagnosed by RI angiocardiogram showing characteristic 'dead space' between intracardiac and intrapulmonary radioactivity. 5. It was found that the diagnostic accuracy of this study was 78.4%. It is concluded that above results obtained are useful and accurate enough for the diagnostic screening method for clinical practice.

  18. Diagnostic Validity of RI Angiocardiography in Cardiac Diseases

    International Nuclear Information System (INIS)

    Kim, Kwan Yop; Koh, Chang Soon; Lee, Mun Ho

    1972-01-01

    The employment of gamma-ray scintillation camera with the use of short-lived radioisotopic pharmaceuticals, such as 99m Tc sodium pertechnetate, have enabled us to perform RI (radioisotopic) angiocardiography. Although conventional cardiac catheterization or angiocardiography using contrast media have been an important diagnostic tool, they may carry some risks or serious complications. The author investigated on RI angiocardiography in twelve normal and twenty five patients with cardiovascular diseases in an effort to evaluate its diagnostic value. The results obtained with this study are as follows; l. In normal subjects, the scintillation camera transit time of arm-to-right heart was found to be 2.1±0.67 seconds, right heart-to-lung 1.5±0.40 seconds and lung-to-left heart 3.5±0.86 seconds. 2. Transformation or displacement of the heart and the great vessel are easily discriminated by RI angiocardiography. Both in the cases with tricuspid atresia and tetralogy of Fallot, ventricular septal defects are well recognized by sequential RI angiocardiography. 3. It is also helpful in determining the site and extent of obstruction, and estimating the postoperative course both in the cases with superior vena cava syndrome and pulmonary stenosis. 4. Pericarditis with effusion is readily diagnosed by RI angiocardiogram showing characteristic 'dead space' between intracardiac and intrapulmonary radioactivity. 5. It was found that the diagnostic accuracy of this study was 78.4%. It is concluded that above results obtained are useful and accurate enough for the diagnostic screening method for clinical practice.

  19. Diagnostic Validity of RI Angiocardiography in Cardiac Diseases

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kwan Yop; Koh, Chang Soon; Lee, Mun Ho [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    1972-09-15

    The employment of gamma-ray scintillation camera with the use of short-lived radioisotopic pharmaceuticals, such as {sup 99m}Tc sodium pertechnetate, have enabled us to perform RI (radioisotopic) angiocardiography. Although conventional cardiac catheterization or angiocardiography using contrast media have been an important diagnostic tool, they may carry some risks or serious complications. The author investigated on RI angiocardiography in twelve normal and twenty five patients with cardiovascular diseases in an effort to evaluate its diagnostic value. The results obtained with this study are as follows; l. In normal subjects, the scintillation camera transit time of arm-to-right heart was found to be 2.1+-0.67 seconds, right heart-to-lung 1.5+-0.40 seconds and lung-to-left heart 3.5+-0.86 seconds. 2. Transformation or displacement of the heart and the great vessel are easily discriminated by RI angiocardiography. Both in the cases with tricuspid atresia and tetralogy of Fallot, ventricular septal defects are well recognized by sequential RI angiocardiography. 3. It is also helpful in determining the site and extent of obstruction, and estimating the postoperative course both in the cases with superior vena cava syndrome and pulmonary stenosis. 4. Pericarditis with effusion is readily diagnosed by RI angiocardiogram showing characteristic 'dead space' between intracardiac and intrapulmonary radioactivity. 5. It was found that the diagnostic accuracy of this study was 78.4%. It is concluded that above results obtained are useful and accurate enough for the diagnostic screening method for clinical practice.

  20. RIKEN RI Beam Factory project

    Energy Technology Data Exchange (ETDEWEB)

    Yano, Yasushige; Goto, Akira; Katayama, Takeshi [Institute of Physical and Chemical Research, Wako, Saitama (Japan)

    1997-03-01

    The RARF proposes `RIKEN RI Beam Factory` as a next facility-expanding project. The factory makes it the primary aim to provide RI (Radioactive Isotope) beams covering over the whole atomic-mass range with the world-highest intensity in a wide energy range up to several hundreds MeV/nucleon. These RI beams are generated by the fragmentation of high-intensity heavy-ion beams. For the efficient production heavy-ion energies will be boosted up to over 100 MeV/nucleon even for very heavy ions by a K2500-MeV superconducting ring cyclotron serving as a post accelerator of the existing K540-MeV ring cyclotron. A new type of experimental installation called `MUSES` (Multi-USe Experimental Storage rings) will be constructed as well. With MUSES, various types of unique colliding experiments will become possible. (author)

  1. 41 CFR 109-1.5202 - Establishment of a personal property holdings baseline.

    Science.gov (United States)

    2010-07-01

    ... personal property holdings baseline. 109-1.5202 Section 109-1.5202 Public Contracts and Property Management...-1.5202 Establishment of a personal property holdings baseline. (a) If the contractor is a new... baseline or may perform a complete physical inventory of all personal property. This physical inventory is...

  2. Hepatitis C treatment response kinetics and impact of baseline predictors

    DEFF Research Database (Denmark)

    Lindh, M; Arnholm, B; Eilard, A

    2011-01-01

    Summary. The optimal duration of treatment for hepatitis C virus (HCV) infections is highly variable but critical for achieving cure (sustained virological response, SVR). We prospectively investigated the impact of age, fibrosis, baseline viraemia and genotype on the early viral kinetics...... above 400 000 IU/mL were strongly associated with slower second phase declines of HCV RNA. Genotype 2/3 infections responded more rapidly than genotype 1, reaching week 4 negativity (RVR) in 59%vs 22%. We conclude that baseline response predictors such as age, fibrosis and viral load were well reflected...... by the early viral kinetics as assessed by repeated HCV RNA quantifications. The kinetic patterns and the high relapse rate in genotype 2/3 patients without RVR suggest that this group might benefit from treatment durations longer than 24 weeks....

  3. Üksikud naljakad peaaegu kolmikud / Jüri Viikberg ; tlk. Jüri Viikberg

    Index Scriptorium Estoniae

    Viikberg, Jüri 1953-

    2005-01-01

    Arvustus: Punttila, Matti. Haaskannäköinen tyttö : kielikaskuista sanaleikkeihin. Helsinki, 1998 ; Punttila, Matti. Pilkettä silmäkulmaan : kielikaskuista sanaleikkeihin. Helsinki, 2001 ; Punttila, Matti. Poskettomia huulia : kielikaskuista sanaleikkeihin. Helsinki, 2004. Näiteid: Kui keel ei püsi hammaste taga ; Sõna keeles ja keel hammaste vahel / tõlkinud Jüri Viikberg // Oma Keel, 1995, nr. 1, lk. 55-56, 63-64

  4. ri Talveti luulevalimik hispaania keeles

    Index Scriptorium Estoniae

    2003-01-01

    Talvet, Jüri. Elegia Estonia y otros poemas : [luulevalimik] / tõlkinud Jüri Talvet ja Albert Lázaro Tinaut ; järelsõna Janika Kronberg. Valencia : Palmart Capitelum, 2002; Vt. ka Eesti Päevaleht, 13. jaan., lk. 16

  5. Policy Activities in Europlanet 2020 RI

    Science.gov (United States)

    Giacomini, L.; Heward, A.; Mason, N.

    2017-09-01

    The Europlanet 2020 Research Infrastructure (RI) has received 9.945 million Euros from the European Commission to integrate planetary science across Europe, provide access to facilities, develop tools and build community cohesion. To help these processes and to increase engagement between our policy makers and the planetary science community, part of Europlanet 2020 RI's efforts are dedicated to building connections and organising activities for and within the European Parliament. Since September 2015, Europlanet 2020 RI has contacted all 134 Members of the European Parliament (MEPs) on the ITRE Committee. More than 20 individual briefings have been held to date with MEPS and/or their representatives. In November 2016, Europlanet 2020 RI organized a very successful exhibition in the European Parliament as part of the 8th European Innovation Summit and the STOA Annual Lecture, and a dinner debates was held in the on the 'Impact of the EU on planetary science' in April 2016. These events enable members of the Europlanet community, politicians and interested parties to come together and discuss views on topics of interest or concern to the space and planetary sectors. Efforts in recent years have led to important opportunities for our community to feed into reporting and consultative processes. In this talk we will discuss the results achieved in the last two years of activities and the next steps foreseen by Europlanet 2020 RI.

  6. Predictors of HbA1c levels in patients initiating metformin.

    Science.gov (United States)

    Martono, Doti P; Hak, Eelko; Lambers Heerspink, Hiddo; Wilffert, Bob; Denig, Petra

    2016-12-01

    The aim was to assess demographic and clinical factors as predictors of short (6 months) and long term (18 months) HbA1c levels in diabetes patients initiating metformin treatment. We conducted a cohort study including type 2 diabetes patients who received their first metformin prescription between 2007 and 2013 in the Groningen Initiative to Analyze Type 2 Diabetes Treatment (GIANTT) database. The primary outcome was HbA1c level at follow-up adjusted for baseline HbA1c; the secondary outcome was failing to achieve the target HbA1c level of 53 mmol/mol. Associations were analyzed by linear and logistic regression. Multiple imputation was used for missing data. Additional analyses stratified by dose and adherence level were conducted. The cohort included 6050 patients initiating metformin. Baseline HbA1c at target consistently predicted better HbA1c outcomes. Longer diabetes duration and lower total cholesterol level at baseline were predictors for higher HbA1c levels at 6 months. At 18 months, cholesterol level was not a predictor. Longer diabetes duration was also associated with not achieving the target HbA1c at follow-up. The association for longer diabetes duration was especially seen in patients starting on low dose treatment. No consistent associations were found for comorbidity and comedication. Diabetes duration was a relevant predictor of HbA1c levels after 6 and 18 months of follow-up in patients initiating metformin treatment. Given the study design, no causal inference can be made. Our study suggests that prompt treatment intensification may be needed in patients who have a longer diabetes duration at treatment initiation.

  7. FINE-SCALE STRUCTURE OF THE QUASAR 3C 279 MEASURED WITH 1.3 mm VERY LONG BASELINE INTERFEROMETRY

    Energy Technology Data Exchange (ETDEWEB)

    Lu Rusen; Fish, Vincent L.; Doeleman, Sheperd S.; Crew, Geoffrey; Cappallo, Roger J. [Massachusetts Institute of Technology, Haystack Observatory, Route 40, Westford, MA 01886 (United States); Akiyama, Kazunori; Honma, Mareki [National Astronomical Observatory of Japan, Osawa 2-21-1, Mitaka, Tokyo 181-8588 (Japan); Algaba, Juan C.; Ho, Paul T. P.; Inoue, Makoto [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, Taipei 10617, Taiwan, R.O.C. (China); Bower, Geoffrey C.; Dexter, Matt [Department of Astronomy, Radio Astronomy Laboratory, University of California Berkeley, 601 Campbell, Berkeley, CA 94720-3411 (United States); Brinkerink, Christiaan [Department of Astrophysics, IMAPP, Radboud University Nijmegen, P.O. Box 9010, 6500-GL Nijmegen (Netherlands); Chamberlin, Richard [Caltech Submillimeter Observatory, 111 Nowelo Street, Hilo, HI 96720 (United States); Freund, Robert [Arizona Radio Observatory, Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721-0065 (United States); Friberg, Per [James Clerk Maxwell Telescope, Joint Astronomy Centre, 660 North A' ohoku Place, University Park, Hilo, HI 96720 (United States); Gurwell, Mark A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Jorstad, Svetlana G. [Institute for Astrophysical Research, Boston University, Boston, MA 02215 (United States); Krichbaum, Thomas P. [Max-Planck-Institut fuer Radioastronomie, Auf dem Huegel 69, D-53121 Bonn (Germany); Loinard, Laurent, E-mail: rslu@haystack.mit.edu [Centro de Radiostronomia y Astrofisica, Universidad Nacional Autonoma de Mexico, 58089 Morelia, Michoacan (Mexico); and others

    2013-07-20

    We report results from five day very long baseline interferometry observations of the well-known quasar 3C 279 at 1.3 mm (230 GHz) in 2011. The measured nonzero closure phases on triangles including stations in Arizona, California, and Hawaii indicate that the source structure is spatially resolved. We find an unusual inner jet direction at scales of {approx}1 pc extending along the northwest-southeast direction (P.A. = 127 Degree-Sign {+-} 3 Degree-Sign ), as opposed to other (previously) reported measurements on scales of a few parsecs showing inner jet direction extending to the southwest. The 1.3 mm structure corresponds closely with that observed in the central region of quasi-simultaneous super-resolution Very Long Baseline Array images at 7 mm. The closure phase changed significantly on the last day when compared with the rest of observations, indicating that the inner jet structure may be variable on daily timescales. The observed new direction of the inner jet shows inconsistency with the prediction of a class of jet precession models. Our observations indicate a brightness temperature of {approx}8 Multiplication-Sign 10{sup 10} K in the 1.3 mm core, much lower than that at centimeter wavelengths. Observations with better uv coverage and sensitivity in the coming years will allow the discrimination between different structure models and will provide direct images of the inner regions of the jet with 20-30 {mu}as (5-7 light months) resolution.

  8. FINE-SCALE STRUCTURE OF THE QUASAR 3C 279 MEASURED WITH 1.3 mm VERY LONG BASELINE INTERFEROMETRY

    International Nuclear Information System (INIS)

    Lu Rusen; Fish, Vincent L.; Doeleman, Sheperd S.; Crew, Geoffrey; Cappallo, Roger J.; Akiyama, Kazunori; Honma, Mareki; Algaba, Juan C.; Ho, Paul T. P.; Inoue, Makoto; Bower, Geoffrey C.; Dexter, Matt; Brinkerink, Christiaan; Chamberlin, Richard; Freund, Robert; Friberg, Per; Gurwell, Mark A.; Jorstad, Svetlana G.; Krichbaum, Thomas P.; Loinard, Laurent

    2013-01-01

    We report results from five day very long baseline interferometry observations of the well-known quasar 3C 279 at 1.3 mm (230 GHz) in 2011. The measured nonzero closure phases on triangles including stations in Arizona, California, and Hawaii indicate that the source structure is spatially resolved. We find an unusual inner jet direction at scales of ∼1 pc extending along the northwest-southeast direction (P.A. = 127° ± 3°), as opposed to other (previously) reported measurements on scales of a few parsecs showing inner jet direction extending to the southwest. The 1.3 mm structure corresponds closely with that observed in the central region of quasi-simultaneous super-resolution Very Long Baseline Array images at 7 mm. The closure phase changed significantly on the last day when compared with the rest of observations, indicating that the inner jet structure may be variable on daily timescales. The observed new direction of the inner jet shows inconsistency with the prediction of a class of jet precession models. Our observations indicate a brightness temperature of ∼8 × 10 10 K in the 1.3 mm core, much lower than that at centimeter wavelengths. Observations with better uv coverage and sensitivity in the coming years will allow the discrimination between different structure models and will provide direct images of the inner regions of the jet with 20-30 μas (5-7 light months) resolution.

  9. 75 FR 26746 - ONEOK Westex Transmission, L.L.C.; Notice of Baseline Filing

    Science.gov (United States)

    2010-05-12

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR10-19-000] ONEOK Westex Transmission, L.L.C.; Notice of Baseline Filing May 5, 2010. Take notice that on April 29, 2010, ONEOK Westex Transmission, L.L.C. submitted its baseline filing of its Statement of Operating Conditions for transportation...

  10. Dicty_cDB: Contig-U06499-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 46 1.0 1 ( EU494536 ) Zaprionus lineosus voucher 103961 16S ribosomal R... 46 1.0 1 ( EU494535 ) Scaptodrosophila... pattersoni voucher 105497 16S ri... 46 1.0 1 ( EU494534 ) Scaptodrosophila lebanonensis voucher 10

  11. FcεRI γ-Chain Negatively Modulates Dectin-1 Responses in Dendritic Cells

    Directory of Open Access Journals (Sweden)

    Yi-Gen Pan

    2017-10-01

    Full Text Available The inhibitory effect of immunoreceptor tyrosine-based activation motif (ITAM-containing adapters DAP12 and FcεRI γ-chain (FcRγ has been found in many immune functions. Herein, we have further explored the role of these adapters in C-type lectin receptors response. We identified that FcRγ, but not DAP12, could negatively regulate the Dectin-1 responses in dendritic cells (DCs. Loss of FcRγ or both DAP12 and FcRγ enhanced the maturation and cytokine production in DCs upon Dectin-1 activation compared to normal cells, whereas DCs lacking only DAP12 showed little changes. In addition, increments of T cell activation and T helper 17 polarization induced by FcRγ-deficient DCs were observed both in vitro and in vivo. Examining the Dectin-1 signaling, we revealed that the activations of several signaling molecules were augmented in FcRγ-deficient DCs stimulated with Dectin-1 ligands. Furthermore, we demonstrated that the association of phosphatases SHP-1 and PTEN with FcRγ may contribute to the negative regulation of FcRγ in Dectin-1 activation in DCs. These results extend the inhibitory effect of ITAM-containing adapters to Dectin-1 response in immune functions, even though Dectin-1 contains an ITAM-like intracellular domain. According to the role of Dectin-1 in responding to microbes and tumor cells, our finding may have applications in the development of vaccine and cancer therapy.

  12. ri Ratas : Tallinnasse rahvuspark! / Jüri Ratas ; interv. Ilmar Palli

    Index Scriptorium Estoniae

    Ratas, Jüri, 1978-

    2005-01-01

    Tallinna uus linnapea Jüri Ratas rohelisest vööndist, keskkonnakaitsest, ohtlikest veostest, teede olukorrast, linna elukeskkonnast, asotsiaalide probleemist ning kohaliku omavalitsuse ja riigi koostööst

  13. A soluble form of the high affinity IgE receptor, Fc-epsilon-RI, circulates in human serum.

    Directory of Open Access Journals (Sweden)

    Eleonora Dehlink

    Full Text Available Soluble IgE receptors are potential in vivo modulators of IgE-mediated immune responses and are thus important for our basic understanding of allergic responses. We here characterize a novel soluble version of the IgE-binding alpha-chain of Fc-epsilon-RI (sFcεRI, the high affinity receptor for IgE. sFcεRI immunoprecipitates as a protein of ∼40 kDa and contains an intact IgE-binding site. In human serum, sFcεRI is found as a soluble free IgE receptor as well as a complex with IgE. Using a newly established ELISA, we show that serum sFcεRI levels correlate with serum IgE in patients with elevated IgE. We also show that serum of individuals with normal IgE levels can be found to contain high levels of sFcεRI. After IgE-antigen-mediated crosslinking of surface FcεRI, we detect sFcεRI in the exosome-depleted, soluble fraction of cell culture supernatants. We further show that sFcεRI can block binding of IgE to FcεRI expressed at the cell surface. In summary, we here describe the alpha-chain of FcεRI as a circulating soluble IgE receptor isoform in human serum.

  14. Improving Forecast Skill by Assimilation of AIRS Cloud Cleared Radiances RiCC

    Science.gov (United States)

    Susskind, Joel; Rosenberg, Robert I.; Iredell, Lena

    2015-01-01

    ECMWF, NCEP, and GMAO routinely assimilate radiosonde and other in-situ observations along with satellite IR and MW Sounder radiance observations. NCEP and GMAO use the NCEP GSI Data Assimilation System (DAS).GSI DAS assimilates AIRS, CrIS, IASI channel radiances Ri on a channel-by-channel, case-by-case basis, only for those channels i thought to be unaffected by cloud cover. This test excludes Ri for most tropospheric sounding channels under partial cloud cover conditions. AIRS Version-6 RiCC is a derived quantity representative of what AIRS channel i would have seen if the AIRS FOR were cloud free. All values of RiCC have case-by-case error estimates RiCC associated with them. Our experiments present to the GSI QCd values of AIRS RiCC in place of AIRS Ri observations. GSI DAS assimilates only those values of RiCC it thinks are cloud free. This potentially allows for better coverage of assimilated QCd values of RiCC as compared to Ri.

  15. Decontamination manual of RI handling laboratory

    International Nuclear Information System (INIS)

    Wadachi, Yoshiki

    2004-01-01

    Based on experiences in Japan Atomic Energy Research Institute (JAERI), the essential and practical knowledge of radioactive contamination and its decontamination, and the method and procedure of floor decontamination are described for researcher and managing person in charge of handling radioisotopes (RI) in RI handling laboratories. Essential knowledge concerns the uniqueness of solid surface contamination derived from RI half lives and quantities, surface contamination density limit, and mode/mechanism of contamination. The principle of decontamination is a single conduct with recognition of chemical form of the RI under use. As the practical knowledge, there are physical and chemical methods of solid surface decontamination. The latter involves use of inorganic acids, chelaters and surfactants. Removal and replacement of contaminated solid like floor material are often effective. Distribution mapping of surface contamination can be done by measuring the radioactivity in possibly contaminated areas, and is useful for planning of effective decontamination. Floor surface decontamination is for the partial and spread areas of the floor. It is essential to conduct the decontamination with reagent from the highly to less contaminated areas. Skin decontamination with either neutral detergent or titanium oxide is also described. (N.I.)

  16. Laser spectroscopy of exotic RI atoms in superfluid helium-OROCHI experiment

    International Nuclear Information System (INIS)

    Furukawa, T.; Matsuo, Y.; Hatakeyama, A.; Fujikake, K.; Matsuura, Y.; Kobayashi, T.; Shimoda, T.

    2010-01-01

    We have been developing a new laser spectroscopic technique 'OROCHI,' which is based on the combination of superfluid helium as a stopper of radioactive isotope (RI) beam and in-situ laser spectroscopy of RI atoms, for determining spins and moments of exotic RIs. By using this unique technique, it is feasible to measure nuclear spins and electromagnetic moments of extremely low yield RI (estimated as less than 1 pps). Recently, we have demonstrated that nuclear spins and moments are obtained from Zeeman and hyperfine splittings of stable Rb isotopes measured using this OROCHI technique. Details of this laser spectroscopy method in He II 'OROCHI' and the summary of our development are presented.

  17. A pilot interventional study to evaluate the impact of cholecalciferol treatment on HbA1c in type 1 diabetes (T1D

    Directory of Open Access Journals (Sweden)

    R Perchard

    2017-05-01

    Full Text Available Background: Higher 25(OHD3 levels are associated with lower HbA1c, but there are limited UK interventional trials assessing the effect of cholecalciferol on HbA1c. Aims: (1 To assess the baseline 25(OHD3 status in a Manchester cohort of children with type 1 diabetes (T1D. (2 To determine the effect of cholecalciferol administration on HbA1c. Methods: Children with T1D attending routine clinic appointments over three months in late winter/early spring had blood samples taken with consent. Participants with a 25(OHD3 level 10 years units. HbA1c levels before and after treatment were recorded. Results: Vitamin D levels were obtained from 51 children. 35 were Caucasian, 11 South Asian and 5 from other ethnic groups. 42 were vitamin D deficient, but 2 were excluded from the analysis. All South Asian children were vitamin D deficient, with mean 25(OHD3 of 28 nmol/L. In Caucasians, there was a negative relationship between baseline 25(OHD3 level and HbA1c (r = −0.484, P < 0.01. In treated participants, there was no significant difference in mean HbA1c at 3 months (t = 1.010, P = 0.328 or at 1 year (t = −1.173, P = 0.248 before and after treatment. One-way ANCOVA, controlling for age, gender, ethnicity, BMI and diabetes duration showed no difference in Δ HbA1c level. Conclusion: We report important findings at baseline, but in children treated with a stat dose of cholecalciferol, there was no effect on HbA1c. Further studies with larger sample sizes and using maintenance therapy are required.

  18. A research on the empowerment plan for specialist in RI-biomics field

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Wo Ho; Park, Tai Jin; Yeom, Yu Sun [Korea Association for Radiation Application, Seoul (Korea, Republic of); Park, Sang Hyun [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup (Korea, Republic of)

    2014-12-15

    Increasing utilization of radiation and RI (Radioisotope) in nuclear industry including non-power area has achieved sustainable development of radiation industry. Industries are no longer confined by a single technology or abilities but expanded for application gradually. RIBiomics fields are one of the convergence technology that is recognized on a high-tech industry. Unlike the conventional industry, RI-Biomics field needs to various specialists to perform related task. There is no domestic training program to educate the whole process. This study aims to suggest the plan for improvement of practical skills for specialists in RI-Biomics through development of our training program. For this purpose, we have first investigated the opinion about classification scheme from experts and then analyzed the results in order to reflecting our training program. Based on analyzed results, conformity assessment was executed to organize curriculum through status of constructed device and instructor in domestic. Our training program was performed jointly with KAERI (Korea Atomic Energy Research Institute). RI-Biomics center is prepared with facilities of overall experiment to improve quality of education. Due to the fact that specialists have routine task, we organized a five-day short course to reflect temporal difficulties. We performed a trial operation to 6 participants in RI-Biomics field. Through the survey for the specialists who participated in the program, we evaluated the efficiency of our training program. The results showed that participants were satisfied with the organized curriculum and educational materials. Therefore, our program is expected to be utilized as basic research data to develop feasible program for policy development and to improve practical skills in RI-Biomics.

  19. A research on the empowerment plan for specialist in RI-biomics field

    International Nuclear Information System (INIS)

    Shin, Wo Ho; Park, Tai Jin; Yeom, Yu Sun; Park, Sang Hyun

    2014-01-01

    Increasing utilization of radiation and RI (Radioisotope) in nuclear industry including non-power area has achieved sustainable development of radiation industry. Industries are no longer confined by a single technology or abilities but expanded for application gradually. RIBiomics fields are one of the convergence technology that is recognized on a high-tech industry. Unlike the conventional industry, RI-Biomics field needs to various specialists to perform related task. There is no domestic training program to educate the whole process. This study aims to suggest the plan for improvement of practical skills for specialists in RI-Biomics through development of our training program. For this purpose, we have first investigated the opinion about classification scheme from experts and then analyzed the results in order to reflecting our training program. Based on analyzed results, conformity assessment was executed to organize curriculum through status of constructed device and instructor in domestic. Our training program was performed jointly with KAERI (Korea Atomic Energy Research Institute). RI-Biomics center is prepared with facilities of overall experiment to improve quality of education. Due to the fact that specialists have routine task, we organized a five-day short course to reflect temporal difficulties. We performed a trial operation to 6 participants in RI-Biomics field. Through the survey for the specialists who participated in the program, we evaluated the efficiency of our training program. The results showed that participants were satisfied with the organized curriculum and educational materials. Therefore, our program is expected to be utilized as basic research data to develop feasible program for policy development and to improve practical skills in RI-Biomics

  20. Study on the Contribution of Nuclear and RI Technology to the National Economy

    International Nuclear Information System (INIS)

    Lee, Man Ki; Moon, K. H.; Kim, S. S.

    2004-12-01

    This study evaluated the economic value addition of nuclear power generation technology and radio-isotope(RI) technology quantitatively by using modified Input-Output table. For the nuclear power generation technology, the economic effect of both power plant construction and operation was evaluated. On the other hand, the economic effect of the RI utilization on the national economy was evaluated for RI technology. Firstly, the total economic value addition from nuclear power generation(both construction and operation) was estimated as 1.4% of Gross Domestic Product(GDP) in 2000. Among them, 1.2% was from nuclear power plant operation and the rest was from construction. On the other hand, the economic value addition from RI technology has continuously increased. Its share of GDP increased from 0.30% in 1980 to 0.58 in 2000

  1. Application of RI-counting method for posttraumatic CSF rhinorrhea

    International Nuclear Information System (INIS)

    Itoh, Takahiko; Terai, Yoshinori; Fujimoto, Shunichiro; Kawauchi, Masamitsu.

    1987-01-01

    Numerous techniques and procedures have been reported for the evaluation of CSF fistulas. Especially metrizamide CT cisternography and radioisotope (RI) cisternography have been reported to be reliable for localizing the site of CSF leakage, however, it has been difficult to diagnose the existence and the site of CSF leakages in some cases. RI-counting method, measuring RI-count of intranasal cotton pledgets after the intrathecal injection of RI ( 111 In-DTPA) is thought to be the most reliable method for detecting the presence of CSF leakage in these cases. We used six cotton pledgets which were inserted into upper, middle, and lower meatuses on both side. Because the site of pledgets with ghest RI-count has anatomical relationship to the opening of the paranasal sinus, we can surmise the leakage of dural defect and CSF leakage. RI counting method was applied to two patients in whom it was difficult to diagnose the presence of CSF leakage with other procedures. The patients were free in position for four hours after the intrathecal injection of RI, and in the prone position for 30 minutes before RI-counting of intranasal cotton pledgets. After measuring the RI-counts of six pledgets, the counts were compared with each other. The cotton pledget inserted into left middle meatus showed the highest count in both cases. From this result and finding of conventional skull tomography we speculated the site of CSF leakage to be frontal sinus or ethmoid sinus. Operation demonstrated the opening of dura into the frontal sinus in one case, and ethmoid sinus in another case. As mentioned above, RI-counting method has the advantages of detecting the existence and the site of CSF leakage. (author)

  2. N-Heterocyclic Carbene Coinage Metal Complexes of the Germanium-Rich Metalloid Clusters [Ge9R3]− and [Ge9RI2]2− with R = Si(iPr3 and RI = Si(TMS3

    Directory of Open Access Journals (Sweden)

    Felix S. Geitner

    2017-07-01

    Full Text Available We report on the synthesis of novel coinage metal NHC (N-heterocyclic carbene compounds of the germanium-rich metalloid clusters [Ge9R3]− and [Ge9RI2]2− with R = Si(iPr3 and RI = Si(TMS3. NHCDippCu{η3Ge9R3} with R = Si(iPr3 (1 represents a less bulky silyl group-substituted derivative of the known analogous compounds with R = Si(iBu3 or Si(TMS3. The coordination of the [NHCDippCu]+ moiety to the cluster unit occurs via one triangular face of the tri-capped trigonal prismatic [Ge9] cluster. Furthermore, a series of novel Zintl cluster coinage metal NHC compounds of the type (NHCM2{η3Ge9RI2} (RI = Si(TMS3 M = Cu, Ag and Au; NHC = NHCDipp or NHCMes is presented. These novel compounds represent a new class of neutral dinuclear Zintl cluster coinage metal NHC compounds, which are obtained either by the stepwise reaction of a suspension of K12Ge17 with Si(TMS3Cl and the coinage metal carbene complexes NHCMCl (M = Cu, Ag, Au, or via a homogenous reaction using the preformed bis-silylated cluster K2[Ge9(Si(TMS32] and the corresponding NHCMCl (M = Cu, Ag, Au complex. The molecular structures of NHCDippCu{η3Ge9(Si(iPr33} (1 and (NHCDippCu2{η3-Ge9(Si(TMS32} (2 were determined by single crystal X-ray diffraction methods. In 2, the coordination of the [NHCDippCu]+ moieties to the cluster unit takes place via both open triangular faces of the [Ge9] entity. Furthermore, all compounds were characterized by means of NMR spectroscopy (1H, 13C, 29Si and ESI-MS.

  3. Space and Salvation in Colette's Chéri and La Fin de Chéri

    Directory of Open Access Journals (Sweden)

    Ann Leone Philbrick

    1984-01-01

    Full Text Available Colette's critics often seem to dismiss all but her autobiographical creatures as whimsical and inarticulate. Her characters are frequently less eloquent than the spaces they create and inhabit; this observation offers an approach to Chéri and La Fin de Chéri that invites us to read them as two of Colette's most ambitious and authentic works. Here are stories of compromises with the containers of one's life and identity: streets, salons, boudoirs, and, ultimately, the body. Indeed, the self and its containers function symbiotically. Chéri makes no effort to direct this relationship, and kills himself when the world finally seems inscrutable and formless; his older mistress, Léa, responds joyfully—or with melancholic respect—to the surfaces and limits of her world. We are left with a harsher insight into Colette's vision than we are accustomed to. She suggests that survival lies not in the endless definition of one's place in the world, but in its recognition and a loving, even fearing, homage.

  4. Baseline estimate of the retained gas volume in Tank 241-C-106

    International Nuclear Information System (INIS)

    Stewart, C.W.; Chen, G.

    1998-06-01

    This report presents the results of a study of the retained gas volume in Hanford Tank 241-C-106 (C-106) using the barometric pressure effect method. This estimate is required to establish the baseline conditions for sluicing the waste from C-106 into AY-102, scheduled to begin in the fall of 1998. The barometric pressure effect model is described, and the data reduction and detrending techniques are detailed. Based on the response of the waste level to the larger barometric pressure swings that occurred between October 27, 1997, and March 4, 1998, the best estimate and conservative (99% confidence) retained gas volumes in C-106 are 24 scm (840 scf) and 50 scm (1,770 scf), respectively. This is equivalent to average void fractions of 0.025 and 0.053, respectively

  5. Baseline Plasma C-Reactive Protein Concentrations and Motor Prognosis in Parkinson Disease.

    Directory of Open Access Journals (Sweden)

    Atsushi Umemura

    Full Text Available C-reactive protein (CRP, a blood inflammatory biomarker, is associated with the development of Alzheimer disease. In animal models of Parkinson disease (PD, systemic inflammatory stimuli can promote neuroinflammation and accelerate dopaminergic neurodegeneration. However, the association between long-term systemic inflammations and neurodegeneration has not been assessed in PD patients.To investigate the longitudinal effects of baseline CRP concentrations on motor prognosis in PD.Retrospective analysis of 375 patients (mean age, 69.3 years; mean PD duration, 6.6 years. Plasma concentrations of high-sensitivity CRP were measured in the absence of infections, and the Unified Parkinson's Disease Rating Scale Part III (UPDRS-III scores were measured at five follow-up intervals (Days 1-90, 91-270, 271-450, 451-630, and 631-900.Change of UPDRS-III scores from baseline to each of the five follow-up periods.Change in UPDRS-III scores was significantly greater in PD patients with CRP concentrations ≥0.7 mg/L than in those with CRP concentrations <0.7 mg/L, as determined by a generalized estimation equation model (P = 0.021 for the entire follow-up period and by a generalized regression model (P = 0.030 for the last follow-up interval (Days 631-900. The regression coefficients of baseline CRP for the two periods were 1.41 (95% confidence interval [CI] 0.21-2.61 and 2.62 (95% CI 0.25-4.98, respectively, after adjusting for sex, age, baseline UPDRS-III score, dementia, and incremental L-dopa equivalent dose.Baseline plasma CRP levels were associated with motor deterioration and predicted motor prognosis in patients with PD. These associations were independent of sex, age, PD severity, dementia, and anti-Parkinsonian agents, suggesting that subclinical systemic inflammations could accelerate neurodegeneration in PD.

  6. Addition of ribavirin to daclatasvir plus asunaprevir for chronic hepatitis C 1b patients with baseline NS5A resistance-associated variants improved response.

    Science.gov (United States)

    Hong, Chun-Ming; Liu, Chun-Jen; Yeh, Shiou-Hwei; Chen, Pei-Jer

    2017-04-01

    Daclatasvir is a nonstructural protein 5A inhibitor with potent activity against hepatitis C virus genotypes 1-6 in vitro, and asunaprevir is a nonstructural protein 3 protease inhibitor with activity against genotypes 1, 4, 5, and 6. Despite a 90% sustained virologic response (SVR) rate, the SVR rate in patients with baseline NS5A-L31/Y93H polymorphisms decreased to around 40%. Therefore, an alternative regimen under the consideration of cost-effectiveness would be important. Whether the addition of ribavirin could improve the SVR rate among this group of patients remains unknown and hence our case series was reported. For six adult chronic hepatitis C 1b patients with a pre-existing NS5A-Y93H (>20%) polymorphism, we added ribavirin (800 mg/d) to daclatasvir/asunaprevir for 24 weeks and followed through 12-weeks post-treatment. Four of these patients received interferon/ribavirin treatment before but relapsed, while the other two were naïve cases. Two of them had liver cirrhosis and one had hepatocellular carcinoma postcurative therapy. The primary efficacy end-point was undetectable hepatitis C virus RNA (hepatitis C virus RNA level ofhepatitis C patients with NS5A-Y93H polymorphism, the addition of ribavirin to daclatasvir/asunaprevir may increase the SVR12 rate with minimal side effects, and thus deserves more comprehensive trials in resource-limited areas. Copyright © 2016. Published by Elsevier B.V.

  7. Evaluation of inventory change report (ICR) in 2008/2009 - 2012/2013 in MBA.RI-B

    International Nuclear Information System (INIS)

    Agustinus Suprijanto; Suratno; Sigit Pramana

    2013-01-01

    Evaluation has been performed for Inventory Change Report (ICR) in 2008/2009 - 2012/2013 in MBA.RI-B (MBA = Material Balance Area) (RI-B = Center for Accelerator and Material Process Technology). The evaluation performed on the inventory change report of nuclear material document. Changes in inventories occur when there is acceptance or shipment of nuclear materials outside nuclear facilities. Successive reports changes in inventory of nuclear material in 2008/2009 comprised 3 sheets ICR document numbers (153, 154 and 155), in 2009/2010 comprised 1 sheet ICR document number (159), in 2010/2011 comprised 3 sheets ICR document numbers (164, 165 and 166), and in 2012/2013 comprised 2 sheets ICR document numbers (175 and 176). From these data report changes in inventory of nuclear material can be concluded that in MBA.RI-B has been the displacement of nuclear material activities includes receipt of nuclear material from other nuclear facilities and shipments of nuclear materials out of facilities for research and development includes receipt 4 times from RI-E and 1 times from RI-A and 3 times shipment to RI-E. (author)

  8. Nooruslik kaupmeheemand kavatseb äri laiendada / Hille Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Hille, 1941-2014

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 23. märts lk. 8. Tallinnas Vana-Kalamaja tänaval paikneva Alma Äri omanik Alma Sooäär avas oma esimese poe enam kui 15 aastat tagasi Nõmmel, praegu plaanib poeomanik majapidamistarvete äri laiendamist. Kaart: Alma Äri

  9. Baseline design of an OTEC pilot plantship. Volume C. Specifications

    Energy Technology Data Exchange (ETDEWEB)

    Glosten, L. R.; Bringloe, Thomas; Soracco, Dave; Fenstermacher, Earl; Magura, Donald; Sander, Olof; Richards, Dennis; Seward, Jerry

    1979-05-01

    Volume C is part of a three-volume report that presents a baseline engineering design of an Ocean Thermal Energy Conversion (OTEC) plantship. This volume provides the specifications for the hull, cold-water pipe, ship outfitting and machinery, OTEC power system, electrical system, and folded-tube heat exchangers.

  10. Tüüri vioolakontserdi esiettekanne

    Index Scriptorium Estoniae

    2008-01-01

    24. okt. toovad Taanis Sonderborgis maailmaesiettekandele Erkki-Sven Tüüri Vioolakontserdi "Illuminatio" norra vioolamängija Lars Anders Tomter ja Lõuna- Jüütimaa Sümfooniaorkester, mida juhatab Vladimir Ziva. Evelyn Glennie ja New Jersey Sümfooniaorkester Neeme Järvi juhatusel esitavad 10. okt. USAs Newarkis ja 12. okt. New Brunswickis Tüüri 4. sümfoonia "Magma". Sellega seoses esineb Tüür loengutega oma loomingust järgmistes kõrgkoolides: New York Univerdity, Juilliard Scool of Music, Princeton University ja Montclair State University

  11. Dicty_cDB: Contig-U04424-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available _2( CU633751 |pid:none) Cupriavidus taiwanensis str. LMG19... 36 0.93 BT065311_1(...a sp. wRi, complete geno... 33 7.9 >CU633751_2( CU633751 |pid:none) Cupriavidus taiwanensis str. LMG19424 pl

  12. A heavy ion linac complex for RI beams

    International Nuclear Information System (INIS)

    Arai, Shigeaki

    1995-01-01

    A heavy ion linac complex for RI-beams has been under construction since fiscal year 1992 at INS. The linac complex comprises following accelerating structures: a 25.5-MHz split coaxial RFQ (SCRFQ), a 51-MHz interdigital-H (IH) linac, and a 25.5-MHz rebuncher cavity. The SCRFQ with modulated vanes accelerates ions with a charge-to-mass ratio (q/A) greater than 1/30 from 2 to 170 keV/u. The IH linac comprises four cavities and three magnetic quadrupole triplets placed between cavities, accelerates ions with q/A≥1/10, and varies the output energy continuously in the range 0.17 ∼1.05 MeV/u. The rebuncher cavity with six accelerating gaps is a double coaxial λ/4 resonator, and the total accelerating voltage is 200 kV. (author)

  13. RI beam factory project at RIKEN

    CERN Document Server

    Motobayashi, T

    2003-01-01

    Construction of the RI beam factory project in the first phase has started. The aim of the project is to provide intense radio-isotopes (RI) beams at energies of several hundred MeV/nucleon in a wide range of atomic masses. These beams will be produced by the projectile fragmentation of primary beams accelerated by a cascade of the existing ring cyclotron and a series of new ring cyclotrons. Improvements of the existing facility made for the new cyclotron complex have extended the energy range of available beams, which already opened new domains of study.

  14. Eco RI RFLP in the human IGF II gene

    Energy Technology Data Exchange (ETDEWEB)

    Cocozza, S; Garofalo, S; Robledo, R; Monticelli, A; Conti, A; Chiarotti, L; Frunzio, R; Bruni, C B; Varrone, S

    1988-03-25

    The probe was a 500 bp cDNA containing exons 2-3 and 4 of the human IGF II gene. The clone was isolated by screening a human liver cDNA library with synthetic oligonucleotides. Eco RI digestion of genomic DNA and hybridization with the IGF II probe detects a two allele polymorphism with allelic fragments of 13.5 kb and 10.5 kb. The frequency was studied 38 unrelated Caucasians: Human IGF II gene was localized on the short arm of chromosome 11 (p15) by in situ hybridization. Codominant segregation was observed in 2 Caucasian families (10 individuals).

  15. Hanford Site technical baseline database. Revision 1

    International Nuclear Information System (INIS)

    Porter, P.E.

    1995-01-01

    This report lists the Hanford specific files (Table 1) that make up the Hanford Site Technical Baseline Database. Table 2 includes the delta files that delineate the differences between this revision and revision 0 of the Hanford Site Technical Baseline Database. This information is being managed and maintained on the Hanford RDD-100 System, which uses the capabilities of RDD-100, a systems engineering software system of Ascent Logic Corporation (ALC). This revision of the Hanford Site Technical Baseline Database uses RDD-100 version 3.0.2.2 (see Table 3). Directories reflect those controlled by the Hanford RDD-100 System Administrator. Table 4 provides information regarding the platform. A cassette tape containing the Hanford Site Technical Baseline Database is available

  16. RCRA Facility Investigation/Remedial Investigation Report with Baseline Risk Assessment for the Fire Department Hose Training Facility (904-113G)

    Energy Technology Data Exchange (ETDEWEB)

    Palmer, E. [Westinghouse Savannah River Company, AIKEN, SC (United States)

    1997-04-01

    This report documents the Resource Conservation and Recovery Act (RCRA) Facility Investigation/Remedial Investigation/Baseline Risk Assessment (RFI/RI/BRA) for the Fire Department Hose Training Facility (FDTF) (904-113G).

  17. ri Talveti luulepiiriületamised / Jüri Talvet ; intervjueerinud Rein Veidemann

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    2010-01-01

    IX Moncayo luulefestivalist Aragoonias 10. aug. 2010 ja Jüri Talveti luule tõlgetest: Del sueno, de la nieve / tõlkinud Albert Lázaro Tinaut (Olifante, 2010) ; Of Snow, of Soul / tõlkinud H. L. Hix (Guernica, 2010)

  18. HBA1C CONTROL AND COST-EFFECTIVENESS IN PATIENTS WITH TYPE 2 DIABETES MELLITUS INITIATED ON CANAGLIFLOZIN OR A GLUCAGON-LIKE PEPTIDE 1 RECEPTOR AGONIST IN A REAL-WORLD SETTING.

    Science.gov (United States)

    Wysham, Carol H; Pilon, Dominic; Ingham, Mike; Lafeuille, Marie-Hélène; Emond, Bruno; Kamstra, Rhiannon; Pfeifer, Michael; Lefebvre, Patrick

    2018-03-01

    To compare glycated hemoglobin (HbA1c) control and medication costs between patients with type 2 diabetes mellitus (T2DM) treated with canagliflozin 300 mg (CANA) or a glucagon-like peptide 1 receptor agonist (GLP-1 RA) in a real-world setting. Adults with T2DM newly initiated on CANA or a GLP-1 RA (index date) were identified from IQVIA ™ Real-World Data Electronic Medical Records U.S. database (March 29, 2012-April 30, 2016). Inverse probability of treatment weighting accounted for differences in baseline characteristics. HbA1c levels at 3-month intervals were compared using generalized estimating equations. Medication costs used wholesale acquisition costs. For both cohorts (CANA: n = 11,435; GLP-1 RA: n = 11,582), HbA1c levels decreased at 3 months postindex and remained lower through 30 months. Absolute changes in mean HbA1c from index to 3 months postindex for CANA and GLP-1 RA were -1.16% and -1.21% (patients with baseline HbA1c ≥7% [53 mmol/mol]); -1.54% and -1.51% (patients with baseline HbA1c ≥8% [64 mmol/mol]); and -2.13% and -1.99% (patients with baseline HbA1c ≥9% [75 mmol/mol]), respectively. Postindex, CANA patients with baseline HbA1c ≥7% had similar HbA1c levels at each interval versus GLP-1 RA patients, except 9 months (mean HbA1c, 7.75% [61 mmol/mol] vs. 7.86% [62 mmol/mol]; P = .0305). CANA patients with baseline HbA1c ≥8% and ≥9% had consistently lower HbA1c numerically versus GLP-1 RA patients and statistically lower HbA1c at 9 (baseline HbA1c ≥8% or ≥9%), 27, and 30 months (baseline HbA1c ≥9%). Continuous 12-month medication cost $3,326 less for CANA versus GLP-1 RA. This retrospective study demonstrated a similar evolution of HbA1c levels among CANA and GLP-1 RA patients in a real-world setting. Lower medication costs suggest CANA is economically dominant over GLP-1 RA (similar effectiveness, lower cost). AHA = antihyperglycemic agent BMI = body mass index CANA = canagliflozin 300 mg DCSI = diabetes complications severity

  19. AHP 10: "I, Ya ri a bsod, Am a Dog": The Life and Music of a Tibetan Mendicant Singer

    Directory of Open Access Journals (Sweden)

    Skal dbang skyid སྐལ་དབང་སྐྱིད།

    2011-06-01

    Full Text Available The life and music of Ya ri A bsod, a Tibetan composer and singer who lived in the early twentieth century, is described. Ya ri A bsod wandered through Tibetan nomad areas where contemporary Qinghai, Gansu, and Sichuan provinces meet in China. Texts and transcribed melodies of Ya ri A bsod songs are presented. These songs are contextualized in terms of their contemporary transmission, and the historical and autobiographical circumstances of their composition.

  20. Changes in HbA1c and Weight Following Transition to Continuous Subcutaneous Insulin Infusion Therapy in Adults With Type 1 Diabetes.

    Science.gov (United States)

    Mehta, Sanjeev N; Andersen, Henrik Ullits; Abrahamson, Martin J; Wolpert, Howard A; Hommel, Eva E; McMullen, William; Ridderstråle, Martin

    2017-01-01

    Historically, intensive insulin therapy for type 1 diabetes (T1D) has improved glycemic control at the risk of adverse weight gain. The impact of continuous subcutaneous insulin infusion therapy (CSII) on weight in the current era remains unknown. We assessed changes in hemoglobin A1c (HbA1c) and weight in adults with T1D transitioning to CSII at 2 diabetes centers in Denmark and the United States. Patients with T1D, aged ≥18 years, managed with multiple daily injections (MDI) who transitioned to CSII between 2002 and 2013 were identified using electronic health record data from the Steno Diabetes Center (n = 600) and Joslin Diabetes Center (n = 658). Changes in HbA1c and weight after 1 year was assessed overall and by baseline HbA1c cut points. Multivariate regression assessed correlates of HbA1c reduction. In adults with T1D transitioning to CSII, clinically significant HbA1c reductions were found in patients with baseline HbA1c 8.0-8.9% (Steno, -0.7%; Joslin, -0.4%) and baseline HbA1c ≥9.0% (Steno, -1.1%; Joslin, -0.9%) ( P HbA1c ≥9% at Steno (1.1 ± 0.3 kg, P HbA1c reduction was associated with higher HbA1c, older age, female sex at Steno ( R 2 = .28, P HbA1c at Joslin ( R 2 = .19, P HbA1c without a negative impact on weight 1 year after transitioning from MDI to CSII.

  1. The RiSE climbing robot: body and leg design

    Science.gov (United States)

    Saunders, A.; Goldman, D. I.; Full, R. J.; Buehler, M.

    2006-05-01

    The RiSE robot is a biologically inspired, six legged climbing robot, designed for general mobility in scansorial (vertical walls, horizontal ledges, ground level) environments. It exhibits ground reaction forces that are similar to animal climbers and does not rely on suction, magnets or other surface-dependent specializations to achieve adhesion and shear force. We describe RiSE's body and leg design as well as its electromechanical, communications and computational infrastructure. We review design iterations that enable RiSE to climb 90° carpeted, cork covered and (a growing range of) stucco surfaces in the quasi-static regime.

  2. Influencing Pathways to Quality of Life and HbA1c in Patients With Diabetes: A Longitudinal Study That Inform Evidence-Based Practice.

    Science.gov (United States)

    Hsu, Hui-Chun; Lee, Yau-Jiunn; Wang, Ruey-Hsia

    2018-04-01

    Determining possible associated factors and the influencing pathways to hemoglobin A1C (HbA1C) levels and quality of life (QoL) will facilitate the development of effective interventions to improve the physical and psychosocial health of patients with type 2 diabetes mellitus (T2DM). To test a hypothesized model that addressed the pathways among personal characteristics, social support, diabetes distress, and self-care behaviors to HbA1C and QoL. A total of 382 adults with T2DM were recruited. Self-reported questionnaires and medical records were used to collect data regarding personal characteristics, diabetes distress, and social support at baseline. The self-care behaviors characters were collected 6 months later, as well as QoL and HbA1C levels 1 year later. The 12-month QoL directly affected 12-month HbA1C levels. The 6-month self-care behaviors directly affected 12-month QoL, and indirectly affected 12-month HbA1C levels through 12-month QoL. Baseline diabetes distress directly affected 12-month QoL. Moreover, baseline diabetes distress indirectly affected 12-month HbA1C levels through 12-month QoL. Baseline social support directly affected baseline diabetes distress and 6-month self-care behaviors. In addition, baseline social support indirectly affected 12-month QoL through baseline diabetes distress. Baseline social support also indirectly affected 12-month QoL through 6-month self-care behaviors. Enhancing QoL is important to improve HbA1C levels. Enhancing self-care behaviors is essential to improve subsequent HbA1C control and QoL. Reducing diabetes distress is crucial to improve subsequent QoL. Improving social support is suggested a favorable strategy to reduce diabetes distress and enhance subsequent self-care behaviors in patients with T2DM. © 2018 Sigma Theta Tau International.

  3. Fall in C-Peptide During First 4 Years From Diagnosis of Type 1 Diabetes: Variable Relation to Age, HbA1c, and Insulin Dose.

    Science.gov (United States)

    Hao, Wei; Gitelman, Steven; DiMeglio, Linda A; Boulware, David; Greenbaum, Carla J

    2016-10-01

    We aimed to describe the natural history of residual insulin secretion in Type 1 Diabetes TrialNet participants over 4 years from diagnosis and relate this to previously reported alternative clinical measures reflecting β-cell secretory function. Data from 407 subjects from 5 TrialNet intervention studies were analyzed. All subjects had baseline stimulated C-peptide values of ≥0.2 nmol/L from mixed-meal tolerance tests (MMTTs). During semiannual visits, C-peptide values from MMTTs, HbA1c, and insulin doses were obtained. The percentage of individuals with stimulated C-peptide of ≥0.2 nmol/L or detectable C-peptide of ≥0.017 nmol/L continued to diminish over 4 years; this was markedly influenced by age. At 4 years, only 5% maintained their baseline C-peptide secretion. The expected inverse relationships between C-peptide and HbA1c or insulin doses varied over time and with age. Combined clinical variables, such as insulin-dose adjusted HbA1c (IDAA1C) and the relationship of IDAA1C to C-peptide, also were influenced by age and time from diagnosis. Models using these clinical measures did not fully predict C-peptide responses. IDAA1C ≤9 underestimated the number of individuals with stimulated C-peptide ≥0.2 nmol/L, especially in children. Current trials of disease-modifying therapy for type 1 diabetes should continue to use C-peptide as a primary end point of β-cell secretory function. Longer duration of follow-up is likely to provide stronger evidence of the effect of disease-modifying therapy on preservation of β-cell function. © 2016 by the American Diabetes Association.

  4. Efficacy of acarbose and metformin in newly diagnosed type 2 diabetes patients stratified by HbA1c levels.

    Science.gov (United States)

    Zhang, Jin-Ping; Wang, Na; Xing, Xiao-Yan; Yang, Zhao-Jun; Wang, Xin; Yang, Wen-Ying

    2016-07-01

    The aim of the present study was to investigate whether the therapeutic efficacy of acarbose and metformin is correlated with baseline HbA1c levels in Chinese patients with newly diagnosed type 2 diabetes mellitus (T2DM). Data for 711 subjects were retrieved from the MARCH (Metformin and AcaRbose in Chinese as initial Hypoglycemic treatment) trial database and reviewed retrospectively. Patients were grouped according to baseline HbA1c levels (8%) and the results for these three groups were compared between acarbose and metformin treatments. Acarbose and metformin treatment significantly improved T2DM-associated parameters (weight, fasting plasma glucose [FPG], postprandial glucose [PPG], glucagon-like peptide-1 [GLP-1], HOMA-IR, and total cholesterol) across all HbA1c levels. Acarbose decreased PPG and HOMA-β significantly more than metformin, but only in subjects with lower baseline HbA1c (PPG in the HbA1c levels (P HbA1c groups (all P HbA1c levels, whereas metformin induced greater reductions in FPG. These results may help guide selection of initial therapy based on baseline HbA1c. © 2015 Ruijin Hospital, Shanghai Jiaotong University School of Medicine and Wiley Publishing Asia Pty Ltd.

  5. Síndrome de lisis tumoral en un paciente con cáncer de riñón tratado con sunitinib

    Directory of Open Access Journals (Sweden)

    Ezequiel Rodríguez-Reimúndes

    2011-04-01

    Full Text Available El síndrome de lisis tumoral (SLT es un trastorno metabólico que ocurre como consecuencia de una destrucción celular masiva. Se caracteriza por la presencia de hiperuricemia, hiperfosfatemia, hipocalcemia e hiperkalemia, y predispone al desarrollo de insuficiencia renal aguda. En la mayoría de los casos el SLT ocurre luego de instaurarse un tratamiento antitumoral y es más frecuente en tumores de alto grado de malignidad y alta sensibilidad a la quimioterapia. Presentamos el caso de un paciente con diagnóstico de cáncer de riñón recidivado que presenta un SLT e insuficiencia renal aguda luego de iniciar tratamiento con sunitinib.

  6. Kas e-äri võrdub pankrotiga / Priit Vaikmaa

    Index Scriptorium Estoniae

    Vaikmaa, Priit

    2001-01-01

    E-äride pankrotilaine aastal 2000. Firmadevaheline äri internetis - B2B (business-to-business). B2B ärikeskkondade kodulehekülgede aadressid. B2B ja e-äri lahenduste pakkujad Eestis. Diagramm: B2B e-kommertsi prognoositud käive 2004.a.

  7. The role of baseline impedance as a marker of mucosal integrity in children with gastro esophageal reflux disease.

    Science.gov (United States)

    Pilic, Denisa; Hankel, Saskia; Koerner-Rettberg, Cordula; Hamelmann, Eckard; Schmidt-Choudhury, Anjona

    2013-07-01

    Diagnosis of gastro esophageal reflux disease (GERD) in children is challenging. 24-h-pH-multichannel-intraluminal-impedance measurement (pH-MII) is the best diagnostic tool to display gastro esophageal reflux whereas esophageal endoscopy indicates mucosal lesions. The aim of this study was to compare esophageal endoscopy results with reflux parameters such as acid exposure time (reflux index RI), bolus exposure time (bolus index BI), baseline impedance level (BIL) detected by pH-MII in children with suspected GERD. Analysis of data from 285 children (38 infants) referred to our hospital with suspected GERD. Division into three 'reflux esophagitis' (RE)-stages depending on the severity of endoscopic and histological findings and comparison with reflux parameters in these stages. Further categorization into four groups based on the pH-MII-results. Children with high-grade esophagitis had a significantly lower BIL; otherwise there was no significant association between elevated reflux parameters and esophagitis. Pathological pH-MII results (RI and BI) were associated with lower BIL in the distal impedance channel. The BIL was significantly lower in infants compared to children >1 year regardless of the RI or BI. The main difference between these groups regarding reflux parameters was a longer BI and a higher number of retrograde bolus movements. Pathologic pH-MII results are not predictive for an erosive esophagitis and vice versa. Therefore, these two procedures cannot replace each other. A lower BIL is associated with esophagitis ≥ LA-grade B and may be caused by longer acid but also by longer bolus exposure and thus may be another useful parameter in GERD monitoring.

  8. FcepsilonRI-alpha siRNA inhibits the antigen-induced activation of mast cells.

    Science.gov (United States)

    Safaralizadeh, Reza; Soheili, Zahra-Soheila; Deezagi, Abdolkhaleg; Pourpak, Zahra; Samiei, Shahram; Moin, Mostafa

    2009-12-01

    FcepsilonRI, The high affinity receptor for IgE plays a critical role in triggering the allergic reactions. It is responsible for inducing mast cell degranulation and deliberation of allergy mediators when it is aggregated by allergen and IgE complexes. FcepsilonRI on the mast cells consists of three subunits; alpha chain directly binds IgE, beta chain and dimmer of gamma chains together mediate intracellular signaling. Cross-linking of IgE-bound FcepsilonRI on the surface of mast cells and basophils by the multivalent antigen induces release of chemical mediators. The present in vitro study was designed to investigate the effect of synthetic FcepsilonRI-alpha siRNA on the antigen-induced activation of MC/9 cells. MC/9 cells which are murine mast cells were transfected by FcepsilonRI-alpha siRNA and negative control siRNA. After 6 h, anti-DNP (Dinitrophenyl) IgE was used for the cells sensitization. Then the cells were challenged with Dinitrophenyl-Human Serum Albumin (DNP-HSA) for mast cell degranulation induction before collection of supernatants. The amount of mRNA and protein expression was measured by Real Time PCR and western blot analysis, respectively. Determination of the expression rate of FcepsilonRI-alpha on cell surface was achieved by flow cytometry. ELISA and spectrophotometry methods were used subsequently for measuring the effects of FcepsilonRI-alpha siRNA on antigen-induced histamine and beta-hexosaminidase release. FcepsilonRI-alpha siRNA treated cells showed significant decrease in FcepsilonRI-alpha mRNA and protein expression in comparison to control cells. FcepsilonRI-mediated mast cell release of beta-hexosaminidase and histamine were also inhibited. In this study it was shown that FcepsilonRI-alpha siRNA could suppress FcepsilonRI-alpha expression and inhibited degranulation and histamine release in antigen-stimulated MC/9 cells. In conclusion, knock-down of FcepsilonRI-alpha by siRNA could be a promising method for inhibition of the mast

  9. Loss of dysbindin-1, a risk gene for schizophrenia, leads to impaired group 1 metabotropic glutamate receptor function in mice.

    Directory of Open Access Journals (Sweden)

    Sanjeev K Bhardwaj

    2015-03-01

    Full Text Available The expression of dysbindin-1, a protein coded by the risk gene dtnbp1, is reduced in the brains of schizophrenia patients. Evidence indicates a role of dysbindin-1 in dopaminergic and glutamatergic transmission. Glutamatergic transmission and plasticity at excitatory synapses is critically regulated by G-protein coupled metabotropic glutamate receptor (mGluR family members, that have been implicated in schizophrenia. Here, we report a role of dysbindin-1 in hippocampal group 1 mGluR (mGluRI function in mice. In hippocampal synaptoneurosomal preparations from sandy (sdy mice, that have a loss of function mutation in dysbindin-1 gene, we observed a striking reduction in mGluRI agonist [(S-3,5-dihydroxyphenylglycine] (DHPG-induced phosphorylation of extracellular signal regulated kinase 1/2 (ERK1/2. This mGluR-ERK1/2 deficit occurred in the absence of significant changes in protein levels of the two members of the mGluRI family (i.e., mGluR1 and mGluR5 or in another mGluRI signaling pathway, i.e., protein kinase C (PKC. Aberrant mGluRI-ERK1/2 signaling affected hippocampal synaptic plasticity in the sdy mutants as DHPG-induced long-term depression (LTD at CA1 excitatory synapses was significantly reduced. Behavioral data suggest that the mGluRI hypofunction may underlie some of the cognitive abnormalities described in sdy mice as the administration of CDPPB (3-cyano-N-(1,3-diphenyl-1H-pyrazol-5-yl benzamide, a positive allosteric modulator of mGluR5, rescued short-term object recognition and spatial learning and memory deficits in these mice. Taken together, our data suggest a novel role of dysbindin-1 in regulating mGluRI functions.

  10. Patient factors associated with hemoglobin A1C change with pioglitazone as adjunctive therapy in type 2 Diabetes Mellitus

    Directory of Open Access Journals (Sweden)

    Tran MT

    2008-06-01

    Full Text Available Objective: To identify patient factors associated with change in hemoglobin A1C (A1C with adjunct pioglitazone therapy in routine clinical practice. Methods: This was a retrospective analysis of adult type 2 diabetes mellitus patients in a health maintenance organization setting who were newly-initiated on pioglitazone between January 2002 and December 2005. Eligible patients were receiving at least one other oral antihyperglycemic medication prior to initiating pioglitazone and maintained a stable dose of pioglitazone for 90 days. Data on eligible patients’ characteristics, pharmacy purchases, comorbidities, and A1C measurement 90 days prior to the pioglitazone purchase date (baseline and 90 days after achieving a stable dose (follow-up were obtained from electronic records. Multivariate regression modeling was used to assess factors independently associated with: 1 absolute change in A1C, 2 achieving a1 percentage point decrease in A1C, and 3 achieving an A1C8%. At follow-up, the mean A1C change was -1.2 percentage points (interquartile range= -0.4, -2.1, 59% achieved a1 unit decrease in A1C, and 44% achieved an A1C<7%. Independent predictors in all models were baseline A1C and time (in days between baseline and follow-up A1C measurements (p<0.05. Conclusions: Adjunct pioglitazone therapy in routine clinical practice was associated with clinically meaningful reductions in A1C levels. Patients with higher baseline A1C achieved the greatest absolute reduction in A1C but were less likely to achieve levels <7%.

  11. C-018H Pre-Operational Baseline Sampling Plan

    International Nuclear Information System (INIS)

    Guzek, S.J.

    1993-01-01

    The objective of this task is to field characterize and sample the soil at selected locations along the proposed effluent line routes for Project C-018H. The overall purpose of this effort is to meet the proposed plan to discontinue the disposal of contaminated liquids into the Hanford soil column as described by DOE (1987). Detailed information describing proposed transport pipeline route and associated Kaiser Engineers Hanford Company (KEH) preliminary drawings (H288746...755) all inclusive, have been prepared by KEH (1992). The information developed from field monitoring and sampling will be utilized to characterize surface and subsurface soil along the proposed C-018H effluent pipeline and it's associated facilities. Potentially existing contaminant levels may be encountered therefore, soil characterization will provide a construction preoperational baseline reference, develop personnel safety requirements, and determine the need for any changes in the proposed routes prior to construction of the pipeline

  12. Baseline High-Sensitivity C-Reactive Protein Predicts Macrovascular and Microvascular Complications of Type 2 Diabetes: A Population-Based Study.

    Science.gov (United States)

    Aryan, Zahra; Ghajar, Alireza; Faghihi-Kashani, Sara; Afarideh, Mohsen; Nakhjavani, Manouchehr; Esteghamati, Alireza

    2018-04-25

    This prospective study is aimed at examining the predictive value of high-sensitivity C-reactive protein (hs-CRP) for coronary heart disease (CHD) events and microvascular complications of type 2 diabetes mellitus (T2DM). A population-based study (NCT02958579) was conducted on 1,301 participants with T2DM (mean follow-up of 7.5 years). Risk assessment for vascular events was done at baseline, and serum hs-CRP was measured. End points of this study include CHD events, diabetic retinopathy, neuropathy, and diabetic kidney disease. Individuals with unavailable data or hs-CRP >20 mg/L were excluded. The discrimination and reclassification improvement of study end points were tested after addition of hs-CRP to traditional risk factors. Median serum hs-CRP was 2.00 ranging from 0.1 to 17 mg/L. Hazards ratio of each SD increment in baseline hs-CRP was 1.028 (1.024-1.032) for CHD, 1.025 (1.021-1.029) for diabetic neuropathy, 1.037 (1.030-1.043) for diabetic retinopathy, and 1.035 (1.027-1.043) for diabetic kidney disease. The addition of hs-CRP to traditional risk factors of vascular complications of T2DM improved discrimination of all end points (p < 0.001). Net reclassification improvement ranged from 8% for diabetic neuropathy to 31% for diabetic kidney disease (p < 0.05). Baseline hs-CRP predicts both of CHD events and microvascular complications of patients with T2D. © 2018 S. Karger AG, Basel.

  13. Baseline prediction of combination therapy outcome in hepatitis C virus 1b infected patients by discriminant analysis using viral and host factors.

    Science.gov (United States)

    Saludes, Verónica; Bracho, Maria Alma; Valero, Oliver; Ardèvol, Mercè; Planas, Ramón; González-Candelas, Fernando; Ausina, Vicente; Martró, Elisa

    2010-11-30

    Current treatment of chronic hepatitis C virus (HCV) infection has limited efficacy -especially among genotype 1 infected patients-, is costly, and involves severe side effects. Thus, predicting non-response is of major interest for both patient wellbeing and health care expense. At present, treatment cannot be individualized on the basis of any baseline predictor of response. We aimed to identify pre-treatment clinical and virological parameters associated with treatment failure, as well as to assess whether therapy outcome could be predicted at baseline. Forty-three HCV subtype 1b (HCV-1b) chronically infected patients treated with pegylated-interferon alpha plus ribavirin were retrospectively studied (21 responders and 22 non-responders). Host (gender, age, weight, transaminase levels, fibrosis stage, and source of infection) and viral-related factors (viral load, and genetic variability in the E1-E2 and Core regions) were assessed. Logistic regression and discriminant analyses were used to develop predictive models. A "leave-one-out" cross-validation method was used to assess the reliability of the discriminant models. Lower alanine transaminase levels (ALT, p=0.009), a higher number of quasispecies variants in the E1-E2 region (number of haplotypes, nHap_E1-E2) (p=0.003), and the absence of both amino acid arginine at position 70 and leucine at position 91 in the Core region (p=0.039) were significantly associated with treatment failure. Therapy outcome was most accurately predicted by discriminant analysis (90.5% sensitivity and 95.5% specificity, 85.7% sensitivity and 81.8% specificity after cross-validation); the most significant variables included in the predictive model were the Core amino acid pattern, the nHap_E1-E2, and gamma-glutamyl transferase and ALT levels. Discriminant analysis has been shown as a useful tool to predict treatment outcome using baseline HCV genetic variability and host characteristics. The discriminant models obtained in this

  14. Transcription of Russian intonation ToRI, an interactive research tool and learning module on the internet

    NARCIS (Netherlands)

    Odé, C.

    2008-01-01

    This article discusses a new system for the Transcription of Russian Intonation, ToRI, on the Internet. Section 1 presents a general outline of the system. The terminology used in ToRI is defined in an online glossary, from which Section 2 gives the following examples: pitch accent and

  15. Lamivudine monotherapy-based cART is efficacious for HBV treatment in HIV/HBV co-infection when baseline HBV DNA<20,000IU/ml

    Science.gov (United States)

    LI, Yijia; XIE, Jing; HAN, Yang; WANG, Huanling; ZHU, Ting; WANG, Nidan; LV, Wei; GUO, Fuping; QIU, Zhifeng; LI, Yanling; DU, Shanshan; SONG, Xiaojing; THIO, Chloe L; LI, Taisheng

    2016-01-01

    Background Although combination antiretroviral therapy (cART) including tenofovir (TDF)+lamivudine (3TC) or emtricitabine (FTC) is recommended for treatment of HIV/HBV co-infected patients, TDF is unavailable in some resource-limited areas. Some data suggest that 3TC monotherapy-based cART may be effective in patients with low pre-treatment HBV DNA. Methods Prospective study of 151 Chinese HIV/HBV co-infected subjects of whom 60 received 3TC-based cART and 91 received TDF+3TC-based cART. Factors associated with HBV DNA suppression at 24 and 48 weeks, including anti-HBV drugs, baseline HBV DNA, and baseline CD4 cell count, were evaluated overall and stratified by baseline HBV DNA using Poisson regression with a robust error variance. Results Baseline HBV DNA≥20,000 IU/ml was present in 48.3% and 44.0% of subjects in the 3TC and TDF groups, respectively (P=0.60). After 48 weeks of treatment, HBV DNA suppression rates were similar between these two groups (96.8% vs. 98.0% for 3TC and TDF+3TC, P>0.999) in subjects with baseline HBV DNAHBV DNA ≥20,000 IU/ml, TDF+3TC was associated with higher suppression rates (34.5% vs. 72.5% in 3TC and TDF+3TC groups, respectively, P=0.002). In stratified multivariate regression, TDF use (RR 1.98, P=0.010) and baseline HBV DNA (per 1 log increase in IU/ml, RR 0.74, PHBV DNA suppression only when baseline HBV DNA≥20,000IU/ml. Conclusion This study suggests that 3TC monotherapy-based cART is efficacious for HBV treatment through 48 weeks in HIV/HBV co-infection when baseline HBV DNA<20,000IU/ml. Studies with long-term follow-up are warranted to determine if this finding persists. PMID:26745828

  16. Statistical dynamic imaging of RI-labeled tracer from list-mode PET data

    International Nuclear Information System (INIS)

    Tanimoto, Michiaki; Kuroda, Yoshihiro; Oshiro, Osamu; Watabe, Hiroshi; Kuroda, Tomohiro

    2009-01-01

    Positron emission tomography (PET) can be used in physiological analysis to illustrate physiological states by visualizing the accumulation of radioisotope (RI)-labeled tracer in specific organs or tissues. PET obtains spatio-temporal statistics in the form of list-mode data. However, conventional imaging techniques, which sum up list-mode data over a given time period, cannot depict detailed temporal dynamics of the RI-labeled tracer. In this study, a spatio-temporal analysis approach was employed to visualize the temporal flow dynamics of RI-labeled tracer from the obtained list-mode data. Experiments to assess the visualization of simulated RI-labeled tracer dynamics as well as RI-labeled tracer dynamics in a vascular phantom showed that the proposed method successfully depicted detailed temporal flow dynamics that could not be visualized using conventional methods. (author)

  17. Remedial Investigation/Feasibility Study (RI/FS) process, elements and techniques guidance

    Energy Technology Data Exchange (ETDEWEB)

    1993-12-01

    This manual provides detailed guidance on Remedial Investigation/Feasibility Studies (RI/FSs) conducted pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) at Department of Energy (DOE) facilities. The purpose of the RI/FS, to assess the risk posed by a hazardous waste site and to determine the best way to reduce that risk, and its structure (site characterization, risk assessment, screening and detailed analysis of alternatives, etc.) is defined in the National Oil and Hazardous Substances Pollution Contingency Plan (NCP) and further explained in the Environmental Protection Agency`s (EPA`s) Guidance for Conducting Remedial Investigations and Feasibility Studies Under CERCLA (Interim Final) 540/G-89/004, OSWER Directive 9355.3-01, October 1988. Though issued in 1988, the EPA guidance remains an excellent source of information on the conduct and structure of an RI/FS. This document makes use of supplemental RI/FS-related guidance that EPA has developed since its initial document was issued in 1988, incorporates practical lessons learned in more than 12 years of experience in CERCLA hazardous site remediation, and drawing on those lessons, introduces the Streamlined Approach For Environmental Restoration (SAFER), developed by DOE as a way to proceed quickly and efficiently through the RI/FS process at DOE facilities. Thus as its title implies, this guidance is intended to describe in detail the process and component elements of an RI/FS, as well as techniques to manage the RI/FS effectively.

  18. DNA Nucleotide Sequence Restricted by the RI Endonuclease

    Science.gov (United States)

    Hedgpeth, Joe; Goodman, Howard M.; Boyer, Herbert W.

    1972-01-01

    The sequence of DNA base pairs adjacent to the phosphodiester bonds cleaved by the RI restriction endonuclease in unmodified DNA from coliphage λ has been determined. The 5′-terminal nucleotide labeled with 32P and oligonucleotides up to the heptamer were analyzed from a pancreatic DNase digest. The following sequence of nucleotides adjacent to the RI break made in λ DNA was deduced from these data and from the 3′-dinucleotide sequence and nearest-neighbor analysis obtained from repair synthesis with the DNA polymerase of Rous sarcoma virus [Formula: see text] The RI endonuclease cleavage of the phosphodiester bonds (indicated by arrows) generates 5′-phosphoryls and short cohesive termini of four nucleotides, pApApTpT. The most striking feature of the sequence is its symmetry. PMID:4343974

  19. The importance of human FcgammaRI in mediating protection to malaria.

    Directory of Open Access Journals (Sweden)

    Richard S McIntosh

    2007-05-01

    Full Text Available The success of passive immunization suggests that antibody-based therapies will be effective at controlling malaria. We describe the development of fully human antibodies specific for Plasmodium falciparum by antibody repertoire cloning from phage display libraries generated from immune Gambian adults. Although these novel reagents bind with strong affinity to malaria parasites, it remains unclear if in vitro assays are predictive of functional immunity in humans, due to the lack of suitable animal models permissive for P. falciparum. A potentially useful solution described herein allows the antimalarial efficacy of human antibodies to be determined using rodent malaria parasites transgenic for P. falciparum antigens in mice also transgenic for human Fc-receptors. These human IgG1s cured animals of an otherwise lethal malaria infection, and protection was crucially dependent on human FcgammaRI. This important finding documents the capacity of FcgammaRI to mediate potent antimalaria immunity and supports the development of FcgammaRI-directed therapy for human malaria.

  20. Cardiomyopathie du péri-partum prise en charge en milieu ...

    African Journals Online (AJOL)

    Cardiomyopathie du péri-partum prise en charge en milieu Hospitalier Universitaire de Bobo-Dioulasso : aspects thérapeutiques et évolutifs. S. J-B. Tougouma, A.A. Yaméogo, A. Dembélé, G. Kinda, N.V. Yaméogo, G.R.C. Millogo, J.K. Kologo, A. Héma, Y. Kambiré, L. Savadogo, M.S. Ouédraogo, P. Zabsonré ...

  1. Imaging of the bronchial blood flow using RI-angiography

    International Nuclear Information System (INIS)

    Fujii, Tadashige; Hirayama, Jiro; Kanai, Hisakata; Kobayashi, Toshio; Handa, Kenjiro

    1979-01-01

    RI-angiography with sup(99m)TcO 4 - was carried out using a scintillation camera with a digital minicomputer for the purpose of imaging of bronchial blood flow in various lung diseases, and as application of dual radioisotope techniques, other imagings such as tumor imaging with 197 HgCl 2 or 67 Ga-citrate and/or perfusion imaging with sup(99m)Tc-MAA, were performed simultaneously in patients remaining the same position, too. The image as a iso-count map extracted out of the image of 197 HgCl 2 , 67 Ga-citrate or sup(99m)Tc-MAA, was superimposed to the brightness image of RI-angiogram (aortic phase). By these procedures, the image of bronchial blood flow were obtained in some patients with lung cancer, pulmonary tuberculosis, lung abscess, and chronic bronchitis. The dual radioisotope techniques using RI-angiography and the other imaging were useful to make isotope diagnosis of lung diseases more reliable, and the image superimposition methods using RI-angiogram and the image of tumor of perfusion, were useful to improve anatomic orientation of the former. (author)

  2. Literature as a nation's emotional memory / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1998-01-01

    Bibliograafia, lk. 134-135. Autorist lk. 387. Juri Lotmani semiosfääri tõlgendamisest: "süntagmaatilised" struktuurid ja "perifeersed" kultuurid. Ka Friedebert Tuglase "Kalevipoja"-kriitikast ning Lydia Koidula ja Juhan Liivi luuletustest

  3. Domik Petra / Jüri Kuuskemaa

    Index Scriptorium Estoniae

    Kuuskemaa, Jüri, 1942-

    2006-01-01

    Kunstiajaloolane Jüri Kuuskemaa tutvustab Peeter I majamuuseumi Kadriorus. Maja ajaloost, sisustusest (mööbel, kunstiesemed). Keldriruumis eksponeeritud Salomon Zeltrechti ja tema abiliste poolt tehtud kivibüstidest

  4. Analysis of concept and application or Risk-Informed Performed-Based Regulation (RI-PBR)

    International Nuclear Information System (INIS)

    Kim, W. S.; Sung, K. Y.; Lee, C. J.; Kim, H. J.

    2002-01-01

    For improving regulation of nuclear power plants, the USNRC is adopting the Risk-Informed Performance-Based Regulation (RI-PBR) as an alternative, in parallel with implementing current deterministic regulation. This paper introduces a research plan for 'Institutionalization of RI-PBR' that is being conducted by KINS as a national project for evaluating feasibility for application of the alternative to Korean regulation system. Analysis of regulation characteristics, case study and experience on RI-PBR were presented as interim research results. In addition, the future plan of development of RI-PBR concept as understandable to the public and evaluation of level of techniques needed for implementation of RI-PBR was introduced

  5. Information architecture. Volume 2, Part 1: Baseline analysis summary

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-01

    The Department of Energy (DOE) Information Architecture, Volume 2, Baseline Analysis, is a collaborative and logical next-step effort in the processes required to produce a Departmentwide information architecture. The baseline analysis serves a diverse audience of program management and technical personnel and provides an organized way to examine the Department`s existing or de facto information architecture. A companion document to Volume 1, The Foundations, it furnishes the rationale for establishing a Departmentwide information architecture. This volume, consisting of the Baseline Analysis Summary (part 1), Baseline Analysis (part 2), and Reference Data (part 3), is of interest to readers who wish to understand how the Department`s current information architecture technologies are employed. The analysis identifies how and where current technologies support business areas, programs, sites, and corporate systems.

  6. A Study on the Representative Sampling Survey for Radionuclide Analysis of RI Waste

    Energy Technology Data Exchange (ETDEWEB)

    Jee, K. Y. [KAERI, Daejeon (Korea, Republic of); Kim, Juyoul; Jung, Gunhyo [FNC Tech. Co., Daejeon (Korea, Republic of)

    2007-07-15

    We developed a quantitative method for attaining a representative sample during sampling survey of RI waste. Considering a source, process, and type of RI waste, the method computes the number of sample, confidence interval, variance, and coefficient of variance. We also systematize the method of sampling survey logically and quantitatively. The result of this study can be applied to sampling survey of low- and intermediate-level waste generated from nuclear power plant during the transfer process to disposal facility.

  7. RiTSE/KCGE: Application of artificial intelligence to improve plant availability

    International Nuclear Information System (INIS)

    Frank, M.V.; Epstein, S.A.

    1986-01-01

    Maintenance and other personnel related errors are a major cause of reactor trips in some U.S. plants. Software called RiTSE and KCGE, that can operate on a mini-computer work station, has been developed to dramatically reduce trips caused by clearance coordination problems. Such problems arise because of the enormous number of components that interrelate in ways that cannot always be anticipated during plant operation. Concurrent maintenance, test, surveillance and other operations activities contribute to the unanticipated interactions. RiTSE allows the appropriate plant personnel (i.e., those responsible for authorizing work during start-up and operation) to predict if their next authorizations would cause a reactor trip. With KCGE, RiTSE can warn these personnel of a condition of significantly reduced margin to trip. RiTSE also aids post-trip cause analysis by pointing out those components that could have contributed to the trip. It is believable that use of RiTSE is a quicker and more reliable way to authorize work during operation than reliance on memory and drawings. The software provides maximum benefit when used in conjunction with a configuration management program that assures accurate plant presentation and accurate updating of component status during operation. Application of RiTSE and KCGE to a client's PWR demonstrated part of their potential benefits. (Nogami, K.)

  8. Histología de branquias, hígado y riñón de juveniles del pez neotropical Colossoma macropomum (Characiformes, Characidae expuesto a tres temperaturas

    Directory of Open Access Journals (Sweden)

    Luz-Marina Rojas

    2013-06-01

    Full Text Available Colossoma macropomum es uno de los peces tropicales de agua dulce con mayor éxito en el cultivo en aguas continentales tropicales. Se realizó una evaluación histológica de branquias, hígado y riñón de este pez expuesto a tres temperaturas (T18, T29 y T35ºC. Se utilizaron 18 ejemplares juveniles con índices biométricos de 17.87±7.88cm y 87.69±34.23g. Los análisis histológicos fueron hechos de acuerdo a técnicas previamente descritas. Se encontró que las branquias, el hígado y el riñón de los peces T29 presentaron citoarquitectura normal. Por el contrario, en las branquias de los peces T18, se observaron gotas lipídicas inmersas en el tejido branquial; los peces T35 presentaron desorganización en la estructura del tejido branquial y necrosis celular. El hígado de los peces T18, mostró hepatocitos claros y oscuros y el de T35, presentó células con granulaciones citoplasmáticas y daño en la membrana plasmática. En el riñón de los T18, se observaron alteraciones en la distribución del tejido hematopoyético. La característica más resaltante en el riñón de los peces T35, fue la desorganización del tejido glomerular. En conclusión, la temperatura de 18°C se puede considerar crítica para la cachama y la de 35ºC severa. De los tres órganos evaluados, el hígado y las branquias resultaron ser los más sensibles a los daños inducidos por las temperaturas en esta especie.

  9. [Söejoonistused] / Jüri Marran

    Index Scriptorium Estoniae

    Marran, Jüri, 1937-

    2005-01-01

    ri Marran on hariduselt füüsik ja kunstihariduse omandanud Melanie ja Erich Arraku ateljeekoolis. Lk. 1391 (Gravitatsioon), 1440 (Valgus), 1471 (Vastastikmõju), 1486 (Massenergia), 1519 (Valguse dualism), 1555 (Aja dilatatsioon)

  10. ri Lina kui tegelikkusele osutav Patagoonia šamaan / Jüri Lina ; intervjueerinud Ingrid Peek

    Index Scriptorium Estoniae

    Lina, Jüri, 1949-

    2011-01-01

    2.-5. juunini Tallinnas kinos Sõprus toimuva festivali "Hallo, Kosmos!" raames 2. juunil esilinastuvast Jüri Lina filmist "Täitmatu Uroboros. Massoonide salakaval taktika", tema uuringute põhjusest. Festivali "Hallo, Kosmos!" kavast

  11. Basal insulin analogues in diabetic pregnancy: a literature review and baseline results of a randomised, controlled trial in type 1 diabetes

    DEFF Research Database (Denmark)

    Mathiesen, Elisabeth R; Damm, Peter; Jovanovic, Lois

    2011-01-01

    hagedorn insulin, both with insulin aspart, in women with type 1 diabetes planning a pregnancy (n = 306) or are already pregnant (n = 164). Inclusion criteria include type 1 diabetes > 12 months' duration; screening HbA1c ≤ 9.0% (women recruited prepregnancy), or pregnant with gestational age 8-12 weeks...... with prandial insulin aspart. The results are expected mid-2011 with full publications expected later this year. Baseline characteristics show that basal insulin analogues are already frequently used in pregnant women with type 1 diabetes. This study will hopefully elucidate the safety and efficacy of the basal...... of the current literature concerning basal insulin analogue use in diabetic pregnancy, and to present the design and preliminary, non-validated baseline characteristics of a currently ongoing randomized, controlled, open-label, multicentre, multinational trial comparing insulin detemir with neutral protamine...

  12. Basal insulin analogues in diabetic pregnancy: a literature review and baseline results of a randomised, controlled trial in type 1 diabetes

    DEFF Research Database (Denmark)

    Mathiesen, Elisabeth R; Damm, Peter; Jovanovic, Lois

    2011-01-01

    hagedorn insulin, both with insulin aspart, in women with type 1 diabetes planning a pregnancy (n = 306) or are already pregnant (n = 164). Inclusion criteria include type 1 diabetes > 12 months' duration; screening HbA1c = 9.0% (women recruited prepregnancy), or pregnant with gestational age 8-12 weeks...... with prandial insulin aspart. The results are expected mid-2011 with full publications expected later this year. Baseline characteristics show that basal insulin analogues are already frequently used in pregnant women with type 1 diabetes. This study will hopefully elucidate the safety and efficacy of the basal...... of the current literature concerning basal insulin analogue use in diabetic pregnancy, and to present the design and preliminary, non-validated baseline characteristics of a currently ongoing randomized, controlled, open-label, multicentre, multinational trial comparing insulin detemir with neutral protamine...

  13. Tanshinone IIA suppresses FcεRI-mediated mast cell signaling and anaphylaxis by activation of the Sirt1/LKB1/AMPK pathway.

    Science.gov (United States)

    Li, Xian; Park, Soon Jin; Jin, Fansi; Deng, Yifeng; Yang, Ju Hye; Chang, Jae-Hoon; Kim, Dong-Young; Kim, Jung-Ae; Lee, Youn Ju; Murakami, Makoto; Son, Kun Ho; Chang, Hyeun Wook

    2018-06-01

    AMP-activated protein kinase (AMPK) and its upstream mediators liver kinase B1 (LKB1) and sirtuin 1 (Sirt1) are generally known as key regulators of metabolism. We have recently reported that the AMPK pathway negatively regulates mast cell activation and anaphylaxis. Tanshinone IIA (Tan IIA), an active component of Salvia miltiorrhiza extract that is currently used for the treatment of cardiovascular and cerebrovascular diseases, shows anti-diabetic activity and improves insulin resistance in db/db mice through activation of AMPK. The aim of this study was to evaluate the anti-allergic activity of Tan IIA in vivo and to investigate the underlying mechanism in vitro in the context of AMPK signaling. The anti-allergic effect of Tan IIA was evaluated using mouse bone marrow-derived mast cells (BMMCs) from AMPKα2 -/- or Sirt1 -/- mice, or BMMCs transfected with siRNAs specific for AMPKα2, LKB1, or Sirt1. AMPKα2 -/- and Sirt1 -/- mice were used to confirm the anti-allergic effect of Tan IIA in anaphylaxis in vivo. Tan IIA dose-dependently inhibited FcεRI-mediated degranulation and production of eicosanoids and cytokines in BMMCs. These inhibitory effects were diminished by siRNA-mediated knockdown or genetic deletion of AMPKα2 or Sirt1. Moreover, Tan IIA inhibited a mast cell-mediated local passive anaphylactic reaction in wild-type mice, but not in AMPKα2 -/- or Sirt1 -/- mice. In conclusion, Tan IIA suppresses FcεRI-mediated mast cell activation and anaphylaxis through activation of the inhibitory Sirt1-LKB1-AMPK pathway. Thus, Tan IIA may be useful as a new therapeutic agent for mast cell-mediated allergic diseases. Copyright © 2018 Elsevier Inc. All rights reserved.

  14. Florentine Renaissance Resources. Online Tratte of Office Holders 1282-1532, Ed. by D. Herlihy, R. Burr Litchfield, A. Molho, R. Barducci, 2000. Online Catasto of 1427, Ed. by D. Herlihy, C. Klapisch-Zuber, Vers. 1.2., Brown University, Providence, R.I.

    Directory of Open Access Journals (Sweden)

    Marco Bicchierai

    2002-12-01

    Full Text Available Florentine Renaissance Resources. - Online Tratte of Office Holders 1282-1532, Edited by David Herlihy, R. Burr Litchfield, Anthony Molho and Roberto Barducci , 2000 - Online Catasto of 1427, Edited by David Herlihy, Christiane Klapisch-Zuber, Version 1.2., Brown University, Providence, R.I. , 1996

  15. Meie ühine mure on tervishoid / Jüri Ratas

    Index Scriptorium Estoniae

    Ratas, Jüri, 1978-

    2008-01-01

    Ilmunud ka: Den za Dnjom 1. veebr. lk. 18. Põhjarannik 18. jaan. 2008, lk. 2, Severnoje Poberezhje 18. jaan. 2008, lk. 2, Den za Dnjom 18. jaan. 2008, lk. 2. Riigikogu aseesimees Jüri Ratas tunneb muret Eesti elanike tervise pärast

  16. Change in Sedentary Time, Physical Activity, Bodyweight, and HbA1c in High-Risk Adults.

    Science.gov (United States)

    McCarthy, Matthew; Edwardson, Charlotte L; Davies, Melanie J; Henson, Joseph; Gray, Laura; Khunti, Kamlesh; Yates, Thomas

    2017-06-01

    In recent years, there has been a migration toward the use of glycated hemoglobin (HbA1c) in determining glycemic control. This study aimed to quantify the associations between changes in body weight, sedentary time, and moderate to vigorous physical activity (MVPA) time with HbA1c levels for a 3-yr period among adults at high risk of type 2 diabetes. This study reports baseline and 3-yr follow-up data from the Walking Away from Type 2 Diabetes study. ActiGraph GT3X accelerometers captured sedentary time and MVPA. Linear regression examined the independent associations of changes in sedentary time, MVPA, and body weight with HbA1c between baseline and 3-yr follow-up. The sample composed of 489 participants (mean age = 64.2 ± 7.3 yr, body mass index = 31.7 ± 5.1, 63.4% male) with valid baseline and follow-up accelerometer, body weight, and HbA1c data. After adjustment for known confounders, an increase in MVPA time (per 30 min·d) was associated with a decrease in HbA1c percentage (β = -0.11 [-0.18 to -0.05], P = 0.001), and an increase in body weight (per 6 kg) was associated with an increase in HbA1c percentage (β = 0.08 [0.04-0.12], P HbA1c ≥ 6.0%) strengthened these associations (P HbA1c after adjustment for change in MVPA time. Increases in MVPA and body weight were associated with a reduction and increase in HbA1c, respectively, particularly in those with dysglycemia. Quantifying the effect that health behavior changes have on HbA1c can be used to inform prevention programs.

  17. Äriühingute vastastikune tunnustamine ja asukohavahetus Euroopa Liidus / Andres Vutt

    Index Scriptorium Estoniae

    Vutt, Andres, 1969-

    2007-01-01

    Äriühingute vastastikuse tunnustamise põhimõtetest ja võimalustest, kuidas saab Euroopa Liidus muuta äriühingu asukohta ühest riigist teise ning mida tuleb Eestil seoses sellega arvestada. Äriühingute asukohavahetusest Euroopa Kohtu lahendites. Artikkel on valminud ETF-i grandi 6747 abil

  18. Baseline Risk Assessment Supporting Closure at Waste Management Area C at the Hanford Site Washington

    International Nuclear Information System (INIS)

    Singleton, Kristin M.

    2015-01-01

    The Office of River Protection under the U.S. Department of Energy is pursuing closure of the Single-Shell Tank (SST) Waste Management Area (WMA) C under the requirements of the Hanford Federal Facility Agreement and Consent Order (HFFACO). A baseline risk assessment (BRA) of current conditions is based on available characterization data and information collected at WMA C. The baseline risk assessment is being developed as a part of a Resource Conservation and Recovery Act (RCRA) Facility Investigation (RFI)/Corrective Measures Study (CMS) at WMA C that is mandatory under Comprehensive Environmental Response, Compensation, and Liability Act and RCRA corrective action. The RFI/CMS is needed to identify and evaluate the hazardous chemical and radiological contamination in the vadose zone from past releases of waste from WMA C. WMA C will be under Federal ownership and control for the foreseeable future, and managed as an industrial area with restricted access and various institutional controls. The exposure scenarios evaluated under these conditions include Model Toxics Control Act (MTCA) Method C, industrial worker, maintenance and surveillance worker, construction worker, and trespasser scenarios. The BRA evaluates several unrestricted land use scenarios (residential all-pathway, MTCA Method B, and Tribal) to provide additional information for risk management. Analytical results from 13 shallow zone (0 to 15 ft. below ground surface) sampling locations were collected to evaluate human health impacts at WMA C. In addition, soil analytical data were screened against background concentrations and ecological soil screening levels to determine if soil concentrations have the potential to adversely affect ecological receptors. Analytical data from 12 groundwater monitoring wells were evaluated between 2004 and 2013. A screening of groundwater monitoring data against background concentrations and Federal maximum concentration levels was used to determine vadose zone

  19. Baseline Risk Assessment Supporting Closure at Waste Management Area C at the Hanford Site Washington

    Energy Technology Data Exchange (ETDEWEB)

    Singleton, Kristin M. [Washington River Protection Solutions LLC, Richland, WA (United States)

    2015-01-07

    The Office of River Protection under the U.S. Department of Energy is pursuing closure of the Single-Shell Tank (SST) Waste Management Area (WMA) C under the requirements of the Hanford Federal Facility Agreement and Consent Order (HFFACO). A baseline risk assessment (BRA) of current conditions is based on available characterization data and information collected at WMA C. The baseline risk assessment is being developed as a part of a Resource Conservation and Recovery Act (RCRA) Facility Investigation (RFI)/Corrective Measures Study (CMS) at WMA C that is mandatory under Comprehensive Environmental Response, Compensation, and Liability Act and RCRA corrective action. The RFI/CMS is needed to identify and evaluate the hazardous chemical and radiological contamination in the vadose zone from past releases of waste from WMA C. WMA C will be under Federal ownership and control for the foreseeable future, and managed as an industrial area with restricted access and various institutional controls. The exposure scenarios evaluated under these conditions include Model Toxics Control Act (MTCA) Method C, industrial worker, maintenance and surveillance worker, construction worker, and trespasser scenarios. The BRA evaluates several unrestricted land use scenarios (residential all-pathway, MTCA Method B, and Tribal) to provide additional information for risk management. Analytical results from 13 shallow zone (0 to 15 ft. below ground surface) sampling locations were collected to evaluate human health impacts at WMA C. In addition, soil analytical data were screened against background concentrations and ecological soil screening levels to determine if soil concentrations have the potential to adversely affect ecological receptors. Analytical data from 12 groundwater monitoring wells were evaluated between 2004 and 2013. A screening of groundwater monitoring data against background concentrations and Federal maximum concentration levels was used to determine vadose zone

  20. Analytical Characterization of the Hydrolysis of Barley Malt Macromolecules During Enzymatic Degradation Over Time Using AF4/MALS/RI.

    Science.gov (United States)

    Rübsam, Heinrich; Becker, Thomas; Gastl, Martina

    2017-06-01

    The changes on the molecular weight distribution (MWD) and particle size distribution (PSD) during hydrolysis of barley malt in isothermal mashing procedures were determined using asymmetrical flow field flow fractionation coupled to multiangle laser light scattering and refractive index (AF4/MALS/RI). Mash/trials were focused on amylolytic starch degradation. Therefore, temperatures (65, 70, and 75 °C) were selected according to α- and β-amylases range of activity. Samples were produced by triplicate, tracking amylolytic processes over time periods from 10 to 90 min in each mash/trial. AF4/MALS/RI analysis demonstrated significant differences on the values of the MWD and PSD according to the temperature/time profile used. At mashing times over 30 min at a temperature of 65 °C, when α- and β-amylase are both active, the decrease over time of the MWD and PSD was significantly higher (P < 0.005) than at 70 °C when mainly α-amylase is active. At 75 °C, also the activity of α-amylase decreased and the MWD and PSD were significantly lower (P < 0.005) than at 70 or 65 °C at any time of the procedure. The MWD and PSD of beer components influence beer palate fullness, thus AF4/ MALS/RI would be a powerful tool for breweries to adapt their technological processes to obtain beers with particular sensorial attributes. © 2017 Institute of Food Technologists®.

  1. HbA1c Outcomes in Patients Treated With Canagliflozin Versus Sitagliptin in US Health Plans.

    Science.gov (United States)

    Thayer, Sarah; Aguilar, Richard; Korrer, Stephanie; Chow, Wing

    2017-10-01

    Clinical trial evidence supports greater glycemic control with canagliflozin than with sitagliptin. The objective of this study was to provide real-world evidence comparing outcomes in routine clinical practice among patients initiating each medication. With the use of a health care administrative database, patients initiating canagliflozin were compared with patients initiating sitagliptin (first prescription fill as index date). Baseline (6 months before index date) demographic and clinical (eg, comorbidities and diabetes-related complications) characteristics were compared, and propensity score matching was used to control for baseline differences between cohorts. Outcomes included change in glycosylated hemoglobin (HbA 1c ) and persistence with medication over a 9-month period after index date. Before matching, the canagliflozin cohort (N = 3993) was younger than the sitagliptin cohort (N = 12,153) and was composed of fewer women and Medicare Advantage enrollees, with lower mean baseline comorbidity scores (all p < 0.001). Before matching, the canagliflozin cohort (valid n = 1482) had a significantly (p < 0.001) higher baseline HbA 1c (8.60) than the sitagliptin cohort (valid n = 3697; HbA 1c , 8.32). After matching (n = 1472 per cohort), patients were well balanced on baseline characteristics, and HbA 1c values were not significantly different (p = 0.634) between the cohorts. Patients initiating canagliflozin had greater reductions in HbA 1c than patients in the sitagliptin cohort (-0.93% versus -0.57%, respectively; p = 0.004), with similar mean (median) time from index date to follow-up HbA 1c of 185.4 (199.0) and 184.3 (190.5) days, respectively (p = 0.802). Only 29.8% of canagliflozin patients discontinued during follow-up compared with 41.5% of sitagliptin patients (p < 0.001); the average days of persistence on index therapy was longer for canagliflozin patients (152 days) than for sitagliptin patients (139 days; p < 0.001). In this observational study

  2. ri Naela rahakotti prantsatas miljon krooni / Aigi Viira

    Index Scriptorium Estoniae

    Viira, Aigi

    2009-01-01

    Tallinna Ülikooli tantsukompositsiooni dotsent Jüri Nael sai Eesti haridus- ja teadusministeeriumilt miljonikroonise stipendiumi doktoriõpinguteks Londonis Royal Holloway University's. Jüri Nael pühendub Londonis õppides sellele, mis jääb teatri ja tantsu vahele ehk füüsilisele teatrile, täpsemalt – füüsilisele eksperimentaalteatrile

  3. Teel kriisist õigusriiki / Jüri Raidla

    Index Scriptorium Estoniae

    Raidla, Jüri, 1957-

    1990-01-01

    ri Raidla, justiitsminister (kinnitati 17. 04. 1990). Sündinud 1957. a. Pärnus, 1980. a. lõpetas Tartu Ülikooli õigusteaduskonna, kaitses 12. 02. 1987. a. Leningradi Ülikoolis väitekirja "Mehaaniliste transpordivahenditega kahju tekitamisest tulenevad kohustused"

  4. Contributions of F-BAR and SH2 domains of Fes protein tyrosine kinase for coupling to the FcepsilonRI pathway in mast cells.

    Science.gov (United States)

    McPherson, Victor A; Everingham, Stephanie; Karisch, Robert; Smith, Julie A; Udell, Christian M; Zheng, Jimin; Jia, Zongchao; Craig, Andrew W B

    2009-01-01

    This study investigates the roles of Fer-CIP4 homology (FCH)-Bin/amphiphysin/Rvs (F-BAR) and SH2 domains of Fes protein tyrosine kinase in regulating its activation and signaling downstream of the high-affinity immunoglobulin G (IgE) receptor (FcepsilonRI) in mast cells. Homology modeling of the Fes F-BAR domain revealed conservation of some basic residues implicated in phosphoinositide binding (R113/K114). The Fes F-BAR can bind phosphoinositides and induce tubulation of liposomes in vitro. Mutation of R113/K114 to uncharged residues (RK/QQ) caused a significant reduction in phosphoinositide binding in vitro and a more diffuse cytoplasmic localization in transfected COS-7 cells. RBL-2H3 mast cells expressing full-length Fes carrying the RK/QQ mutation show defects in FcepsilonRI-induced Fes tyrosine phosphorylation and degranulation compared to cells expressing wild-type Fes. This correlated with reduced localization to Lyn kinase-containing membrane fractions for the RK/QQ mutant compared to wild-type Fes in mast cells. The Fes SH2 domain also contributes to Fes signaling in mast cells, via interactions with the phosphorylated FcepsilonRI beta chain and the actin regulatory protein HS1. We show that Fes phosphorylates C-terminal tyrosine residues in HS1 implicated in actin stabilization. Thus, coordinated actions of the F-BAR and SH2 domains of Fes allow for coupling to FcepsilonRI signaling and potential regulation the actin reorganization in mast cells.

  5. A comparison of the baseline metabolic profiles between Diabetes Prevention Trial-Type 1 and TrialNet Natural History Study participants.

    Science.gov (United States)

    Sosenko, Jay M; Mahon, Jeffrey; Rafkin, Lisa; Lachin, John M; Krause-Steinrauf, Heidi; Krischer, Jeffrey P; Cuthbertson, David; Palmer, Jerry P; Thompson, Clinton; Greenbaum, Carla J; Skyler, Jay S

    2011-03-01

    We assessed whether differing autoantibody screening criteria for type 1 diabetes (T1D) prevention trials result in different baseline metabolic profiles of those who screen positive. Diabetes Prevention Trial-Type 1 (DPT-1) participants were screened for islet cell autoantibodies, whereas TrialNet Natural History Study (TNNHS) participants were screened for biochemical autoantibodies. In both studies, those determined to be autoantibody positive underwent baseline oral glucose tolerance tests (OGTTs) in which glucose and C-peptide were measured. The percentage of those with an OGTT in the diabetic range was higher among the DPT-1 participants (10.0% of 956 vs. 6.4% of 645, p < 0.01). In a logistic regression analysis with adjustments for age and gender, the difference persisted (p < 0.01). Among those in the non-diabetic range (n = 860 for DPT-1 and n = 604 for the TNNHS), glucose levels were similar at all time points, except for higher fasting glucose levels in the TNNHS participants (p < 0.001). There was a higher percentage of impaired fasting glucose (IFG) in the TNNHS participants (10.9 vs. 6.7%, p < 0.01); however, with adjustments for age and gender, there was no longer a significant difference. There was no significant difference in the percentages with impaired glucose tolerance. C-peptide levels were much lower in the DPT-1 cohort at all OGTT time points (p < 0.001 for all). Differing criteria for autoantibody screening can result in marked differences in the baseline metabolic profiles of prospective participants of T1D prevention trials. © 2010 John Wiley & Sons A/S.

  6. The Effect of Prolonged Glucosamine Usage on HbA1c Levels and New-Onset Diabetes Mellitus in Overweight and Obese Middle-Aged Women.

    Science.gov (United States)

    Gommans, Yvonne M M; Runhaar, Jos; Jacobs, Marloes L; Bierma-Zeinstra, Sita M A

    2017-06-01

    The aim of the present study was to evaluate the effect of a 2.5-year glucosamine sulfate intervention on hemoglobin A1c (HbA1c) levels and the incidence of new-onset diabetes mellitus over 6.5 years in middle-aged women with a body mass index ≥27 kg/m 2 . In total, 407 women were randomized into either oral crystalline glucosamine sulfate or placebo. At baseline, 1 year, 2.5 years, and 6.5 years, a blood sample for the HbA1c level was drawn and questionnaires were taken. After 6.5 years there were missing data for some variables, therefore, multiple imputation was used. With the imputed data, a generalized estimating equation was performed to analyze the effect of glucosamine sulfate usage over 6.5 years. Finally, these analyses were rerun for the 2 subgroups of participants with and without high HbA1c level (≥42 mmol/mol) at baseline. There was no significant effect of a 2.5-year glucosamine sulfate intervention on mean HbA1c level or on obtaining a high HbA1c level or new-onset diabetes mellitus over 6.5 years. The subgroup analyses of participants with and without high HbA1c level at baseline were also not statistically significant. However, participants with a high HbA1c level at baseline had higher odds ratios compared with the participants with a normal HbA1c at baseline. There was no effect of glucosamine sulfate on mean HbA1c level nor on obtaining a high HbA1c level or new-onset diabetes mellitus over 6.5 years, especially in participants with a normal HbA1c level at baseline. Copyright © 2016 Elsevier Inc. All rights reserved.

  7. Baseline Body Mass Index and the Efficacy of Hypoglycemic Treatment in Type 2 Diabetes: A Meta-Analysis

    Science.gov (United States)

    Cai, Xiaoling; Yang, Wenjia; Gao, Xueying; Zhou, Lingli; Han, Xueyao; Ji, Linong

    2016-01-01

    Aim The aim of this study is to compare the effects of hypoglycemic treatments in groups of patients categorized according to the mean baseline body mass indexes (BMIs). Methods Studies were identified by a literature search and all the studies were double blind, placebo-controlled randomized trials in type 2 diabetes patients; study length of ≥12 weeks with the efficacy evaluated by changes in HbA1c from baseline in groups. The electronic search was first conducted in January 2015 and repeated in June 2015. Results 227 studies were included. Treatment with sulfonylureas was compared with placebo in overweight patients and resulted in a significantly greater change in the HbA1c levels (weighted mean difference (WMD), −1.39%) compared to obese patients (WMD, −0.77%)(p0.05). Treatment with alpha glucosidase inhibitors in normal weight patients was associated with a HbA1c change (WMD, −0.94%) that was comparable that in overweight (WMD, −0.72%) and obese patients (WMD, −0.56%)(p>0.05). Treatment with thiazolidinediones in normal weight patients was associated with a HbA1c change (WMD, −1.04%) that was comparable with that in overweight (WMD, −1.02%) and obese patients (WMD, −0.88%)(p>0.05). Treatment with DPP-4 inhibitors in normal weight patients was associated with a HbA1c change (WMD, −0.93%) that was comparable with that in overweight (WMD, −0.66%) and obese patients (WMD, −0.61%)(p>0.05). In total, of the seven hypoglycemic agents, regression analysis indicated that the mean baseline BMI was not associated with the mean HbA1c changes from baseline. Conclusion In each kind of hypoglycemic therapy in type 2 diabetes, the baseline BMI was not associated with the efficacy of HbA1c changes from baseline. PMID:27935975

  8. BV RI CCD photometry of 361,281 objects in the field of M 31

    Science.gov (United States)

    Magnier, E. A.; Lewin, W. H. G.; Van Paradijs, J.; Hasinger, G.; Jain, A.; Pietsch, W.; Truemper, J.

    1992-01-01

    Deep BV RI CCD photometry was performed on a 1 sq deg region of M 31. A catalog of photometry and astrometry of a total of 361,281 stars is presented, with typical completion limits of BV RI = (22.3, 22.2, 22.2, 20.9). Photometric accuracy is about 2 percent at V = 19. This catalog allows detailed studies of stellar populations and reddening. The data are currently being used to assist in finding the optical counterparts of Einstein and ROSAT X-ray sources.

  9. A comparative study of the FcepsilonRI molecule on human mast cell and basophil cell lines

    DEFF Research Database (Denmark)

    Jensen, Bettina Margrethe; Dissing, S; Skov, P S

    2005-01-01

    Mast cells and basophils express the high-affinity IgE receptor FcepsilonRI. We have analysed the human mast cell line LAD2 and four subclones of the basophil cell line KU812 in order to reveal possible differences concerning the FcepsilonRI surface regulation, anti-IgE-triggered activation......, FcepsilonRIalpha protein stability and the mRNA level of FcepsilonRIalpha-, beta- and the truncated beta-chain (beta(T)), and thereby determine the utility of these cell lines in investigations of the FcepsilonRI biology....

  10. The anatomy of a radio source hot spot : Very large baseline array imaging of 3C 205

    NARCIS (Netherlands)

    Lonsdale, CJ; Barthel, PD

    Total intensity and linear polarization Very Long Baseline Array (VLBA) images of the high-redshift quasar 3C 205 at a wavelength of 18 cm reveal a complex curved hot-spot structure with polarization percentages frequently as high as 70%. A one-sided jet is detected emerging from the central

  11. Sudan ebolavirus long recovered survivors produce GP-specific Abs that are of the IgG1 subclass and preferentially bind FcγRI.

    Science.gov (United States)

    Radinsky, Olga; Edri, Avishay; Brusilovsky, Michael; Fedida-Metula, Shlomit; Sobarzo, Ariel; Gershoni-Yahalom, Orly; Lutwama, Julius; Dye, John; Lobel, Leslie; Porgador, Angel

    2017-07-20

    Ebolavirus is a highly lethal pathogen, causing a severe hemorrhagic disease with a high fatality rate. To better understand immune correlates of protection by virus specific IgG, we investigated the evolution of the Fcγ receptors (FcγRs)-activating capabilities of antiviral IgG in serum samples of long recovered survivors. To this end, longitudinal serum samples from survivors of Sudan ebolavirus (SUDV) infection, studied over years, were examined for the presence of Ebola-GP specific IgG subclasses, and for their binding to FcγRs. We developed a cell-based reporter system to quantitate pathogen-specific antibody binding to FcγRIIIA, FcγRIIA, FcγRIIB and FcγRI. With this system, we demonstrate that anti-GP-specific stimulation of the FcγRI reporter by survivors' sera was substantially high one year after acute infection, with a slight reduction in activity over a decade post infection. We further demonstrate that GP-specific IgG1 is by far the seroprevalent subclass that retained and even enhanced its presence in the sera, over ten years post infection; the prevalence of other GP-specific IgG subclasses was considerably reduced over time. In accordance, GP-specific FcγRI reporter response and GP-specific total IgG1 subclass correlated in the studied group of Ebola survivors. These observations are important for further informing Ebola vaccine and therapeutic development.

  12. Inhibitory Effects of Cytosolic Ca2+ Concentration by Ginsenoside Ro Are Dependent on Phosphorylation of IP3RI and Dephosphorylation of ERK in Human Platelets

    Directory of Open Access Journals (Sweden)

    Hyuk-Woo Kwon

    2015-01-01

    Full Text Available Intracellular Ca2+ ([Ca2+]i is platelet aggregation-inducing molecule and is involved in activation of aggregation associated molecules. This study was carried out to understand the Ca2+-antagonistic effect of ginsenoside Ro (G-Ro, an oleanane-type saponin in Panax ginseng. G-Ro, without affecting leakage of lactate dehydrogenase, dose-dependently inhibited thrombin-induced platelet aggregation, and the half maximal inhibitory concentration was approximately 155 μM. G-Ro inhibited strongly thrombin-elevated [Ca2+]i, which was strongly increased by A-kinase inhibitor Rp-8-Br-cAMPS compared to G-kinase inhibitor Rp-8-Br-cGMPS. G-Ro increased the level of cAMP and subsequently elevated the phosphorylation of inositol 1, 4, 5-triphosphate receptor I (IP3RI (Ser1756 to inhibit [Ca2+]i mobilization in thrombin-induced platelet aggregation. Phosphorylation of IP3RI (Ser1756 by G-Ro was decreased by PKA inhibitor Rp-8-Br-cAMPS. In addition, G-Ro inhibited thrombin-induced phosphorylation of ERK 2 (42 kDa, indicating inhibition of Ca2+ influx across plasma membrane. We demonstrate that G-Ro upregulates cAMP-dependent IP3RI (Ser1756 phosphorylation and downregulates phosphorylation of ERK 2 (42 kDa to decrease thrombin-elevated [Ca2+]i, which contributes to inhibition of ATP and serotonin release, and p-selectin expression. These results indicate that G-Ro in Panax ginseng is a beneficial novel Ca2+-antagonistic compound and may prevent platelet aggregation-mediated thrombotic disease.

  13. A novel approach for baseline correction in 1H-MRS signals based on ensemble empirical mode decomposition.

    Science.gov (United States)

    Parto Dezfouli, Mohammad Ali; Dezfouli, Mohsen Parto; Rad, Hamidreza Saligheh

    2014-01-01

    Proton magnetic resonance spectroscopy ((1)H-MRS) is a non-invasive diagnostic tool for measuring biochemical changes in the human body. Acquired (1)H-MRS signals may be corrupted due to a wideband baseline signal generated by macromolecules. Recently, several methods have been developed for the correction of such baseline signals, however most of them are not able to estimate baseline in complex overlapped signal. In this study, a novel automatic baseline correction method is proposed for (1)H-MRS spectra based on ensemble empirical mode decomposition (EEMD). This investigation was applied on both the simulated data and the in-vivo (1)H-MRS of human brain signals. Results justify the efficiency of the proposed method to remove the baseline from (1)H-MRS signals.

  14. Genealogy of gas cells for low-energy RI-beam production

    Energy Technology Data Exchange (ETDEWEB)

    Wada, Michiharu, E-mail: mw@riken.jp

    2013-12-15

    Highlights: • In order to overcome serious limitations in the universality of the traditional isotope separator on-line technique, various endeavors have been made on gas catcher cells for converting relativistic RI-beams from in-flight separators to low-energy RI-beams. • The origin of the gas catcher is found in the IGISOL (Ion guide isotope separator on-line) technique. • Many developments have been made over the years to overcome the various difficulties and drawbacks found in the IGISOL technique. -- Abstract: In order to overcome serious limitations in the universality of the traditional isotope separator on-line technique, various endeavors have been made on gas catcher cells for converting relativistic RI-beams from in-flight separators to low-energy RI-beams. The origin of the gas catcher is found in the IGISOL (Ion guide isotope separator on-line) technique. Many developments have been made over the years to overcome the various difficulties and drawbacks found in the IGISOL technique.

  15. Genealogy of gas cells for low-energy RI-beam production

    International Nuclear Information System (INIS)

    Wada, Michiharu

    2013-01-01

    Highlights: • In order to overcome serious limitations in the universality of the traditional isotope separator on-line technique, various endeavors have been made on gas catcher cells for converting relativistic RI-beams from in-flight separators to low-energy RI-beams. • The origin of the gas catcher is found in the IGISOL (Ion guide isotope separator on-line) technique. • Many developments have been made over the years to overcome the various difficulties and drawbacks found in the IGISOL technique. -- Abstract: In order to overcome serious limitations in the universality of the traditional isotope separator on-line technique, various endeavors have been made on gas catcher cells for converting relativistic RI-beams from in-flight separators to low-energy RI-beams. The origin of the gas catcher is found in the IGISOL (Ion guide isotope separator on-line) technique. Many developments have been made over the years to overcome the various difficulties and drawbacks found in the IGISOL technique

  16. Tallinna linnapea Jüri Ratas : Keskerakond ei ole maffia! / Jüri Ratas ; interv. Urmo Soonvald

    Index Scriptorium Estoniae

    Ratas, Jüri, 1978-

    2005-01-01

    Tallinna linnapea Jüri Ratas vastab küsimustele, mis puudutavad Rein Ratase Tallinna Vee nõukogu liikmeks määramist, K-kohukse reklaami seost Keskerakonna valimiskampaaniaga, linnapeaks saamist, koostööd teiste poliitikutega, Edgar Savisaare osa Tallinna linna juhtimises

  17. ANALISIS DAMPAK PERMEN KP RI NOMOR 1/PERMEN-KP/2015 TERHADAP PERDAGANGAN DOMESTIK ANTAR PROVINSI KOMODITI LOBSTER (Panulirus spp, KEPITING (Scylla serrata DAN RAJUNGAN (Portunus pelagicus DI KALIMANTAN SELATAN

    Directory of Open Access Journals (Sweden)

    Ichi Langlang Buana Machmud

    2017-05-01

    Full Text Available This study aims to (1 analyze the impact of Permen KP RI No. 1/PERMEN-KP/2015 against the decrease/increase of the amount of volume, frequency and value of interprovincial domestic trade of lobster (Panulirus spp, crab (Scylla serrata and small crab (Portunus pelagicus commodities; (2 to analyze the causes of the offense of smuggling attempts by large inter-provincial traders of lobster (Panulirus spp, crab (Scylla serrata and small crab (Portunus pelagicus commodities; and (3 to analyze the impact of Permen KP RI No.1/PERMEN-KP/2015 against the marketing channels of trade of lobster (Panulirus spp, crab (Scylla serrata and small crab (Portunus pelagicus commodities and trade organizations involved in domestic trade of the three commodities.  This thesis study activities were carried out in the province of South Kalimantan. The data collected were data sourced directly from the observation in the study site, and other supporting data relating to the object of study.  The results of this study: (1 Impact of Permen KP RI No. 1/PERMEN-KP/2015 are as follows: (a it has an effect of significantly reducing the volume, frequency and value of inter-provincial domestic trade of live crab (Scylla serrata and small fresh crab (Portunus pelagicus commodities, (b it has an effect of significantly reducing the volume and value of trade and has no significant effect on the frequency of inter-provincial domestic trade of soft-shelled crab commodity (Scylla serrata; (c it has no impact on inter-provincial domestic trade of fresh/frozen lobster commodities (Panulirus spp; (d it has no significant effect on the volume, frequency and value of inter-provincial domestic trade of crab meat (Scylla serrata, small crab meat (Portunus pelagicus, fresh/boiled crab (Scylla serrata and live lobsters (Panulirus spp commodities. (2 The occurrence of repeated violations in the form of an attempt smuggling by entrepreneurs (wholesalers of inter-provincial domestic sender of

  18. Hemoglobin A1c and arterial and ventricular stiffness in older adults.

    Directory of Open Access Journals (Sweden)

    Susan J Zieman

    Full Text Available Arterial and ventricular stiffening are characteristics of diabetes and aging which confer significant morbidity and mortality; advanced glycation endproducts (AGE are implicated in this stiffening pathophysiology. We examined the association between HbA(1c, an AGE, with arterial and ventricular stiffness measures in older individuals without diabetes.Baseline HbA(1c was measured in 830 participants free of diabetes defined by fasting glucose or medication use in the Cardiovascular Health Study, a population-based cohort study of adults aged ≥ 65 years. We performed cross-sectional analyses using baseline exam data including echocardiography, ankle and brachial blood pressure measurement, and carotid ultrasonography. We examined the adjusted associations between HbA(1c and multiple arterial and ventricular stiffness measures by linear regression models and compared these results to the association of fasting glucose (FG with like measures.HbA(1c was correlated with fasting and 2-hour postload glucose levels (r = 0.21; p<0.001 for both and positively associated with greater body-mass index and black race. In adjusted models, HbA(1c was not associated with any measure of arterial or ventricular stiffness, including pulse pressure (PP, carotid intima-media thickness, ankle-brachial index, end-arterial elastance, or left ventricular mass (LVM. FG levels were positively associated with systolic, diastolic and PP and LVM.In this sample of older adults without diabetes, HbA(1c was not associated with arterial or ventricular stiffness measures, whereas FG levels were. The role of AGE in arterial and ventricular stiffness in older adults may be better assessed using alternate AGE markers.

  19. The Asia-RiCE activity with data cube

    Science.gov (United States)

    Oyoshi, K.; Sobue, S.; LE Toan, T.; Lam, N. D.

    2017-12-01

    The Asia-RiCE initiative (http://www.asia-rice.org) has been organized to enhance rice production estimates through the use of Earth observation satellites data, and seeks to ensure that Asian rice crops are appropriately represented within GEO Global Agriculture Monitoring (GEO-GLAM) to support FAO Agriculture Market Information System (FAO-AMIS). Asia-RiCE is composed of national teams that are actively contributing to the Crop Monitor for AMIS and developing technical demonstrations of rice crop monitoring activities using both Synthetic Aperture Radar (SAR) data (Radarsat-2 from 2013; Sentinel-1 and ALOS-2 from 2015.From 2016 after the successful rice crop area and growing estimation using SAR in a technical demonstration site (provincial level), wall-to-wall (national scale) excurse as phase 2 has been implemented in Vietnam and Indonesia in cooperation with ministry of agriculture and space agencies. This paper reports this year activity of 2017 accomplishment and way forward, especially for analysis ready data (ARD) definition of SAR to ingest to CEOS data cube to provide national scale service in Vietnam and Indonesia.

  20. Quantitative and clinical evaluation of whole CSF-axis RI image

    International Nuclear Information System (INIS)

    Tomono, Yuji; Nose, Tadao; Maki, Yutaka

    1987-01-01

    Whole CSF-axis RI scintigraphy was evaluated in 122 adult patients intending to know not only intracranial CSF flow but also the dynamics of whole CSF axis, particularly of spinal CSF flow. The change of radioactivity in several compartments was studied quantitatively with a dataprocessor on 18 cases with dilated ventricles, and more practically, clinical features and the findings of the films were comparatively studied on all the cases. The results were as follows: (1) Roughly speaking, the findings were classified into two types, i.e. a type with early RI movement to the intracranial CSF space and another with stagnation of radioactivity in spinal space till late stage, even 48 hours after RI injection (spinal stasis). (2) Although majority of the cases with spinal stasis did not show ventricular stasis, a shunt operation was not effective even when ventricular stasis was observed. (3) Spinal stasis tended to increase with aging, and was observed more frequently in cases with possible severe cerebral damage, as severe cerebrovascular disease and severe deterioration of mental activity. (4) The clearance of radioactivity of whole CSF-axis was remarkably delayed. It is considered that the spinal CSF flow is generated by intracranial CSF pulsation and, so, that spinal stasis shows the condition of lowered CSF flow by pulsation due to cerebral parenchymal damages. (author)

  1. HbA1c in relation to incident diabetes and diabetes-related complications in non-diabetic adults at baseline.

    Science.gov (United States)

    Metcalf, Patricia Anne; Kyle, Cam; Kenealy, Tim; Jackson, Rod T

    2017-05-01

    We compared the utility of glycated hemoglobin (HbA 1c ) and oral glucose tolerance (oGTT) in non-diabetic patients for identifying incident diabetes; all-cause mortality; cardiovascular disease (CVD) mortality; CVD, coronary heart disease (CHD), and ischemic stroke events; and diabetes microvascular complications. Data from a New Zealand community setting were prospectively linked to hospitalization, mortality, pharmaceutical and laboratory test results data. After applying exclusion criteria (prior laboratory diagnosis or history of drug treatment for diabetes or hospitalization for diabetes or CVD event), there were 31,148 adults who had an HbA 1c and 2-h 75g oGTT. HbA 1c was measured by ion-exchange high-performance liquid chromatography, and glucose using a commercial enzymatic method. We compared glycemic measures and outcomes using multivariable Cox proportional hazards regression. The median follow-up time was 4years (range 0 to 13). The mean age was 57·6years and 53·0% were male. After adjusting for other glycemic measures (fasting glucose, 2-h glucose and/or HbA 1c where relevant) in addition to age, sex, ethnicity and smoking habit, the hazard ratios for incident diabetes and diabetes complications of retinopathy and nephropathy were highest for 2-h glucose levels, followed by HbA 1c and lastly by fasting glucose. However, all-cause mortality and CHD were significantly associated with HbA 1c concentrations only, and ischemic stroke and CVD events with 2-h glucose only. Circulatory complications showed a stronger association with HbA 1c . Apart from neuropathy, HbA 1c showed stronger associations with outcomes compared to fasting glucose and provides a convenient alternative to an oGTT. Copyright © 2017 Elsevier Inc. All rights reserved.

  2. RFI/RI work plan for the Road A Chemical Basin 904-111G

    International Nuclear Information System (INIS)

    Kmetz, T.F.

    2000-01-01

    This Resource Conservation and Recovery Act (RCRA) Facility Investigation (RFI)/Remedial Investigation (RI) Work Plan has been prepared for the Road A Chemical Basin Operable Unit (RdACB OU) (904-111G). This unit is subject to the requirements of both RCRA and the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA). This Work Plan presents the initial evaluation of existing unit data, applicable background data, the regulatory framework for the unit investigation, and the evaluations and decisions made during the determination of the scope and objectives of the planned Remedial Investigation/Feasibility Study (RI/FS) activities

  3. RFI/RI work plan for the Road A Chemical Basin 904-111G

    Energy Technology Data Exchange (ETDEWEB)

    Kmetz, T.F.

    2000-03-07

    This Resource Conservation and Recovery Act (RCRA) Facility Investigation (RFI)/Remedial Investigation (RI) Work Plan has been prepared for the Road A Chemical Basin Operable Unit (RdACB OU) (904-111G). This unit is subject to the requirements of both RCRA and the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA). This Work Plan presents the initial evaluation of existing unit data, applicable background data, the regulatory framework for the unit investigation, and the evaluations and decisions made during the determination of the scope and objectives of the planned Remedial Investigation/Feasibility Study (RI/FS) activities.

  4. Verbascumkurdistanicum (Scrophulariaceae), a new species from Hakkâri, Turkey.

    Science.gov (United States)

    Fırat, Mehmet

    2015-01-01

    Verbascumkurdistanicum Fırat (Scrophulariaceae), is described and illustrated as a new species that is located in Hakkâri, Turkey. In this study, diagnostic morphological characters of this and closely related species (Verbascumoreophilum K.Koch and Verbascumpyramidatum M. Bieb) are discussed. Furthermore, distribution maps for the three taxa are provided.

  5. Näitus "Sajand eesti puugravüüri klotsidel" / Jüri Hain

    Index Scriptorium Estoniae

    Hain, Jüri, 1941-

    2007-01-01

    Eesti Rahvusraamatukogus 15. I-3. II eksponeeritud ja rahvusraamatukogu kollektsioonist koostatud näitusest "Sajand eesti puugravüüri klotsidel: 1840-1940". Järgmistest kunstnikest ja nende töödest: Aleksander Otto Gern, Bogdan Gottlieb Friedrich Kally, August Daugell, Hermann Eduard Hartmann, Eduard Magnus Jakobson, Mart Pukits, Andres Kuusk, Karl Friedrich Schnell, Anton Suurkask (1873-1965), Arkadio Laigo, Hando Mugasto, Eduard Järv, Richard Kaljo, Ott Kangilaski, Ants Puks (1918-?), Salome Trei

  6. Äri- ja ettevõtluskeeldude piiriülene mõju / Maarja Torga, Juhan Sarv

    Index Scriptorium Estoniae

    Torga, Maarja, 1984-

    2017-01-01

    Eestis kohaldatud äri- ja ettevõtluskeeldude piiriülesest mõjust ning välisriigis kohaldatud äri- ja ettevõtluskeelu mõjust Eestis. Äri- ja ettevõtluskeeldude piiriülesest tsiviilõiguslikust ja karistusõiguslikust mõjust. Sisaldab asjakohast kohtupraktikat

  7. Dicty_cDB: Contig-U05695-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -709P8, WORKING... 44 1.2 3 ( EU926921 ) Bactrocera cucurbitae voucher YSUW95011901 16S ri... 40 1.2 2 ( CP0...01056 ) Clostridium botulinum B str. Eklund 17B, complete... 34 1.6 16 ( AB048754 ) Bactrocera cucurbitae mi...tochondrial genes for 16S... 40 1.6 2 ( AB048748 ) Bactrocera cucurbitae mitochon...drial genes for 16S... 40 1.6 2 ( AB035113 ) Bactrocera cucurbitae mitochondrial genes for 16S... 40 1.6 2 (... AB035112 ) Bactrocera cucurbitae mitochondrial genes for 16S... 40 1.6 2 ( AB048746 ) Bactrocera tau mitoch

  8. Reiu Tüüri maratonloeng kunstiturust / Reiu Tüür

    Index Scriptorium Estoniae

    Tüür, Reiu

    2001-01-01

    27. VI toimus Pärnus Kunstplatze Unobomberi galeriis Reiu Tüüri näitus-loeng kaasaegse kunsti galeriidest Londonis ja Eestis. Näitus on osa R. Tüüri sel sügisel Londoni linnaülikooli juures kaitstavast kunsti mänedzhmendi alasest magistritööst "Eesti kaasaegse kunsti turg". Juhendaja Jani Robertson Hollandist.

  9. Hemoglobin A1c Levels Predicts Acute Kidney Injury after Coronary Artery Bypass Surgery in Non-Diabetic Patients

    Directory of Open Access Journals (Sweden)

    Cevdet Ugur Kocogulları

    Full Text Available Abstract INTRODUCTION: Elevated hemoglobin A1c levels in patients with diabetes mellitus have been known as a risk factor for acute kidney injury after coronary artery bypass grafting. However, the relationship between hemoglobin A1c levels in non-diabetics and acute kidney injury is under debate. We aimed to investigate the association of preoperative hemoglobin A1c levels with acute kidney injury in non-diabetic patients undergoing isolated coronary artery bypass grafting. METHODS: 202 non-diabetic patients with normal renal function (serum creatinine <1.4 mg/dl who underwent isolated coronary bypass were analyzed. Hemoglobin A1c level was measured at the baseline examination. Patients were separated into two groups according to preoperative Hemoglobin A1c level. Group 1 consisted of patients with preoperative HbA1c levels of < 5.6% and Group 2 consisted of patients with preoperative HbA1c levels of ≥ 5.6%. Acute kidney injury diagnosis was made by comparing baseline and postoperative serum creatinine to determine the presence of predefined significant change based on the Kidney Disease Improving Global Outcomes (KDIGO definition. RESULTS: Acute kidney injury occurred in 19 (10.5% patients after surgery. The incidence of acute kidney injury was 3.6% in Group 1 and 16.7% in Group 2. Elevated baseline hemoglobin A1c level was found to be associated with acute kidney injury (P=0.0001. None of the patients became hemodialysis dependent. The cut off value for acute kidney injury in our group of patients was 5.75%. CONCLUSION: Our findings suggest that, in non-diabetics, elevated preoperative hemoglobin A1c level may be associated with acute kidney injury in patients undergoing coronary artery bypass grafting. Prospective randomized studies in larger groups are needed to confirm these results.

  10. Acute cellular rejection is a risk factor for bronchiolitis obliterans syndrome independent of post-transplant baseline FEV1

    DEFF Research Database (Denmark)

    Burton, C.M.; Iversen, M.; Carlsen, J.

    2009-01-01

    BACKGROUND: Post-transplant baseline forced expiratory volume in 1 second (FEV(1)) constitutes a systematic bias in analyses of bronchiolitis obliterans syndrome (BOS). This retrospective study evaluates risk factors for BOS adjusting for the confounding of post-transplant baseline FEV(1). METHODS......-specific hazard of BOS (hazard ratio 1.4, confidence interval 1.1 to 1.8, p = 0.009). The absolute value of baseline FEV(1) was a significant confounder in all survival and competing risk analyses of BOS (p ... an independent risk factor for the development of BOS after adjusting for the confounding of post-transplant baseline FEV(1) Udgivelsesdato: 2009/9...

  11. HbA1c, diabetes and cognitive decline: the English Longitudinal Study of Ageing.

    Science.gov (United States)

    Zheng, Fanfan; Yan, Li; Yang, Zhenchun; Zhong, Baoliang; Xie, Wuxiang

    2018-04-01

    The aim of the study was to evaluate longitudinal associations between HbA 1c levels, diabetes status and subsequent cognitive decline over a 10 year follow-up period. Data from wave 2 (2004-2005) to wave 7 (2014-2015) of the English Longitudinal Study of Ageing (ELSA) were analysed. Cognitive function was assessed at baseline (wave 2) and reassessed every 2 years at waves 3-7. Linear mixed models were used to evaluate longitudinal associations. The study comprised 5189 participants (55.1% women, mean age 65.6 ± 9.4 years) with baseline HbA 1c levels ranging from 15.9 to 126.3 mmol/mol (3.6-13.7%). The mean follow-up duration was 8.1 ± 2.8 years and the mean number of cognitive assessments was 4.9 ± 1.5. A 1 mmol/mol increment in HbA 1c was significantly associated with an increased rate of decline in global cognitive z scores (-0.0009 SD/year, 95% CI -0.0014, -0.0003), memory z scores (-0.0005 SD/year, 95% CI -0.0009, -0.0001) and executive function z scores (-0.0008 SD/year, 95% CI -0.0013, -0.0004) after adjustment for baseline age, sex, total cholesterol, HDL-cholesterol, triacylglycerol, high-sensitivity C-reactive protein, BMI, education, marital status, depressive symptoms, current smoking, alcohol consumption, hypertension, CHD, stroke, chronic lung disease and cancer. Compared with participants with normoglycaemia, the multivariable-adjusted rate of global cognitive decline associated with prediabetes and diabetes was increased by -0.012 SD/year (95% CI -0.022, -0.002) and -0.031 SD/year (95% CI -0.046, -0.015), respectively (p for trend cognitive decline with diabetes. Significant longitudinal associations between HbA 1c levels, diabetes status and long-term cognitive decline were observed in this study. Future studies are required to determine the effects of maintaining optimal glucose control on the rate of cognitive decline in people with diabetes.

  12. Competency remodelling and application plans for development of job competency in RI-biomics

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Woo Ho; Park, Tai Jin [Korean Association for Radiation Application, Seoul (Korea, Republic of)

    2017-03-15

    RI-Biomics technology is advanced convergence technologies that can be measured in real time and track in vivo behavior and metabolism of substances using characteristics of the radioactive isotope. Its application fields are increasing such as drug development, agriculture, development of new materials and their utilization, etc. In addition, according to domestic and international developments and changes in the RI-Biomics environment, RI-Biomics professionals are needed to train continuously. To develop systematic human resources basement and competency-based curriculum, we perform competency modeling of pedagogical perspective to targeted at high-performance on RI-Biomics. Furthermore, we redefine the competency model and verified by industry experts with focus group interviews. In the result, two general competencies and three professional competencies were extracted by interview. Each competencies are organized six sub-competencies and nine sub-competencies. In the final steps, the same procedures were repeated to obtain the consensus of experts on derived competencies and behavioral objectives. The results of the study are applicable to enhance human resource management and to develop the curriculum for RI-Biomics expert training. It is expected to be used as reference material of long term-planning for RI-Biomics professional.

  13. Competency remodelling and application plans for development of job competency in RI-biomics

    International Nuclear Information System (INIS)

    Shin, Woo Ho; Park, Tai Jin

    2017-01-01

    RI-Biomics technology is advanced convergence technologies that can be measured in real time and track in vivo behavior and metabolism of substances using characteristics of the radioactive isotope. Its application fields are increasing such as drug development, agriculture, development of new materials and their utilization, etc. In addition, according to domestic and international developments and changes in the RI-Biomics environment, RI-Biomics professionals are needed to train continuously. To develop systematic human resources basement and competency-based curriculum, we perform competency modeling of pedagogical perspective to targeted at high-performance on RI-Biomics. Furthermore, we redefine the competency model and verified by industry experts with focus group interviews. In the result, two general competencies and three professional competencies were extracted by interview. Each competencies are organized six sub-competencies and nine sub-competencies. In the final steps, the same procedures were repeated to obtain the consensus of experts on derived competencies and behavioral objectives. The results of the study are applicable to enhance human resource management and to develop the curriculum for RI-Biomics expert training. It is expected to be used as reference material of long term-planning for RI-Biomics professional

  14. XX sajandi hispaania teater : peamärgid / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1998-01-01

    Hispaania ja ladinaameerika näitekirjandusest. Ka näidendite lavastamisest eesti teatrites. Põhjalikumalt Ram̤n MarÍa del Valle-Incl{u00E1ni (1866-1936), Federico GarcÍa Lorca (1898-1936) ja Antonio Buero Vallejo (sünd. 1916) loomingust. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 234-250

  15. In-line microfluidic refractometer based on C-shaped fiber assisted photonic crystal fiber Sagnac interferometer.

    Science.gov (United States)

    Wu, Chuang; Tse, Ming-Leung Vincent; Liu, Zhengyong; Guan, Bai-Ou; Lu, Chao; Tam, Hwa-Yaw

    2013-09-01

    We propose and demonstrate a highly sensitive in-line photonic crystal fiber (PCF) microfluidic refractometer. Ultrathin C-shaped fibers are spliced in-between the PCF and standard single-mode fibers. The C-shaped fibers provide openings for liquid to flow in and out of the PCF. Based on a Sagnac interferometer, the refractive index (RI) response of the device is investigated theoretically and experimentally. A high sensitivity of 6621 nm/RIU for liquid RI from 1.330 to 1.333 is achieved in the experiment, which agrees well with the theoretical analysis.

  16. Dental caries prevalence as a product of agriculture and subsistence pattern at the Yean-ri site, South Korea.

    Science.gov (United States)

    Fujita, H; Hashimoto, H; Shoda, S; Suzuki, T

    2011-01-01

    Yean-ri human skeletal remains from South Korea have been dated to the fourth to seventh century AD. They have morphological similarities to immigrants of the Yayoi period excavated in northern Kyushu and Yamaguchi prefecture in Japan. The overall dental caries prevalence was 8.1% in the Yean-ri skeletal remains, indicating a much lower prevalence than that of most Yayoi immigrant skeletal remains from Japan, although similar to that of the Kofun people (8.3%) in Japan. There was no significant difference in the dental caries prevalence between the males and females of the same age group, but there were differences in the prevalence by age. The late middle age and elderly males and females had significantly higher dental caries prevalence than the early middle age males and females, indicating increased prevalence with age. Root caries prevalence tended to increase in old age. The percentage of root caries increased, accounting for 80% of all caries in Yean-ri human skeletal remains. Agriculture is believed to have arisen approximately 3,000 years ago in Korea. Therefore, agriculture was practiced during this period, but since the Yean-ri tumuli are from coastal areas, their diet may have retained a significant marine component. Additionally, caries prevalence was not very high in Nukdo human remains (ca. 2100-2000 BC) in Korea. We speculate that they maintained subsistence activities suitable for their environment despite their knowledge of agriculture. This hypothesis is supported by differences in the caries prevalence between excavation sites of the Yayoi and Kofun periods in Japan. Copyright © 2011 S. Karger AG, Basel.

  17. Impact of Disease Management Programs on HbA1c Values in Type 2 Diabetes Patients in Germany.

    Science.gov (United States)

    Kostev, Karel; Rockel, Timo; Jacob, Louis

    2017-01-01

    The aim was to analyze the impact of disease management programs on HbA1c values in type 2 diabetes mellitus (T2DM) patients in Germany. This study included 9017 patients followed in disease management programs (DMPs) who started an antihyperglycemic treatment upon inclusion in a DMP. Standard care (SC) patients were included after individual matching (1:1) to DMP cases based on age, gender, physician (diabetologist versus nondiabetologist care), HbA1c values at baseline, and index year. The main outcome was the share of patients with HbA1c HbA1c level as a dependent variable and the potential predictor (DMP versus SC). The mean age was 64.3 years and 54.7% of the patients were men. The mean HbA1c level at baseline was equal to 8.7%. In diabetologist practices, 64.7% of DMP patients and 55.1% of SC patients had HbA1c levels HbA1c levels HbA1c levels HbA1c levels HbA1c levels lower than 7.5% or 6.5% after 6 months of therapy in both diabetologist and general care practices. The present study indicates that the enrollment of T2DM patients in DMPs has a positive impact on HbA1c values in Germany.

  18. Pealinlased olid aktiivsemad valijad / Jüri Ratas

    Index Scriptorium Estoniae

    Ratas, Jüri, 1978-

    2007-01-01

    Ilmunud ka: Stolitsa, 14. märts 2007, lk. 2. Tallinna linnapea Jüri Ratas parlamendivalimiste tulemustest. Vt. samas: Kes Tallinnast riigikokku valiti?; Riigikogu valimise tulemused Tallinnas: diagramm

  19. Preoperative tumor localization of primary hyperparathyroidism. Comprehensive study of ultrasonography (US), scintigraphy (RI), arteriography (AG) and venous sampling (VS)

    Energy Technology Data Exchange (ETDEWEB)

    Morita, Yutaka; Shinohara, Masahiro; Ito, Kazuo; Imamura, Fumimoto; Kasai, Yoichi (Hokkaido Univ., Sapporo (Japan). School of Medicine); Ishizuka, Reiki

    1983-02-01

    The diagnostic rate of each methods were discussed in thirty six cases and the following conclusions were made. (1.) The diagnostic rate of US, RI, AG and VS was 64.7%, 50%, 57.9%, 60.7% respectively. (2.) Ultrasonography and subtruction-scintigraphy were useful for screening examination for localization of parathyroid tumor. (3.) The reasonable diagnostic procedures were as follows: (1) In the cases of palpable, reno-uretrolithiasic type, and biochemical type: US ..-->.. RI ..-->.. VS. (2) In the cases of nonpalpable osteolytic type, and previous neck surgery: US ..-->.. RI ..-->.. AG ..-->.. VS. These results indicate that the systemic diagnoses are useful to predict localization of parathyroid tumors.

  20. 200-UP-2 Operable Unit technical baseline report

    International Nuclear Information System (INIS)

    Deford, D.H.

    1991-02-01

    This report is prepared in support of the development of a Remedial Investigation/Feasibility Study (RI/FS) Work Plan for the 200-UP-2 Operable Unit by EBASCO Environmental, Incorporated. It provides a technical baseline of the 200-UP-2 Operable Unit and results from an environmental investigation undertaken by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The 200-UP-2 Operable Unit Technical Baseline Report is based on review and evaluation of numerous Hanford Site current and historical reports, Hanford Site drawings and photographs and is supplemented with Hanford Site inspections and employee interviews. No field investigations or sampling were conducted. Each waste site in the 200-UP-2 Operable Unit is described separately. Close relationships between waste units, such as overflow from one to another, are also discussed. The 200-UP-2 Operable Unit consists of liquid-waste disposal sites in the vicinity of, and related to, U Plant operations in the 200 West Area of the Hanford Site. The ''U Plant'' refers to the 221-U Process Canyon Building, a chemical separations facility constructed during World War 2. It also includes the Uranium Oxide (UO 3 ) Plant, which was constructed at the same time and, like the 221-U Process Canyon Building, was later converted for other missions. Waste sites in the 200-UP-2 Operable Unit are associated with the U Plant Uranium Metal Recovery Program mission that occurred between 1952 and 1958 and the UO 3 Plant's ongoing uranium oxide mission and include one or more cribs, reverse wells, french drains, septic tanks and drain fields, trenches, catch tanks, settling tanks, diversion boxes, waste vaults, and the lines and encasements that connect them. 11 refs., 1 tab

  1. The mosaic genome structure of the Wolbachia wRi strain infecting Drosophila simulans

    DEFF Research Database (Denmark)

    Klasson, Lisa; Westberg, Joakim; Sapountzis, Panagiotis

    2009-01-01

    genome of W. pipientis strain wRi that induces very strong cytoplasmic incompatibility in its natural host Drosophila simulans. A comparison with the previously sequenced genome of W. pipientis strain wMel from Drosophila melanogaster identified 35 breakpoints associated with mobile elements and repeated...... sequences that are stable in Drosophila lines transinfected with wRi. Additionally, 450 genes with orthologs in wRi and wMel were sequenced from the W. pipientis strain wUni, responsible for the induction of parthenogenesis in the parasitoid wasp Muscidifurax uniraptor. The comparison of these A...

  2. Greater-than-Class C Low-Level Radioactive Waste Program 1992 baseline strategy

    International Nuclear Information System (INIS)

    1993-02-01

    This baseline strategy document describes Department of Energy (DOE) goals, objectives, and strategy for fulfilling its responsibility to dispose of greater-than-Class C low-level radioactive waste (GTCC LLW) according to the requirements of Section 3(b) of the Low-Level Radioactive Waste Policy Amendments Act of 1985, Public Law 99-240. This document describes the baseline strategy being employed at the end of FY 1992. The strategy for fulfilling the above responsibility consists of three tasks: interim storage of limited quantities of GTCC LLW at a currently operating DOE facility to eliminate a potential public health and safety threcceptance of GTCC LLW for storage in a DOE dedicated facility on an as-needed basis pending disposal; and disposal in a facility licensed by the Nuclear Regulatory Commission. The objectives, assumptions, and strategies for each of these tasks are presented in this plan

  3. Bacteria and viruses modulate FcεRI-dependent mast cell activity 

    Directory of Open Access Journals (Sweden)

    Aleksandra Słodka

    2013-03-01

    Full Text Available Undoubtedly, mast cells play a central role in allergic processes. Specific allergen cross-linking of IgE bound to the high affinity receptors (FcεRI on the mast cell surface leads to the release of preformed mediators and newly synthesized mediators, i.e. metabolites of arachidonic acid and cytokines. More and more data indicate that bacteria and viruses can influence FcεRI-dependent mast cell activation. Some bacterial and viral components can reduce the surface expression of FcεRI. There are also findings that ligation of Toll-like receptors (TLRs by bacterial or viral antigens can affect IgE-dependent mast cell degranulation and preformed mediator release as well as eicosanoid production. The synergistic interaction of TLR ligands and allergen can also modify cytokine synthesis by mast cells stimulated via FcεRI. Moreover, data suggest that specific IgE for bacterial or viral antigens can influence mast cell activity. What is more, some bacterial and viral components or some endogenous proteins produced during viral infection can act as superantigens by interacting with the VH3 domain of IgE. All these observations indicate that bacterial and viral infections modify the course of allergic diseases by affecting FcεRI-dependent mast cell activation. 

  4. Euroopa äriühingu mudel ja selle rakendamine finantssektori äriühingute poolt / Ingrid Ulst

    Index Scriptorium Estoniae

    Ulst, Ingrid, 1977-

    2005-01-01

    SE (Euroopa äriühingu) mudeli olemusest ja SE regulatsiooni olulisematest aspektidest, põgusalt Nordea Bank AB praegusest grupistruktuurist ja võimalikust restruktureerimisest. Lisatud tabel: Nordea Bank AB olulisemad grupiettevõtted ja järelevalve (01/01/2004)

  5. Relationship of Baseline Hemoglobin Level with Serum Ferritin, Postphlebotomy Hemoglobin Changes, and Phlebotomy Requirements among HFE C282Y Homozygotes

    Directory of Open Access Journals (Sweden)

    Seyed Ali Mousavi

    2015-01-01

    Full Text Available Objectives. We aimed to examine whether baseline hemoglobin levels in C282Y-homozygous patients are related to the degree of serum ferritin (SF elevation and whether patients with different baseline hemoglobin have different phlebotomy requirements. Methods. A total of 196 patients (124 males and 72 females who had undergone therapeutic phlebotomy and had SF and both pre- and posttreatment hemoglobin values were included in the study. Results. Bivariate correlation analysis suggested that baseline SF explains approximately 6 to 7% of the variation in baseline hemoglobin. The results also showed that males who had higher (≥150 g/L baseline hemoglobin levels had a significantly greater reduction in their posttreatment hemoglobin despite requiring fewer phlebotomies to achieve iron depletion than those who had lower (<150 g/L baseline hemoglobin, regardless of whether baseline SF was below or above 1000 µg/L. There were no significant differences between hemoglobin subgroups regarding baseline and treatment characteristics, except for transferrin saturation between male subgroups with SF above 1000 µg/L. Similar differences were observed when females with higher (≥138 g/L baseline hemoglobin were compared with those with lower (<138 g/L baseline hemoglobin. Conclusion. Dividing C282Y-homozygous patients into just two subgroups according to the degree of baseline SF elevation may obscure important subgroup variations.

  6. Relationship of Baseline Hemoglobin Level with Serum Ferritin, Postphlebotomy Hemoglobin Changes, and Phlebotomy Requirements among HFE C282Y Homozygotes

    Science.gov (United States)

    Mousavi, Seyed Ali; Mahmood, Faiza; Aandahl, Astrid; Knutsen, Teresa Risopatron; Llohn, Abid Hussain

    2015-01-01

    Objectives. We aimed to examine whether baseline hemoglobin levels in C282Y-homozygous patients are related to the degree of serum ferritin (SF) elevation and whether patients with different baseline hemoglobin have different phlebotomy requirements. Methods. A total of 196 patients (124 males and 72 females) who had undergone therapeutic phlebotomy and had SF and both pre- and posttreatment hemoglobin values were included in the study. Results. Bivariate correlation analysis suggested that baseline SF explains approximately 6 to 7% of the variation in baseline hemoglobin. The results also showed that males who had higher (≥150 g/L) baseline hemoglobin levels had a significantly greater reduction in their posttreatment hemoglobin despite requiring fewer phlebotomies to achieve iron depletion than those who had lower (baseline hemoglobin, regardless of whether baseline SF was below or above 1000 µg/L. There were no significant differences between hemoglobin subgroups regarding baseline and treatment characteristics, except for transferrin saturation between male subgroups with SF above 1000 µg/L. Similar differences were observed when females with higher (≥138 g/L) baseline hemoglobin were compared with those with lower (baseline hemoglobin. Conclusion. Dividing C282Y-homozygous patients into just two subgroups according to the degree of baseline SF elevation may obscure important subgroup variations. PMID:26380265

  7. Comparative study of electron-impact C(1s) core-excitation processes in C{sub 2} and C{sub 2}N{sub 2} molecules

    Energy Technology Data Exchange (ETDEWEB)

    Michelin, S.E. [Departamento de Fisica, Universidade Federal de Santa Catarina, 88040-900 Florianopolis, SC (Brazil)], E-mail: fsc1sem@fsc.ufsc.br; Mazon, K.T.; Arretche, F.; Tenfen, W.; Oliveira, H.L.; Falck, A.S.; Scopel, M.A.; Silva, L.S.S. da [Departamento de Fisica, Universidade Federal de Santa Catarina, 88040-900 Florianopolis, SC (Brazil); Fujimoto, M.M. [Departamento de Fisica, Universidade Federal do Parana, 81531-990 Curitiba, PR (Brazil); Iga, I.; Lee, M.-T. [Departamento de Quimica, Universidade Federal de Sao Carlos, 13565-905, Sao Carlos, SP (Brazil)

    2009-04-15

    Distorted-wave approximation (DWA) is applied to study core-orbital excitations in C{sub 2}and C{sub 2}N{sub 2} molecules by electron impact. More specifically, we report calculated integral cross sections (ICS) for the X{sup 1}{sigma}{sub g}{sup +}{yields}{sup 1,3}{pi}{sub u}(1s{sigma}{sub u}{yields}1p{pi}{sub g}) and X{sup 1}{sigma}{sub g}{sup +}{yields}{sup 1,3}{pi}{sub g}(1s{sigma}{sub g}{yields}1p{pi}{sub g}) transitions in the C{sub 2}, and X{sup 1}{sigma}{sub g}{sup +}{yields}{sup 1,3}{pi}{sub g}(2s{sigma}{sub g}{yields}2p{pi}{sub g}) and X{sup 1}{sigma}{sub g}{sup +}{yields}{sup 1,3}{pi}{sub u}(2s{sigma}{sub u}{yields}2p{pi}{sub g}) transitions in the C{sub 2}N{sub 2} molecules in the 300-800 eV incident energy range. The comparison of the calculated ICS of these targets with the corresponding data for C{sub 2}H{sub 2} presented. Comparison is also made for the theoretical RI(3:1) ratios of these targets which are calculated by dividing the ICS for triplet transitions by the corresponding results for singlet transitions. The similarities and differences of these results, particularly the presence of the shape resonances at near excitation thresholds, are discussed. The influence of the atomic (localized) and molecular (delocalized) characters of the core orbitals on the core-excitation processes is also investigated. In addition, generalized oscillator strengths for the singlet core-orbital transitions are calculated at incident energy of 1290 eV for C{sub 2} and C{sub 2}N{sub 2}. A comparison with the existing theoretical and experimental data for C{sub 2}H{sub 2} is also presented.

  8. Dicty_cDB: Contig-U13057-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nqlnmvnykrfqly*rrm lksfqclmmirelhfmkplqmanwiqciy*liif*ri*kkikfqkl*inkmimvghhfmm l...e B: wptglkkvqnkmy*iekvvhhyiwhvvnhhqqtislivvvilvyqwliyyyyqvhp*lvv hmvdifymklhqkvivitlivs*k*iqilqiqqthsdvhhyl

  9. [Mihai Eminescu luulefestivalil osales Jüri Talvet

    Index Scriptorium Estoniae

    2014-01-01

    Mihai Eminescu luulefestivalil esitleti mahukat tõlkeantoloogiat "Antologia poeziei universal de astăzi" (Craiova: Editura Europa”, 2014), mille on koostanud Ion Deaconescu. Antoloogias on ka Jüri Talveti luulet

  10. The Resilient Schools Consortium (RiSC): Linking Climate Literacy, Resilience Thinking and Service Learning

    Science.gov (United States)

    Branco, B. F.; Fano, E.; Adams, J.; Shon, L.; Zimmermann, A.; Sioux, H.; Gillis, A.

    2017-12-01

    Public schools and youth voices are largely absent from climate resilience planning and projects in New York City. Additionally, research shows that U.S. science teachers' understanding of climate science is lacking, hence there is not only an urgent need to train and support teachers on both the science and pedagogy of climate change, but to link climate literacy, resilience thinking and service learning in K-12 education. However, research on participation of students and teachers in authentic, civic-oriented experiences points to increased engagement and learning outcomes in science. The Resilient Schools Consortium (RiSC) Project will address all these needs through an afterschool program in six coastal Brooklyn schools that engages teachers and urban youth (grades 6-12), in school and community climate resilience assessment and project design. The RiSC climate curriculum, co-designed by New York City school teachers with Brooklyn College, the National Wildlife Federation, New York Sea Grant and the Science and Resilience Institute at Jamaica Bay, will begin by helping students to understand the difference between climate and weather. The curriculum makes extensive use of existing resources such as NOAA's Digital Coast and the Coastal Resilience Mapping Portal. Through a series of four modules over two school years, the six RiSC teams will; 1. explore and understand the human-induced drivers of climate change and, particularly, the significant climate and extreme weather related risks to their schools and surrounding communities; 2. complete a climate vulnerability assessment within the school and the community that is aligned to OneNYC - the city's resilience planning document; 3. design and execute a school-based resilience project; and 4. propose resilience guidelines for NYC Department of Education schools. At the end of each school year, the six RiSC teams will convene a RiSC summit with city officials and resilience practitioners to share ideas and

  11. A1C predicts type 2 diabetes and impaired glucose tolerance in a population at risk: the community diabetes prevention project

    Directory of Open Access Journals (Sweden)

    Leite Silmara AO

    2009-09-01

    Full Text Available Abstract Aims In a population at risk for type 2 diabetes (T2DM, we assessed early physical and metabolic markers that predict progression from normal to impaired glucose tolerance (IGT and T2DM. Methods A total of 388 individuals (22% male, age 46 + 11 years at risk for T2DM were randomized to Standard (n = 182 or Intervention (n = 206 care and evaluated at baseline and 5 annual follow-up visits, including blood pressure, BMI, A1C, lipids, urine albumin/creatinine ratio, VO2max, fasting glucose, insulin and C-peptide. The Standard group received results of annual lab tests and quarterly newsletters, while the Intervention group received quarterly newsletters and detailed discussions of lab results, routine self-directed activities, semi-annual group meetings and monthly telephone calls for ongoing support. Results Overall, 359 (93% returned for at least one follow-up visit and 272 (70% completed the final 5-year assessment. Return rates, changes in measures and incidence of IGT/T2DM were similar between groups. Low cardiorespiratory fitness (VO2max was the most prevalent baseline abnormality. A1C and BMI were significant predictors of IGT/T2DM after controlling for other factors. The risk of IGT/T2DM within 5 years was 17.16 (95% CL: 6.169, 47.736 times greater for those with baseline A1C>=5.8% as compared to those Conclusion Baseline A1C>=5.8% was a significant predictor of IGT/T2DM within 5 years in a population at high risk for T2DM. A1C is routinely performed among patients with diabetes, however these data and other evidence suggest that it may also be a useful tool for risk assessment and screening.

  12. HbA1c as a Predictor of Diabetes and as an Outcome in the Diabetes Prevention Program: A Randomized Clinical Trial

    Science.gov (United States)

    2015-01-01

    OBJECTIVE Glycated hemoglobin (HbA1c), a standard measure of chronic glycemia for managing diabetes, has been proposed to diagnose diabetes and identify people at risk. The Diabetes Prevention Program (DPP) was a 3.2-year randomized clinical trial of preventing type 2 diabetes with a 10-year follow-up study, the DPP Outcomes Study (DPPOS). We evaluated baseline HbA1c as a predictor of diabetes and determined the effects of treatments on diabetes defined by an HbA1c ≥6.5% (48 mmol/mol). RESEARCH DESIGN AND METHODS We randomized 3,234 nondiabetic adults at high risk of diabetes to placebo, metformin, or intensive lifestyle intervention and followed them for the development of diabetes as diagnosed by fasting plasma glucose (FPG) and 2-h postload glucose (2hPG) concentrations (1997 American Diabetes Association [ADA] criteria). HbA1c was measured but not used for study eligibility or outcomes. We now evaluate treatment effects in the 2,765 participants who did not have diabetes at baseline according to FPG, 2hPG, or HbA1c (2010 ADA criteria). RESULTS Baseline HbA1c predicted incident diabetes in all treatment groups. Diabetes incidence defined by HbA1c ≥6.5% was reduced by 44% by metformin and 49% by lifestyle during the DPP and by 38% by metformin and 29% by lifestyle throughout follow-up. Unlike the primary DPP and DPPOS findings based on glucose criteria, metformin and lifestyle were similarly effective in preventing diabetes defined by HbA1c. CONCLUSIONS HbA1c predicted incident diabetes. In contrast to the superiority of the lifestyle intervention on glucose-defined diabetes, metformin and lifestyle interventions had similar effects in preventing HbA1c-defined diabetes. The long-term implications for other health outcomes remain to be determined. PMID:25336746

  13. Thermal characteristic of insulation for optimum design of RI transport package

    International Nuclear Information System (INIS)

    Lee, J. C.; Bang, K. S.; Seo, K. S.

    2002-01-01

    A package to transport the high level radioactive materials in required to withstand the hypothetical accident conditions as well as normal transport conditions according to IAEA and domestic regulations. The regulations require that the package should maintain the shielding, thermal and structural integrities to release no radioactive material. Thermal characteristics of insulations were evaluated and optimum insulation thickness was deduced for RI transport package. The package has a maximum capacity of 600 Curies for Ir-192 sealed source. The insulation thickness was decided with 10 mm of polyurethane form to maintain the thermal safety under fire accident condition. Thermal analysis was carried out for RI transport package, and it was shown that the thermal integrity of the package was maintained. The results obtained this study will be applied to a basic data for design of RI transport cask

  14. Beam optics simulation of rare-RI ring at RI beam factory in RIKEN

    International Nuclear Information System (INIS)

    Arai, I.; Ozawa, A.; Yasuda, Y.

    2009-01-01

    The cyclotron-like storage ring dedicated to Rare-RI Ring project consists of 6 magnetic sectors and 6 straight sections, having a circumference of 56.13 m. The magnetic sector works for both bending and focusing. The total circulation is assumed to be 1,000 turns. Over the momentum range from -1% to +1% in ∆p/p, the required isochronicity is 10 -6 while the beam emittance is several tens of π mm-mrad. To examine the design of cyclotron-like storage ring and fix its parameters, we have developed a high precision beam optics simulation. To achieve the precision as high as possible within a feasible computational time, we have adopted a geometrical tracking assuming a circular orbit for a small spatial segment. For that purpose, it is enough that the magnetic sector is divided into 150 sub-sectors in calculation. In each sub-sector, the magnetic field is given as a function of radial position but uniform around the vicinity of beam trajectory. The beam trajectory is evaluated in 4th order Runge-Kutta algorithm. Finally, we have achieved a precision of 10 -9 in ∆T/T and a computational time of 1.8 sec on a typical PC server for ray tracing of single particle undergoing a circulation of 1,000 turns. (author)

  15. Serum cystatin C is an independent biomarker associated with the renal resistive index in patients with chronic kidney disease.

    Science.gov (United States)

    Ogawa-Akiyama, Ayu; Sugiyama, Hitoshi; Kitagawa, Masashi; Tanaka, Keiko; Onishi, Akifumi; Yamanari, Toshio; Morinaga, Hiroshi; Uchida, Haruhito Adam; Nakamura, Kazufumi; Ito, Hiroshi; Wada, Jun

    2018-01-01

    Cystatin C is a cysteine protease inhibitor that is produced by nearly all human cells. The serum level of cystatin C is a stronger predictor of the renal outcome and the risk of cardiovascular events than the creatinine level. The resistive index (RI) on renal Doppler ultrasonography is a good indicator of vascular resistance as well as the renal outcomes in patients with chronic kidney disease (CKD). However, it is unclear whether serum cystatin C is associated with signs of vascular dysfunction, such as the renal RI. We measured the serum cystatin C levels in 101 CKD patients and investigated the relationships between cystatin C and markers of vascular dysfunction, including the renal RI, ankle-brachial pulse wave velocity (baPWV), intima-media thickness (IMT), and cardiac function. The renal RI was significantly correlated with the serum cystatin C level (p < 0.0001, r = 0.6920). The serum cystatin C level was found to be a significant determinant of the renal RI (p < 0.0001), but not the baPWV, in a multivariate regression analysis. The multivariate odds ratio of the serum cystatin C level for a renal RI of more than 0.66 was statistically significant (2.92, p = 0.0106). The area under the receiver-operating characteristic curve comparing the sensitivity and specificity of cystatin C for predicting an RI of more than 0.66 was 0.882 (cutoff value: 2.04 mg/L). In conclusion, the serum cystatin C level is an independent biomarker associated with the renal RI in patients with CKD.

  16. Preliminary Beam Irradiation Test for RI Production Targets at KOMAC

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Sang Pil; Kwon, Hyeok Jung; Kim, Han Sung; Cho, Yong Sub; Seol, Kyung Tae; Song, Young Gi; Kim, Dae Il; Jung, Myung Hwan; Kim, Kye Ryung; Min, Yi Sub [KAERI, Daejeon (Korea, Republic of)

    2016-05-15

    The new beamline and target irradiation facility has been constructed for the production of therapeutic radio-isotope. Sr-82 and Cu-67 were selected as the target isotope in this facility, they are promising isotope for the PET imaging and cancer therapy. For the facility commissioning, the irradiation test for the prototype-target was conducted to confirm the feasibility of radio-isotope production, the proto-type targets are made of RbCl pellet and the natural Zn metal for Sr-82 and Cu-67 production respectively, In this paper, an introduction to the RI production targetry system and the results of the preliminary beam irradiation test are discussed. the low-flux beam irradiation tests for proto-type RI target have been conducted. As a result of the beam irradiation tests, we could obtain the evidence of Sr-82 and Cu-67 production, have confirmed the feasibility of Sr-82 and Cu-67 production at KOMAC RI production facility.

  17. Preliminary Beam Irradiation Test for RI Production Targets at KOMAC

    International Nuclear Information System (INIS)

    Yoon, Sang Pil; Kwon, Hyeok Jung; Kim, Han Sung; Cho, Yong Sub; Seol, Kyung Tae; Song, Young Gi; Kim, Dae Il; Jung, Myung Hwan; Kim, Kye Ryung; Min, Yi Sub

    2016-01-01

    The new beamline and target irradiation facility has been constructed for the production of therapeutic radio-isotope. Sr-82 and Cu-67 were selected as the target isotope in this facility, they are promising isotope for the PET imaging and cancer therapy. For the facility commissioning, the irradiation test for the prototype-target was conducted to confirm the feasibility of radio-isotope production, the proto-type targets are made of RbCl pellet and the natural Zn metal for Sr-82 and Cu-67 production respectively, In this paper, an introduction to the RI production targetry system and the results of the preliminary beam irradiation test are discussed. the low-flux beam irradiation tests for proto-type RI target have been conducted. As a result of the beam irradiation tests, we could obtain the evidence of Sr-82 and Cu-67 production, have confirmed the feasibility of Sr-82 and Cu-67 production at KOMAC RI production facility

  18. Pharmacist-led, primary care-based disease management improves hemoglobin A1c in high-risk patients with diabetes.

    Science.gov (United States)

    Rothman, Russell; Malone, Robb; Bryant, Betsy; Horlen, Cheryl; Pignone, Michael

    2003-01-01

    We developed and evaluated a comprehensive pharmacist-led, primary care-based diabetes disease management program for patients with Type 2 diabetes and poor glucose control at our academic general internal medicine practice. The primary goal of this program was to improve glucose control, as measured by hemoglobin A1c (HbA1c). Clinic-based pharmacists offered support to patients with diabetes through direct teaching about diabetes, frequent phone follow-up, medication algorithms, and use of a database that tracked patient outcomes and actively identified opportunities to improve care. From September 1999, to May 2000, 159 subjects were enrolled, and complete follow-up data were available for 138 (87%) patients. Baseline HbA1c averaged 10.8%, and after an average of 6 months of intervention, the mean reduction in HbA1c was 1.9 percentage points (95% confidence interval, 1.5-2.3). In predictive regression modeling, baseline HbA1c and new onset diabetes were associated with significant improvements in HbA1c. Age, race, gender, educational level, and provider status were not significant predictors of improvement. In conclusion, a pharmacist-based diabetes care program integrated into primary care practice significantly reduced HbA1c among patients with diabetes and poor glucose control.

  19. Identifying the independent effect of HbA1c variability on adverse health outcomes in patients with Type 2 diabetes.

    Science.gov (United States)

    Prentice, J C; Pizer, S D; Conlin, P R

    2016-12-01

    To characterize the relationship between HbA 1c variability and adverse health outcomes among US military veterans with Type 2 diabetes. This retrospective cohort study used Veterans Affairs and Medicare claims for veterans with Type 2 diabetes taking metformin who initiated a second diabetes medication (n = 50 861). The main exposure of interest was HbA 1c variability during a 3-year baseline period. HbA 1c variability, categorized into quartiles, was defined as standard deviation, coefficient of variation and adjusted standard deviation, which accounted for the number and mean number of days between HbA 1c tests. Cox proportional hazard models predicted mortality, hospitalization for ambulatory care-sensitive conditions, and myocardial infarction or stroke and were controlled for mean HbA 1c levels and the direction of change in HbA 1c levels during the baseline period. Over a mean 3.3 years of follow-up, all HbA 1c variability measures significantly predicted each outcome. Using the adjusted standard deviation measure for HbA 1c variability, the hazard ratios for the third and fourth quartile predicting mortality were 1.14 (95% CI 1.04, 1.25) and 1.42 (95% CI 1.28, 1.58), for myocardial infarction and stroke they were 1.25 (95% CI 1.10, 1.41) and 1.23 (95% CI 1.07, 1.42) and for ambulatory-care sensitive condition hospitalization they were 1.10 (95% CI 1.03, 1.18) and 1.11 (95% CI 1.03, 1.20). Higher baseline HbA 1c levels independently predicted the likelihood of each outcome. In veterans with Type 2 diabetes, greater HbA 1c variability was associated with an increased risk of adverse long-term outcomes, independently of HbA 1c levels and direction of change. Limiting HbA 1c fluctuations over time may reduce complications. © 2016 Diabetes UK.

  20. Võrguäri Eestis kiratseb / Indrek Kald

    Index Scriptorium Estoniae

    Kald, Indrek, 1974-

    2004-01-01

    Autor otsib põhjusi, miks tänavuse Interneti-kaupluste edetabeli koostamiseks saatis oma äritulemused vaid viis võrgukauplust. Zebra Infosüsteemide tegevjuhi Peeter Tamme arvamus e-äri kiratsemise põhjuste kohta

  1. Narragansett, RI Lab--Office of Research and Development

    Science.gov (United States)

    The EPA-ORD laboratory in Narragansett, RI is a recognized leader in scientific knowledge and expertise concerning the ecology of oceans, estuaries, and water-sheds, and the effects of human activities on that ecology.

  2. 77 FR 43514 - Anchorage Regulations; Narragansett Bay and Rhode Island Sound, RI

    Science.gov (United States)

    2012-07-25

    ...-AA01 Anchorage Regulations; Narragansett Bay and Rhode Island Sound, RI AGENCY: Coast Guard, DHS... Narragansett Bay, Rhode Island, and adding an offshore anchorage in Rhode Island Sound south of Brenton Point... rulemaking (NPRM) entitled ``Anchorage Regulations; Narragansett Bay and Rhode Island Sound, RI,'' in the...

  3. Elagu eesti energia : Jaan ja Jüri Ojaver, Paul Rodgers / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2001-01-01

    Paul Rodgersi, Jüri ja Jaan Ojaveri ühisnäitusest "Koostöö" Rakvere Kesklinna galeriis. P. Rodgersilt ja Jüri Ojaverilt on väljas Viinist "Eesti energia" näituselt naasnud tööd, Jaan Ojaverilt minimalistlikud tööriistad-objektid

  4. Alcohol binding in the C1 (C1A + C1B) domain of protein kinase C epsilon

    Science.gov (United States)

    Pany, Satyabrata; Das, Joydip

    2015-01-01

    Background Alcohol regulates the expression and function of protein kinase C epsilon (PKCε). In a previous study we identified an alcohol binding site in the C1B, one of the twin C1 subdomains of PKCε. Methods In this study, we investigated alcohol binding in the entire C1 domain (combined C1A and C1B) of PKCε. Fluorescent phorbol ester, SAPD and fluorescent diacylglycerol (DAG) analog, dansyl-DAG were used to study the effect of ethanol, butanol, and octanol on the ligand binding using fluorescence resonance energy transfer (FRET). To identify alcohol binding site(s), PKCεC1 was photolabeled with 3-azibutanol and 3-azioctanol, and analyzed by mass spectrometry. The effects of alcohols and the azialcohols on PKCε were studied in NG108-15 cells. Results In the presence of alcohol, SAPD and dansyl-DAG showed different extent of FRET, indicating differential effects of alcohol on the C1A and C1B subdomains. Effects of alcohols and azialcohols on PKCε in NG108-15 cells were comparable. Azialcohols labeled Tyr-176 of C1A and Tyr-250 of C1B. Inspection of the model structure of PKCεC1 reveals that these residues are 40 Å apart from each other indicating that these residues form two different alcohol binding sites. Conclusions The present results provide evidence for the presence of multiple alcohol-binding sites on PKCε and underscore the importance of targeting this PKC isoform in developing alcohol antagonists. PMID:26210390

  5. Helilooja Jüri Dmitrievi loominguline õhtu / Vladislav Horuzhenko

    Index Scriptorium Estoniae

    Horuzhenko, Vladislav

    2006-01-01

    Viiuldajast, pianistist ja heliloojast Jüri Dmitrievist. Loomingulisest õhtust 8. okt. Pärnu raekojas Pärnumaa Rahvakultuuri Keskseltsi korraldatava projekti "Inimesed Pärnumaa kultuurimaastikul" raames

  6. Targeting allergen to FcgammaRI reveals a novel T(H)2 regulatory pathway linked to thymic stromal lymphopoietin receptor.

    Science.gov (United States)

    Hulse, Kathryn E; Reefer, Amanda J; Engelhard, Victor H; Patrie, James T; Ziegler, Steven F; Chapman, Martin D; Woodfolk, Judith A

    2010-01-01

    The molecule H22-Fel d 1, which targets cat allergen to FcgammaRI on dendritic cells (DCs), has the potential to treat cat allergy because of its T-cell modulatory properties. We sought to investigate whether the T-cell response induced by H22-Fel d 1 is altered in the presence of the T(H)2-promoting cytokine thymic stromal lymphopoietin (TSLP). Studies were performed in subjects with cat allergy with and without atopic dermatitis. Monocyte-derived DCs were primed with H22-Fel d 1 in the presence or absence of TSLP, and the resulting T-cell cytokine repertoire was analyzed by flow cytometry. The capacity for H22-Fel d 1 to modulate TSLP receptor expression on DCs was examined by flow cytometry in the presence or absence of inhibitors of Fc receptor signaling molecules. Surprisingly, TSLP alone was a weak inducer of T(H)2 responses irrespective of atopic status; however, DCs coprimed with TSLP and H22-Fel d 1 selectively and synergistically amplified T(H)2 responses in highly atopic subjects. This effect was OX40 ligand independent, pointing to an unconventional TSLP-mediated pathway. Expression of TSLP receptor was upregulated on atopic DCs primed with H22-Fel d 1 through a pathway regulated by FcgammaRI-associated signaling components, including src-related tyrosine kinases and Syk, as well as the downstream molecule phosphoinositide 3-kinase. Inhibition of TSLP receptor upregulation triggered by H22-Fel d 1 blocked TSLP-mediated T(H)2 responses. Discovery of a novel T(H)2 regulatory pathway linking FcgammaRI signaling to TSLP receptor upregulation and consequent TSLP-mediated effects questions the validity of receptor-targeted allergen vaccines. Copyright 2010 American Academy of Allergy, Asthma & Immunology. Published by Mosby, Inc. All rights reserved.

  7. 40 CFR 74.20 - Data for baseline and alternative baseline.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Data for baseline and alternative baseline. 74.20 Section 74.20 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... baseline and alternative baseline. (a) Acceptable data. (1) The designated representative of a combustion...

  8. An alternative approach to modelling HbA1c trajectories in patients with type 2 diabetes mellitus.

    Science.gov (United States)

    McEwan, Phil; Bennett, Hayley; Qin, Lei; Bergenheim, Klas; Gordon, Jason; Evans, Marc

    2017-05-01

    Time-dependent HbA1c trajectories in health economic models of type 2 diabetes mellitus (T2DM) are typically informed by the UK Prospective Diabetes Study (UKPDS). However, this approach may not accurately predict HbA1c progression in patients who do not conform to the demographic profile of the original UKPDS cohort. This study aimed to develop an alternative mathematical model (MM) to simulate HbA1c progression in T2DM. A systematic literature review identified studies, published between 2005 and 2015, that reported HbA1c in adult T2DM patients over a minimum duration of 18 months. Pooled data from eligible studies were used to develop an alternative MM equation for HbA1c progression, which was then contrasted with the UKPDS 68 progression equation in illustrative scenarios. A total of 68 studies were eligible for data extraction (mean follow-up time 4.1 years). HbA1c progression was highly heterogeneous across studies, varying with baseline HbA1c, treatment group and patient age. The MM equation was fitted with parameters for mean baseline HbA1c (8.3%), initial change in HbA1c (-0.62%) and upper quartile of maximum observed HbA1c (9.3%). Differences in HbA1c trajectories between the MM and UKPDS approaches altered the timing of therapy escalation in illustrative scenarios. The MM represents an alternative approach to simulate HbA1c trajectories in T2DM models, as UKPDS data may not adequately reflect the heterogeneity of HbA1c profiles observed in clinical studies. However, the choice of approach should ultimately be determined by the characteristics of individual patients under consideration and the clinical face validity of the modelled trajectories. © 2016 John Wiley & Sons Ltd.

  9. The Ri chicken breed and livelihoods in North Vietnam: characterization and prospects

    Directory of Open Access Journals (Sweden)

    Pascal Leroy

    2011-06-01

    Full Text Available For the last twenty years, the consumption of poultry meat has boomed in Vietnam as in the rest of the developing world. Capital-intensive production has grown rapidly to satisfy this demand. Based on a few numbers of genetically uniform strains, these systems threaten biodiversity. In Vietnam, both rural and urban households still keep indigenous chickens as part of a diversified livelihood portfolio. In line with the national in situ conservation strategy, this study approached the context of local poultry keeping in two rural and one suburban districts of Northern Vietnam. It aimed at understanding households’ willingness, constraints and opportunities for practice improvement, including breeds’ management. As the Ri chicken constitutes the large majority of backyard flocks, two particular objectives of this study are the morpho-biometric characterisation of phenotypic diversity among individuals classified as Ri by farmers and an assessment of their productive potential. Chicken was found to hold a different place in livelihoods of the three districts with consequences on the management of genetic resources. The most favourable conditions for improvement of the Ri breed was found in the rural district of Luong-Son, due to market integration. In the more remote district of Ky-Son, living standards were lower and much would be gained from Ri conservation. Ri breed was the most threatened in the suburban Gia-Lam district, where poultry was a minor side-activity, lacking incentive for genetic management. From motives and constraints, tracks about breeding goals are suggested. Further considerations about conservation, improvement, market integration and livelihoods are proposed.

  10. Activation and amplification of c-Ki-ras in a chemically induced transplantable human pancreas carcinoma

    International Nuclear Information System (INIS)

    Parsa, I.; Maheshwari, K.K.

    1986-01-01

    Increasing evidence suggests that carcinogenesis is associated with the stepwise activation of oncogenes. The c-Ki-ras oncogene has been demonstrated in several human solid tumors and is shown to be amplified in tumor cell lines. The authors have probed endonuclease cleaved human pancreas (HP) DNAs and DNAs from an in vitro induced transplantable human pancreas carcinoma (HP-T1) for the presence and/or amplification of c-Ki-ras oncogene. The DNAs were cleaved with BamHI, BgIII, EcoRI, HhaI, HinfI, KpnI, PSTI, PvuII, SaII, SstI, TaqI or XbaI and were subjected to Southern blot analysis using 32 P-labelled EcoRI fragments from HiHi3 clone. The hybridization profiles were similar in both DNAs when digested with BamHI, BgIII, HinfI, KpnI, SaII, SstI, or TaqI. The EcoRI cleaved DNAs from HP and HP-T1 revealed two hybridizing fragments of 6.8 and 3.0 kbp. The 3.0 kbp fragments in DNA from HP-T1 showed more than a 100 folds enhancement as compared to that of HP. The 6.8 hybridizing fragments also appeared 10 fold greater in HP-T1 DNA. Similar enhancements were also present in HP-T1 DNA cleaved with PstI and PvuII. Preliminary results from comparison of poly(A) + RNAs, prepared from total HP and HP-T1 RNAs, by Northern blot analysis using the same probe reflect similar enhancement in RNA from transplantable pancreas carcinoma

  11. Verbascum kurdistanicum (Scrophulariaceae, a new species from Hakkâri, Turkey

    Directory of Open Access Journals (Sweden)

    Mehmet Fırat

    2015-07-01

    Full Text Available Verbascum kurdistanicum Fırat (Scrophulariaceae, is described and illustrated as a new species that is located in Hakkâri, Turkey. In this study, diagnostic morphological characters of this and closely related species (V. oreophilum K.Koch and V. pyramidatum M. Bieb are discussed. Furthermore, distribution maps for the three taxa are provided.

  12. Glycated haemoglobin (HbA1c), diabetes and trajectories of change in episodic memory performance.

    Science.gov (United States)

    Pappas, Colleen; Andel, Ross; Infurna, Frank J; Seetharaman, Shyam

    2017-02-01

    As the ageing population grows, it is important to identify strategies to moderate cognitive ageing. We examined glycated haemoglobin (HbA1c) and diabetes in relation to level and change in episodic memory in older adults with and without diabetes. Data from 4419 older adults with (n=950) and without (n=3469) diabetes participating in a nationally representative longitudinal panel study (the Health and Retirement Study) were examined. Average baseline age was 72.66 years and 58% were women. HbA1c was measured in 2006 and episodic memory was measured using immediate and delayed list recall over 4 biennial waves between 2006 and 2012. Growth curve models were used to assess trajectories of episodic memory change. In growth curve models adjusted for age, sex, education, race, depressive symptoms and waist circumference, higher HbA1c levels and having diabetes were associated with poorer baseline episodic memory (p=0.036 and HbA1c on episodic memory decline was smaller than the effect of age. The results were stronger for women than men and were not modified by age or race. When the main analyses were estimated for those with and without diabetes separately, HbA1c was significantly linked to change in episodic memory only among those with diabetes. Higher HbA1c and diabetes were both associated with declines in episodic memory, with this relationship further exacerbated by having diabetes and elevated HbA1c. HbA1c appeared more important for episodic memory performance among women than men. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  13. A Diabetes Mobile App With In-App Coaching From a Certified Diabetes Educator Reduces A1C for Individuals With Type 2 Diabetes.

    Science.gov (United States)

    Kumar, Shefali; Moseson, Heidi; Uppal, Jaspreet; Juusola, Jessie L

    2018-06-01

    Purpose There are currently many diabetes apps available, but there is limited evidence demonstrating clinical impact. The purpose of this study is to evaluate the impact of a diabetes mobile app with in-app coaching by a certified diabetes educator on glycemic control for individuals with type 2 diabetes. Methods A 12 week-long single-arm intent-to-treat trial evaluated the impact of a diabetes mobile app and coaching program (One Drop | Mobile With One Drop | Experts), which facilitated tracking of self-care and included an in-app diabetes education program, on A1C for individuals with type 2 diabetes and an A1C ≥7.5% (58 mmol/mol). An online study platform (Achievement Studies, Evidation Health Inc, San Mateo, CA) was used to screen, consent, and enroll participants; collect study data; and track participants' progress throughout the study. Baseline and study end A1C measurements as well as questionnaire data from participants were collected. Results Participants (n = 146) were 52 ± 9 years old, 71% female, 25% black or Hispanic, diagnosed with diabetes for 11 ± 7 years, and with a mean baseline A1C of 9.87% ± 2.0 (84 mmol/mol). In adjusted repeated measures models, mean A1C improved by -0.86% among study completers (n = 127), -0.96% among active users of the app and coaching program (n = 93), and -1.32% among active users with a baseline A1C ≥9.0% (75 mmol/mol) (n = 53). Conclusions This program was associated with a clinically meaningful and significant reduction in A1C and can potentially increase access to effective diabetes self-management education and support for individuals with diabetes.

  14. ri Talvet maailmaluule tõlgendajana / Jüri Talvet’s Interpretations of World Poetry

    OpenAIRE

    Lauri Pilter

    2016-01-01

    Teesid: Tartu Ülikooli maailmakirjanduse professori, luuletaja, kirjandusteadlase ja hispaaniakeelse kirjanduse spetsialisti Jüri Talveti tõlketegevuse viljade hulka kuulub luulet ja proosat nii sajandeid vanast Hispaania klassikast kui ka 20. sajandil või tänapäeval romaani keeltes või inglise keeles loodud teostest. Käesolev artikkel keskendub sellele, kuidas professor Talvet on tõlgendanud luule ja poeetika, kuid ka kirjandusajaloo, iseäranis barokk-kirjanduse alaseid küsimusi oma kirjandu...

  15. Listeria monocytogenes in RTE foods marketed in Italy: prevalence and automated EcoRI ribotyping of the isolates.

    Science.gov (United States)

    Meloni, Domenico; Galluzzo, Pietro; Mureddu, Anna; Piras, Francesca; Griffiths, Mansel; Mazzette, Rina

    2009-02-15

    The aims of the present study were: (a) to investigate the prevalence and the enumeration of Listeria monocytogenes in 200 samples of ready to eat (RTE) foods of animal and vegetal origin collected from different outlets and processing plants in Sardinia; (b) to characterize the isolates by phenotypical and molecular methods; (c) to analyze a subset of 42 L. monocytogenes by automated EcoRI ribotyping in order to predict the strain's potential virulence for humans. The strains were isolated from: smoked fish products, cooked marinated products, meat products and pre-packaged mixed vegetable salads. Of the samples tested, 22% were positive for Listeria spp. The prevalence of L. monocytogenes was 9.5%, while the level of L. monocytogenes in the positive samples was 93%), belonging to 17 different DuPont Identification Library Codes (DUP-IDs) clones. The Simpson's numerical index of discrimination was 0.911. Cluster analysis pointed out a high similarity among strains isolated from meat, fish, and vegetables of different origin. These results confirmed the existence of a widespread population of L. monocytogenes, characterized by highly related strains existing in different geographical areas. 65% of these strains belonged to lineage II (serotypes 1/2a and 1/2c), subtypes known to be associated with sporadic human listeriosis outbreaks. The remaining 35% of the isolates (serotypes 1/2b, 3b and 4b) were allocated to lineage I and belong to distinct clonal groups (DUP-ID 1038 and 1042), which again have been associated with several outbreaks of human listeriosis. Neither atypical profiles nor lineage III strains were found. EcoRI ribotyping was confirmed as a rapid and reliable method for L. monocytogenes typing, providing useful data for epidemiologic and clonality surveys of L. monocytogenes strains isolated from RTE foods.

  16. RiSA: A Science Festival for the Bilingual and Bicultural Rio Grande Valley

    Science.gov (United States)

    Key, Joey Shapiro; Torres, Cristina; Stone, Robert

    2014-03-01

    The Rio Grande Science and Arts (RiSA) Festival organized by the Center for Gravitational Wave Astronomy (CGWA) at the University of Texas at Brownsville (UTB) will use a wide variety of artforms to bring physics and science topics to the bilingual and bicultural population of the Rio Grande Valley of South Texas. The science and art faculty at UTB will partner with art and education professionals to create an annual community event celebrating science though art. Music, dance, poetry, and visual arts will headline the festival activities. Festival events and products will be produced in both English and Spanish to attract and inform the bilingual local community. The RiSA Festival is supported by the Science Festival Alliance and the Sloan Foundation. Supported by the Science Festival Alliance and the Sloan Foundation.

  17. A nomogram to estimate the HbA1c response to different DPP-4 inhibitors in type 2 diabetes: a systematic review and meta-analysis of 98 trials with 24 163 patients

    Science.gov (United States)

    Esposito, Katherine; Chiodini, Paolo; Maiorino, Maria Ida; Capuano, Annalisa; Cozzolino, Domenico; Petrizzo, Michela; Bellastella, Giuseppe; Giugliano, Dario

    2015-01-01

    Objectives To develop a nomogram for estimating the glycated haemoglobin (HbA1c) response to different dipeptidyl peptidase-4 (DPP-4) inhibitors in type 2 diabetes. Design A systematic review and meta-analysis of randomised controlled trials (RCTs) of DPP-4 inhibitors (vildagliptin, sitagliptin, saxagliptin, linagliptin and alogliptin) on HbA1c were conducted. Electronic searches were carried out up to December 2013. Trials were included if they were carried out on participants with type 2 diabetes, lasted at least 12 weeks, included at least 30 participants and had a final assessment of HbA1c. A random effect model was used to pool data. A nomogram was used to represent results of the metaregression model. Participants Adults with type 2 diabetes. Interventions Any DPP-4 inhibitor (vildagliptin, sitagliptin, saxagliptin, linagliptin or alogliptin). Outcome measures The HbA1c response to each DPP-4 inhibitor within 1 year of therapy. Results We screened 928 citations and reviewed 98 articles reporting 98 RCTs with 100 arms in 24 163 participants. There were 26 arms with vildagliptin, 37 with sitagliptin, 13 with saxagliptin, 13 with linagliptin and 11 with alogliptin. For all 100 arms, the mean baseline HbA1c value was 8.05% (64 mmol/mol); the decrease of HbA1c from baseline was −0.77% (95% CI −0.82 to −0.72%), with high heterogeneity (I2=96%). Multivariable metaregression model that included baseline HbA1c, type of DPP-4 inhibitor and fasting glucose explained 58% of variance between studies, with no significant interaction between them. Other factors, including age, previous diabetes drugs and duration of treatment added low predictive power (HbA1c reduction from baseline using the type of DPP-4 inhibitor, baseline values of HbA1c and fasting glucose. Conclusions Baseline HbA1c level and fasting glucose explain most of the variance in HbA1c change in response to DPP-4 inhibitors: each increase of 1.0% units HbA1c provides a 0.4–0.5% units greater

  18. Corrective action baseline report for underground storage tank 2331-U Building 9201-1

    International Nuclear Information System (INIS)

    1994-01-01

    The purpose of this report is to provide baseline geochemical and hydrogeologic data relative to corrective action for underground storage tank (UST) 2331-U at the Building 9201-1 Site. Progress in support of the Building 9201-1 Site has included monitoring well installation and baseline groundwater sampling and analysis. This document represents the baseline report for corrective action at the Building 9201-1 site and is organized into three sections. Section 1 presents introductory information relative to the site, including the regulatory initiative, site description, and progress to date. Section 2 includes the summary of additional monitoring well installation activities and the results of baseline groundwater sampling. Section 3 presents the baseline hydrogeology and planned zone of influence for groundwater remediation

  19. The role of the observational approach in RI planning: WAG 5 case study

    International Nuclear Information System (INIS)

    Brill, A.K.; Kuhaida, A.J. Jr.

    1992-10-01

    A Remedial Investigation (RI) Plan was developed for the Oak Ridge National Laboratory (ORNL) Waste Area Grouping (WAG) 5 in March 1988 and submitted to the Environmental Protection Agency (EPA) Region IV and the State of Tennessee for review and approval. The observational approach was evaluated by the ORNL Environmental Restoration (ER) Program and accepted by EPA as an accelerated and cost-effective approach to the RI/Feasibility Study (FS) process for remediation of WAG 5. The traditional approach used in preparing the 1988 RI Plan focused on data completeness, included a typical range of RI data-gathering activities for determining the nature and extent of contamination at WAG 5, and used multiple iterations of sampling activities to deal with uncertainties without consideration of potential deviations. In fall 1991, a revised Field Sampling Plan (FSP) was developed that used the observational approach to integrate site characterization with site remediation needs. This approach recognized the uncertainties of site characterization/remedial planning and developed contingency plans for dealing with them. The observational approach emphasizes data sufficiency to support remedial planning decisions for WAG 5

  20. Eksjuhtide hoogne kinnisvaraäri / Koit Brinkmann

    Index Scriptorium Estoniae

    Brinkmann, Koit

    2007-01-01

    Endised Skanska EMV juhid Jaanus Otsa ja Olaf Herman ajasid põhitöökoha kõrvalt tulusat eraäri. Lisad: Skanska partnerlus Mati Tusoviga; Palju firmasid, kuid samad nimed; Väljavõte Skanska eetikakoodeksist. Kommenteerib Mika Toivola

  1. COOMET.RI(I)-K1 comparison of national measurement standards of air kerma for 60Co γ radiation

    International Nuclear Information System (INIS)

    Buermann, L.; Oborin, A.V.; Dobrovosky, J.; Milevsky, V.S.; Walwyn Salas, G.; Lapenas, A.

    2009-01-01

    Results are presented of the COOMET key comparison of the national measurement standards of air kerma for 60 Co γ radiation. Participants of the comparison were PTB (Germany, pilot institute), VNIIM (Russia), SMU (Slovakia), BelGIM (Belarus), CPHR (Cuba) and RMTC (Latvia). PTB, VNIIM and SMU had previously taken part in a key comparison with the Bureau International de Poids et Mesures (BIPM) and operated as link laboratories in order to evaluate the degree of equivalence of the participants' results with the key comparison reference value. These data form the basis of the results entered into the BIPM key comparison database for comparison COOMET.RI(I)-K1. (authors)

  2. Fall in C-Peptide During First 4 Years From Diagnosis of Type 1 Diabetes: Variable Relation to Age, HbA1c, and Insulin Dose

    OpenAIRE

    Hao, Wei; Gitelman, Steven; DiMeglio, Linda A.; Boulware, David; Greenbaum, Carla J.

    2016-01-01

    OBJECTIVE We aimed to describe the natural history of residual insulin secretion in Type 1 Diabetes TrialNet participants over 4 years from diagnosis and relate this to previously reported alternative clinical measures reflecting β-cell secretory function. RESEARCH DESIGN AND METHODS Data from 407 subjects from 5 TrialNet intervention studies were analyzed. All subjects had baseline stimulated C-peptide values of ≥0.2 nmol/L from mixed-meal tolerance tests (MMTTs). During semiannual visits, C...

  3. A histopathological score on baseline biopsies from elderly donors predicts outcome 1 year after renal transplantation

    DEFF Research Database (Denmark)

    Toft, Birgitte G; Federspiel, Birgitte H; Sørensen, Søren S

    2012-01-01

    wall thickness of arteries and/or arterioles. Nineteen renal baseline biopsies from 15 donors (age: 64 ± 10 years) were included and following consensus the histopathological score was 4.3 ± 2.1 (intraclass correlation coefficient: 0.81; confidence interval: 0.66-0.92). The donor organs were used......Kidneys from elderly deceased patients and otherwise marginal donors may be considered for transplantation and a pretransplantation histopathological score for prediction of postoperative outcome is warranted. In a retrospective design, 29 baseline renal needle biopsies from elderly deceased donors...... Danish donors a histopathological score on baseline renal needle biopsies, with at least ten glomeruli and one artery present, predicts graft function 1 year after transplantation....

  4. Hispaania kirjanduse elav keha / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1996-01-01

    Keha ja kehatus hispaania kirjanduses (Cervantese Dulcinea, Sancho Panza, don Quijote) ja maailmakirjanduses esinevate tegelaskujude näiteil : Ka Tõnu Õnnepalu Joonatanist romaanis 'Hind'. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 469-473

  5. Transgenic fertile Scoparia dulcis L., a folk medicinal plant, conferred with a herbicide-resistant trait using an Ri binary vector.

    Science.gov (United States)

    Yamazaki, M; Son, L; Hayashi, T; Morita, N; Asamizu, T; Mourakoshi, I; Saito, K

    1996-01-01

    Transgenic herbicide-resistant Scoparia dulcis plants were obtained by using an Ri binary vector system. The chimeric bar gene encoding phosphinothricin acetyltransferase flanked by the promoter for cauliflower mosaic virus 35S RNA and the terminal sequence for nopaline synthase was introduced in the plant genome by Agrobacterium-mediated transformation by means of scratching young plants. Hairy roots resistant to bialaphos were selected and plantlets (R0) were regenerated. Progenies (S1) were obtained by self-fertilization. The transgenic state was confirmed by DNA-blot hybridization and assaying of neomycin phosphotransferase II. Expression of the bar gene in the transgenic R0 and S1 progenies was indicated by the activity of phosphinothricin acetyltransferase. Transgenic plants accumulated scopadulcic acid B, a specific secondary metabolite of S. dulcis, in amounts of 15-60% compared with that in normal plants. The transgenic plants and progenies showed resistant trait towards bialaphos and phosphinothricin. These results suggest that an Ri binary system is one of the useful tools for the transformation of medicinal plants for which a regeneration protocol has not been established.

  6. Linnapea, keda rõõmustab titekisa / Jüri Ratas ; interv. Riina Luik

    Index Scriptorium Estoniae

    Ratas, Jüri, 1978-

    2006-01-01

    Tallinna linnapea vastab küsimustele, mis puudutavad tema suhtumist opositsiooni kriitikasse, linna juhtimist, perekonda, lapsepõlve, spordiga tegelemist, sõpruskonda, eraettevõtlusest loobumist ning suhteid kirikuga. Lisa: Jüri Ratas (27). Vt. samas lühiintervjuud linnapea abikaasa Karin Ratasega. Kommenteerib Jüri Ratase endine klassijuhataja Nõmme gümnaasiumist, võrkpallitreener Raimund Pundi

  7. Eielson Air Force Base OU-1 baseline risk assessment

    International Nuclear Information System (INIS)

    Jarvis, M.T.; Jarvis, T.T.; Van Houten, N.C.; Lewis, R.E.

    1993-09-01

    This Baseline Risk Assessment report is the second volume in a set of three volumes for operable Unit 1 (OU-1). The companion documents contain the Remedial Investigation and the Feasibility Study. Operable Unit 1 (OU-1) is one of several groups of hazardous waste sites located at Eielson Air Force Base (AFB) near Fairbanks, Alaska. The operable units at Eielson are typically characterized by petroleum, oil, lubricant/solvent contamination, and by the presence of organics floating at the water table. In 1989 and 1990, firms under contract to the Air Force conducted field studies to gather information about the extent of chemical contamination in soil, groundwater, and soil air pore space (soil gas) at the site. This report documents the results of a baseline risk assessment, which uses the 1989 and 1991 site characterization database to quantify the potential human health risk associated with past Base industrial activities in the vicinity of OU-1. Background data collected in 1992 were also used in the preparation of this report

  8. GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1998-01-01

    Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453

  9. Effective research and innovation (R&I) policy in the EU-28: A causal and configurational analysis of political governance determinants

    NARCIS (Netherlands)

    Turkeli, S.; Kemp, R.P.M.

    2015-01-01

    Effective research and innovation (R&I) policy depends on the extent to which ideas, interests and institutional mechanisms for policy making work together rather than work against each other. In a political governance model for effective R&I policy in the EU-28, the separate influence of

  10. Arved Viirlaid teises kaanonis / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    2002-01-01

    Arved Viirlaid 80. Ka tema juubeliks ilmunud ingliskeelsest luulekogust "Selected poems" (tlk. Taimi Ene Moks ja R. W. Stedingh). Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 417-420, pealk.: Teises Kaanonis: Viirlaiu luule inglise keeles

  11. Benefits of combination of insulin degludec and liraglutide are independent of baseline glycated haemoglobin level and duration of type 2 diabetes

    DEFF Research Database (Denmark)

    Rodbard, Helena W; Buse, John B; Woo, Vincent C

    2016-01-01

    liraglutide, irrespective of baseline HbA1c. In DUAL II, insulin dose and hypoglycaemia rate were similar with IDegLira and IDeg (maximum dose limited to 50 U) independent of baseline HbA1c. The reduction in HbA1c with IDegLira was independent of disease duration and previous insulin dose but varied depending...... of disease progression stage including baseline glycated haemoglobin (HbA1c), disease duration and previous insulin dose. RESULTS: Across four categories of baseline HbA1c (≤7.5-9.0%), HbA1c reductions were significantly greater with IDegLira (1.1-2.5%) compared with IDeg or liraglutide alone in DUAL I...

  12. Final Remedial Investigation/Baseline Risk Assessment for the Ravines and Beach Area Study of the Surplus Operable Unit, Fort Sheridan, Illinois. Volume 1: RI Text and RI Appendices A-I.

    Science.gov (United States)

    1998-04-13

    ecoCOPCs (laboratory or field studies) for impairment of amphibian reproductive success . • Measurement Endpoint 3— results of site-specific fathead...Date: \\C\\2\\ \\Q^ Jcalculator Used: ’"\\(-Q).Q Form: Lc )ADII IG Ikeas . Dev.: t-e-ica Balance Used: SP I S O Aquatic

  13. Application of RI power sources to cardiac pacemakers and aftercare in its implantation

    International Nuclear Information System (INIS)

    Hori, Motokazu

    1974-01-01

    RI power sources have long life when they are implanted into human bodies together with cardiac pacemakers, as compared with e.g. mercury batteries. Therefore, the frequency of their replacement can be by far less. However, there are the problems of radiation protection, high cost, availability, etc. The following matters are described: The cardiac pacemaker and its power supply, implantation into human body, problems with patients and conventional power sources; the current state of RI power sources for cardiac pacemakers, including plutonium-238 RTG and 147 Pm and 3 H batteries; and problems with the RI power sources. (Mori, K.)

  14. Rembrandt Kadrioru lossis / Jüri Hain

    Index Scriptorium Estoniae

    Hain, Jüri, 1941-

    2000-01-01

    Kadrioru lossi kuppelsaali tundmatu meistri laemaali maalimise ajalugu. Maali aluseks on Rembrandti maal "Diana suplus". Laemaal on maalitud Magdalena de Passe (1600-1638) vasegravüüri põhjal, mis on tehtud Rembrandti maalist. Rembrandt on lähtunud Antonio Tempesta (1555-1630) kahest gravüürist, viimane on lähtunud Otto van Veeni (1556-1629) maalist

  15. Baseline tests for arc melter vitrification of INEL buried wastes. Volume 1: Facility description and summary data report

    International Nuclear Information System (INIS)

    Oden, L.L.; O'Connor, W.K.; Turner, P.C.; Soelberg, N.R.; Anderson, G.L.

    1993-01-01

    This report presents field results and raw data from the Buried Waste Integrated Demonstration (BWID) Arc Melter Vitrification Project Phase 1 baseline test series conducted by the Idaho National Engineering Laboratory (INEL) in cooperation with the U.S. Bureau of Mines (USBM). The baseline test series was conducted using the electric arc melter facility at the USBM Albany Research Center in Albany, Oregon. Five different surrogate waste feed mixtures were tested that simulated thermally-oxidized, buried, TRU-contaminated, mixed wastes and soils present at the INEL. The USBM Arc Furnace Integrated Waste Processing Test Facility includes a continuous feed system, the arc melting furnace, an offgas control system, and utilities. The melter is a sealed, 3-phase alternating current (ac) furnace approximately 2 m high and 1.3 m wide. The furnace has a capacity of 1 metric ton of steel and can process as much as 1,500 lb/h of soil-type waste materials. The surrogate feed materials included five mixtures designed to simulate incinerated TRU-contaminated buried waste materials mixed with INEL soil. Process samples, melter system operations data and offgas composition data were obtained during the baseline tests to evaluate the melter performance and meet test objectives. Samples and data gathered during this program included (a) automatically and manually logged melter systems operations data, (b) process samples of slag, metal and fume solids, and (c) offgas composition, temperature, velocity, flowrate, moisture content, particulate loading and metals content. This report consists of 2 volumes: Volume I summarizes the baseline test operations. It includes an executive summary, system and facility description, review of the surrogate waste mixtures, and a description of the baseline test activities, measurements, and sample collection. Volume II contains the raw test data and sample analyses from samples collected during the baseline tests

  16. A gas circulation and purification system for gas-cell-based low-energy RI-beam production

    Energy Technology Data Exchange (ETDEWEB)

    Sonoda, T.; Wada, M.; Katayama, I.; Kojima, T. M.; Reponen, M. [RIKEN Nishina Center for Accelerator-Based Science, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Tsubota, T. [Tokyo KOATSU Co., Ltd., 1-9-8 Shibuya, Shibuyaku, Tokyo 150-0002 (Japan)

    2016-06-15

    A gas circulation and purification system was developed at the RIKEN Radioactive Isotope Beam Factory that can be used for gas-cell-based low-energy RI-beam production. A high-flow-rate gas cell filled with one atmosphere of buffer gas (argon or helium) is used for the deceleration and thermalization of high-energy RI-beams. The exhausted buffer gas is efficiently collected using a compact dry pump and returned to the gas cell with a recovery efficiency of >97%. The buffer gas is efficiently purified using two gas purifiers as well as collision cleaning, which eliminates impurities in the gas. An impurity level of one part per billion is achieved with this method.

  17. A study of 32P-phosphate uptake in a plant by a real-time RI imaging system

    International Nuclear Information System (INIS)

    Yamawaki, M.; Kanno, S.; Ishibashi, H.; Noda, A.; Hirose, A.; Tanoi, K.; Nakanishi, T.M.

    2011-01-01

    It is very important to visualize the process of nutrient absorption and distribution to study the physiological activity of the plant. We developed a real-time radioisotope (RI) imaging system, where RI tracers were applied to the plant sample. This system allowed the quantitative measurement concerning the uptake of nutrients labeled with radioisotopes, such as 45 Ca, 35 S, 32 P and 14 C as long as several days. The β-rays emitted from the sample were converted to light by a CsI(Tl) scintillator and were guided to a highly sensitive CCD camera. The scintillator surface was covered with an Al plate to avoid LED light penetration but allow selected β-ray penetration. We employed Lotus japonicus for the plant sample and observed the 32 P-phosphate absorption in roots and the accumulation to the aboveground part of the plant. The environment condition of daytime and night was simulated by the ON/OFF of LED timer and the accumulation manner of the 32 P-phosphate in roots and leaves during daytime and night was analyzed. The accumulation of 32 P-phosphate in leaves was highly dependant on light irradiation and higher when the LEDs was turned on, whereas the absorption of 32 P-phosphate in root was higher when the LEDs was turned off. The transfer function concerning the transportation of phosphate within the plant during the developmental stage was obtained from the analysis of 32 P uptake images. We are now trying to get specific moving images of each radioisotope when two kinds of isotopes, such as 32 P and 32 S, were applied at the same time to the plant, through an image analysis. (orig.)

  18. In vivo assessment of intracellular redox state in rat liver using hyperpolarized [1-13 C]Alanine.

    Science.gov (United States)

    Park, Jae Mo; Khemtong, Chalermchai; Liu, Shie-Chau; Hurd, Ralph E; Spielman, Daniel M

    2017-05-01

    The intracellular lactate to pyruvate concentration ratio is a commonly used tissue assay biomarker of redox, being proportional to free cytosolic [NADH]/[NAD + ]. In this study, we assessed the use of hyperpolarized [1- 13 C]alanine and the subsequent detection of the intracellular products of [1- 13 C]pyruvate and [1- 13 C]lactate as a useful substrate for assessing redox levels in the liver in vivo. Animal experiments were conducted to measure in vivo metabolism at baseline and after ethanol infusion. A solution of 80-mM hyperpolarized [1- 13 C]alanine was injected intravenously at baseline (n = 8) and 45 min after ethanol infusion (n = 4), immediately followed by the dynamic acquisition of 13 C MRS spectra. In vivo rat liver spectra showed peaks from [1- 13 C] alanine and the products of [1- 13 C]lactate, [1- 13 C]pyruvate, and 13 C-bicarbonate. A significantly increased 13 C-lactate/ 13 C-pyruvate ratio was observed after ethanol infusion (8.46 ± 0.58 at baseline versus 13.58 ± 0.69 after ethanol infusion; P alanine is presented, with the validity of the proposed 13 C-pyruvate/ 13 C-lactate metric tested using an ethanol challenge to alter liver redox state. Magn Reson Med 77:1741-1748, 2017. © 2017 International Society for Magnetic Resonance in Medicine. © 2017 International Society for Magnetic Resonance in Medicine.

  19. Enhancement of antibody-dependent cell-mediated cytotoxicity by endowing IgG with FcαRI (CD89) binding.

    Science.gov (United States)

    Borrok, M Jack; Luheshi, Nadia M; Beyaz, Nurten; Davies, Gareth C; Legg, James W; Wu, Herren; Dall'Acqua, William F; Tsui, Ping

    2015-01-01

    Fc effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC) and antibody-dependent cell-mediated phagocytosis (ADCP) are crucial to the efficacy of many antibody therapeutics. In addition to IgG, antibodies of the IgA isotype can also promote cell killing through engagement of myeloid lineage cells via interactions between the IgA-Fc and FcαRI (CD89). Herein, we describe a unique, tandem IgG1/IgA2 antibody format in the context of a trastuzumab variable domain that exhibits enhanced ADCC and ADCP capabilities. The IgG1/IgA2 tandem Fc format retains IgG1 FcγR binding as well as FcRn-mediated serum persistence, yet is augmented with myeloid cell-mediated effector functions via FcαRI/IgA Fc interactions. In this work, we demonstrate anti-human epidermal growth factor receptor-2 antibodies with the unique tandem IgG1/IgA2 Fc can better recruit and engage cytotoxic polymorphonuclear (PMN) cells than either the parental IgG1 or IgA2. Pharmacokinetics of IgG1/IgA2 in BALB/c mice are similar to the parental IgG, and far surpass the poor serum persistence of IgA2. The IgG1/IgA2 format is expressed at similar levels and with similar thermal stability to IgG1, and can be purified via standard protein A chromatography. The tandem IgG1/IgA2 format could potentially augment IgG-based immunotherapeutics with enhanced PMN-mediated cytotoxicity while avoiding many of the problems associated with developing IgAs.

  20. Framework for applying RI-ISI methodology for Indian PHWRs

    International Nuclear Information System (INIS)

    Vinod, Gopika; Saraf, R.K.; Ghosh, A.K.; Kushwaha, H.S.

    2006-01-01

    Risk Informed In-Service Inspection (RI-ISI) aims at categorizing the components for In-Service inspection based on their contribution to Risk. For defining the contribution of risk from components, their failure probabilities and its subsequent effect on Core Damage Frequency (CDF) needs to be evaluated using Probabilistic Safety Assessment methodology. During the last several years, both the U.S. Nuclear Regulatory Commission (NRC) and the nuclear industry have recognized that Probabilistic Safety Assessment (PSA) has evolved to be more useful in supplementing traditional engineering approaches in reactor regulation. The paper highlights the various stages involved in applying RI-ISI and then compares the findings with existing ISI practices. (author)

  1. Hemoglobin A1c (HbA1c) Test: MedlinePlus Lab Test Information

    Science.gov (United States)

    ... page: https://medlineplus.gov/labtests/hemoglobina1chba1ctest.html Hemoglobin A1c (HbA1c) Test To use the sharing features on this page, please enable JavaScript. What is a hemoglobin A1c (HbA1c) test? A hemoglobin A1c (HbA1c) test measures ...

  2. The experiences to improve plant performance and reliability of Ko-Ri nuclear power plants

    International Nuclear Information System (INIS)

    Kang, Ho Weon

    1998-01-01

    This paper provides a discussion of the lessons learned from operational experience and the future plans to improve performance of the Ko-Ri plant. To operate nuclear power plants safely with good performance is the only way to mitigate the negative image of nuclear power generation to the public and to enhance the economical benefit compared to other electrical generation method. Therefore, in a continuous effort to overcome a negative challenge from outside, we have driven an aggressive 'OCTF' campaign as part of safety. As a result of our efforts, the following remarkable achievements have been accomplished. (1) 3 times of OCTF during recent three years (2) Selected twice as a top notch power plant on the list of NEI magazine in terms of plant capacity factor (3) No scram recorded in 1997 for all 4 units at Ko-Ri site. Ko-Ri is now undergoing the large scale plant betterment projects for retaking-off our operating performance to the level of new challenge target. Such improvement of critical components in the reactor coolant system and turbine system greatly contribute to increase the safety and reliability of the plant and to shortening of the planned outage period as well as to reduction of radiation exposure and radwaste. (Cho, G. S.). 5 tabs., 10 figs

  3. Ühest avastamata illustreeritud raamatust / Jüri Hain

    Index Scriptorium Estoniae

    Hain, Jüri, 1941-

    2011-01-01

    Erick, Françoise. Heute / ill. Sergei Slastnikov. Tallinn : Tallinna Eesti Kirjastus-Ühisus, 1926. S. Slastnikovi puugravüüris illustratsioonidest, tema kunstialastest kirjutistest ja puugravüüri kasutuselevõtust eesti raamatukunstis

  4. The X-X-/E+E+ genotype of the XbaI/EcoRI polymorphisms of the apolipoprotein B gene as a marker of coronary artery disease in a Brazilian sample

    Directory of Open Access Journals (Sweden)

    M. Scartezini

    2003-03-01

    Full Text Available Studies that consider polymorphisms within the apolipoprotein B (apo B gene as risk factors for coronary artery disease (CAD have reported conflicting results. The aim of the present study was to search for associations between two DNA RFLPs (XbaI and EcoRI of the apo B gene and CAD diagnosed by angiography. In the present study we compared 116 Brazilian patients (92 men with CAD (CAD+ to 78 control patients (26 men without ischemia or arterial damage (CAD-. The allele frequencies at the XbaI (X and EcoRI (E sites did not differ between groups. The genotype distributions of CAD+ and CAD- patients were different (chi²(1 = 6.27, P = 0.012 when assigned to two classes (X-X-/E+E+ and the remaining XbaI/EcoRI genotypes. Multivariate logistic regression analysis showed that individuals with the X-X-/E+E+ genotype presented a 6.1 higher chance of developing CAD than individuals with the other XbaI/EcoRI genotypes, independently of the other risk factors considered (sex, tobacco consumption, total cholesterol, hypertension, and triglycerides. We conclude that the X-X-/E+E genotype may be in linkage disequilibrium with an unknown variation in the apo B gene or with a variation in another gene that affects the risk of CAD.

  5. Comprehension of radiation for RI license

    International Nuclear Information System (INIS)

    Guk, Jin Sun

    2005-08-01

    This book starts with theoretical nuclear energy which explains technical terms such as nuclear physics and chemistry, RI and utilization of radiation, radiochemistry and radiation chemistry, radiation biology. It also explains radiation measurements technology including radiation detector and measurements radiation measurements circuit, measuring of energy spectrum. Radiation protection monitoring for radiation protection. It deals with nuclear law, enforcement regulation and ordinance.

  6. Studying astrophysical reactions with low-energy RI beams at CRIB

    Directory of Open Access Journals (Sweden)

    Yamaguchi H.

    2016-01-01

    Full Text Available Studies on nuclear astrophysics, nuclear structure, and other interests have been performed using the radioactive-isotope (RI beams at the low-energy RI beam separator CRIB, operated by Center for Nuclear Study (CNS, the University of Tokyo. A typical measurement performed at CRIB is the elastic resonant scattering with the inverse kinematics. One recent experiment was on the α resonant scattering with 7Li and 7Be beams. This study is related to the astrophysical 7Li/7Be(α,γ reactions, important at hot p-p chain and νp-process in supernovae. There have also been measurements based on other experimental methods. The first THM measurement using an RI beam has been performed at CRIB, to study the 18F(p, α15O reaction at astrophysical energies via the three body reaction 2H(18F, α15On. The 18F(p, α 15O reaction rate is crucial to understand the 511-keV γ-ray production in nova explosion phenomena, and we successfully evaluated the reaction cross section at novae temperature and below experimentally for the first time.

  7. IgG4-Related Disease: Baseline clinical and laboratory features in 125 patients with biopsy-proven disease

    Science.gov (United States)

    Wallace, Zachary S.; Deshpande, Vikram; Mattoo, Hamid; Mahajan, Vinay S.; Kulikova, Maria; Pillai, Shiv; Stone, John H.

    2015-01-01

    Purpose IgG4-related disease (IgG4-RD) is an immune-mediated fibroinflammatory condition that can affect nearly any organ. No detailed clinical and laboratory assessments have been reported in large numbers of patients with IgG4-RD diagnoses established by strict clinicopathological correlation. Methods We reviewed the baseline features of 125 patients with biopsy-proven disease. The diagnosis was confirmed by pathology review according to consensus diagnostic criteria. Disease activity and damage were assessed by the IgG4-RD Responder Index (RI). Flow cytometry was used to assess levels of circulating plasmablasts. Results Of the 125 patients, 103 had active disease and 86 were on no treatment. Only 51% of the patients with active disease had elevated serum IgG4 concentrations. However, patients with active disease and elevated serum IgG4 concentrations were older, had a higher RI, a greater number of organs involved, lower complement levels, higher absolute eosinophil counts, and higher IgE levels compared to those with active disease but normal serum IgG4 (PIgG4+ plasmablast level and RI (R=0.45, P=0.003) was stronger than that of total plasmablasts and RI. Seventy-six (61%) of the patients were male, but no significant differences according to gender were observed with regard to disease severity, organ involvement, or serum IgG4 concentrations. Glucocorticoids failed to produce sustained remission in the majority of patients. Conclusion Nearly 50% of this patient cohort with biopsy-proven, clinically-active IgG4-RD had normal serum IgG4 concentrations. Serum IgG4 elevation identify a subset with more inflammatory features. IgG4+ plasmablasts correlate well with disease activity. PMID:25988916

  8. Safety and Immunogenicity of EBA-175 RII-NG Malaria Vaccine Administered Intramuscularly in Semi-Immune Adults: A Phase 1, Double-Blinded Placebo Controlled Dosage Escalation Study.

    Science.gov (United States)

    Koram, Kwadwo A; Adu, Bright; Ocran, Josephine; Karikari, Yaa S; Adu-Amankwah, Susan; Ntiri, Michael; Abuaku, Benjamin; Dodoo, Daniel; Gyan, Ben; Kronmann, Karl C; Nkrumah, Francis

    2016-01-01

    The erythrocyte binding antigen region II (EBA-175 RII) is a Plasmodium falciparum ligand that mediates erythrocyte invasion and is considered an important malaria vaccine candidate. A phase Ia trial in malaria naïve adults living in the United States found the recombinant non-glycosylated vaccine antigen, EBA-175 RII-NG adjuvanted with aluminium phosphate to be safe, immunogenic and capable of inducing biologically active antibodies that can inhibit parasite growth in vitro. The aim of the current study was to assess the safety and immunogenicity of this vaccine in malaria exposed semi-immune healthy adults living in a malaria endemic country, Ghana. In this double-blinded, placebo controlled, dose escalation phase I trial, eighteen subjects per group received ascending dose concentrations (5 μg, 20 μg or 80 μg) of the vaccine intramuscularly at 0, 1 and 6 months, while 6 subjects received placebo (normal saline). The primary end point was the number of subjects experiencing Grade 3 systemic or local adverse events within 14 days post-vaccination. Serious adverse events were assessed throughout the study period. Blood samples for immunological analyses were collected at days 0, 14, 28, 42, 180 and 194. A total of 52 subjects received three doses of the vaccine in the respective groups. No serious adverse events were reported. The majority of all adverse events reported were mild to moderate in severity, with local pain and tenderness being the most common. All adverse events, irrespective of severity, resolved without any sequelae. Subjects who received any of the EBA-175 RII-NG doses had high immunoglobulin G levels which moderately inhibited P. falciparum growth in vitro, compared to those in the placebo group. In conclusion, the EBA-175 RII-NG vaccine was safe, well tolerated and immunogenic in malaria semi-immune Ghanaian adults. Its further development is recommended. ClinicalTrials.gov. Identifier: NCT01026246.

  9. Safety and Immunogenicity of EBA-175 RII-NG Malaria Vaccine Administered Intramuscularly in Semi-Immune Adults: A Phase 1, Double-Blinded Placebo Controlled Dosage Escalation Study.

    Directory of Open Access Journals (Sweden)

    Kwadwo A Koram

    Full Text Available The erythrocyte binding antigen region II (EBA-175 RII is a Plasmodium falciparum ligand that mediates erythrocyte invasion and is considered an important malaria vaccine candidate. A phase Ia trial in malaria naïve adults living in the United States found the recombinant non-glycosylated vaccine antigen, EBA-175 RII-NG adjuvanted with aluminium phosphate to be safe, immunogenic and capable of inducing biologically active antibodies that can inhibit parasite growth in vitro. The aim of the current study was to assess the safety and immunogenicity of this vaccine in malaria exposed semi-immune healthy adults living in a malaria endemic country, Ghana. In this double-blinded, placebo controlled, dose escalation phase I trial, eighteen subjects per group received ascending dose concentrations (5 μg, 20 μg or 80 μg of the vaccine intramuscularly at 0, 1 and 6 months, while 6 subjects received placebo (normal saline. The primary end point was the number of subjects experiencing Grade 3 systemic or local adverse events within 14 days post-vaccination. Serious adverse events were assessed throughout the study period. Blood samples for immunological analyses were collected at days 0, 14, 28, 42, 180 and 194. A total of 52 subjects received three doses of the vaccine in the respective groups. No serious adverse events were reported. The majority of all adverse events reported were mild to moderate in severity, with local pain and tenderness being the most common. All adverse events, irrespective of severity, resolved without any sequelae. Subjects who received any of the EBA-175 RII-NG doses had high immunoglobulin G levels which moderately inhibited P. falciparum growth in vitro, compared to those in the placebo group. In conclusion, the EBA-175 RII-NG vaccine was safe, well tolerated and immunogenic in malaria semi-immune Ghanaian adults. Its further development is recommended.ClinicalTrials.gov. Identifier: NCT01026246.

  10. Eduard Vääri : [Wiedemanni keeleauhinna laureaat 2001

    Index Scriptorium Estoniae

    2005-01-01

    Sisu: Kogu elu eesti keele kaitsel : [F. J. Wiedemanni keeleauhinna vastuvõtmisel peetud kõne alusel] ; Laks, Meinhard. Liivi rannarahva lipp : [luuletus] = Livõ rńdarouv plaga / liivi keelde tõlkinud Eduard Vääri

  11. Tüüri ava(sta)mas, kuid mitte ainult / Igor Garšnek

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    2011-01-01

    Kahest kontserdist Estonia kontserdisaalis - 4. märtsil ERSO ja Herbert Schuch (klaver) Olari Eltsi dirigeerimisel, kavas Tüüri Sümfoonia nr 8, Pärdi "Nekroloog" ja Ullmanni Klaverikontsert ning 10. märtsil Erkki-Sven Tüüri autorikontsert, kus esinesid Eesti Filharmoonia Kammerkoor ja Sinfonietta Riga Daniel Reussi juhatusel

  12. Contemporary risk estimates of three HbA1c variables in relation to heart failure following diagnosis of type 2 diabetes.

    Science.gov (United States)

    Skrtic, Stanko; Cabrera, Claudia; Olsson, Marita; Schnecke, Volker; Lind, Marcus

    2017-03-01

    We evaluated the association between glycaemic control and the risk of heart failure (HF) in a contemporary cohort of persons followed after diagnosis of type 2 diabetes (T2D). Persons with T2D diagnosed between 1998 and 2012 were retrieved from the Clinical Practice Research Data Link in the UK and followed from diagnosis until the event of HF, mortality, drop out from the database due to any other reason, or the end of the study on 1 July 2015. The association between each of three different haemoglobin A 1C (HbA 1c ) metrics and HF was estimated using adjusted proportional hazard models. In the overall cohort (n=94 332), the increased risk for HF per 1% (10 mmol/mol) increase in HbA 1c was 1.15 (95% CI 1.13 to 1.18) for updated mean HbA 1c , and 1.06 (1.04 to 1.07) and 1.06 (1.04 to 1.08) for baseline HbA 1c and updated latest HbA 1c , respectively. When categorised, the hazard risk (HR) for the updated mean HbA 1c in relation to HF became higher than for baseline and updated latest HbA 1c above HbA 1c levels of 9%, but did not differ at lower HbA 1c levels. The updated latest variable showed an increased risk for HbA 1c <6% (42 mmol/mol) of 1.16 (1.07 to 1.25), relative category 6-7%, while the HRs for updated mean and baseline HbA 1c showed no such J-shaped pattern. Hyperglycaemia is still a risk factor for HF in persons with T2D of similar magnitude as in earlier cohorts. Such a relationship exists for current glycaemic levels, at diagnosis and the overall level but the pattern differs for these variables. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  13. Sonya Smith ja telenovela-äri / Tiina Lepiste

    Index Scriptorium Estoniae

    Lepiste, Tiina

    2006-01-01

    Telenovelade ärist ja fenomenist. Ka Venetsueela päritolu näitlejannast Sonya Smithist seriaalis "Armastuse jõud". Sama: Teleleht, 17. Jul. 2006, nr. 28, lk. 6-7 : ill pealkirjaga "Seebiäri vohab ja õitseb"

  14. ANALISIS FAKTOR-FAKTOR YANG MEMENGARUHI TRANSFORMASI KAPABILITAS ORGANISASI DAN PERAN BADAN PEMERIKSA KEUANGAN RI

    Directory of Open Access Journals (Sweden)

    Agus Joko Pramono

    2017-01-01

    Full Text Available ABSTRACT This study is aimed to study the influencing factors of the Audit Board of Republic Indonesia’s roles and capabilities transformation to meet the national development goals. This study use a qualitative approach with Analytic Network Process (ANP method, to map out the interrelated factors of nodes within 3 clusters, which are the external, internal, and supporting factors. Focus Group Discussion (FGD was conducted to design a Framework Analysis. The participants of the FGD were BPK RI officials and its stakeholders including relevant external experts. The FGD has made a quantification framework as an ideal approach to use for data processing on software superdecisions. This process has brought about the priorities as follows: external stakeholder engagement, leadership and governance system, communication and the management of information system. The research has found out that the most significant and urgent factor is the concern of, and support from, the external stakeholders for BPK RI. Therefore, BPK RI has to design a strategy and communication program that can effectively improve the external support and concern. Keywords: Transformation, organizational capability, organizational roles, The Audit  Board of Indonesia, Analytic Network Process. ABSTRAK Kajian ini bertujuan untuk mengkaji faktor-faktor yang berpengaruh terhadap transformasi kapabilitas dan peran Badan Pemeriksa Keuangan Republik Indonesia. Kajian ini menggunakan pendekatan kualitatif dengan metode Analytic Network Process (ANP untuk mendapatkan hubungan antar node dalam 3 cluster (faktor eksternal, internal dan penunjang yang bersifat network. Framework analysis disusun melalui FGD para pakar dari eksternal dan internal BPK RI. Kuantifikasi framework dihasilkan dari FGD para pakar internal BPK RI. Olah data pada software superdecisions menghasilkan prioritas-prioritas sebagai berikut: faktor eksternal prioritasnya Stakeholders Engagement; faktor internal

  15. Comparing RIEGL RiCOPTER UAV LiDAR Derived Canopy Height and DBH with Terrestrial LiDAR.

    Science.gov (United States)

    Brede, Benjamin; Lau, Alvaro; Bartholomeus, Harm M; Kooistra, Lammert

    2017-10-17

    In recent years, LIght Detection And Ranging (LiDAR) and especially Terrestrial Laser Scanning (TLS) systems have shown the potential to revolutionise forest structural characterisation by providing unprecedented 3D data. However, manned Airborne Laser Scanning (ALS) requires costly campaigns and produces relatively low point density, while TLS is labour intense and time demanding. Unmanned Aerial Vehicle (UAV)-borne laser scanning can be the way in between. In this study, we present first results and experiences with the RIEGL RiCOPTER with VUX ® -1UAV ALS system and compare it with the well tested RIEGL VZ-400 TLS system. We scanned the same forest plots with both systems over the course of two days. We derived Digital Terrain Model (DTMs), Digital Surface Model (DSMs) and finally Canopy Height Model (CHMs) from the resulting point clouds. ALS CHMs were on average 11.5 c m higher in five plots with different canopy conditions. This showed that TLS could not always detect the top of canopy. Moreover, we extracted trunk segments of 58 trees for ALS and TLS simultaneously, of which 39 could be used to model Diameter at Breast Height (DBH). ALS DBH showed a high agreement with TLS DBH with a correlation coefficient of 0.98 and root mean square error of 4.24 c m . We conclude that RiCOPTER has the potential to perform comparable to TLS for estimating forest canopy height and DBH under the studied forest conditions. Further research should be directed to testing UAV-borne LiDAR for explicit 3D modelling of whole trees to estimate tree volume and subsequently Above-Ground Biomass (AGB).

  16. Does the treatment of type 2 diabetes mellitus with the DPP-4 inhibitor vildagliptin reduce HbA1c to a greater extent in Japanese patients than in Caucasian patients?

    Directory of Open Access Journals (Sweden)

    Foley JE

    2016-01-01

    Full Text Available James E Foley,1 Vaishali Bhosekar,2 Ryuzo Kawamori3 1Novartis Pharmaceuticals Corporation, East Hanover, NJ, USA; 2Novartis Healthcare Pvt Ltd, Hyderabad, Telangana, India; 3Sportology Center, Juntendo University Graduate School of Medicine, Juntendo University, Tokyo, Japan Background: Previous work suggests that Japanese patients with type 2 diabetes mellitus (T2DM may respond more favorably to a DPP-4 (dipeptidyl peptidase-4 inhibitor than Caucasians. We aimed to compare the efficacy of the DPP-4 inhibitor vildagliptin (50 mg twice daily [bid] between Japanese and Caucasian populations. Methods: This analysis pooled data from 19 studies of drug-naïve patients with T2DM who were treated for 12 weeks with vildagliptin 50 mg bid as monotherapy. The pool comprised Japanese patients (n=338 who had been treated in Japan and Caucasian patients (n=1,275 who were treated elsewhere. Change from baseline (Δ in glycated hemoglobin (HbA1c at 12 weeks (in millimoles per mole versus baseline HbA1c (both in percentage National Glycohemoglobin Standardization Program units [NGSP%] and millimoles per mole for each population was reported. Universal HbA1c in millimoles per mole was calculated from either the Japanese Diabetes Society or the NGSP% HbA1c standards. Results: At baseline, mean values for Japanese and Caucasian patients, respectively, were as follows: age, 59 years and 56 years; % male, 69% and 57%. The average HbA1c was reduced from 7.90% to 6.96% (Japanese Diabetes Society and from 8.57% to 7.50% (United States National Glycohemoglobin Standardization Program, while HbA1c was reduced from 63 mmol/mol to 53 mmol/mol and from 70 mmol/mol to 58 mmol/mol in Japanese and Caucasians, respectively. ΔHbA1c increased with increasing baseline in both populations. The slopes were the same (0.41, r2=0.36; and 0.41, r2=0.15, and the intercepts were 15.4 mmol/mol and 17.2 mmol/mol, respectively. In Japanese patients, mean ΔHbA1c was greater by 1.7 mmol

  17. Effects of adjunctive N-acetylcysteine on depressive symptoms: Modulation by baseline high-sensitivity C-reactive protein.

    Science.gov (United States)

    Porcu, Mauro; Urbano, Mariana Ragassi; Verri, Waldiceu A; Barbosa, Decio Sabbatini; Baracat, Marcela; Vargas, Heber Odebrecht; Machado, Regina Célia Bueno Rezende; Pescim, Rodrigo Rossetto; Nunes, Sandra Odebrecht Vargas

    2018-05-01

    Outcomes in a RCTs of 12 weeks of theclinical efficacy of N-acetylcysteine (NAC) as an adjunctive treatment on depression and anxiety symptoms and its effects on high-sensitivity C-reactive protein (hs-CRP) levels. A wide array of measures were made. The 17-item version of the Hamilton Depression Rating Scale (HDRS17); the Hamilton Anxiety Rating Scale (HAM-A); Sheehan Disability Scale; Quality of Life; Clinical Global Impression (CGI); anthropometrics measures; and vital signs and biochemical laboratory. There were no significant differences among the groups regarding demographic, clinical features, use of medication, metabolic syndrome and comorbidities. From baseline to week 12, individuals receiving NAC, versus placebo, had a statistically significant reduction in depressive symptoms on HDRS 17 (p  3 mg/L at baseline. Individuals receiving NAC with baseline levels of hs-CRP > 3 mg/L, had more significant reduction in uric acid levels compared to individuals with baseline levels of hs-CRP ≤ 3 mg/L on week 12. Participants receiving placebogained significantly more weight during the 12 weeks for baseline levels of hs-CRP ≤ 3 mg/L and hs-CRP > 3 mg/L, and individuals receiving NAC in both groups did not have significant weight change during the 12 weeks. No individuals were withdrawn from the study because of adverse event. NAC group exhibited significantly greater reduction on hs-CRP levels than placebo group from baseline to week 12. clinicaltrials.gov Identifier; NCT02252341. Copyright © 2018 Elsevier B.V. All rights reserved.

  18. Mida me Tallinnas teinud oleme / Jüri Ratas

    Index Scriptorium Estoniae

    Ratas, Jüri, 1978-

    2006-01-01

    Tallinna linnapea Jüri Ratas annab ülevaate linnavalitsuse tegevusest esimese saja päeva jooksul. Linnavalitsuse tegevust hindavad Tallinna volikogu Isamaaliidu fraktsiooni esimees Toomas Tõniste, volikogu Reformierakonna esimees Keit Pentus ja volikogu sotsiaaldemokraatide fraktsiooni aseesimees Hannes Rumm

  19. Anna Lampérière, solidarité et citoyenneté féminine sous la Troisième République

    Directory of Open Access Journals (Sweden)

    Anne R. Epstein

    2008-12-01

    Full Text Available Cet article examine les idées de l’institutrice Anna Lampérière, l’une des rares femmes à avoir contribué à la discussion théorique sur l’idéologie de la solidarité pendant la Troisième République. Vue dans le contexte de son parcours personnel et de son engagement civique, la pensée d’A. Lampérière offre un aperçu inédit d’un modèle solidariste de citoyenneté féminine sans droit de vote. Au sein d’une culture d’associations florissante au début du XXe siècle, elle participe à la création et au fonctionnement d’importantes associations mixtes qui, par l’éducation civique, visent la mise en place de l’idéologie solidariste de Léon Bourgeois. Se proclamant anti-féministe, Anna Lampérière se présente néanmoins comme une défenseuse de la cause des femmes et du progrès social et, comme beaucoup de ses contemporains, elle place la réforme scolaire au cœur de son projet républicain. Après une analyse de la vision sociale d’Anna Lampérière, l’article examine les pratiques civiques et la structure mixte selon les sexes de la Société pour l’éducation sociale, une association pour la promotion du solidarisme, dont elle a été Secrétaire générale. L’idéologie solidariste et sa pratique avaient un attrait pour des femmes républicaines comme Anna Lampérière qui avaient une vocation civique mais qui n’étaient pas attirées par un modèle égalitaire de la citoyenneté.Anna Lampérière, solidarité and female citizenship in the Third Republic This article explores the ideas of educator Anna Lampérière, one of the rare women to contribute significantly to the theoretical discussion about the ideology of solidarity during the Third Republic. Viewed in tandem with her own personal history and civic activism, Lampérière’s thought provides unique insight into a possible solidarist model of female citizenship without voting rights. Operating within the flourishing associational

  20. A long baseline global stereo matching based upon short baseline estimation

    Science.gov (United States)

    Li, Jing; Zhao, Hong; Li, Zigang; Gu, Feifei; Zhao, Zixin; Ma, Yueyang; Fang, Meiqi

    2018-05-01

    In global stereo vision, balancing the matching efficiency and computing accuracy seems to be impossible because they contradict each other. In the case of a long baseline, this contradiction becomes more prominent. In order to solve this difficult problem, this paper proposes a novel idea to improve both the efficiency and accuracy in global stereo matching for a long baseline. In this way, the reference images located between the long baseline image pairs are firstly chosen to form the new image pairs with short baselines. The relationship between the disparities of pixels in the image pairs with different baselines is revealed by considering the quantized error so that the disparity search range under the long baseline can be reduced by guidance of the short baseline to gain matching efficiency. Then, the novel idea is integrated into the graph cuts (GCs) to form a multi-step GC algorithm based on the short baseline estimation, by which the disparity map under the long baseline can be calculated iteratively on the basis of the previous matching. Furthermore, the image information from the pixels that are non-occluded under the short baseline but are occluded for the long baseline can be employed to improve the matching accuracy. Although the time complexity of the proposed method depends on the locations of the chosen reference images, it is usually much lower for a long baseline stereo matching than when using the traditional GC algorithm. Finally, the validity of the proposed method is examined by experiments based on benchmark datasets. The results show that the proposed method is superior to the traditional GC method in terms of efficiency and accuracy, and thus it is suitable for long baseline stereo matching.

  1. President vabastas Jüri Sakkarti kohtuniku ametist / Tanel Mazur

    Index Scriptorium Estoniae

    Mazur, Tanel, 1971-

    2010-01-01

    President Toomas Hendrik Ilves kirjutas 9. veebruaril 2010 alla otsusele vabastada Jüri Sakkart Viru Maakohtu kohtuniku ametist tema enda soovil. Kaitsepolitsei on J. Sakkarti kuriteokahtlustusega kinni pidanud

  2. Report on EUROMET.RI(I)-K1 and EUROMET.RI(I)-K4 (EUROMET project no. 813): Comparison of air kerma and absorbed dose to water measurements of 60Co radiation beams for radiotherapy

    International Nuclear Information System (INIS)

    Csete, I.; Leiton, A.G.; Sochor, V.; Lapenas, A.; Grindborg, J.E.; Jokelainen, I.; Bjerke, H.; Dobrovodsky, J.; Megzifene, A.; Hourdakis, C.J.; Ivanov, R.; Vekic, B.; Kokocinski, J.; Cardoso, J.; Buermann, L.; Tiefenboeck, W.; Stucki, G.; Van Dijk, E.; Toni, M.P.; Minniti, R.; McCaffrey, J.P.; Silva, C.N.M.; Kharitonov, I.; Webb, D.; Saravi, M.; Delaunay, F.

    2010-01-01

    The results of an unprecedented international effort involving 26 countries are reported. The EUROMET.RI(I)-K1 and EUROMET.RI(I)-K4 key comparisons were conducted with the goal of supporting the relevant calibration and measurement capabilities (CMC) planned for publication by the participant laboratories. The measured quantities were the air kerma (K air ) and the absorbed dose to water (Dw) in 60 Co radiotherapy beams. The comparison was conducted by the pilot laboratory MKEH (Hungary), in a star-shaped arrangement from January 2005 to December 2008. The calibration coefficients of four transfer ionization chambers were measured using two electrometers. The largest deviation between any two calibration coefficients for the four chambers in terms of air kerma and absorbed dose to water was 2.7% and 3.3% respectively. An analysis of the participant uncertainty budgets enabled the calculation of degrees of equivalence (DoE), in terms of the deviations of the results and their associated uncertainties. As a result of this EUROMET project 813 comparison, the BIPM key comparison database (KCDB) will include eleven new Kair and fourteen new D w DoE values of European secondary standard dosimetry laboratories (SSDLs), and the KCDB will be updated with the new DoE values of the other participant laboratories. The pair-wise degrees of equivalence of participants were also calculated. In addition to assessing calibration techniques and uncertainty calculations of the participants, these comparisons enabled the experimental determinations of N Dw /N Kair ratios in the 60 Co gamma radiation beam for the four radiotherapy transfer chambers. (authors)

  3. EDF'S ''OMF-structures'' RI-ISI process: overview of the methodology, applications and comparison with the other existing RI-ISI initiatives

    International Nuclear Information System (INIS)

    Codron, P.; Lauriot, B.; Dubreuil-Chambardel, A.

    2001-01-01

    The OMF-Structures process has been developed by EDF in order to optimise the maintenance of piping components. The principles of the OMF-Structures are consistent with the RCM concepts in EDF's OMF process (applied to active components). Several applications of this process have been performed. This paper also presents several applications which have been performed, notably on the AFW, RHR, and HPSI/LPSI systems of EDF's 900 MW PWR plants. These applications led to propose optimised preventive maintenance programs for these systems. These updated preventive maintenance programs confirmed and justified a large proportion of existing maintenance, despite some inspection tasks were suppressed and some inspection tasks were added. Globally, these new programs guarantee a better safety level, insuring that preventive maintenance is applied on piping segments where risks are concentrated. A comparative evaluation of the OMF-Structures process with the EPRI and WOG/ASME RI-ISI methodologies has been performed. This comparison demonstrated the consistence of the OMF-Structures principles and selection criteria with the other RI-ISI processes. (author)

  4. The TDAQ Baseline Architecture

    CERN Multimedia

    Wickens, F J

    The Trigger-DAQ community is currently busy preparing material for the DAQ, HLT and DCS TDR. Over the last few weeks a very important step has been a series of meetings to complete agreement on the baseline architecture. An overview of the architecture indicating some of the main parameters is shown in figure 1. As reported at the ATLAS Plenary during the February ATLAS week, the main area where the baseline had not yet been agreed was around the Read-Out System (ROS) and details in the DataFlow. The agreed architecture has: Read-Out Links (ROLs) from the RODs using S-Link; Read-Out Buffers (ROB) sited near the RODs, mounted in a chassis - today assumed to be a PC, using PCI bus at least for configuration, control and monitoring. The baseline assumes data aggregation, in the ROB and/or at the output (which could either be over a bus or in the network). Optimization of the data aggregation will be made in the coming months, but the current model has each ROB card receiving input from 4 ROLs, and 3 such c...

  5. Tartu kui märk / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1996-01-01

    Ilmus algkujul hispaania keeles Sevillas Andaluusia Semiootikaassotsiatsiooni ajakirja Discurso Tartu semiootikakoolkonnale pühendatud erinumbris (nr. 8, 1993). Ilmunud ka kogumikus: Talvet, Jüri. Ameerika märkmeid, ehk, Kaemusi Eestist. Tartu : Ilmamaa, 2000, lk. 62-71, pealk.: Tartu vaim

  6. 77 FR 28253 - Safety Zone; America's Cup World Series, East Passage, Narragansett Bay, RI

    Science.gov (United States)

    2012-05-14

    ...-AA00 Safety Zone; America's Cup World Series, East Passage, Narragansett Bay, RI AGENCY: Coast Guard... navigable waters of the East Passage, Narragansett Bay, Rhode Island, during the America's Cup World Series... rulemaking (NPRM) entitled ``Safety Zones; America's Cup World Series, East Passage, Narragansett Bay, RI...

  7. Comparison of vildagliptin and sitagliptin in patients with type 2 diabetes and severe renal impairment: a randomised clinical trial.

    Science.gov (United States)

    Kothny, Wolfgang; Lukashevich, Valentina; Foley, James E; Rendell, Marc S; Schweizer, Anja

    2015-09-01

    There are limited data comparing dipeptidyl peptidase-4 (DPP-4) inhibitors directly. We compared the safety and efficacy of vildagliptin and sitagliptin in patients with type 2 diabetes and severe renal impairment (RI). This study was a parallel-arm, randomised, multicentre, double-blind, 24 week study conducted in 87 centres across Brazil and the USA. Patients with type 2 diabetes, either drug naive or treated with any glucose-lowering agents, who had inadequate glycaemic control (HbA1c 6.5-10.0% [48-86 mmol/mol]) and an estimated GFR vildagliptin 50 mg once daily or sitagliptin 25 mg once daily. These doses are recommended in this patient population and considered maximally effective. Participants, investigators and the sponsor were blinded to group assignment. Efficacy endpoints included change in HbA1c and fasting plasma glucose (FPG) at all visits and the primary safety endpoint was assessment of treatment-emergent adverse events. In total, 148 patients were randomised, 83 to vildagliptin and 65 to sitagliptin. All patients were analysed. After 24 weeks, the adjusted mean change in HbA1c was -0.54% (5.9 mmol/mol) from a baseline of 7.52% (59 mmol/mol) with vildagliptin and -0.56% (6.1 mmol/mol) from a baseline of 7.80% (62 mmol/mol) with sitagliptin (p = 0.874). FPG decreased by 0.47 ± 0.37 mmol/l with vildagliptin and increased by 0.16 ± 0.43 mmol/l with sitagliptin (p = 0.185). Both treatments were well tolerated with overall similar safety profiles. At their recommended doses for severe RI, vildagliptin (50 mg once daily) compared with sitagliptin (25 mg once daily) demonstrated similar efficacy and both drugs were well tolerated. This study provides further support for the use of DPP-4 inhibitors in patients with severe RI. ClinicalTrials.gov NCT00616811 (completed) This study was planned and conducted by Novartis.

  8. The experiences to improve plant performance and reliability of Ko-Ri nuclear power plants

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Ho Weon [Korea Electric Power Corp. Ko-Ri nuclear power division, Ko-Ri (Korea, Republic of)

    1998-07-01

    This paper provides a discussion of the lessons learned from operational experience and the future plans to improve performance of the Ko-Ri plant. To operate nuclear power plants safely with good performance is the only way to mitigate the negative image of nuclear power generation to the public and to enhance the economical benefit compared to other electrical generation method. Therefore, in a continuous effort to overcome a negative challenge from outside, we have driven an aggressive 'OCTF' campaign as part of safety. As a result of our efforts, the following remarkable achievements have been accomplished. (1) 3 times of OCTF during recent three years (2) Selected twice as a top notch power plant on the list of NEI magazine in terms of plant capacity factor (3) No scram recorded in 1997 for all 4 units at Ko-Ri site. Ko-Ri is now undergoing the large scale plant betterment projects for retaking-off our operating performance to the level of new challenge target. Such improvement of critical components in the reactor coolant system and turbine system greatly contribute to increase the safety and reliability of the plant and to shortening of the planned outage period as well as to reduction of radiation exposure and radwaste. (Cho, G. S.). 5 tabs., 10 figs.

  9. Current situation of RI's and radiation utilization in Japan

    International Nuclear Information System (INIS)

    1976-01-01

    Usage of RIs and radiation is now extensive, for the improvement of industrial production techniques and also in medicine and agriculture. The current situation in Japan is described as follows: enterprises using RIs, circulation of RIs, the equipments provided with RIs in private enterprises, commercial RI, and radiation utilization, expenditures and sales related to RIs and radiation in mining and industries, and personnel. The number of places using RIs and radiation totaled about 3,200 (in 1975). The expenditures for RIs and radiation in private enterprises are about 17,500 million yen while sales are 20,800 million yen (both in fiscal 1974). The total number of personnel engaged in RI and radiation works is about 62,000. (Mori, K.)

  10. Riigikohus arutleb autode üle / Ranno Tingas, Lemmi Kann ; kommenteerinud Jüri Allikalt

    Index Scriptorium Estoniae

    Tingas, Ranno, 1976-

    2009-01-01

    Riigikohtu lahenditest 3-3-1-93-08, 3-3-1-44-00, Tallinna Ringkonnakohtu lahendist 2-3-143/2002 sõiduautode erisoodustuse küsimuses. Kommenteerib Maksukonsultandi UÜ jurist, Eesti Maksumaksjate Liidu (EML) juhatuse liige Jüri Allikalt. Lisa: Maksuamet: sõidupäevikud ei kao kuhugi / Lemmi Kann (ÄP Online, 05.03.2009) ; MTA pressiteade ; EML teabenõue ; MTA vastus

  11. Establishment of a novel high-affinity IgE receptor-positive canine mast cell line with wild-type c-kit receptors

    International Nuclear Information System (INIS)

    Amagai, Yosuke; Tanaka, Akane; Ohmori, Keitaro; Matsuda, Hiroshi

    2008-01-01

    Much is known regarding participations of mast cells with innate and acquired immunity by secreting various cytokines and chemical mediators. However, details of mast cell biology still remain unclear. In this study, we successfully established a novel growth factor-independent mast cell line (MPT-1) derived from canine mast cell tumor. MPT-1 cells manifested factor-independent proliferation as floating cells containing a large amount of histamine, as well as chymase-like dog mast cell protease 3, in cytosolic granules. Particularly, MPT-1 cells expressed high-affinity IgE receptors (FcεRI) and wild-type c-kit receptors. Degranulation of MPT-1 cells was induced not only by stimulation with calcium ionophore but also by cross-linkage of the surface IgE. Given that MPT-1 is the first mast cell line with FcεRI which has no c-kit mutations, MPT-1 cells may provide great contribution for investigation of IgE-mediated activation mechanisms of mast cells, leading to development of effective treatment for allergic disorders

  12. Endurance test for IR rig for RI production assembly (test procedure)

    International Nuclear Information System (INIS)

    Chung, Heung June; Ryu, Jeong Soo

    2000-08-01

    This test procedure details the test loop, test method, and test procedure for pressure drop, vibration and endurance test of IR Rig for RI production. From the pressure drop test, the hydraulic design requirements of the capsule are verified. HANARO limit condition is checked and the compatibility with HANARO core is verified. From flow induced vibration test vibration frequency and displacement are investigated. The wear of IR Rig is investigated through endurance test, and these data are used to evaluate the expected wear at maximum resident time of the IR Rig for RI production

  13. HbA1c variability in type 2 diabetes is associated with the occurrence of new-onset albuminuria within three years.

    Science.gov (United States)

    Dorajoo, Sreemanee Raaj; Ng, Joceline Shi Ling; Goh, Jessica Hui Fen; Lim, Su Chi; Yap, Chun Wei; Chan, Alexandre; Lee, Joyce Yu Chia

    2017-06-01

    To evaluate the association between HbA1c coefficient of variation (HbA1c-CV) and 3-year new-onset albuminuria risk. A retrospective cohort study involving 716 normoalbuminuric type 2 diabetes patients was conducted between 2010 and 2014. HbA1c-CV was used to categorize patients into low, moderate or high variability groups. Multivariate logistic models were constructed and validated. Integrated discrimination (IDI) and net reclassification (NRI) improvement indices were used to quantify the added predictive value of HbA1c-CV. The mean age of our cohort was 56.1±12.9years with a baseline HbA1c of 8.3±1.3%. Over 3-years of follow-up, 35.2% (n=252) developed albuminuria. An incremental risk of albuminuria was observed with moderate (6.68-13.43%) and high (above 13.44%) HbA1c-CV categories demonstrating adjusted odds ratios of 1.63 (1.12-2.38) and 3.80 (2.10-6.97) for 3-year new-onset albuminuria, respectively. Including HbA1c-CV for 3-year new-onset albuminuria prediction improved model discrimination (IDI: 0.023, NRI: 0.293, pHbA1c-CV improves 3-year prediction of new-onset albuminuria. Together with mean HbA1c, baseline urine albumin-to-creatinine ratio and presence of hypertension, accurate 3-year new-onset albuminuria prediction may be possible. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. Tüüri autoriplaat on MIDEM-i auhinna nominent

    Index Scriptorium Estoniae

    2008-01-01

    Muusikamessi MIDEM klassikalise muusika plaatide auhinnaõhtul on üheks preemia nominendiks Luciano Berio ja Krzysztof Penderecki kõrval Erkki-Sven Tüüri autoriplaat "Magma", messist 27.-31. jaan. Cannes'is Prantsusmaal

  15. Äri domeeninimedega kogub Ameerikas hoogu / Margus Mihkels

    Index Scriptorium Estoniae

    Mihkels, Margus

    2006-01-01

    2005. aastal müüdi Ameerikas 5851 domeeninime ja nimeäri käive ulatus 29 miljoni USA dollarini. 2006. aasta esimese kolme kuu jooksul on ajakirja Domain Name Journal andmetel müüdud 1949 veebiaadressi 14,2 miljoni dollari eest

  16. Reasoning and representation in RiTSE

    International Nuclear Information System (INIS)

    Epstein, S.A.

    1987-01-01

    RiTSE, the Reactor Trip Simulation Environment, is a frame and rule-base artificial intelligence (AI) application which aids nuclear power plant operators in determining if a proposed change in a state of a component or process causes safety systems to automatically shut the plant down. This paper stresses the software techniques used to implement the system. The authors demonstrate that prototypes and industrial strength systems can be built quickly and economically without expert system shells, and that integration of AI and database techniques create a novel programming paradigm

  17. A Comparison of the Optimization and Analysis of Doubly Curved Shells Using MSC/NASTRAN and ASTROS

    Science.gov (United States)

    1990-12-01

    BMC(7,5)=I.OD+00 CALL BMAT (X1,RI,X2,R2,0.OD+00,B,DL) CALL EMAT(DNU,E,T,G) C C DO BMC*E*B C DO 100 J1=1,7 DO 100 J2=1,5 DO 100 J3=1,5 DO 100 J4=1,6...ELEMENT LENGTH. C SUBROUTINE BMAT (XI,RI,X2,R2,DKSI,B,DL) DOUBLE PRECISION XI,RI,X2,R2,DKSI,B(S,6),DL,R,PHI,CPR,SPR,R, &DKMDKP, DLINV C C EXPLANATION OF

  18. Office of Geologic Repositories program baseline procedures notebook (OGR/B-1)

    International Nuclear Information System (INIS)

    1986-06-01

    Baseline management is typically applied to aid in the internal control of a program by providing consistent programmatic direction, control, and surveillance to an evolving system development. This fundamental concept of internal program control involves the establishment of a baseline to serve as a point of departure for consistent technical program coordination and to control subsequent changes from that baseline. The existence of a program-authorized baseline ensures that all participants are working to the same ground rules. Baseline management also ensures that, once the baseline is defined, changes are assessed and approved by a process which ensures adequate consideration of overall program impact. Baseline management also includes the consideration of examptions from the baseline. The process of baseline management continues through all the phases of an evolving system development program. As the Program proceeds, there will be a progressive increase in the data contained in the baseline documentation. Baseline management has been selected as a management technique to aid in the internal control of the Office of Geologic Repositories (OGR) program. Specifically, an OGR Program Baseline, including technical and programmatic requirements, is used for program control of the four Mined Geologic Disposal System field projects, i.e., Basalt Waste Isolation Project, Nevada Nuclear Waste Storage Investigation, Salt Repository Project and Crystalline Repository Project. This OGR Program Baseline Procedures Notebook provides a description of the baseline mwanagement concept, establishes the OGR Program baseline itself, and provides procedures to be followed for controlling changes to that baseline. The notebook has a controlled distribution and will be updated as required

  19. Propensity score to detect baseline imbalance in cluster randomized trials: the role of the c-statistic.

    Science.gov (United States)

    Leyrat, Clémence; Caille, Agnès; Foucher, Yohann; Giraudeau, Bruno

    2016-01-22

    Despite randomization, baseline imbalance and confounding bias may occur in cluster randomized trials (CRTs). Covariate imbalance may jeopardize the validity of statistical inferences if they occur on prognostic factors. Thus, the diagnosis of a such imbalance is essential to adjust statistical analysis if required. We developed a tool based on the c-statistic of the propensity score (PS) model to detect global baseline covariate imbalance in CRTs and assess the risk of confounding bias. We performed a simulation study to assess the performance of the proposed tool and applied this method to analyze the data from 2 published CRTs. The proposed method had good performance for large sample sizes (n =500 per arm) and when the number of unbalanced covariates was not too small as compared with the total number of baseline covariates (≥40% of unbalanced covariates). We also provide a strategy for pre selection of the covariates needed to be included in the PS model to enhance imbalance detection. The proposed tool could be useful in deciding whether covariate adjustment is required before performing statistical analyses of CRTs.

  20. Uudised : Eesti muusikalistaarid Euroopas. Tüüri 5.sümfoonia Tallinnas

    Index Scriptorium Estoniae

    2005-01-01

    Koit Toome, Ele Millistver ja Lauri Liiv alustavad 1. detsembril Brnos rahvusvahelises muusikalitrupis "Hairi" proovidega. Esietendus on 26. dets. Iserlohni linnas Saksamaal ning etendusi antakse järgmise aasta 16. aprillini Saksa linnades, Austrias, Šveitsis ja Taanis. Erkki-Sven Tüüri 5. sümfoonia tuleb Eestis esiettekandele 10. dets. Estonia Kontserdisaalis, teose esiettekannet selle aasta veebruaris Stuttgardis dirigeeris Olari Elts

  1. Novel method for the production of spin-aligned RI beams in projectile fragmentation reaction with the dispersion matching technique

    Energy Technology Data Exchange (ETDEWEB)

    Ichikawa, Y., E-mail: yuichikawa@phys.titech.ac.jp [Tokyo Institute of Technology, Department of Physics (Japan); Ueno, H. [RIKEN Nishina Center (Japan); Ishii, Y. [Tokyo Institute of Technology, Department of Physics (Japan); Furukawa, T. [Tokyo Metropolitan University, Department of Physics (Japan); Yoshimi, A. [Okayama University, Research Core for Extreme Quantum World (Japan); Kameda, D.; Watanabe, H.; Aoi, N. [RIKEN Nishina Center (Japan); Asahi, K. [Tokyo Institute of Technology, Department of Physics (Japan); Balabanski, D. L. [Bulgarian Academy of Sciences, Institute for Nuclear Research and Nuclear Energy (Bulgaria); Chevrier, R.; Daugas, J. M. [CEA, DAM, DIF (France); Fukuda, N. [RIKEN Nishina Center (Japan); Georgiev, G. [CSNSM, IN2P3-CNRS, Universite Paris-sud (France); Hayashi, H.; Iijima, H. [Tokyo Institute of Technology, Department of Physics (Japan); Inabe, N. [RIKEN Nishina Center (Japan); Inoue, T. [Tokyo Institute of Technology, Department of Physics (Japan); Ishihara, M.; Kubo, T. [RIKEN Nishina Center (Japan); and others

    2013-05-15

    A novel method to produce spin-aligned rare-isotope (RI) beam has been developed, that is the two-step projectile fragmentation method with a technique of dispersion matching. The present method was verified in an experiment at the RIKEN RIBF, where an RI beam of {sup 32}Al with spin alignment of 8(1) % was successfully produced from a primary beam of {sup 48}Ca, with {sup 33}Al as an intermediate nucleus. Figure of merit of the present method was found to be improved by a factor larger than 50 compared with a conventional method employing single-step projectile fragmentation.

  2. DPP-4 inhibitor treatment: β-cell response but not HbA1c reduction is dependent on the duration of diabetes

    Directory of Open Access Journals (Sweden)

    Kozlovski P

    2017-03-01

    Full Text Available Plamen Kozlovski,1 Vaishali Bhosekar,2 James E Foley3 1Novartis Pharma AG, Basel, Switzerland; 2Novartis Healthcare Private Limited, Hyderabad, India; 3Novartis Pharmaceuticals Corporation, East Hanover, NJ, USA Introduction: Dipeptidyl peptidase-4 (DPP-4 inhibitors reduce hyperglycemia in patients with type 2 diabetes mellitus (T2DM by enhancing insulin and suppressing glucagon secretion. Since T2DM is associated with progressive loss of β-cell function, we hypothesized that the DPP-4 inhibitor action to improve β-cell function would be attenuated with longer duration of T2DM.Methods: Data from six randomized, placebo-controlled trials of 24 weeks duration, where β-cell response to vildagliptin 50 mg twice daily was assessed, were pooled. In each study, the insulin secretory rate relative to glucose (ISR/G 0–2h during glucose load (standard meal or oral glucose tolerance test was assessed at baseline and end of study. The mean placebo-subtracted difference (PSD in the change in ISR/G 0–2h from baseline for each study was evaluated as a function of age, duration of T2DM, baseline ISR/G 0–2h, glycated hemoglobin (HbA1c, fasting plasma glucose, body mass index, and mean PSD in the change in HbA1c from baseline, using univariate model.Results: There was a strong negative association between the PSD in the change from baseline in ISR/G 0–2h and duration of T2DM (r= −0.89, p<0.02. However, there was no association between the PSD in the change from baseline in ISR/G 0–2h and the PSD in the change from baseline in HbA1c (r=0.33, p=0.52. None of the other characteristics were significantly associated with mean PSD change in ISR/G 0–2h.Conclusion: These findings indicate that the response of the β-cell, but not the HbA1c reduction, with vildagliptin is dependent on duration of T2DM. Further, it can be speculated that glucagon suppression may become the predominant mechanism via which glycemic control is improved when treatment with a

  3. Factors associated with reaching or not reaching target HbA1c after initiation of basal or premixed insulin in patients with type 2 diabetes.

    Science.gov (United States)

    Scheen, A J; Schmitt, H; Jiang, H H; Ivanyi, T

    2017-02-01

    To evaluate factors associated with reaching or not reaching target glycated haemoglobin (HbA 1c ) levels by analysing the respective contributions of fasting hyperglycaemia (FHG), also referred to as basal hyperglycaemia, vs postprandial hyperglycaemia (PHG) before and after initiation of a basal or premixed insulin regimen in patients with type 2 diabetes. This post-hoc analysis of insulin-naïve patients in the DURABLE study randomised to receive either insulin glargine or insulin lispro mix 25 evaluated the percentages of patients achieving a target HbA 1c of <7.0% (<53mmol/mol) per baseline HbA 1c quartiles, and the effect of each insulin regimen on the relative contributions of PHG and FHG to overall hyperglycaemia. Patients had comparable demographic characteristics and similar HbA 1c and FHG values at baseline in each HbA 1c quartile regardless of whether they reached the target HbA 1c . The higher the HbA 1c quartile, the greater was the decrease in HbA 1c , but also the smaller the percentage of patients achieving the target HbA 1c . HbA 1c and FHG decreased more in patients reaching the target, resulting in significantly lower values at endpoint in all baseline HbA 1c quartiles with either insulin treatment. Patients not achieving the target HbA 1c had slightly higher insulin doses, but lower total hypoglycaemia rates. Smaller decreases in FHG were associated with not reaching the target HbA 1c , suggesting a need to increase basal or premixed insulin doses to achieve targeted fasting plasma glucose and improve patient response before introducing more intensive prandial insulin regimens. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  4. The erudite humility of the historian: the 'critical epistemology' of Georges Lantéri-Laura.

    Science.gov (United States)

    Basso Lorini, Elisabetta

    2017-06-01

    This paper analyses the historical and epistemological work of the French psychiatrist Georges Lantéri-Laura (1930-2004) within the context of the French 'tradition' of history and philosophy of sciences, with special reference to Georges Canguilhem and Michel Foucault. After an introduction devoted to a critical survey of the most recent works on the history and historiography of psychiatry in French, the paper outlines Lantéri-Laura's approach by focusing especially on the role played by the methodological concept of 'semiology' as regards the relation between medicine and psychiatry. The last part of the paper draws attention to the relation between the history and philosophy of psychiatry in light of Lantéri-Laura's 'critical epistemology'.

  5. Fyn kinase controls Fc{epsilon}RI receptor-operated calcium entry necessary for full degranulation in mast cells

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez-Miranda, Elizabeth; Ibarra-Sanchez, Alfredo [Departamento de Farmacobiologia, Centro de Investigacion y de Estudios Avanzados (Cinvestav), Sede Sur, Calzada de los Tenorios 235, Col. Granjas Coapa, CP 14330 Mexico City (Mexico); Gonzalez-Espinosa, Claudia, E-mail: cgonzal@cinvestav.mx [Departamento de Farmacobiologia, Centro de Investigacion y de Estudios Avanzados (Cinvestav), Sede Sur, Calzada de los Tenorios 235, Col. Granjas Coapa, CP 14330 Mexico City (Mexico)

    2010-01-22

    IgE-antigen-dependent crosslinking of the high affinity IgE receptor (Fc{epsilon}RI) on mast cells leads to degranulation, leukotriene synthesis and cytokine production. Calcium (Ca{sup 2+}) mobilization is a sine qua non requisite for degranulation, allowing the rapid secretion of stored pro-inflammatory mediators responsible for allergy symptoms. Fyn is a Src-family kinase that positively controls Fc{epsilon}RI-induced mast cell degranulation. However, our understanding of the mechanism connecting Fyn activation to secretion of pre-synthesized mediators is very limited. We analyzed Fc{epsilon}RI-dependent Ca{sup 2+} mobilization in bone marrow-derived mast cells (BMMCs) differentiated from WT and Fyn -/- knock out mice. Fyn -/- BMMCs showed a marked defect in extracellular Ca{sup 2+} influx after Fc{epsilon}RI crosslinking but not after thapsigargin addition. High concentrations of Gadolinium (Gd{sup 3+}) partially blocked Fc{epsilon}RI-induced Ca{sup 2+} influx in WT cells but, in contrast, completely inhibited Ca{sup 2+} mobilization in Fyn -/- cells. Low concentrations of an inhibitor of the canonical transient receptor potential (TRPC) Ca{sup 2+} channels (2-aminoethoxyphenyl-borane, 2-APB) blocked Fc{epsilon}RI-induced maximal Ca{sup 2+} rise in WT but not in Fyn -/- cells. Ca{sup 2+} entry through Fyn-controlled, 2-APB sensitive channels was found to be important for full degranulation and IL-2 mRNA accumulation in WT cells. Immunoprecipitation assays showed that Fyn kinase interacts with TRPC 3/6/7 channels after IgE-antigen stimulation, but its association is not related to protein tyrosine phosphorylation. Results indicate Fyn kinase mediates the receptor-dependent activation of TRPC channels that contribute to degranulation in Fc{epsilon}RI-stimulated mast cells.

  6. Induction of T helper 1 response by immunization of BALB/c mice with the gene encoding the second subunit of Echinococcus granulosus antigen B (EgAgB8/2

    Directory of Open Access Journals (Sweden)

    Boutennoune H.

    2012-05-01

    Full Text Available A pre-designed plasmid containing the gene encoding the second subunit of Echinococcus granulosus AgB8 (EgAgB8/2 was used to study the effect of the immunization route on the immune response in BALB/c mice. Mice were immunized with pDRIVEEgAgB8/ 2 or pDRIVE empty cassette using the intramuscular (i.m., intranasal (i.n. or the epidermal gene gun (g.g. routes. Analysis of the antibody response and cytokine data revealed that gene immunization by the i.m. route induced a marked bias towards a T helper type 1 (Th1 immune response as characterized by high IFN-γ gene expression and a low IgG1/IgG2a reactivity index (R.I. ratio of 0.04. The i.n. route showed a moderate IFN-γ expression but a higher IgG1/IgG2a R.I. ratio of 0.25 indicating a moderate Th1 response. In contrast, epidermal g.g. immunization induced a Th2 response characterized by high IL-4 expression and the highest IgG1/IgG2a R.I. ratio of 0.58. In conclusion, this study showed the advantage of genetic immunization using the i.m. route and i.n. over the epidermal g.g. routes in the induction of Th1 immunity in response to E. granulosus AgB gene immunization.

  7. Development of Biochips and Kits using RI Detection Technology for Life Science

    International Nuclear Information System (INIS)

    Park, Sang Hyun; Park, H. J.; Choi, S. M.

    2010-04-01

    Microarrays have recently become a precious research tool for proteomics and clinical investigation. In this study, we report on an efficient strategy for the detection of phosphorylation of a substrate catalyzed by kinase, using the radioisotope (RI) detection technique for a protein biochip. The biochip for the detection of phosphorylation using a RI facilitates the detection of phosphorylation with minimum amount of a sample by simple processes, compared with the conventional method using an antibody. It was more than 30 times detection sensitivity compared to conventional fluorescence detection technique. This technique does not employ the use of the blocking step which is commonly used in conventional methods to prevent non-specific binding. ELSA method was more than seven steps, but the usage of RI detection technique reduces the overall steps. Consequently, this technique is very simple, and considerably reduces the experiment time thus facilitating in an easy detection. Furthermore, it is highly sensitivity, thus facilitating the detection of even minor quantities of protein and rapid data analysis. It can be a useful tool for a high throughput screening in biological and medical research, and for studying protein-protein interactions

  8. Development of new auxiliary basis functions of the Karlsruhe segmented contracted basis sets including diffuse basis functions (def2-SVPD, def2-TZVPPD, and def2-QVPPD) for RI-MP2 and RI-CC calculations.

    Science.gov (United States)

    Hellweg, Arnim; Rappoport, Dmitrij

    2015-01-14

    We report optimized auxiliary basis sets for use with the Karlsruhe segmented contracted basis sets including moderately diffuse basis functions (Rappoport and Furche, J. Chem. Phys., 2010, 133, 134105) in resolution-of-the-identity (RI) post-self-consistent field (post-SCF) computations for the elements H-Rn (except lanthanides). The errors of the RI approximation using optimized auxiliary basis sets are analyzed on a comprehensive test set of molecules containing the most common oxidation states of each element and do not exceed those of the corresponding unaugmented basis sets. During these studies an unsatisfying performance of the def2-SVP and def2-QZVPP auxiliary basis sets for Barium was found and improved sets are provided. We establish the versatility of the def2-SVPD, def2-TZVPPD, and def2-QZVPPD basis sets for RI-MP2 and RI-CC (coupled-cluster) energy and property calculations. The influence of diffuse basis functions on correlation energy, basis set superposition error, atomic electron affinity, dipole moments, and computational timings is evaluated at different levels of theory using benchmark sets and showcase examples.

  9. 77 FR 39395 - Special Local Regulations; Ocean State Tall Ships Festival 2012, Narragansett Bay, RI

    Science.gov (United States)

    2012-07-03

    ...-AA08 Special Local Regulations; Ocean State Tall Ships Festival 2012, Narragansett Bay, RI AGENCY... Tall Ships Festival 2012. DATES: This rule is effective from July 6, 2012 until July 10, 2012... ``Special Local Regulations: Ocean State Tall Ships Festival 2012, Narragansett Bay, RI'' in the Federal...

  10. Changes in interleukin-1 signal modulators induced by 3,4-methylenedioxymethamphetamine (MDMA: regulation by CB2 receptors and implications for neurotoxicity

    Directory of Open Access Journals (Sweden)

    O'Shea Esther

    2011-05-01

    Full Text Available Abstract Background 3,4-Methylenedioxymethamphetamine (MDMA produces a neuroinflammatory reaction in rat brain characterized by an increase in interleukin-1 beta (IL-1β and microglial activation. The CB2 receptor agonist JWH-015 reduces both these changes and partially protects against MDMA-induced neurotoxicity. We have examined MDMA-induced changes in IL-1 receptor antagonist (IL-1ra levels and IL-1 receptor type I (IL-1RI expression and the effects of JWH-015. The cellular location of IL-1β and IL-1RI was also examined. MDMA-treated animals were given the soluble form of IL-1RI (sIL-1RI and neurotoxic effects examined. Methods Dark Agouti rats received MDMA (12.5 mg/kg, i.p. and levels of IL-1ra and expression of IL-1RI measured 1 h, 3 h or 6 h later. JWH-015 (2.4 mg/kg, i.p. was injected 48 h, 24 h and 0.5 h before MDMA and IL-1ra and IL-1RI measured. For localization studies, animals were sacrificed 1 h or 3 h following MDMA and stained for IL-1β or IL-1RI in combination with neuronal and microglial markers. sIL-1RI (3 μg/animal; i.c.v. was administered 5 min before MDMA and 3 h later. 5-HT transporter density was determined 7 days after MDMA injection. Results MDMA produced an increase in IL-ra levels and a decrease in IL-1RI expression in hypothalamus which was prevented by CB2 receptor activation. IL-1RI expression was localized on neuronal cell bodies while IL-1β expression was observed in microglial cells following MDMA. sIL-1RI potentiated MDMA-induced neurotoxicity. MDMA also increased IgG immunostaining indicating that blood brain-barrier permeability was compromised. Conclusions In summary, MDMA produces changes in IL-1 signal modulators which are modified by CB2 receptor activation. These results indicate that IL-1β may play a partial role in MDMA-induced neurotoxicity.

  11. Chapiniella variabilis (Nematoda parasitizing Chelonoidis carbonarius and C. denticulatus (Testudinidae in the state of Piauí

    Directory of Open Access Journals (Sweden)

    Simone Mousinho Freire

    Full Text Available Abstract Chapiniella variabilis (Chapin, 1924, a strongylid nematode, was collected parasitizing the large intestine of the tortoises Chelonoidis carbonarius (Spix, 1824 (Cc and C. denticulatus (Linnaeus, 1766 (Cd in the Zoobotanical Park of the municipality of Teresina, state of Piauí, Brazil. The taxonomic identification was based on morphological and morphometric features, using bright-field and scanning electron microscopy. The present study adds new observations on the morphology, mainly relating to the mouth papillae, external and internal leaf-crown elements, excretory pore, deirids and male and female posterior end. The parasitic indices of prevalence (P, mean intensity (MI, mean abundance (MA and range of infection (RI of C. variabilis in these two tortoise species were: P = 100%, MI = 833.3, MA = 833.3, RI = 500-1,500 (Cc; P = 100%, MI = 472.2, MA = 472.2, RI = 333-500 (Cd. This record expands occurrences of C. variabilis to a new host, C. carbonarius, and to another state in Brazil, in the Neotropical region of South America. Adjustment to host management with the aim of improving hygiene and health conditions is suggested.

  12. Nutritional intervention and impact of polyphenol on glycohemoglobin (HbA1c) in non-diabetic and type 2 diabetic subjects: Systematic review and nmeta-analysis.

    Science.gov (United States)

    Palma-Duran, Susana A; Vlassopoulos, Antonis; Lean, Mike; Govan, Lindsay; Combet, Emilie

    2017-03-24

    Polyphenols have been extensively studied for their antioxidant and anti-inflammatory properties. Recently, their antiglycative actions by oxidative stress modulation have been linked to the prevention of diabetes and associated complications. This article assesses the evidence for polyphenol interventions on glycohemoglobin (HbA1c) in non-diabetic, pre-diabetic, and type 2 diabetes mellitus (T2DM) subjects. A systematic review of polyphenols' clinical trials on HbA1c in humans was performed according to the Preferred Reporting Items for Systematic Review and Meta-Analysis. Thirty-six controlled randomized trials with HbA1c values were included. Polyphenols (extracts, supplements, and foods) were supplemented (28 mg to 1.5 g) for 0.7 to 12 months. Combining all subjects (n = 1954, mean baseline HbA1c = 7.03%, 53 mmol/mol), polyphenol supplementation significantly (P HbA1c% by -0.53 ± 0.12 units (-5.79 ± 0.13 mmol/mol). This reduction was significant (P HbA1c = 7.44%, 58 mmol/mol), with HbA1c% lowered by -0.21 ± 0.04 units (-2.29 ± 0.4 mmol/mol). Polyphenol supplementation had no significant effect (P > 0.21) in the non-diabetic (n = 258, mean baseline HbA1c = 5.47%, 36 mmol/mol) and the pre-diabetic subjects (n = 270, mean baseline HbA1c = 6.06%, 43 mmol/mol) strata: -0.39 ± 0.27 HbA1c% units (-4.3 ± 0.3 mmol/mol), and -0.38 ± 0.31 units (-4.2 ± 0.31 mmol/mol), respectively. In conclusion, polyphenols can successfully reduce HbA1c in T2DM without any intervention at glycemia, and could contribute to the prevention of diabetes complications.

  13. Radical SAM Enzymes in the Biosynthesis of Ribosomally Synthesized and Post-translationally Modified Peptides (RiPPs

    Directory of Open Access Journals (Sweden)

    Alhosna Benjdia

    2017-11-01

    Full Text Available Ribosomally-synthesized and post-translationally modified peptides (RiPPs are a large and diverse family of natural products. They possess interesting biological properties such as antibiotic or anticancer activities, making them attractive for therapeutic applications. In contrast to polyketides and non-ribosomal peptides, RiPPs derive from ribosomal peptides and are post-translationally modified by diverse enzyme families. Among them, the emerging superfamily of radical SAM enzymes has been shown to play a major role. These enzymes catalyze the formation of a wide range of post-translational modifications some of them having no counterparts in living systems or synthetic chemistry. The investigation of radical SAM enzymes has not only illuminated unprecedented strategies used by living systems to tailor peptides into complex natural products but has also allowed to uncover novel RiPP families. In this review, we summarize the current knowledge on radical SAM enzymes catalyzing RiPP post-translational modifications and discuss their mechanisms and growing importance notably in the context of the human microbiota.

  14. 75 FR 66748 - Notice of Baseline Filings

    Science.gov (United States)

    2010-10-29

    ...- 000] Notice of Baseline Filings October 22, 2010. ONEOK Gas Transportation, L.L.C Docket No. PR11-68... above submitted a revised baseline filing of their Statement of Operating Conditions for services...

  15. DIFFERENTIAL BINDING OF HUMAN INTERLEUKIN-1 (IL-1) RECEPTOR ANTAGONIST TO NATURAL AND RECOMBINANT SOLUBLE AND CELLULAR IL-1 TYPE-I RECEPTORS

    DEFF Research Database (Denmark)

    Svenson, Morten; Nedergaard, Susanne; Heegaard, Peter M. H.

    1995-01-01

    antagonist (IL-1ra). Recombinant soluble human IL-1RI expressed in COS cells (sIL-1RI) consists of the extracellular part of the receptor and binds all three known IL-1 species but preferentially to IL-1ra. We further characterized the sizes and binding of IL-1raBF and sIL-1RI to IL-1ra by polyacrylamide gel...... electrophoresis in the presence of sodium dodecylsulfate, ligand binding interference analyses, N-glycosidase treatment, concanavalin A affinity chromatography, and with the use of monoclonal antibodies (mAb) to human recombinant IL-1ra. We also evaluated the binding of IL-1ra to cellular IL-1RI on MRC5...... binding of both molecules to IL-1ra. Both factors blocked binding of IL-1ra to cellular IL-1RI, as did mAb to IL-1ra, but the sites on IL-1ra which bound to the mAb, and to IL-1raBF and sIL-1RI, differed. We conclude that there are important differences between the natural and recombinant forms of soluble...

  16. Report on EUROMET.RI(I)-K1 and EUROMET.RI(I)-K4 (EUROMET project no. 813): Comparison of air kerma and absorbed dose to water measurements of {sup 60}Co radiation beams for radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Csete, I. [National Office of Measures (OMH) - pilot laboratory and corresponding author (Hungary); Leiton, A.G. [Research Centre for Energy, Environment and Technology (CMRI-CIEMAT) (Spain); Sochor, V. [Czech Metrology Institute (CMI) (Czech Republic); Lapenas, A. [Latvian National Metrology Center (LNMC-RMTC) (Latvia); Grindborg, J.E. [Swedish Radiation Protection Authority (SSI) (Sweden); Jokelainen, I. [Radiation and Nuclear Safety Authority (STUK) (Finland); Bjerke, H. [Norwegian Radiation Protection Authority (NRPA) (Norway); Dobrovodsky, J. [Slovak Institute of Metrology (SMU) (Slovakia); Megzifene, A. [International Atomic Energy Agency, IAEA, Vienna (Austria); Hourdakis, C.J. [Hellenic Atomic Energy Committee (HAEC-HIRCL) (Greece); Ivanov, R. [National Centre of Metrology (NCM) (Bulgaria); Vekic, B. [Rudjer Boskovic Institute (IRB) (Croatia); Kokocinski, J. [Central Office of Measures (GUM) (Poland); Cardoso, J. [Institute for Nuclear Technology (ITN-LMRIR) (Portugal); Buermann, L. [Physikalisch Technische Bundesanstalt (PTB) (Germany); Tiefenboeck, W. [Bundesamt fur Eich und Vermesungswesen (BEV) (Austria); Stucki, G. [17 Bundesamt fur Metrologie (METAS) (Switzerland); Van Dijk, E. [NMi Van Swinden Laboratorium (NMi) (Netherlands); Toni, M.P. [ENEA-CR Istituto Nazionale di Metrologia delle Radiazioni Ionizzanti (ENEA) (Italy); Minniti, R. [20 National Institute of Standards and Technology (NIST) (United States); McCaffrey, J.P. [National Research Council Canada (NRC) (Canada); Silva, C.N.M. [National Metrology Laboratory of Ionizing Radiation (LNMRI-IRD) (Brazil); Kharitonov, I. [D I Mendeleyev Institute for Metrology (VNIIM) (RU); Webb, D. [Australian Radiation Protection and Nuclear Safety Agency (ARPANSA) (Australia); Saravi, M. [National Atomic Energy Commission (CNEA-CAE) (Argentina); Delaunay, F. [Laboratoire National Henri Becquerel (LNE-LNHB) (France)

    2010-06-15

    The results of an unprecedented international effort involving 26 countries are reported. The EUROMET.RI(I)-K1 and EUROMET.RI(I)-K4 key comparisons were conducted with the goal of supporting the relevant calibration and measurement capabilities (CMC) planned for publication by the participant laboratories. The measured quantities were the air kerma (K{sub air}) and the absorbed dose to water (Dw) in {sup 60}Co radiotherapy beams. The comparison was conducted by the pilot laboratory MKEH (Hungary), in a star-shaped arrangement from January 2005 to December 2008. The calibration coefficients of four transfer ionization chambers were measured using two electrometers. The largest deviation between any two calibration coefficients for the four chambers in terms of air kerma and absorbed dose to water was 2.7% and 3.3% respectively. An analysis of the participant uncertainty budgets enabled the calculation of degrees of equivalence (DoE), in terms of the deviations of the results and their associated uncertainties. As a result of this EUROMET project 813 comparison, the BIPM key comparison database (KCDB) will include eleven new Kair and fourteen new D{sub w} DoE values of European secondary standard dosimetry laboratories (SSDLs), and the KCDB will be updated with the new DoE values of the other participant laboratories. The pair-wise degrees of equivalence of participants were also calculated. In addition to assessing calibration techniques and uncertainty calculations of the participants, these comparisons enabled the experimental determinations of N{sub Dw}/N{sub Kair} ratios in the {sup 60}Co gamma radiation beam for the four radiotherapy transfer chambers. (authors)

  17. Dating the Bibong-ri Neolithic site in Korea: Excavating the oldest ancient boat

    International Nuclear Information System (INIS)

    Park, Gyujun; Kim, Jong-Chan; Youn, Minyoung; Yun, Chongcheol; Kang, Jin; Song, Yong-Mi; Song, Su-Jin; Noh, Hye-Jin; Kim, Do-Kyun; Im, Hack-Jong

    2010-01-01

    The remains of an ancient wooden boat were unearthed at the Bibong-ri shell mound site. The site was located at Bibong-ri, Bugog-myeon, Changnyeong-gun, Gyeongsangnam-do in South Korea. A substantial fragment of the vessel was discovered in the lowest layer of the site. We collected 17 samples of charcoal and wood from pebble, sand, and shell layers. Sample preparation extracted the carbon from each sample material and converted it into graphite for AMS radiocarbon dating. Radiocarbon dates of the samples indicate that they belong to the Neolithic period and that the boat dates from ca. 5700 BC. To this point, the oldest known boat in the world has been a wooden boat dating from ca. 5500 BC in China. Other ancient boats from around the world include a logboat dating from ca. 3600 BC in Japan and a fleet of wooden boats dating from ca. 3000 BC in Egypt. The Bibong-ri boat is the first boat from the Neolithic period ever found in South Korea and must represent one of the world's oldest known boats.

  18. Consideration of the direction for improving RI-biomics information system for using big data in radiation field

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seung Hyun; Kim, Joo Yeon; Park, Tai Jin [Korean Association for Radiation Application, Seoul (Korea, Republic of); Lim, Young Khi [Dept. of Radiological Science, Gachon University, Incheon (Korea, Republic of)

    2017-03-15

    RI-Biomics is a fusion technology in radiation felds for evaluating in-vivo dynamics such as absorption, distribution, metabolism and excretion (RI-ADME) of new drugs and materials using radioisotopes and quantitative evaluation of their effcacy. RI-Biomics information is being provided by RIBio-Info developed as information system for distributing its information and three requirements for improving RIBio-Info system have been derived through reviewing recent big data trends in this study. Three requirements are defined as resource, technology and manpower, and some reviews for applying big data in RIBio-In system are suggested. Fist, applicable external big data have to be obtained, second, some infrastructures for realizing applying big data to be expanded, and finally, data scientists able to analyze large scale of information to be trained. Therefore, an original technology driven to analyze for atypical and large scale of data can be created and this stated technology can contribute to obtain a basis to create a new value in RI-Biomics feld.

  19. Consideration of the direction for improving RI-biomics information system for using big data in radiation field

    International Nuclear Information System (INIS)

    Lee, Seung Hyun; Kim, Joo Yeon; Park, Tai Jin; Lim, Young Khi

    2017-01-01

    RI-Biomics is a fusion technology in radiation felds for evaluating in-vivo dynamics such as absorption, distribution, metabolism and excretion (RI-ADME) of new drugs and materials using radioisotopes and quantitative evaluation of their effcacy. RI-Biomics information is being provided by RIBio-Info developed as information system for distributing its information and three requirements for improving RIBio-Info system have been derived through reviewing recent big data trends in this study. Three requirements are defined as resource, technology and manpower, and some reviews for applying big data in RIBio-In system are suggested. Fist, applicable external big data have to be obtained, second, some infrastructures for realizing applying big data to be expanded, and finally, data scientists able to analyze large scale of information to be trained. Therefore, an original technology driven to analyze for atypical and large scale of data can be created and this stated technology can contribute to obtain a basis to create a new value in RI-Biomics feld

  20. High titers of both rheumatoid factor and anti-CCP antibodies at baseline in patients with rheumatoid arthritis are associated with increased circulating baseline TNF level, low drug levels, and reduced clinical responses: a post hoc analysis of the RISING study.

    Science.gov (United States)

    Takeuchi, Tsutomu; Miyasaka, Nobuyuki; Inui, Takashi; Yano, Toshiro; Yoshinari, Toru; Abe, Tohru; Koike, Takao

    2017-09-02

    Although both rheumatoid factor (RF) and anticyclic citrullinated peptide antibodies (anti-CCP) are useful for diagnosing rheumatoid arthritis (RA), the impact of these autoantibodies on the efficacy of tumor necrosis factor (TNF) inhibitors has been controversial. The aim of this post hoc analysis of a randomized double-blind study (the RISING study) was to investigate the influences of RF and anti-CCP on the clinical response to infliximab in patients with RA. Methotrexate-refractory patients with RA received 3 mg/kg of infliximab from weeks 0 to 6 and then 3, 6, or 10 mg/kg every 8 weeks from weeks 14 to 46. In this post hoc analysis, patients were stratified into three classes on the basis of baseline RF/anti-CCP titers: "low/low-C" (RF < 55 IU/ml, anti-CCP < 42 U/ml), "high/high-C" (RF ≥ 160 IU/ml, anti-CCP ≥ 100 U/ml), and "middle-C" (neither low/low-C nor high/high-C). Baseline plasma TNF level, serum infliximab level, and disease activity were compared between the three classes. Baseline RF and anti-CCP titers showed significant correlations with baseline TNF and infliximab levels in weeks 2-14. Comparison of the three classes showed that baseline TNF level was lowest in the low/low-C group and highest in the high/high-C group (median 0.73 versus 1.15 pg/ml), that infliximab levels at week 14 were highest in the low/low-C group and lowest in the high/high-C group (median 1.0 versus 0.1 μg/ml), and that Disease Activity Score in 28 joints based on C-reactive protein at week 14 was lowest in the low/low-C group and highest in the high/high-C group (median 3.17 versus 3.82). A similar correlation was observed at week 54 in the 3 mg/kg dosing group, but not in the 6 or 10 mg/kg group. Significant decreases in both RF and anti-CCP were observed during infliximab treatment. RF/anti-CCP titers correlated with TNF level. This might explain the association of RF/anti-CCP with infliximab level and clinical response in patients with RA

  1. Modeling tools for an Integrated River-Delta-Sea system investigation: the Pan-European Research Infrastructure DANUBIUS-RI philosophy

    Science.gov (United States)

    Umgiesser, Georg; Bellafiore, Debora; De Pascalis, Francesca; Icke, Joost; Stanica, Adrian

    2017-04-01

    urban area and a water quality model for the sea. Obviously, the subsystems interact with each other: water flows from the catchments to the rivers and into the sea. The rainfall runoff from the upstream catchment picks up the emissions and the river transports the substances via the estuaries to the sea. In the sea, the substances interact with the marine ecosystem. The challenge for the modeling of river - sea systems is (1) the integration of models for the geographical domains, (2) the integration of physical, chemical, ecological and socio-economical processes and (3) the exploration and application of new data sources. The modeling strategy that is starting to be shaped within DANUBIUS-RI will provide relocatable tools and suitable techniques to be efficiently applied in the different geographical areas, integrating the DANUBIUS-RI modeling skills and showing high performance modeling solutions for the investigation of RS systems. Moreover, a technological advanced platform for modeling services, in terms of software and shared data will be created. A preliminary sketch of the organization of the DANUBIUS modeling node and examples of field of action for RS systems investigation will be provided.

  2. Development & automation of a novel ["1"8F]F prosthetic group, 2-["1"8F]-fluoro-3-pyridinecarboxaldehyde, and its application to an amino(oxy)-functionalised Aβ peptide

    International Nuclear Information System (INIS)

    Morris, Olivia; Gregory, J.; Kadirvel, M.; Henderson, Fiona; Blykers, A.; McMahon, Adam; Taylor, Mark; Allsop, David; Allan, Stuart; Grigg, J.; Boutin, Herve; Prenant, Christian

    2016-01-01

    2-["1"8F]-Fluoro-3-pyridinecarboxaldehyde (["1"8F]FPCA) is a novel, water-soluble prosthetic group. It's radiochemistry has been developed and fully-automated for application in chemoselective radiolabelling of amino(oxy)-derivatised RI-OR2-TAT peptide, (Aoa-k)-RI-OR2-TAT, using a GE TRACERlab FX-FN. RI-OR2-TAT is a brain-penetrant, retro-inverso peptide that binds to amyloid species associated with Alzheimer's Disease. Radiolabelled (Aoa-k)-RI-OR2-TAT was reproducibly synthesised and the product of the reaction with FPCA has been fully characterised. In-vivo biodistribution of ["1"8F]RI-OR2-TAT has been measured in Wistar rats.

  3. Äriühingu juhatuse liikme teenistusalane suhe : [bakalaureusetöö] / Anneli Kiljako ; Tartu Ülikool, õigusteaduskond ; juhendaja: Inge-Maret Orgo

    Index Scriptorium Estoniae

    Kiljako, Anneli

    1999-01-01

    Äriühingu juhatuse liikme teenistusalase suhtega seonduvad probleemid, äriühingu juhatuse liikme ja ja äriühingu vahelise lepingu sõlmimine, poolte õigused, kohustused, vastutus; juhtimislepingu lõppemine

  4. The future plan for the applications of RI produced in the proton-induced spallation-reaction

    Energy Technology Data Exchange (ETDEWEB)

    Ikezoe, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1997-07-01

    A plan of research facilities (transmutations of minor actinides and neutron scattering for material and life sciences) has been proposed in JAERI. This plan is based on a proton lineac with an energy of 1.5 GeV and a beam current of several mA. Among these facilities, we are planning to accelerate neutron-rich radioactive nuclei (RI) produced in the fission and spallation reactions of thorium or uranium bombarded by the intense high energy proton beams. The RI produced in an ion source are separated by a high resolution isotope separator and their charge states are changed to be negative to inject into the existing tandem-booster accelerator. Main purpose of this plan is to study the nuclear and chemical properties of neutron rich transactinium elements not yet synthesized and the nuclear structures of neutron rich nuclei far from the nuclear stability line. (author)

  5. AN EXAMINATION OF RECENT TRANSFORMATIONS TO THE BV(RI)C PHOTOMETRIC SYSTEM FROM THE PERSPECTIVE OF STELLAR MODELS FOR OLD STARS

    International Nuclear Information System (INIS)

    VandenBerg, Don A.; Casagrande, L.; Stetson, Peter B.

    2010-01-01

    Isochrones for ages ∼>4 Gyr and metallicities in the range -2.5∼ C photometric system for several open and globular star clusters. The adopted color-T eff relations include those which we have derived from the latest MARCS model atmospheres and the empirical transformations for dwarf and subgiant stars given by Casagrande et al. (CRMBA). Those reported by VandenBerg and Clem have also been considered, mainly to resolve some outstanding questions concerning them. Indeed, for the latter, V - I C colors should be corrected by ∼-0.02 mag, for all metal abundances, in order to obtain consistent interpretations of the observed (B - V, V), (V - R C , V), and (V - I C , V) diagrams for M 67 and the Hyades as well as for local subdwarfs. Remarkably, when the subdwarfs in the CRMBA data set that have σ π /π ≤ 0.15 are superimposed on a set of 12 Gyr isochrones spanning a wide range in [Fe/H], the inferred metallicities and effective temperatures agree, in the mean, with those given by CRMBA to within ±0.05 dex and ±10 K, respectively. Thus, the hot T eff scale derived by CRMBA is nearly identical with that predicted by stellar models; and consequently, there is excellent consistency between theory and observations on the Hertzsprung-Russell diagram and the different color-magnitude diagrams considered in this investigation. To obtain similar consistency, the colors obtained from the MARCS and VandenBerg and Clem (B - V)-T eff relations for metal-poor dwarf stars should be adjusted to the red by 0.02-0.03 mag. In general, isochrones that employ the CRMBA transformations provide reasonably consistent fits to our BV(RI) C photometry for main-sequence stars in the globular clusters 47 Tuc, M 3, M 5, M 92, and NGC 1851-but not the cluster giants (when adopting the synthetic MARCS colors). We speculate that differences between the actual heavy-element mixtures and those assumed in the theoretical models may be the primary cause of this difficulty.

  6. DOES CLINICAL INERTIA VARY BY PERSONALIZED A1C GOAL? A STUDY OF PREDICTORS AND PREVALENCE OF CLINICAL INERTIA IN A U.S. MANAGED-CARE SETTING.

    Science.gov (United States)

    Lin, Jay; Zhou, Steve; Wei, Wenhui; Pan, Chunshen; Lingohr-Smith, Melissa; Levin, Philip

    2016-02-01

    Clinical inertia is defined as failure to initiate or intensify therapy despite an inadequate treatment response. We assessed the prevalence and identified the predictors of clinical inertia among patients with type 2 diabetes (T2DM) based on personalized goals. Three hemoglobin A1c (A1C) targets (American Diabetes Association A1C inertia was defined as no intensification of treatment during the response period. Demographic and clinical characteristics were analyzed to identify predictors of treatment intensification. Irrespective of A1C target, the majority of patients with T2DM (70.4 to 72.8%) experienced clinical inertia in the 6 months following the index event, with 5.3 to 6.2% of patients intensifying treatment with insulin. Patients with a lower likelihood of intensification were older, used >1 oral antidiabetes drug during the baseline period, and had an above-target A1C more recently. Treatment intensification was associated with patients who had point-of-service insurance, mental illness, an endocrinologist visit in the baseline period, or higher index A1C. The prevalence of clinical inertia among patients with T2DM in a U.S. managed-care setting is high and has increased over more recent years. Factors predicting increased risk of clinical inertia may help identify "at-risk" populations and assist in developing strategies to improve their management.

  7. Physics with a very long neutrino factory baseline

    International Nuclear Information System (INIS)

    Gandhi, Raj; Winter, Walter

    2007-01-01

    We discuss the neutrino oscillation physics of a very long neutrino factory baseline over a broad range of lengths (between 6000 km and 9000 km), centered on the 'magic baseline' (∼7500 km) where correlations with the leptonic CP phase are suppressed by matter effects. Since the magic baseline depends only on the density, we study the impact of matter density profile effects and density uncertainties over this range, and the impact of detector locations off the optimal baseline. We find that the optimal constant density describing the physics over this entire baseline range is about 5% higher than the average matter density. This implies that the magic baseline is significantly shorter than previously inferred. However, while a single detector optimization requires fine-tuning of the (very long) baseline length, its combination with a near detector at a shorter baseline is much less sensitive to the far detector location and to uncertainties in the matter density. In addition, we point out different applications of this baseline which go beyond its excellent correlation and degeneracy resolution potential. We demonstrate that such a long baseline assists in the improvement of the θ 13 precision and in the resolution of the octant degeneracy. Moreover, we show that the neutrino data from such a baseline could be used to extract the matter density along the profile up to 0.24% at 1σ for large sin 2 2θ 13 , providing a useful discriminator between different geophysical models

  8. Äriõigus 2006 : seaduste tekstid seisuga 01. 03. 2006 / koost. Andrus Lauren

    Index Scriptorium Estoniae

    2006-01-01

    Kaanel sisu: Äriseadustik. Tulundusühistuseadus. TsÜS. Euroopa äriühingu (SE) määrus. Euroopa äriühingu (SE) määruse RS. SE töötajate kaasamise seadus. Euroopa ühistu (SCE) määrus. Euroopa ühistu (SCE) määruse RS. EMHÜ määrus. EMHÜ määruse RS. Konkurentsiseadus. Majandustegevuse registri seadus. Väärtpaberite keskregistri seadus. - Kommentaarid lk. 256-276

  9. Rahvus, "glokaalsus" ja eesti kirjandusdiskursus aastatuhandevahetusel / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    2001-01-01

    Bibliogr. joonealustes märkustes. Artikli aluseks on rahvusvahelisel konverentsil "Cultural Identity and Its Glocal Manifestations" (Joensuu, 14.-16. IX 2000) peetud ingliskeelne ettekanne. Artikkel on ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 31-45

  10. The effectiveness of theory- and model-based lifestyle interventions on HbA1c among patients with type 2 diabetes: a systematic review and meta-analysis.

    Science.gov (United States)

    Doshmangir, P; Jahangiry, L; Farhangi, M A; Doshmangir, L; Faraji, L

    2018-02-01

    The prevalence of type 2 diabetes is rising rapidly around the world. A number of systematic reviews have provided evidence for the effectiveness of lifestyle interventions on diabetic patients. The effectiveness of theory- and model-based education-lifestyle interventions for diabetic patients are unclear. The systematic review and meta-analysis aimed to evaluate and quantify the impact of theory-based lifestyle interventions on type 2 diabetes. A literature search of authentic electronic resources including PubMed, Scopus, and Cochrane collaboration was performed to identify published papers between January 2002 and July 2016. The PICOs (participants, intervention, comparison, and outcomes) elements were used for the selection of studies to meet the inclusion and exclusion criteria. Mean differences and standard deviations of hemoglobin A1c (HbA1c [mmol/mol]) level in baseline and follow-up measures of studies in intervention and control groups were considered for data synthesis. A random-effects model was used for estimating pooled effect sizes. To investigate the source of heterogeneity, predefined subgroup analyses were performed using trial duration, baseline HbA1c (mmol/mol) level, and the age of participants. Meta-regression was performed to examine the contribution of trial duration, baseline HbA1c (mmol/mol) level, the age of participants, and mean differences of HbA1c (mmol/mol) level. The significant level was considered P HbA1c (mmol/mol) -5.35% (95% confidence interval = -6.3, -4.40; P HbA1c (mmol/mol) indices in patients with type 2 diabetes. Health education theories have been applied as a useful tool for lifestyle change among people with type 2 diabetes. Copyright © 2017 The Royal Society for Public Health. Published by Elsevier Ltd. All rights reserved.

  11. Ääremärkused diagnoosiks : Imagosfäär tulgu I = Remarks for diagnosis : Imagosphere Come I / Jüri Soolep

    Index Scriptorium Estoniae

    Soolep, Jüri, 1962-

    2008-01-01

    Imagosfääri empiiriline kehtestumine: meedia, Gutenbergi galaktika, isiklik imagosfäär. Imagosfääri teoreetiline konstitutsioon: simulaakrumid ja hüperreaalsus. Imagosfääri praktiline realisatsioon: Putini Venemaa. Artikkel põhineb Eesti Kunstiakadeemias 2007. a. sügissemestril peetud loengukursusel "Linnaehituse nüüdisaegsed probleemid". Bibliograafia lk. 38

  12. Prevalence of pre-treatment hepatitis C virus NS5A resistance associated amino-acid substitutions in genotype 1A infected patients in Scotland.

    Science.gov (United States)

    Bradley-Stewart, Amanda; Goldstein, Emily; MacLean, Alasdair; Gunson, Rory

    2018-04-01

    Hepatitis C (HCV) NS5A resistance associated amino-acid substitutions (RAS) can exist at baseline in treatment naïve individuals and have been shown to be associated with lower rates of sustained virological response (SVR) for patients infected with HCV genotype 1A (G1A) following treatment with NS5A inhibitors. The aim of this study was to measure the prevalence of baseline NS5A resistance in Scotland. The study population consisted of 531 treatment naïve, G1A infected patients. The patient samples were collected between March and September 2017. The NS5A region was amplified and sequenced. Baseline NS5A resistance in Scotland is high (16.8%) and is comparable to rates reported by a number of previously published studies. The high rate of baseline RAS, together with the high cost of direct-acting antivirals (DAAs), supports resistance testing to guide current patient treatment. However, given the rate at which new DAAs are currently being licensed with ever broader genotype efficacy and higher SVR rates, baseline resistance testing may not be required in the near future. Baseline NS5A inhibitor resistance is high. The results of the present study support performing resistance testing at baseline for current regimens. Crown Copyright © 2018. Published by Elsevier B.V. All rights reserved.

  13. A scalable implementation of RI-SCF on parallel computers

    International Nuclear Information System (INIS)

    Fruechtl, H.A.; Kendall, R.A.; Harrison, R.J.

    1996-01-01

    In order to avoid the integral bottleneck of conventional SCF calculations, the Resolution of the Identity (RI) method is used to obtain an approximate solution to the Hartree-Fock equations. In this approximation only three-center integrals are needed to build the Fock matrix. It has been implemented as part of the NWChem package of portable and scalable ab initio programs for parallel computers. Utilizing the V-approximation, both the Coulomb and exchange contribution to the Fock matrix can be calculated from a transformed set of three-center integrals which have to be precalculated and stored. A distributed in-core method as well as a disk based implementation have been programmed. Details of the implementation as well as the parallel programming tools used are described. We also give results and timings from benchmark calculations

  14. Aktsionäri infoõigus : [bakalaureusetöö] / Henri Parisalu ; Tartu Ülikool, õigusteaduskond ; juhendaja: Andres Vutt

    Index Scriptorium Estoniae

    Parisalu, Henri

    2009-01-01

    Aktsionäri infoõiguse eesmärkidest ja funktsioonidest, olemusest ja sisust mittebörsiühingutes ning börsiühingutes, siseriiklike ja rahvusvaheliste organisatsioonide mõjust aktsionäri infoõigusele

  15. Comparison of cerebrospinal fluid dynamics studied by computed tomography (CT) and radioisotope (RI) cisternography

    International Nuclear Information System (INIS)

    Tamaki, N.; Kanazawa, Y.; Asada, M.; Kusunoki, T.; Matsumoto, S.

    1978-01-01

    CT and RI cisternography were done on 55 cases with normal and abnormal CSF circulation. Of 19 cases in which both studies were done, 14 cases disclosed a good correspondence. The remaining five cases showed no correspondence because of technical failure. Analyzing the results, CT cisternography demonstrates pathology of the CSF dynamics in a more precise and quantitative manner than RI cisternography does. Metrizamide CT cisternography will soon be the most reliable method of investigation for the evaluation of the CSF kinetics. (orig.) [de

  16. Baseline Polymorphisms and Emergence of Drug Resistance in the NS3/4A Protease of Hepatitis C Virus Genotype 1 following Treatment with Faldaprevir and Pegylated Interferon Alpha 2a/Ribavirin in Phase 2 and Phase 3 Studies.

    Science.gov (United States)

    Berger, K L; Scherer, J; Ranga, M; Sha, N; Stern, J O; Quinson, A-M; Kukolj, G

    2015-10-01

    Analysis of data pooled from multiple phase 2 (SILEN-C1 to 3) and phase 3 studies (STARTVerso1 to 4) of the hepatitis C virus (HCV) nonstructural protein 3/4A (NS3/4A) protease inhibitor faldaprevir plus pegylated interferon alpha/ribavirin (PR) provides a comprehensive evaluation of baseline and treatment-emergent NS3/4A amino acid variants among HCV genotype-1 (GT-1)-infected patients. Pooled analyses of GT-1a and GT-1b NS3 population-based pretreatment sequences (n = 3,124) showed that faldaprevir resistance-associated variants (RAVs) at NS3 R155 and D168 were rare (<1%). No single, noncanonical NS3 protease or NS4A cofactor baseline polymorphism was associated with a reduced sustained virologic response (SVR) to faldaprevir plus PR, including Q80K. The GT-1b NS3 helicase polymorphism T344I was associated with reduced SVR to faldaprevir plus PR (P < 0.0001) but was not faldaprevir specific, as reduced SVR was also observed with placebo plus PR. Among patients who did not achieve SVR and had available NS3 population sequences (n = 507 GT-1a; n = 349 GT-1b), 94% of GT-1a and 83% of GT-1b encoded faldaprevir treatment-emergent RAVs. The predominant GT-1a RAV was R155K (88%), whereas GT-1b encoded D168 substitutions (78%) in which D168V was predominant (67%). The novel GT-1b NS3 S61L substitution emerged in 7% of virologic failures as a covariant with D168V, most often among the faldaprevir breakthroughs; S61L in combination with D168V had a minimal impact on faldaprevir susceptibility compared with that for D168V alone (1.5-fold difference in vitro). The median time to loss of D168 RAVs among GT-1b-infected patients who did not have a sustained virologic response at 12 weeks posttreatment (non-SVR12) after virologic failure was 5 months, which was shorter than the 14 months for R155 RAVs among GT-1a-infected non-SVR12 patients, suggesting that D168V is less fit than R155K in the absence of faldaprevir selective pressure. Copyright © 2015, American Society for

  17. Baseline muscle mass is a poor predictor of functional overload-induced gain in the mouse model

    Directory of Open Access Journals (Sweden)

    Audrius Kilikevicius

    2016-11-01

    Full Text Available Genetic background contributes substantially to individual variability in muscle mass. Muscle hypertrophy in response to resistance training can also vary extensively. However, it is less clear if muscle mass at baseline is predictive of the hypertrophic response.The aim of this study was to examine the effect of genetic background on variability in muscle mass at baseline and in the adaptive response of the mouse fast- and slow-twitch muscles to overload. Males of eight laboratory mouse strains: C57BL/6J (B6, n=17, BALB/cByJ (n=7, DBA/2J (D2, n=12, B6.A-(rs3676616-D10Utsw1/Kjn (B6.A, n=9, C57BL/6J-Chr10A/J/NaJ (B6.A10, n=8, BEH+/+ (n=11, BEH (n=12 and DUHi (n=12, were studied. Compensatory growth of soleus and plantaris muscles was triggered by a 4-week overload induced by synergist unilateral ablation. Muscle weight in the control leg (baseline varied from 5.2±07 mg soleus and 11.4±1.3 mg plantaris in D2 mice to 18.0±1.7 mg soleus in DUHi and 43.7±2.6 mg plantaris in BEH (p<0.001 for both muscles. In addition, soleus in the B6.A10 strain was ~40% larger (p<0.001 compared to the B6. Functional overload increased muscle weight, however, the extent of gain was strain-dependent for both soleus (p<0.01 and plantaris (p<0.02 even after accounting for the baseline differences. For the soleus muscle, the BEH strain emerged as the least responsive, with a 1.3-fold increase, compared to a 1.7-fold gain in the most responsive D2 strain, and there was no difference in the gain between the B6.A10 and B6 strains. The BEH strain appeared the least responsive in the gain of plantaris as well, 1.3-fold, compared to ~1.5-fold gain in the remaining strains. We conclude that variation in muscle mass at baseline is not a reliable predictor of that in the overload-induced gain. This suggests that a different set of genes influence variability in muscle mass acquired in the process of normal development, growth and maintenance, and in the process of adaptive

  18. A1c Gear: Laboratory quality HbA1c measurement at the point of care.

    Science.gov (United States)

    Ejilemele, Adetoun; Unabia, Jamie; Ju, Hyunsu; Petersen, John R

    2015-05-20

    HbA1c is an important part of assessing the diabetic control and since the use of point-of-care devices for monitoring HbA1c is increasing, it is important to determine how these devices compare to the central laboratory. One hundred and twenty patient samples were analyzed on the Bio-Rad Variant™II and one POC analyzer (Sakae A1c Gear). Three patient sample pools containing ~5%, ~7%, and ~10% HbA1c levels were run over 20 days. Three reagent lots and three instruments were evaluated for the A1c Gear. The 120 patient samples showed strong correlation (R(2)>0.989) when compared to the Variant™II with means=8.06% and 7.81%, for Variant IIand A1c Gear, respectively. Changing reagent lots or instruments had no impact for the A1c Gear. The ~5%, ~7%, and ~10% pools within-run and between-run imprecision was between 0.87-1.33% and 1.03-1.32%, and 1.41-2.35% and 1.24-1.89% with total imprecision of 1.67-2.35% and 1.61-2.31% for the A1c Gear and Variant II, respectively. The A1c Gear showed a small negative bias (0.25% HbA1c) across HbA1c measurement ranges of Gear meets the criteria of total CV Gear can give results as precise as the laboratory at the POC. Copyright © 2015. Published by Elsevier B.V.

  19. Aiandusäri jahtumismärke ei ilmuta / Aive Herja

    Index Scriptorium Estoniae

    Herja, Aive

    2008-01-01

    Haljastus- ja aiandusäri praegu veel jahtumismärke ei ilmuta. Arvamust avaldavad aiandusettevõtete juhid. Lk. 28 intervjuu maastikuarhitektuurifirma Artes Terrae OÜ juhatuse liikme Sulev Nurmega "Sulev Nurme: maastikuarhitektuuri turg on kasvutrendis"

  20. Functional characterization of the high affinity IgG Receptor : making heads and tails of FcγRI

    NARCIS (Netherlands)

    van der Poel, C.E.

    2011-01-01

    This thesis focuses on human FcγRI, a high affinity receptor for antibodies of the IgG isotype. IgG is the most abundant antibody type in blood and all currently FDA approved therapeutic antibodies are of the IgG isotype. FcγRI, a member of the activating Fcγ receptors, exists as a complex of a

  1. Identification of a Gypsy SHOX mutation (p.A170P) in Léri-Weill dyschondrosteosis and Langer mesomelic dysplasia.

    Science.gov (United States)

    Barca-Tierno, Verónica; Aza-Carmona, Miriam; Barroso, Eva; Heine-Suner, Damia; Azmanov, Dimitar; Rosell, Jordi; Ezquieta, Begoña; Montané, Lucia Sentchordi; Vendrell, Teresa; Cruz, Jaime; Santos, Fernando; Rodríguez, José Ignacio; Pozo, Jesús; Argente, Jesús; Kalaydjieva, Luba; Gracía, Ricardo; Campos-Barros, Angel; Benito-Sanz, Sara; Heath, Karen E

    2011-12-01

    We report the clinical and molecular characteristics of 12 Spanish families with multiple members affected with Léri-Weill dyschondrosteosis (LWD) or Langer mesomelic dysplasia (LMD), who present the SHOX (short stature homeobox gene) mutation p.A170P (c.508G>C) in heterozygosity or homozygosity, respectively. In all studied families, the A170P mutation co-segregated with the fully penetrant phenotype of mesomelic limb shortening and Madelung deformity. A shared haplotype around SHOX was observed by microsatellite analysis, confirming the presence of a common ancestor, probably of Gypsy origin, as 11 of the families were of this ethnic group. Mutation screening in 359 Eastern-European Gypsies failed to identify any carriers. For the first time, we have shown SHOX expression in the human growth plate of a 22-week LMD fetus, homozygous for the A170P mutation. Although the mutant SHOX protein was expressed in all zones of the growth plate, the chondrocyte columns in the proliferative zone were disorganized with the chondrocytes occurring in smaller columnal clusters. We have also identified a novel mutation at the same residue, c. 509C>A (p.A170D), in two unrelated Spanish LWD families, which similar to A170P mutation impedes nuclear localization of SHOX. In conclusion, we have identified A170P as the first frequent SHOX mutation in Gypsy LWD and LMD individuals.

  2. Emergence of auditory-visual relations from a visual-visual baseline with auditory-specific consequences in individuals with autism.

    Science.gov (United States)

    Varella, André A B; de Souza, Deisy G

    2014-07-01

    Empirical studies have demonstrated that class-specific contingencies may engender stimulus-reinforcer relations. In these studies, crossmodal relations emerged when crossmodal relations comprised the baseline, and intramodal relations emerged when intramodal relations were taught during baseline. This study investigated whether auditory-visual relations (crossmodal) would emerge after participants learned a visual-visual baseline (intramodal) with auditory stimuli presented as specific consequences. Four individuals with autism learned AB and CD relations with class-specific reinforcers. When A1 and C1 were presented as samples, the selections of B1 and D1, respectively, were followed by an edible (R1) and a sound (S1). Selections of B2 and D2 under the control of A2 and C2, respectively, were followed by R2 and S2. Probe trials tested for visual-visual AC, CA, AD, DA, BC, CB, BD, and DB emergent relations and auditory-visual SA, SB, SC, and SD emergent relations. All of the participants demonstrated the emergence of all auditory-visual relations, and three of four participants showed emergence of all visual-visual relations. Thus, the emergence of auditory-visual relations from specific auditory consequences suggests that these relations do not depend on crossmodal baseline training. The procedure has great potential for applied technology to generate auditory-visual discriminations and stimulus classes in the context of behavior-analytic interventions for autism. © Society for the Experimental Analysis of Behavior.

  3. riöö võit Saue Tammedele / Arvo Saal

    Index Scriptorium Estoniae

    Saal, Arvo

    2008-01-01

    Padisel toimunud 49. Jüriöö jooksul võitsid peaauhinna, Kalevipoja kuju kuuendat korda Saue Tammede spordiklubi esimese võistkonna orienteerujad Jürgen Einpalu, Kirti Rebane, Peeter Pihl, Viivi-Anne Soots ja Erkki Aadli

  4. ri Pihl vstretilsja s Alfredom Perezom Rubalkaba / Kristina Kareva

    Index Scriptorium Estoniae

    Kareva, Kristina

    2008-01-01

    Siseminister Jüri Pihl kohtus Madridis Hispaania siseministri Alfredo Pérez Rubalcabaþga, et arutada politseiasutuste vahelist koostööd, küberkuritegevuse vastast võitlust ja Hispaania eesistumist Euroopa Liidus 2010. aastal

  5. The pharmacokinetics of peginterferon lambda-1a following single dose administration to subjects with impaired renal function.

    Science.gov (United States)

    Hruska, Matthew W; Adamczyk, Robert; Colston, Elizabeth; Hesney, Michael; Stonier, Michele; Myler, Heather; Bertz, Richard

    2015-09-01

    This open label study was conducted to assess the effect of renal impairment (RI) on the pharmacokinetics (PK) of peginterferon lambda-1a (Lambda). Subjects (age 18-75 years, BMI 18-35 kg m(-2) ) were enrolled into one of five renal function groups: normal (n = 12), mild RI (n = 8), moderate RI (n = 8), severe RI (n = 7), end-stage renal disease (ESRD, n = 8) based on estimated glomerular filtration rate (eGFR) calculated using the Modification of Diet in Renal Disease (MDRD) equation. Subjects received a single dose of Lambda (180 µg) subcutaneously on day 1 followed by PK serum sample collections through day 29. Safety, tolerability and immunogenicity data were collected through day 43. PK parameters were estimated and summarized by group. Geometric mean ratios (GMR) and 90% confidence intervals (CIs) were calculated between normal and RI groups. With decreasing eGFR, Lambda exposure (Cmax , AUC) increased while apparent clearance (CL/F) and apparent volume of distribution (V/F) decreased. Relative to subjects with normal renal function (geometric mean AUC = 99.5 ng ml(-1) h), Lambda exposure estimates (AUC) were slightly increased in the mild RI group (geometric mean [90% CI]: 1.20 [0.82, 1.77]) and greater in the moderate (1.95 [1.35, 2.83]), severe RI (1.95 [1.30, 2.93]) and ESRD (1.88 [1.30, 2.73]) groups. Lambda was generally well tolerated. The results demonstrated that RI reduces the clearance of Lambda and suggests that dose modifications may not be required in patients with mild RI but may be required in patients with moderate to severe RI or ESRD. © 2015 The British Pharmacological Society.

  6. Insulin resistance as a non-invasive method for the assessment of fibrosis in patients with hepatitis C: a comparative study of biochemical methods La resistencia a la insulina en la valoración no invasiva de la fibrosis en pacientes con hepatitis C: Estudio comparativo de métodos bioquímicos

    Directory of Open Access Journals (Sweden)

    M. Romera

    2006-03-01

    Full Text Available Introduction: insulin resistance (IR promotes the progression of fibrosis and diminishes response to treatment in patients with hepatitis C. Recently, Sydney's index (includes IR has been proposed as a non-invasive method for the prediction of fibrosis. Objective: to assess the usefulness of Sydney's index for the prediction of advanced fibrosis (F3-F4 or absence of significant fibrosis (F0-F1 in patients with chronic hepatitis C. Patients and methods: we included 131 patients suffering from chronic hepatitis C. Mean age was 40 ± 11, 78 men and 53 women. Fibrosis stage was (F0-F1 69 patients, F2: 40, and advanced (F3-F4 in 22 patients. We measured baseline AST, ALT, GGT, platelet, cholesterol, alcohol, and IR (HOMA - IR levels. Sydney, Forns' and APRI indexes were calculated. Results: the area under the curve for the diagnosis of absence of significant fibrosis in each method was: Sydney: 0.80, Forns: 0.71, APRI: 0.70; p = ns. Moreover, the diagnostic capacity of advanced fibrosis was: Sydney: 0.88, Forns: 0.83, APRI: 0.82; p = ns. The predictive negative value of significant fibrosis was 74, 72, and 67%, respectively. Due to the presence of intermediate values, the indexes were not applicable to 36, 44 and 43% of patients respectively. Conclusions: the incorporation of insulin resistance among biochemical non-invasive methods slightly improves the yield of other indexes. Nevertheless, results are suboptimal, and more than one third of patients might not be correctly classified.Introducción: la resistencia a la insulina (RI promueve la progresión de la fibrosis y disminuye la respuesta al tratamiento en pacientes con hepatitis C. Recientemente, se ha propuesto el índice de Sidney como método no invasivo de predicción de la fibrosis que incluye la RI. Objetivo: valorar la utilidad del índice de Sidney en la predicción de fibrosis avanzada (F3-F4 o ausencia de fibrosis significativa (F0-F1 en pacientes con hepatitis C. Pacientes y m

  7. Early Glycemic Control and Magnitude of HbA1c Reduction Predict Cardiovascular Events and Mortality: Population-Based Cohort Study of 24,752 Metformin Initiators.

    Science.gov (United States)

    Svensson, Elisabeth; Baggesen, Lisbeth M; Johnsen, Søren P; Pedersen, Lars; Nørrelund, Helene; Buhl, Esben S; Haase, Christiane L; Thomsen, Reimar W

    2017-06-01

    We investigated the association of early achieved HbA 1c level and magnitude of HbA 1c reduction with subsequent risk of cardiovascular events or death in patients with type 2 diabetes who initiate metformin. This was a population-based cohort study including all metformin initiators with HbA 1c tests in Northern Denmark, 2000-2012. Six months after metformin initiation, we classified patients by HbA 1c achieved (<6.5% or higher) and by magnitude of HbA 1c change from the pretreatment baseline. We used Cox regression to examine subsequent rates of acute myocardial infarction, stroke, or death, controlling for baseline HbA 1c and other confounding factors. We included 24,752 metformin initiators (median age 62.5 years, 55% males) with a median follow-up of 2.6 years. The risk of a combined outcome event gradually increased with rising levels of HbA 1c achieved compared with a target HbA 1c of <6.5%: adjusted hazard ratio (HR) 1.18 (95% CI 1.07-1.30) for 6.5-6.99%, HR 1.23 (1.09-1.40) for 7.0-7.49%, HR 1.34 (1.14-1.57) for 7.5-7.99%, and HR 1.59 (1.37-1.84) for ≥8%. Results were consistent for individual outcome events and robust by age-group and other patient characteristics. A large absolute HbA 1c reduction from baseline also predicted outcome: adjusted HR 0.80 (0.65-0.97) for Δ = -4, HR 0.98 (0.80-1.20) for Δ = -3, HR 0.92 (0.78-1.08) for Δ = -2, and HR 0.99 (0.89-1.10) for Δ = -1 compared with no HbA 1c change (Δ = 0). A large initial HbA 1c reduction and achievement of low HbA 1c levels within 6 months after metformin initiation are associated with a lower risk of cardiovascular events and death in patients with type 2 diabetes. © 2017 by the American Diabetes Association.

  8. Accelerator mass spectrometry analysis of "1"4C-oxaliplatin concentrations in biological samples and "1"4C contents in biological samples and antineoplastic agents

    International Nuclear Information System (INIS)

    Toyoguchi, Teiko; Kobayashi, Takeshi; Konno, Noboru; Shiraishi, Tadashi; Kato, Kazuhiro; Tokanai, Fuyuki

    2015-01-01

    Accelerator mass spectrometry (AMS) is expected to play an important role in microdose trials. In this study, we measured the "1"4C concentration in "1"4C-oxaliplatin-spiked serum, urine and supernatant of fecal homogenate samples in our Yamagata University (YU) – AMS system. The calibration curves of "1"4C concentration in serum, urine and supernatant of fecal homogenate were linear (the correlation coefficients were ⩾0.9893), and the precision and accuracy was within the acceptance criteria. To examine a "1"4C content of water in three vacuum blood collection tubes and a syringe were measured. "1"4C was not detected from water in these devices. The mean "1"4C content in urine samples of 6 healthy Japanese volunteers was 0.144 dpm/mL, and the intra-day fluctuation of "1"4C content in urine from a volunteer was little. The antineoplastic agents are administered to the patients in combination. Then, "1"4C contents of the antineoplastic agents were quantitated. "1"4C contents were different among 10 antineoplastic agents; "1"4C contents of paclitaxel injection and docetaxel hydrate injection were higher than those of the other injections. These results indicate that our quantitation method using YU-AMS system is suited for microdosing studies and that measurement of baseline and co-administered drugs might be necessary for the studies in low concentrations.

  9. Concurrent inhibition of kit- and FcepsilonRI-mediated signaling: coordinated suppression of mast cell activation

    DEFF Research Database (Denmark)

    Jensen, Bettina M; Beaven, Michael A; Iwaki, Shoko

    2008-01-01

    Although primarily required for the growth, differentiation, and survival of mast cells, Kit ligand (stem cell factor) is also required for optimal antigen-mediated mast cell activation. Therefore, concurrent inhibition of Kit- and FcepsilonRI-mediated signaling would be an attractive approach...... characterized Kit inhibitor imatinib mesylate (imatinib). In contrast to imatinib, however, hypothemycin also effectively inhibited FcepsilonRI-mediated degranulation and cytokine production in addition to the potentiation of these responses via Kit. The effect of hypothemycin on Kit-mediated responses could...... be explained by its inhibition of Kit kinase activity, whereas the inhibitory effects on FcepsilonRI-dependent signaling were at the level of Btk activation. Because hypothemycin also significantly reduced the mouse passive cutaneous anaphylaxis response in vivo, these data provide proof of principle...

  10. ri Sillart: Hea film on kui õhkõrn orhidee või maavillane parmupill : [2003. a. ilmunud artikli oluliselt täiendatud versioon] / Jüri Sillart ; intervjueerinud Margus Mikomägi

    Index Scriptorium Estoniae

    Sillart, Jüri, 1943-2011

    2013-01-01

    Filmirežissöör, -operaator ja Tallinna Ülikooli filmipedagoog eesti filmist ja enda omadest veidi lähemalt. 29. mail oleks Jüri Sillart saanud 70-aastaseks. Ka tema endiste õpilaste Elari Lendi ja Madis Reimundi meenutused

  11. Difference between observed and predicted glycated hemoglobin at baseline and treatment response to vildagliptin-based dual oral therapy in patients with type 2 diabetes.

    Science.gov (United States)

    Wang, Jun-Sing; Hung, Yi-Jen; Lu, Yung-Chuan; Tsai, Cheng-Lin; Yang, Wei-Shiung; Lee, Ting-I; Hsiao, Ya-Chun; Sheu, Wayne Huey-Herng

    2018-04-01

    We aimed to investigate the association of difference between observed and predicted glycated hemoglobin (dopHbA1c) and HbA1c reduction after vildagliptin-based oral therapy in patients with type 2 diabetes (T2D). This was a prospective observational study. Adults ≥ 20 years old with T2D and HbA1c ≧7% treated with oral anti-diabetic drugs (OADs) were eligible if their OADs were shifted to vildagliptin-based dual oral therapy. Fasting plasma glucose (FPG) and HbA1c were recorded at baseline, week 12, and week 24. To determine baseline dopHbA1c, a predicted HbA1c was calculated by inserting baseline FPG into a regression equation (HbA1c = FPG ∗ 0.0225 + 4.3806) developed from linear relationship between HbA1c and FPG in an independent cohort of 3239 outpatients with T2D (dopHbA1c = observed HbA1c - predicted HbA1c). Patients were assigned to low (≦0) or high (>0) dopHbA1c group according to their baseline dopHbA1c levels. The study endpoint was changes from baseline to week 24 in HbA1c levels. A total of 1224 patients were enrolled. Patients with a dopHbA1c >0 had a greater HbA1c reduction after vildagliptin-based dual oral therapy than those with a dopHbA1c ≦0 (-1.5 ± 2.0 vs. -0.4 ± 1.0%, p vildagliptin-based dual oral therapy. Copyright © 2018 Elsevier B.V. All rights reserved.

  12. The diagnosis of cerebrospinal fluid hypovolemia. The comparison between CT myelography and RI cisternography

    International Nuclear Information System (INIS)

    Watanabe, Keisuke; Hashizume, Keiji; Inoue, Satoki; Fujiwara, Aki; Furuya, Hitoshi

    2008-01-01

    The comparison in the title is performed in cases with suspicious hypovolemia of cerebrospinal fluid (CSF) and its leak at the lumbar region is also examined in whiplash injury. Subjects are 25 cases (M 14/F 11, av. age 36.9 y) with traffic (13 cases), whiplash (4) and null (8) injuries. CT myelography (CTM) is conducted by injection of iotrolan through the lumbar puncturing needle to get 700 images of the whole spine of 1 mm slice thickness, which after animated, are observed visually. RI cisternography (RIC) is done immediately, 2 and 24 hr after injection of 10 MBq of diethylenetriamine pentaacetic acid (DTPA)-In through the puncturing needle. In 15 cases exhibiting positive RIC findings, CTM gives a positive leak at cervical and thoracic regions only in 2 cases and a false positive in other 13. In contrast, RIC fails to detect 2 cases of 4 with a leak at cervical and thoracic regions. Thus RIC is less reliable, and often observable RI accumulation at the lumbar area in RIC is not always a leak. (R.T.)

  13. Moskvast tuli Eestisse Hõbe-Jüri / Kristiina Davidjants

    Index Scriptorium Estoniae

    Davidjants, Kristiina, 1974-

    2004-01-01

    Moskvas lõppes XXVI rahvusvaheline filmifestival. Festivali programmi kuulus ka Renee Reinumäe, Jaak Kilmi noortefilm, mis sai žürii eripreemia, Hõbedase Püha Jüri. Peapreemia sai venelase Dmitri Meshijevi "Omad". Noorte lootustandvate režissööride programmis oli huvitav prantslase Christophe Honoré "Minu ema". Lisatud auhinnatute nimekiri ning nimekiri "Eesti filmide tähtsamaid autasusid"

  14. HOMA-S is associated with greater HbA1c reduction with a GLP-1 analogue in patients with type 2 diabetes.

    Science.gov (United States)

    Heald, A H; Narayanan, R P; Lowes, D; Jarman, E; Onyekwelu, E; Qureshi, Z; Laing, I; Anderson, S G

    2012-07-01

    Exenatide, a glucagon-like peptide-1 (GLP-1) analogue, is an effective glucoregulator for treating overweight individuals, not at target HbA1 c. This prospective study aimed to determine whether estimates of beta cell function (HOMA-B) and insulin sensitivity (HOMA-S) predict response to Exenatide treatment.Prospective data on 43 type 2 diabetes patients were collected for up to 2.8 years in UK primary care. HOMA-B and HOMA-S were estimated prior to initiating Exenatide, with monitoring of cardio-metabolic risk factors.Mean (SD) age and BMI pre-treatment were 54.1±10.5 years and 35.7±7.5 kg/m2 respectively. HbA1c decreased (mean reduction 0.9%, p=0.04; p for trend=0.01) in 61% of patients. In univariate analyses, HOMA-S as a measure of insulin sensitivity was inversely (β=- 0.41, p 0.009) related to change in HbA1c, with no relation for HOMA-B.In a random effects regression model that included age at baseline, weight, LDL-C, HDL-C and triglycerides, change in HbA1c (β= - 0.14, pHOMA-S were 45% more likely to have a fall in HbA1c with an odds ratio (OR) of 0.55 (95% CI 0.47-0.66) p<0.0001 (log likelihood ratio for the model χ2=71.6, p<0.0001).Patients with greater measured insulin sensitivity achieve greater reduction in HbA1c with Exenatide. Determination of insulin sensitivity may assist in guiding outcome expectation in overweight patients treated with GLP-1 analogues. © J. A. Barth Verlag in Georg Thieme Verlag KG Stuttgart · New York.

  15. Work engagement and high-sensitivity C-reactive protein levels among Japanese workers: a 1-year prospective cohort study.

    Science.gov (United States)

    Eguchi, Hisashi; Shimazu, Akihito; Kawakami, Norito; Inoue, Akiomi; Nakata, Akinori; Tsutsumi, Akizumi

    2015-08-01

    Evidence on the association between psychological well-being and high-sensitivity C-reactive protein (hs-CRP) levels is limited. We carried out a prospective study to investigate the association between work engagement and hs-CRP levels in a group of Japanese workers. Our cohort included 1,857 men and 657 women aged 65 and under, and free from major illness, working at two manufacturing worksites in Japan. Baseline examinations were conducted from April to June 2011 to determine the demographic and lifestyle characteristics and levels of work engagement. Blood samples were obtained from participants at baseline and after 1 year. Participants were classified into tertiles of low, moderate, and high work engagement at baseline. Hs-CRP levels were split into low (≤3.0 mg/L) and high (>3.0 mg/L). We used multiple logistic regression analyses to evaluate the association between work engagement at baseline and hs-CRP levels at follow-up, adjusting for hs-CRP at baseline and potential confounding factors. Participants reporting moderate and high levels of work engagement at baseline had significantly lower odds ratios (ORs) of having high hs-CRP levels at follow-up than those with low levels of work engagement at baseline [OR of moderate level 0.44, 95% confidence interval (CI) 0.24-0.81; OR of high level 0.57, 95% CI 0.33-0.99; p for trend work engagement has beneficial effects on workers' cardiovascular health.

  16. Tüüri "Magma" kuuplaat. Pärt Saksa romaani kangelasena

    Index Scriptorium Estoniae

    2007-01-01

    Erkki-Sven Tüüri heliplaat "Magma" oli kuuplaat nii BBC Music Magazine'is kui ka Gramophone'is. Saksa kirjanik Adam Thorpe avaldas romaani "Taktverschiebung" ("Taktimuutus"), mille peategelast, inglise heliloojat Jack Middletoni iseloomustatakse Arvo Pärdi suure austajana

  17. Piiratud vastutusega äriühingu juhatuse liikme lojaalsuskohustus / Tuuve Tiivel

    Index Scriptorium Estoniae

    Tiivel, Tuuve, 1977-

    2001-01-01

    Huvide konfliktist aktsiaseltsi ja selle juhatuse liikme vahelise tehingu puhul, sellise tehingu kehtivusest, juhatuse liikme tasust, laenu- ja konkurentsikeelust ning konfidentsiaalsuskohustusest Eesti ja Ameerika Ühendriikide äriõiguses

  18. Erkki-Sven Tüüri vioolakontsert "Illuminatio" / Igor Grašnek

    Index Scriptorium Estoniae

    Grašnek, Igor, 1958-

    2009-01-01

    Erkki-Sven Tüüri vioolakontserdist "Illuminatio", mis tuli Eestis esiettekandele 20. veebruaril Estonia kontserdisaalis ja mida esitasid vioolamängija Lars Anders Tomter ning ERSO Olari Eltsi dirigeerimisel

  19. Thermal load distribution on the ALT-II limiter of TEXTOR-94 during RI mode operation and during disruptions

    International Nuclear Information System (INIS)

    Finken, K.H.; Denner, T.; Mank, G.

    2000-01-01

    Thermographic measurements using an IR scanner have been performed at the pump limiter ALT-II of TEXTOR-94 during RI mode discharges and during disruptions. The measurements on the RI mode discharges were done to complete the TEXTOR database which had shown a structured decay pattern of the deposited power. It was found that the underlying radial heat flux can be described by two exponential decay functions. This structure, which generates an unexpected heat component close to the tangent line, has been observed in all discharge conditions including the RI mode. During disruptions, the heat is released in short pulses with a typical duration of 0.01-0.1 ms. The radial decay length of these pulses has a similar shape to the heat flux during normal discharges: it consists again of a strong component close to the tangent line with a radial decay length of 2-5 mm and probably one with a decay length of the order of 1 cm. The heat is released at the time when the edge electron temperature of the plasma drops, when intense hydrogen and carbon fluxes occur near the walls, and when electrical currents in the limiter blades are excited. In a tentative interpretation, the temporal and spatial structure of the heat pulse is attributed to the presence and growth of a laminar zone at the plasma edge, which is connected with the ergodization of the plasma edge during a disruption. (author)

  20. Elevated Hemoglobin A1C Levels Correlate with Blood Glucose Elevation in Diabetic Patients following Local Corticosteroid Injection in the Hand: A Prospective Study.

    Science.gov (United States)

    Kim, Nayoung; Schroeder, Jake; Hoffler, C Edward; Matzon, Jonas L; Lutsky, Kevin F; Beredjiklian, Pedro K

    2015-10-01

    Diabetic patients develop hand conditions that are managed with local corticosteroid injections. Injections can result in a transient elevation in serum glucose in diabetic patients. Hemoglobin A1c is the accepted measure of long-term plasma glucose control in diabetics (levels ≥7 percent reflect poor blood glucose control). The purpose of this study was to assess the relationship between hemoglobin A1c levels and increased blood glucose levels after corticosteroid injections. Twenty-five diabetic patients were evaluated prospectively. One milliliter containing 10 mg of triamcinolone acetonide was used. The most recent hemoglobin A1c level and normal average blood glucose levels were obtained. Glucose levels were obtained from patient recall of their daily blood glucose self- monitoring on the day of the injection. Postinjection blood glucose levels were recorded until levels returned to preinjection baseline. Twenty patients (80 percent) had elevation of their blood glucose level from baseline. No patient had elevated blood glucose levels after 5 days. Patients with hemoglobin A1c levels greater than or equal to 7 percent had a higher blood glucose elevation and maintained this for longer than those who had a lower hemoglobin A1c level. Patients in the higher hemoglobin A1c group also had a higher number of hyperglycemic events. There was a strong or moderate correlation between hemoglobin A1c and elevated blood glucose levels during days 1 to 4. Patients with hemoglobin A1c levels greater than or equal to 7 percent have elevations in blood glucose that are higher and last longer than patients with lower levels. Hemoglobin A1c levels can be used to roughly predict the degree of blood glucose elevation after corticosteroid injections into the hands of diabetic patients.

  1. Turvalist kooliaastat - koolis, tänaval ja internetis / Jüri Pihl

    Index Scriptorium Estoniae

    Pihl, Jüri, 1954-

    2008-01-01

    Ilmunud ka: Molodjozh Estonii 1. sept. lk. 4-5, Sakala 2. sept., lk. 2, Virumaa Teataja 2. sept., lk. 11, Oma Saar 2. sept., lk. 5, Tartu Postimees 2. sept., lk. 2, Hiiu Leht 2. sept., lk. 2, Pärnu Postimees 2. sept., lk. 15, Koit 2. sept. lk. 6, Sõnumitooja 3. sept. lk. 2, Vooremaa 4. sept. lk. 2. Siseminister Jüri Pihl esitab kolm suuremat probleemi, mis vähendavad turvalisust koolis ja kooliteel: ohud liikluses, kasvav meelemürkide tarvitamine ning koolivägivald

  2. Trimester-specific reference intervals for haemoglobin A(1c) (HbA(1c)) in pregnancy.

    LENUS (Irish Health Repository)

    O'Connor, Catherine

    2011-11-26

    Abstract Background: Diabetes in pregnancy imposes additional risks to both mother and infant. These increased risks are considered to be primarily related to glycaemic control which is monitored by means of glycated haemoglobin (HbA(1c)). The correlation of HbA(1c) with clinical outcomes emphasises the need to measure HbA(1c) accurately, precisely and for correct interpretation, comparison to appropriately defined reference intervals. Since July 2010, the HbA(1c) assay in Irish laboratories is fully metrologically traceable to the IFCC standard. The objective was to establish trimester-specific reference intervals in pregnancy for IFCC standardised HbA(1c) in non-diabetic Caucasian women. Methods: The authors recruited 311 non-diabetic Caucasian pregnant (n=246) and non-pregnant women (n=65). A selective screening based on risk factors for gestational diabetes was employed. All subjects had a random plasma glucose <7.7 mmol\\/L and normal haemoglobin level. Pregnancy trimester was defined as trimester 1 (T1, n=40) up to 12 weeks +6 days, trimester 2 (T2, n=106) 13-27 weeks +6 days, trimester 3 (T3, n=100) >28 weeks to term. Results: The normal HbA(1c) reference interval for Caucasian non-pregnant women was 29-37 mmol\\/mol (Diabetes Control and Complications Trial; DCCT: 4.8%-5.5%), T1: 24-36 mmol\\/mol (DCCT: 4.3%-5.4%), T2: 25-35 mmol\\/mol (DCCT: 4.4%-5.4%) and T3: 28-39 mmol\\/mol (DCCT: 4.7%-5.7%). HbA(1c) was significantly decreased in trimesters 1 and 2 compared to non-pregnant women. Conclusions: HbA(1c) trimester-specific reference intervals are required to better inform the management of pregnancies complicated by diabetes.

  3. ABORDĂRI ŞTIINŢIFICE PRIVIND DEFINIŢIA CONTABILITĂŢII DE GESTIUNE

    Directory of Open Access Journals (Sweden)

    Maia BAJAN

    2016-12-01

    Full Text Available Contabilitatea de gestiune a evoluat de la o contabilitate a costurilor, în care accentul se punea pe determinarea costului de producţie, până la un domeniu distinct al contabilităţii, unde aceasta este orientată spre analiză şi previziune, accentul fiind axat pe gestiune. Analiza opiniilor savanţilor, expuse în literatura de specialitate autohtonă şi străină, permite identificarea a trei tipuri de abordări ştiinţifice ale definiţiei contabilităţii de gestiune, şi anume: conservative, moderate şi radicale. Contabilitatea de gestiune expusă prin abordări conservative are ca sarcină de bază colectarea şi analiza costurilor de producţie; prin abordări moderate este considerată drept sistem de transmitere a informaţiei necesare pentru luarea deciziilor manageriale; prin abordări radicale fiind recunoscută printr-un sistem de gestionare a entităţii în general şi pe subdiviziuni separate.SCIENTIFIC APPROACHES TO THE DEFINITION OF MANAGEMENT ACCOUNTINGManagement accounting has evolved from cost accounting that put emphasis on the determination of the production cost, to a distinct accounting domain, directed towards analysis and prevision, with a strong focus on management. The analysis of researchers’ opinions, presented in local and foreign literature, allows the identification of three types of scientific approaches to the definition of management accounting, namely: conservative, moderate and radical. The conservative approach on managerial accounting has the basic task of collecting and analyzing productions costs; the moderate approach is considered as a system of transmitting the required information for the management decision-making process, and the radical approach can be recognized in an entity’s general management system, as well as in its separate subdivisions.

  4. ABORDĂRI ŞTIINŢIFICE PRIVIND DEFINIŢIA CONTROLULUI DE GESTIUNE

    Directory of Open Access Journals (Sweden)

    Maia BAJAN

    2016-12-01

    Full Text Available Controlul de gestiune a evoluat de la o activitate de control, unde se punea accent pe verificarea şi realizarea unei norme prestabilite, până la un instrument de gestionare a entităţii, care reflectă un spectru larg de probleme legate de procesul de realizare a obiectivelor. Analiza temeinică a literaturii de specialitate, autohtone şi străine, privind definiţia controlului de gestiune permite a delimita opiniile savanţilor în două grupe de abordări ştiinţifice, şi anume: clasice şi moderne. Controlul de gestiune redat prin abordări clasice se consideră drept o tehnică de calcul care asigură măsurarea performanţelor, iar prin abordări moderne se prezintă ca un instrument strategic de gestionare a entităţii pe viitor.SCIENTIFIC APPROACHES IN DEFINING MANAGEMENT CONTROLManagement control has evolved from a control activity, where the main target was to verify and realize the default standard, to an entity management tool, that reflects a wide range of problems related to the process of objectives achievement. A deep analysis of the domestic and foreign specialty literature concerning the definition of management control, allows the division of scientists’ views into two groups of scientific approaches, and mainly: classical and modern. The classical approach of management control is considered a computing which ensures the measurement of performances, while the modern approach represents a strategic tool for further entity management.

  5. Eesti estamp sisepaguluses : graafikatriennaal / Jüri Hain

    Index Scriptorium Estoniae

    Hain, Jüri, 1941-

    2004-01-01

    Graafikute grupinäitused G-galeriis (kuraator Loit Jõekalda, osalevad Vive Tolli, Vello Vinn, Silvi Liiva, Raul Meel, Mare Vint, Jüri Kass, Ülle Marks, Maria-Kristiina Ulas) kuni 25. IX, Aatriumi galeriis kuni 23. IX, Soome Instituudis kuni 30. IX, Vappu Thurlowi kureeritud näitus "Lähenemised" Estonia kontserdisaalis kuni 15. X, Virge Jõekalda näitus "Vaikus" Ungari Instituudis kuni 27. IX, Loit Jõekalda näitus "Must ja valge" galeriis 36 kuni 19. IX

  6. Developing RESRAD-BASELINE for environmental baseline risk assessment

    International Nuclear Information System (INIS)

    Cheng, Jing-Jy.

    1995-01-01

    RESRAD-BASELINE is a computer code developed at Argonne developed at Argonne National Laboratory for the US Department of Energy (DOE) to perform both radiological and chemical risk assessments. The code implements the baseline risk assessment guidance of the US Environmental Protection Agency (EPA 1989). The computer code calculates (1) radiation doses and cancer risks from exposure to radioactive materials, and (2) hazard indexes and cancer risks from exposure to noncarcinogenic and carcinogenic chemicals, respectively. The user can enter measured or predicted environmental media concentrations from the graphic interface and can simulate different exposure scenarios by selecting the appropriate pathways and modifying the exposure parameters. The database used by PESRAD-BASELINE includes dose conversion factors and slope factors for radionuclides and toxicity information and properties for chemicals. The user can modify the database for use in the calculation. Sensitivity analysis can be performed while running the computer code to examine the influence of the input parameters. Use of RESRAD-BASELINE for risk analysis is easy, fast, and cost-saving. Furthermore, it ensures in consistency in methodology for both radiological and chemical risk analyses

  7. BIPM comparison BIPM.RI(II)-K1.Zn-65 of activity measurements of the radionuclide 65Zn for the BARC (India) with linked results for the CCRI(II)-K2.Zn-65 comparison

    International Nuclear Information System (INIS)

    Michotte, C.; Ratel, G.; Courte, S.; Joseph, L.

    2015-01-01

    A new participation in the BIPM.RI(II)-K1.Zn-65 comparison has been added to the previous results. A link has been made to the CCRI(II)-K2.Zn-65 comparison held in 2003 through the measurement of all ampoules of the K2 comparison in the International Reference System (SIR) at the BIPM before despatch to the participants. This has produced a revised value for the key comparison reference value (KCRV), calculated using the power-moderated weighted mean. Six NMIs used the K2 comparison to update their degree of equivalence. The degrees of equivalence between each equivalent activity measured in the International Reference System (SIR) and the KCRV have been calculated and the results are given in the form of a table for the remaining two NMIs in the BIPM.RI(II)-K1.Zn-65 comparison and the 17 other participants in the CCRI(II)-K2.Zn-65 comparison. A graphical presentation is also given. (authors)

  8. Association of 3BP2 with SHP-1 regulates SHP-1-mediated production of TNF-α in RBL-2H3 cells.

    Science.gov (United States)

    Chihara, Kazuyasu; Nakashima, Kenji; Takeuchi, Kenji; Sada, Kiyonao

    2011-12-01

    Adaptor protein 3BP2, a c-Abl Src homology 3 (SH3) domain-binding protein, is tyrosine phosphorylated and positively regulates mast cell signal transduction after the aggregation of the high affinity IgE receptor (FcεRI). Overexpression of the Src homology 2 (SH2) domain of 3BP2 results in the dramatic suppression of antigen-induced degranulation in rat basophilic leukemia RBL-2H3 cells. Previously, a linker for activation of T cells (LAT) was identified as one of the 3BP2 SH2 domain-binding protein. In this report, to further understand the functions of 3BP2 in FcεRI-mediated activation of mast cell, we explored the protein that associates with the SH2 domain of 3BP2 and found that SH2 domain-containing phosphatase-1 (SHP-1) inducibly interacts with the SH2 domain of 3BP2 after the aggregation of FcεRI. The phosphorylation of Tyr(564) in the carboxy (C)-terminal tail region of SHP-1 is required for the direct interaction of SHP-1 to the SH2 domain of 3BP2. The expression of the mutant form of SHP-1 which was unable to interact with 3BP2 resulted in the significant reduction in SHP-1-mediated tumor necrosis factor-α (TNF-α) production without any effects on the degranulation in antigen-stimulated RBL-2H3 cells. These findings suggest that 3BP2 directly interacts with Tyr(564) -phosphorylated form of SHP-1 and positively regulates the function of SHP-1 in FcεRI-mediated signaling in mast cells. © 2011 The Authors. Journal compilation © 2011 by the Molecular Biology Society of Japan/Blackwell Publishing Ltd.

  9. A1C Test and Diabetes

    Science.gov (United States)

    ... Diagnosis The A1C Test & Diabetes The A1C Test & Diabetes On this page: What is the A1C test? ... the A1C test used to diagnose type 2 diabetes and prediabetes? Health care professionals can use the ...

  10. Programmatic Baseline Summary for Phase 1 Privatization for the Tank Farm contractor

    International Nuclear Information System (INIS)

    DIEDIKER, J.A.

    2000-01-01

    The document describes the systematic integrated baseline planning process and provides a summary of the Tank Farm Contractor scope, schedule and cost analysis developed in support of the Phase 1 privatization mission

  11. Programmatic Baseline Summary for Phase 1 Privatization for the Tank Farm contractor

    Energy Technology Data Exchange (ETDEWEB)

    DIEDIKER, J.A.

    2000-04-22

    The document describes the systematic integrated baseline planning process and provides a summary of the Tank Farm Contractor scope, schedule and cost analysis developed in support of the Phase 1 privatization mission.

  12. EPA R1 RCRA Corrective Action 2020 Baseline Site Property Boundaries

    Data.gov (United States)

    U.S. Environmental Protection Agency — Property boundaries as indicated in figures of all facilities subject to RCRA Corrective Action on the 2020 baseline in Region 1. For more information on the RCRA...

  13. Muusikaäri otsib uusi müügiideid / Kuldar Kullasepp

    Index Scriptorium Estoniae

    Kullasepp, Kuldar, 1980-

    2009-01-01

    IT- valdkonna muusiakäri uutest võimalustest. USA firmast Rdio, Niklas Zennströmi ja Janus Friisi pakutavast tensuest, millega pakutakse muusikat nii arvuti kui ka mobiiltelefoniaskutajatele pakkuda. Digitaalsetest plaadipoodidest Eestis

  14. USA kahepaiksest mängust / Jüri Lina

    Index Scriptorium Estoniae

    Lina, Jüri, 1949-

    2000-01-01

    Sama artikkel on ilmunud ka Eesti 2000 : sõltumatu almanahh ühiskonna ja vaimuelu küsimustes nr. 4 ja nr. 6. Autori väitel on USA muu hulgas huvitatud maakera rahvastiku drastilisest vähendamisest, seepärast ongi pärast Teist maailmasõda kunstlikult lõkkele puhutud sadu sõjalisi konflikte. Lisatud Jüri Lina lühielulugu lk. 23

  15. Baseline glycemic status and mortality in 241,499 Korean metropolitan subjects: A Kangbuk Samsung Health Study.

    Science.gov (United States)

    Rhee, Eun-Jung; Park, Se Eun; Chang, Yoosoo; Ryu, Seungho; Lee, Won-Young

    2016-02-01

    Diabetes and prediabetes subjects have increased risk for mortality. We analyzed the mortality risk due to all causes, cardiovascular disease (CVD) and cancer in Korean subjects participating in a health-screening program according to baseline glycemic status and HbA1c levels. Among 241,499 participants of a health-screening program between 2005 and 2012, the risk of death from all causes, CVD, and cancer was calculated based on the baseline glycemic status (normoglycemia, prediabetes, and diabetes) and HbA1c levels. Uncontrolled diabetes was defined as HbA1c≥7.0%. Vital status and confirmation of the cause of death were based on the analysis of death certificate records from the National Death Index. During 923,343.1 person-years of follow-up, 877 participants died. The multivariable-adjusted hazard ratios (HR) of subjects with controlled and uncontrolled diabetes to normoglycemic subjects for all-cause mortality were 1.58 (95% CI 1.24-2.03) and 2.26 (95% CI 1.78-2.86), respectively. The HRs of subjects with controlled and uncontrolled diabetes to normoglycemic subjects for mortality due to cancer were 1.75 (95% CI 1.23-2.48) and 1.67 (95% CI 1.13-2.45). However, glycemic status was not significantly associated with the risk of mortality due to CVD. The subjects with HbA1c higher than 6.5% showed more than 2-fold increased risk for all-cause mortality and the subjects with HbA1c lower than 5.2% showed increased HR (1.45, 95% CI 1.06-1.97) compared with those with HbA1c of 5.5% in subjects not taking anti-diabetic medications. Mortality risk from all causes and cancer significantly increased in diabetes subjects regardless of the glucose control status. In subjects not taking anti-diabetic medications, both high and low HbA1c resulted in increased risk for all-cause mortality. Copyright © 2015 Elsevier Inc. All rights reserved.

  16. Davallia mariesii Moore Improves FcεRI-Mediated Allergic Responses in the Rat Basophilic Leukemia Mast Cell Line RBL-2H3 and Passive Cutaneous Anaphylaxis in Mice

    Directory of Open Access Journals (Sweden)

    Hyun Ju Do

    2017-01-01

    Full Text Available Davallia mariesii Moore (Drynaria rhizome extract (DRE is widely known for its efficacy in treating inflammation, arteriosclerosis, and bone injuries. This study evaluated whether treatment with DRE inhibited FcɛRI-mediated allergic responses in the RBL-2H3 mast cells and investigated the early- and late-phase mechanisms by which DRE exerts its antiallergic effects. IgE anti-DNP/DNP-HSA-sensitized RBL-2H3 mast cells were tested for cytotoxicity to DRE, followed by the assessment of β-hexosaminidase release. We measured the amounts of inflammatory mediators (e.g., histamine, PGD2, TNF-α, IL-4, and IL-6 and examined the expression of genes involved in arachidonate and FcεRI signaling pathways. In addition, we confirmed the antiallergic effects of DRE on passive cutaneous anaphylaxis (PCA in mice. DRE inhibited RBL-2H3 mast cell degranulation and production of allergic mediators in them. In early allergic responses, DRE reduced expression of FcεRI signaling-related genes (e.g., Syk, Lyn, and Fyn and extracellular signal-regulated kinase phosphorylation in mast cells. In late allergic responses, DRE reduced PGD2 release and COX-2 expression and cPLA2 phosphorylation in FcɛRI-mediated mast cells. Lastly, 250–500 mg/kg DRE significantly attenuated the IgE-induced PCA reaction in mice. These findings provide novel information on the molecular mechanisms underlying the antiallergic effects of DRE in FcɛRI-mediated allergic responses.

  17. Reduction of Fasting Blood Glucose and Hemoglobin A1c Using Oral Aloe Vera: A Meta-Analysis.

    Science.gov (United States)

    Dick, William R; Fletcher, Emily A; Shah, Sachin A

    2016-06-01

    Diabetes mellitus is a global epidemic and one of the leading causes of morbidity and mortality. Additional medications that are novel, affordable, and efficacious are needed to treat this rampant disease. This meta-analysis was performed to ascertain the effectiveness of oral aloe vera consumption on the reduction of fasting blood glucose (FBG) and hemoglobin A1c (HbA1c). PubMed, CINAHL, Natural Medicines Comprehensive Database, and Natural Standard databases were searched. Studies of aloe vera's effect on FBG, HbA1c, homeostasis model assessment-estimated insulin resistance (HOMA-IR), fasting serum insulin, fructosamine, and oral glucose tolerance test (OGTT) in prediabetic and diabetic populations were examined. After data extraction, the parameters of FBG and HbA1c had appropriate data for meta-analyses. Extracted data were verified and then analyzed by StatsDirect Statistical Software. Reductions of FBG and HbA1c were reported as the weighted mean differences from baseline, calculated by a random-effects model with 95% confidence intervals. Subgroup analyses to determine clinical and statistical heterogeneity were also performed. Publication bias was assessed by using the Egger bias statistic. Nine studies were included in the FBG parameter (n = 283); 5 of these studies included HbA1c data (n = 89). Aloe vera decreased FBG by 46.6 mg/dL (p aloe vera for significantly reducing FBG (46.6 mg/dL) and HbA1c (1.05%). Further clinical studies that are more robust and better controlled are warranted to further explore these findings.

  18. PAR1 deletions downstream of SHOX are the most frequent defect in a Spanish cohort of Léri-Weill dyschondrosteosis (LWD) probands.

    Science.gov (United States)

    Benito-Sanz, Sara; del Blanco, Darya Gorbenko; Aza-Carmona, Miriam; Magano, Luis F; Lapunzina, Pablo; Argente, Jesús; Campos-Barros, Angel; Heath, Karen E

    2006-10-01

    ri-Weill dyschondrosteosis (LWD) is a skeletal dysplasia characterized by disproportionate short stature and Madelung deformity. Mutations or deletions of the SHOX gene have been previously identified as the main cause of LWD. We recently identified the existence of a second class of pseudoautosomal region 1 (PAR1) deletions which do not include SHOX, implicated in the etiopathogenesis of LWD. The deletions map at least 30-250 kb downstream of SHOX, are variable in size and clearly cosegregate with the LWD phenotype. In order to determine the frequency of this new type of deletions in the Spanish population we analyzed the distribution of PAR1 defects, including the screening of SHOX deletions, mutations, and PAR1 deletions downstream of SHOX, in a total of 26 LWD probands by a combination of MLPA, microsatellite analysis, SNP genotyping, dHPLC, and DNA sequencing. A molecular defect was identified in 16/26 LWD patients (61.5%): 10 PAR1 deletions downstream of SHOX, four SHOX encompassing deletions, and two SHOX mutations. No apparent phenotypic differences were observed between patients with SHOX defects and those with PAR1 deletions downstream of SHOX. In the examined cohort of Spanish LWD probands, PAR1 deletions downstream of SHOX represent the highest proportion of identified mutations (38%) compared to SHOX deletions (15%) and mutations (8%). As a consequence of our findings, the screening of this region should be included in the routine genetic testing of LWD. Also, LWD patients who tested negative for SHOX defects should be re-evaluated for PAR1 deletions downstream of SHOX.

  19. Prospects of light sterile neutrino oscillation and C P violation searches at the Fermilab Short Baseline Neutrino Facility

    Science.gov (United States)

    Cianci, D.; Furmanski, A.; Karagiorgi, G.; Ross-Lonergan, M.

    2017-09-01

    We investigate the ability of the short baseline neutrino (SBN) experimental program at Fermilab to test the globally-allowed (3 +N ) sterile neutrino oscillation parameter space. We explicitly consider the globally-allowed parameter space for the (3 +1 ), (3 +2 ), and (3 +3 ) sterile neutrino oscillation scenarios. We find that SBN can probe with 5 σ sensitivity more than 85%, 95% and 55% of the parameter space currently allowed at 99% confidence level for the (3 +1 ), (3 +2 ) and (3 +3 ) scenarios, respectively, with the (3 +N ) allowed space used in these studies closely resembling that of previous studies [J. M. Conrad, C. M. Ignarra, G. Karagiorgi, M. H. Shaevitz, and J. Spitz, Adv. High Energy Phys. 2013, 1 (2013)., 10.1155/2013/163897], calculated using the same methodology. In the case of the (3 +2 ) and (3 +3 ) scenarios, C P -violating phases appear in the oscillation probability terms, leading to observable differences in the appearance probabilities of neutrinos and antineutrinos. We explore SBN's sensitivity to those phases for the (3 +2 ) scenario through the currently planned neutrino beam running, and investigate potential improvements through additional antineutrino beam running. We show that, if antineutrino exposure is considered, for maximal values of the (3 +2 ) C P -violating phase ϕ54, SBN could be the first experiment to directly observe ˜2 σ hints of C P violation associated with an extended lepton sector.

  20. RI cisternography and CT cisternography in chronic subdural effusion in infancy

    Energy Technology Data Exchange (ETDEWEB)

    Fujiwara, K.; Hayakawa, I. (Bokuto Municipal Hospital of Metropolitan, Tokyo (Japan))

    1980-10-01

    Differential diagnosis has been made more accurately between subdural and subarachnoid effusions in infancy since the introduction of the CT scan. We have four cases where In-DTPA (lmCi) and Metrizamide (5 ml x 170 mgl/dl) were given intrathecally at the same time. These dynamics were followed at intervals of 3, 6, 24, and 48 hours, and the diagnosis of chronic subdural effusion (or hematoma) was made at the time of surgery. The findings of both cisternographies were analyzed in these 4 cases. The dynamics of the two materials in the CSF space were almost the same. Comparing the two materials, CT cisternography delineates the anatomical structures of CSF pathways more clearly and accurately. Cerebral sulci and sylvian fissures were well defined with metrizamide at 3 and/or 6 h, but the subdural space was nonfilling. The diagnosis of the CSF block is significant in determining operative indications. RI cisternography seems to be the better method of detecting abnormal findings regarding convexity flow, especially the asymmetry of cerebral convexity. However, the asymmetrical convexity flow as determining by RI at 24 and/or 48 h corresponds quite closely to asymmetrical sylvian-fissure filling by metrizamide at 3 and/or 6 h. It has been concluded that metrizamide CT cisternography can replace some parts of RI cisternography in studying chronic subdural effusion in infancy.

  1. Activity measurements of the radionuclide {sup 111}In for the LNE-LNHB, France in the ongoing comparison BIPM.RI(II)-K1.In-111

    Energy Technology Data Exchange (ETDEWEB)

    Michotte, C.; Ratel, G.; Courte, S. [Bureau International des Poids et Mesures (BIPM), Pavillon de Breteuil, 92 - Sevres (France); Verdeau, E.; Amiot, M.N. [Laboratoire national de metrologie et d' essais-Laboratoire National Henri Becquerel (LNE-LNHB), 91 - Gif-sur-Yvette (France)

    2010-10-15

    In 2006, the Laboratoire national de metrologie et d'essais - Laboratoire national Henri Becquerel (LNE-LNHB) submitted a sample of known activity of {sup 111}In to the International Reference System (SIR). The value of the activity submitted was about 14 MBq. This provides a new result for France in the matrix of degrees of equivalence in the key comparison database that enables them to maintain their degrees of equivalence for this radionuclide. The key comparison reference value has been re-evaluated and the comparison, identifier BIPM.RI(II)-K1.In-111, now contains five valid results. (authors)

  2. Alterations in HbA1c following minimal or enhanced non-surgical, non-antibiotic treatment of gingivitis or mild periodontitis in type 2 diabetic patients: a pilot trial.

    Science.gov (United States)

    Madden, Theresa E; Herriges, Brock; Boyd, Linda D; Laughlin, Gayle; Chiodo, Gary; Rosenstein, David

    2008-07-01

    The purpose of this pilot study was to determine and compare the effects of two protocols aimed at reducing periodontal inflammation, upon the metabolic control of the diabetic condition in subjects with elevated baseline glycosylated hemoglobin (HbA1c). Forty-two non-smoking type 2 diabetes subjects with mildly elevated HbA1c (>7 but 9%) were randomized to one of two non-surgical periodontal therapy protocols. Patients in the "minimal therapy" (MT) group received scaling, root planning, and oral hygiene instructions on two occasions six months apart. Participants randomized to the "frequent therapy" (FT) protocol received scaling, root planing, and oral hygiene instructions at two-month intervals and were provided a 0.12% chlorhexidine rinse for home use twice daily. Neither systemic nor local antibiotics were provided to either group. Subjects were asked to report any changes in diabetic medications, nutrition, and physical activity. Data analyses (ANOVA, t-test, Mann-Whitney) grouped subjects according to baseline HbA1c (>7 and 9%), treatment protocol (minimal or frequent), and +/- medication change. In both MT and FT groups the clinical attachment level (CAL) remained unchanged but the other measures [gingival index (GI) and pocket dept (PD)] of periodontal health improved. Mean reductions in plaque showed improvement but calculus was worse in the FT group, likely due to the use of chlorhexidine. At six months, the largest reduction of HbA1c was 3.7; experienced by a subject receiving FT but no changes in diabetic medication. Among the MT and no medication change subjects, the maximum reduction was 1.6. Overall mean reduction in HbA1c of 27 subjects with baseline HbA1c >9.0 and no medication change was 0.6 with no statistical difference between the MT and FT groups. Among the medication-change subjects with baseline HbA1c >9.0, mean reduction of 1.38 was seen with FT compared to 1.10 with MT. Overall, modest improvements in HbA1c were detected with a trend

  3. In-line open-cavity Fabry-Pérot interferometer formed by C-shaped fiber fortemperature-insensitive refractive index sensing.

    Science.gov (United States)

    Wu, Chuang; Liu, Zhengyong; Zhang, A Ping; Guan, Bai-Ou; Tam, Hwa-Yaw

    2014-09-08

    We report an open-cavity optical fiber Fabry-Pérot interferometer (FPI) capable of measuring refractive index with very low temperature cross-sensitivity. The FPI was constructed by splicing a thin piece of C-shaped fiber between two standard single-mode fibers. The refractive index (RI) response of the FPI was characterized using water-ethanol mixtures with RI in the range of 1.33 to 1.36. The RI sensitivity was measured to be 1368 nm/RIU at the wavelength of 1600 nm with good linearity. Thanks to its all-glass structure, the FPI exhibits very low temperature cross-sensitivity of 3.04 × 10⁻⁷ RIU/°C. The effects of cavity length on the performance of the sensor were also studied. A shorter cavity gives rise to broader measurement range while offering larger detection limit, and vice versa. What's more, the effect of material dispersion of analyte on the sensitivity of open-cavity FPIs was identified for the first time. The sensor is compact in size and easy to fabricate. It is potentially useful for label-free optical sensing of chemical and biological samples.

  4. [Effect of the Disease Management Program on HbA1c Value in Type 2 Diabetes Mellitus Patients: A Retrospective Comparison between Disease Management Programs and Standard Care].

    Science.gov (United States)

    Wiefarn, Stefan; Kostev, Karel; Heumann, Christian; Rettelbach, Anja

    2017-10-01

    Background  This retrospective study aims to measure the effect of the disease management program (DMP) for type 2 diabetes mellitus (T2DM) patients on HbA 1c value within Germany. Methods  This study is based on patient data from the Disease Analyzer panel (IMS Health). An adequate control group was created using 2:1 propensity score matching. After matching, the analysis included 14 759 patients. Of these, 5875 participated in a DMP while 8884 received standard care. The DMP effect was estimated on the basis of the matched data, using an unpaired t-test. In addition, subgroups were considered from the perspective of personalized medicine. Results  The reduction in HbA 1c values in the DMP group amounted to an average of 1.0 percentage point (baseline HbA 1c  = 8.1 vs. final HbA 1c  = 7.1), while the SC group was able to achieve an average reduction in HbA 1c values of 0.9 percentage point (baseline HbA 1c  = 8.1 vs. final HbA 1c  = 7.2). The DMP group thus achieved an average reduction in HbA 1c values that exceeded that of the SC group by only 0.1 percentage point (95 % CI: 0.04 - 0.16). Descriptively, it also became apparent that patients from the DMP group received a greater average number of annual prescriptions and had more HbA 1c measurements. The subgroup analysis identified groups of patients who benefit more from DMPs than others. Thus, young patients or patients who are being treated by diabetologists are able to benefit most from a DMP. Furthermore, the baseline HbA 1c value has an influence on the DMP effect. Conclusion  T2DM patients in the DMP exhibit a significantly higher reduction in HbA 1c value. However, it is questionable whether this effect is clinically relevant. Certain groups of patients benefit more from DMPs than others. Nevertheless, further studies are needed in order to better understand the impact of the DMP on HbA 1c value and the reasons for the subgroup effects. Such studies should be carried

  5. Program Baseline Change Control Procedure

    International Nuclear Information System (INIS)

    1993-02-01

    This procedure establishes the responsibilities and process for approving initial issues of and changes to the technical, cost, and schedule baselines, and selected management documents developed by the Office of Civilian Radioactive Waste Management (OCRWM) for the Civilian Radioactive Waste Management System. This procedure implements the OCRWM Baseline Management Plan and DOE Order 4700.1, Chg 1. It streamlines the change control process to enhance integration, accountability, and traceability of Level 0 and Level I decisions through standardized Baseline Change Proposal (BCP) forms to be used by the Level 0, 1, 2, and 3 Baseline Change Control Boards (BCCBs) and to be tracked in the OCRWM-wide Configuration Information System (CIS) Database.This procedure applies to all technical, cost, and schedule baselines controlled by the Energy System Acquisition Advisory Board (ESAAB) BCCB (Level 0) and, OCRWM Program Baseline Control Board (PBCCB) (Level 1). All baseline BCPs initiated by Level 2 or lower BCCBs, which require approval from ESAAB or PBCCB, shall be processed in accordance with this procedure. This procedure also applies to all Program-level management documents controlled by the OCRWM PBCCB

  6. The value of RI scintigraphy and angiography in small intestinal bleeding; Report of eight cases

    Energy Technology Data Exchange (ETDEWEB)

    Kurosawa, Susumu; Kuwata, Hajime; Kushibiki, Kyoko; Akimoto, Kimihiko; Hashimoto, Toshiyuki; Kojima, Toshiya (Showa General Hospital, Kodaira, Tokyo (Japan))

    1991-07-01

    We retrospectively reviewed eight cases of small intestinal bleeding and assessed the value of RI scintigraphy and angiography in diagnosing the bleeding site. The patients' average age was 56.2 years. Chief complaint was melena of variable degree. In most cases neither upper endoscopy nor colonoscopy was diagnostic. RI scientigraphy (Tc-99 labeled human serum albumin) showed 75% of positive rate whereas angiography showed 66.7% (4/6) of positive rate. All four cases of leiomyosarcoma and leiomyoma demonstrated hypervascular stain and/or extra-vasation in angiography whereas RI scintigraphy failed to detect active gastrointestinal bleeding in 2 of the 4 cases. Therefore angiography was considered useful for the detection of bleeding from leiomyoma and leiomyosarcoma which are often hypervascular. Scintigraphy is thought of most value in the demonstration of small amount of bleeding with minimum vascular abnormality. (author).

  7. Performance on the RI-48 Cued Recall Test Best Predicts Conversion to Dementia at the 5- and 10-Year Follow-Ups

    Directory of Open Access Journals (Sweden)

    Bernard Hanseeuw

    2011-08-01

    Full Text Available Background: TheRI-48 cued recall test was devised to discriminate between healthy elderly and patients with mild cognitive impairment who are at risk of developing Alzheimer’s disease (AD. However, no long-term follow-up studies have been conducted using this test. Methods: We analyzed the predictive power of the RI-48 test for determining the patients who will convert to AD dementia within the decade after testing. During 10 years, we followed up 40 non-demented patients who attended our Memory Clinic and underwent complete neuropsychological evaluation including the RI-48. Results: Of the 40 patients, 21 developed dementia (converters, CO and 19 remained stable patients (SP. Of the tests performed at inclusion, only the RI-48 (p Conclusion: The RI-48 had the best overall diagnostic accuracy at 5- and at 10-year follow-ups.

  8. 76 FR 22938 - Submission for Review: RI 25-37, Evidence To Prove Dependency of a Child

    Science.gov (United States)

    2011-04-25

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: RI 25-37, Evidence To Prove Dependency of a..., Evidence to Prove Dependency of a Child. As required by the Paperwork Reduction Act of 1995 (Pub. L. 104-13... Dependency of a Child, is designed to collect sufficient information for the Office of Personnel Management...

  9. Point mutation in activated c-Ha-ras gene of a chemically induced transplantable human pancreas carcinoma

    International Nuclear Information System (INIS)

    Maheshwari, K.K.; Parsa, I.

    1986-01-01

    The authors have reported a model of human pancreas carcinogenesis where repeated treatment with MNU of explants results in the development of transplantable carcinoma. This report compares the endonuclease digests of DNAs from normal human pancreas (HP) and MNU-induced transplantable tumor (HP-T1) analyzed with 32 P-labelled Ha-ras probe prepared from clone BS-9. The hybridization patterns of BamHI, BglII, EcoRI and HindIII digests of HP were significantly different from those of HP-T1. In EcoRI digests a 3.0 kb fragments of HP-T1 DNA hybridized with Ha-ras probe instead of a 4.3 kb fragments seen in HP DNA. The pattern for HindIII digests was similar to those of EcoRI. The BgIII digests of HP DNA revealed two hybridizing fragments of 8.0 and 4.3 kb whereas those of HP-T1 DNA fragments measured 8.5 and 4.0 kb. BamHI treated HP DNA showed only hybridizing fragments of 6.6 kb while the HP-T1 DNA showed to hybridizing fragments of 6.8 and 7.2 kb. The digested DNAs by HhaI, HinfI, KpnI, pstI, PvuII, SaII, SstI, TaqI and XbaI showed similar hybridization profiles. The point mutation in c-Ha-ras was examined in the HpaII and MspI double digests of both DNAs by 0.6 Kb SmaI fragments of pEJ. The hybridized fragments measured 412 and 355 bp in DNA digests from tumor and normal pancreas respectively

  10. Subthreshold Desensitization of Human Basophils Re-capitulates the Loss of syk and FcεRI expression Characterized by Other Methods of Desensitization

    Science.gov (United States)

    MacGlashan, Donald

    2012-01-01

    Background Clinical desensitization of patients to drugs involves progressive exposure to escalating doses of drug over a period of 24 hours. In prior studies, this method was recapitulated in vitro to also demonstrate loss of mast cell or basophil responsiveness. However, most signaling studies of human basophils have identified changes in signaling by using other methods of inducing cellular desensitization. Objective This study examined two well-described endpoints of basophil desensitization, loss of syk or FcεRI expression, under conditions of subthreshold desensitization. Methods The loss of FceRI and syk was examined in human basophils. Results It was shown that both loss of syk and FcεRI/IgE occurred during an escalating series of stimulation (anti-IgE Ab) and that expression loss occurred despite the presence of little histamine release. If basophils were first cultured for 3 days in 10 ng/ml IL-3, the concentration-dependence of histamine release shifted to 100 fold lower concentrations of stimulus. However, loss of syk did not show any change in its EC50 while loss of FcεRI also shifted 100 fold. From the perspective of early signal element activation, the marked shift in the EC50 for histamine release was not accompanied by similar shifts in the EC50s for several signaling elements. The EC50s for phospho-Src, phospho-SHIP1, phospho-Syk, or phospho-Cbl did not change while the EC50s for phospho-Erk and the cytosolic calcium response did shift 100 fold. Conclusions These studies show that under normal conditions, subthreshold desensitization leads to loss of two critical signaling molecules (FcεRI and syk) but under at least one condition, treatment with IL-3, it is possible to markedly blunt the loss of syk, but not FcεRI, while executing a proper subthreshold titration. These data also suggest that IL-3 modifies only the sensitivity of signaling elements that are downstream of syk activation. PMID:22702505

  11. Coastal Barrier Resource Areas, Barrier Islands and Spits; s44gbb89; Barrier Beaches as defined by RI CRMC were barrier beaches as defined by RI CRMC were identified on quad maps and manually digitized from tablets, Published in 1989, 1:24000 (1in=2000ft) scale, Rhode Island and Providence Plantations.

    Data.gov (United States)

    NSGIC State | GIS Inventory — Coastal Barrier Resource Areas dataset current as of 1989. Barrier Islands and Spits; s44gbb89; Barrier Beaches as defined by RI CRMC were barrier beaches as defined...

  12. Diabetes mellitus defined by hemoglobin A1c value: Risk characterization for incidence among Japanese subjects in the JPHC Diabetes Study.

    Science.gov (United States)

    Kato, Masayuki; Takahashi, Yoshihiko; Matsushita, Yumi; Mizoue, Tetsuya; Inoue, Manami; Kadowaki, Takashi; Tsugane, Shoichiro; Noda, Mitsuhiko

    2011-10-07

    Aims/Introduction:  Although several risk factors for type 2 diabetes have been identified, most of them have been identified in studies on Western populations, and they should be evaluated in a Japanese population. In 2010, new diagnostic criteria for diabetes mellitus using hemoglobin A1c (HbA1c) were released and its use in epidemiological studies has many advantages. The aim of the present study was to evaluate risk factors for type 2 diabetes defined based on HbA1c values in a Japanese population.   A total of 9223 subjects (3076 men and 6147 women) were followed up for 5 years. Diabetes was defined based on self-report or HbA1c value. Risk factors for diabetes were evaluated as odds ratios adjusted for potential confounding factors by logistic regression.   During the 5-year follow-up period, we documented 518 incident cases of diabetes (232 men and 286 women). Of the 518 incident cases, 310 cases were diagnosed by HbA1c alone. Among the men, age, smoking (both past smoking and current smoking) and family history of diabetes significantly increased the risk of diabetes. Among the women, body mass index, family history of diabetes and hypertension significantly increased the risk of diabetes. These results did not change markedly after adjustment for the baseline HbA1c values, and the baseline HbA1c value itself was a significant risk factor for diabetes mellitus.   Known risk factors for diabetes established in Western populations also increased the risk of diabetes in a Japanese population defined on the basis of HbA1c values. (J Diabetes Invest, doi: 10.1111/j.2040-1124.2011.00119.x, 2011).

  13. Synthesis of the C1-C28 Portion of Spongistatin 1 (Altohyrtin A).

    Science.gov (United States)

    Claffey, Michelle M.; Hayes, Christopher J.; Heathcock, Clayton H.

    1999-10-29

    A synthetic approach was developed to the C1-C28 subunit of spongistatin 1 (altohyrtin A, 65). The key step was the coupling of the AB and CD spiroketal moieties via an anti-aldol reaction of aldehyde 62 and ethyl ketone 57. The development of a method for the construction of the AB spiroketal fragment is described and included the desymmetrization of C(2)-symmetric diketone 10 and the differentiation of the two primary alcohols of 16. Further elaboration of this advanced intermediate to the desired aldehyde 62 included an Evans' syn-aldol reaction and Tebbe olefination. The synthesis of the CD spiroketal fragment 56 involved the ketalization of a triol-dione, generated in situ by deprotection of 45, to provide a favorable ratio (6-7:1) of spiroketal isomers 46 and 47, respectively. The overall protecting group strategy, involving many selective manipulations of silyl protecting groups, was successfully developed to provide the desired C1-C28 subunit of spongistatin 1 (altohyrtin A) (65).

  14. DETERMINATION OF ATTENUATION INDEX CURVE "Ri(f" FOR HOMOGENEOUS DOUBLE LOCKING ELEMENTS

    Directory of Open Access Journals (Sweden)

    BUZATU G. C.

    2016-12-01

    Full Text Available The paper is structured in three parts. In the first part of the paper, are presented some theoretical notions regarding the sound, noise, the sound insulations materials. Also in the first part of the paper are presented some characteristic regarding the insulation materials and there effects. In the second part it is described an calculation example for a homogeneous wall with double structure in order to determine the attenuation index curve "Ri(f". The example calculation contains 10 steps that must be followed and the final results are presented in table 7 and figure 3. The last part of the paper is represented by conclusions, where the authors tried to explain the importance of the curve "Ri(f" for reducing the noise in the buildings.

  15. Uudised : Fääri ooper Tallinnas. Sigur Ros Tallinnas

    Index Scriptorium Estoniae

    2008-01-01

    10.-12. septembrini mängitakse Tallinnas Kultuurikatlas fääri helilooja Sunleif Rasmusseni ooperit "Hullu mehe aias", lavastajaks Robert Annus. 23. augustil annab Rock Cafés kontserdi Islandi eksperimentaalrocki ansambel Sigur Ros, kes esitleb oma viiendat albumit "Med sud i eyrum vid spilum endalaust" (mida võiks tõlkida "Mängime lõppematult, sumin kõrvus"

  16. A complex of cardiac cytochrome c1 and cytochrome c.

    Science.gov (United States)

    Chiang, Y L; Kaminsky, L S; King, T E

    1976-01-10

    The interactions of cytochrome c1 and cytochrome c from bovine cardiac mitochondria were investigated. Cytochrome c1 and cytochrome c formed a 1:1 molecular complex in aqueous solutions of low ionic strength. The complex was stable to Sephadex G-75 chromatography. The formation and stability of the complex were independent of the oxidation state of the cytochrome components as far as those reactions studied were concerned. The complex was dissociated in solutions of ionic strength higher than 0.07 or pH exceeding 10 and only partially dissociated in 8 M urea. No complexation occurred when cytochrome c was acetylated on 64% of its lysine residues or photooxidized on its 2 methionine residues. Complexes with molecular ratios of less than 1:1 (i.e. more cytochrome c) were obtained when polymerized cytochrome c, or cytochrome c with all lysine residues guanidinated, or a "1-65 heme peptide" from cyanogen bromide cleavage of cytochrome c was used. These results were interpreted to imply that the complex was predominantly maintained by ionic interactions probably involving some of the lysine residues of cytochrome c but with major stabilization dependent on the native conformations of both cytochromes. The reduced complex was autooxidizable with biphasic kinetics with first order rate constants of 6 X 10(-5) and 5 X U0(-5) s-1 but did not react with carbon monoxide. The complex reacted with cyanide and was reduced by ascorbate at about 32% and 40% respectively, of the rates of reaction with cytochrome c alone. The complex was less photoreducible than cytochrome c1 alone. The complex exhibited remarkably different circular dichroic behavior from that of the summation of cytochrome c1 plus cytochrome c. We concluded that when cytochromes c1 and c interacted they underwent dramatic conformational changes resulting in weakening of their heme crevices. All results available would indicate that in the complex cytochrome c1 was bound at the entrance to the heme crevice of

  17. Interaction of berenil with the EcoRI dodecamer d(CGCGAATTCGCG)2 in solution studied by NMR

    International Nuclear Information System (INIS)

    Lane, A.N.; Jenkins, T.C.; Neidle, S.; Brown, T.

    1991-01-01

    The conformation of the EcoRI dodecamer d(CGCGAATTCGCG) 2 has been examined in solution by 1 H and 31 P NMR. Spin-spin coupling constants and nuclear Overhauser (NOE) enhancement spectroscopy show that all deoxyriboses lie in the south domain, with a small admixture of the north conformation (0-20%). The time dependence of the nuclear Overhauser enhancements also reveals a relatively uniform conformation at the glycosidic bonds. The average helical twist is 36.5. Tilt angles are small, and roll angles are poorly determined. Both the NOE intensities and 31 P relaxation data imply conformational anomalies at the C3-G4/C9-G10 and the A5-A6/T7-T8 steps. Berenil binds in 1:1 stoichiometry to the dodecamer with high affinity and causes substantial changes in chemical shifts of the sugar protons of nucleotides Ado 5-Cyt 9 and of the H2 resonances of the two Ado residues. NOEs are observed between the aromatic protons of berenil and the H1' of both Thy 7 and Thy 8, as well as to Ado 5 and Ado 6 H2. These results firmly establish that berenil binds via the minor groove and closely approaches the nucleotides Ado 6, Thy 7, and Thy 8. Using the observed NOEs between the ligand and the DNA together with the derived glycosidic torsion angles, the authors have built models that satisfy all of the available solution data

  18. Abilinnapea Ratas pidas uputust paratamatuseks / Jüri Ratas ; interv. Piret Reiljan

    Index Scriptorium Estoniae

    Ratas, Jüri, 1978-

    2004-01-01

    Tallinna abilinnapea Jüri Ratas kommenteerib olukorda linnas, kus kahe päevaga sadas maha rohkem kui juulikuu sademete norm ette näeb. Vt. samas Meelis Eldermann. Miks veevärk vihmaga toime ei tulnud?

  19. C-Peptide, Baseline and Postprandial Insulin Resistance after a Carbohydrate-Rich Test Meal - Evidence for an Increased Insulin Clearance in PCOS Patients?

    Science.gov (United States)

    Stassek, J; Erdmann, J; Ohnolz, F; Berg, F D; Kiechle, M; Seifert-Klauss, V

    2017-01-01

    Introduction Known characteristics of patients with PCOS include infertility, menstrual disorders, hirsutism and also often insulin resistance. These symptoms increase with increasing body weight. In the LIPCOS study ( L ifestyle I ntervention for Patients with Polycystic Ovary Syndrome [ PCOS ]) long-term changes of the PCOS in dependence on pregnancy and parenthood were systematically assessed. In the framework of the LIPCOS study, PCOS patients were given a standardised carbohydrate-rich test meal in order to examine glucose homeostasis and insulin secretion. The results were compared with those of a eumenorrhoeic control group who all had corresponding BMI values and corresponding ages. Methods and Patients 41 PCOS patients (without diabetes) and 68 controls received a standardised carbohydrate-rich test meal (260 kcal, 62 % carbohydrates, 32 % fat, 6 % proteins) in order to generate a submaximal insulin and glucose stimulation. The values were determined at baseline and postprandial after 60, 120 and 180 minutes. In addition, the corresponding C-peptide levels were recorded. Results In the PCOS patients (n = 41), the insulin secretion test after a standardised test meal showed almost identical baseline and postprandial insulin levels when compared with those of the age- and BMI-matched eumenorrhoeic controls (n = 68). In the PCOS patients, the baseline and postprandial glucose levels were significantly elevated (92.88 ± 10.28 [PCOS] vs. 85.07 ± 9.42 mg/dL [controls]; p PCOS patients formally exhibit a higher fasting insulin resistance than controls. In spite of the higher stimulated C-peptide levels, the insulin levels did not increase more strongly with increasing glucose levels than in controls which may be indicative of a higher insulin clearance in PCOS patients.

  20. Effects of MTHFR and MS gene polymorphisms on baseline blood pressure and Benazepril effectiveness in Chinese hypertensive patients.

    Science.gov (United States)

    Jiang, S; Yu, Y; Venners, S A; Zhang, Y; Xing, H; Wang, X; Xu, X

    2011-03-01

    The development of essential hypertension (EH) and inter-individual differences in response to antihypertensive treatment may partly result from genetic heterogeneity. In this study, we conducted an investigation of the combined effects of 5, 10-methylenetetrahydrofolate reductase (MTHFR) C677T and methionine synthase (MS) A2756G polymorphisms on baseline blood pressure (BP) and BP response to antihypertensive Benazepril treatment in 823 Chinese hypertensive patients with a fixed daily dosage of 10 mg for 15 consecutive days. When MTHFR C677T and MS A2756G polymorphisms were modelled together with adjustment for important covariates, only MTHFR C677T was associated with baseline systolic BP (SBP) (β (s.e.)=2.84 (1.10), P=0.0096) or baseline diastolic BP (DBP) (β (s.e.)=2.19 (0.65), P=0.0008). Modelled together with adjustment for important covariates, MTHFR C677T and MS A2756G polymorphisms were both independently associated with increased DBP response (baseline minus post-treatment) to Benazepril treatment (C677T: β (s.e.)=1.58 (0.76), P=0.038; A2756G: β (s.e.)=2.14 (0.89), P=0.016). Neither polymorphism was associated with SBP response to Benazepril treatment. There were no significant interactions or effect modification between MTHFR C677T and MS A2756G gene polymorphisms in models of baseline SBP, baseline DBP or DBP response to Benazepril treatment. Our results suggest that the effects of MTHFR C677T and MS A2756G gene polymorphisms may have pivotal roles in the aetiology of EH and BP response to Benazepril treatment.

  1. Eesti kirjandus suure ilma äärel / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1999-01-01

    Eesti kirjanduse esindatusest teatmeteoses "Encyclopedia of world literature in the 20th century" (St. James Press, 1999) ja "Der Literatur Brockhaus" (München... [jt.] : B. I. Taschenbuchverlag, 1995). Ilmunud ka kogumikus: Talvet, Jüri. Ameerika märkmed, ehk, Kaemusi Eestist. Tartu : Ilmamaa, 2000, lk. 121-124

  2. Mixed Waste Focus Area integrated technical baseline report, Phase 1: Volume 1

    International Nuclear Information System (INIS)

    1996-01-01

    The Department of Energy (DOE) established the Mixed Waste Characterization, Treatment, and Disposal Focus Area (MWFA) to develop and facilitate implementation of technologies required to meet the Department's commitments for treatment of mixed low-level and transuranic wastes. The mission of the MWFA is to provide acceptable treatment systems, developed in partnership with users and with participation of stakeholders, tribal governments, and regulators, that are capable of treating DOE's mixed waste. These treatment systems include all necessary steps such as characterization, pretreatment, and disposal. To accomplish this mission, a technical baseline is being established that forms the basis for determining which technology development activities will be supported by the MWFA. The technical baseline is the prioritized list of deficiencies, and the resulting technology development activities needed to overcome these deficiencies. This document presents Phase I of the technical baseline development process, which resulted in the prioritized list of deficiencies that the MWFA will address. A summary of the data and the assumptions upon which this work was based is included, as well as information concerning the DOE Office of Environmental Management (EM) mixed waste technology development needs. The next phase in the technical baseline development process, Phase II, will result in the identification of technology development activities that will be conducted through the MWFA to resolve the identified deficiencies

  3. Baseline Optimization for the Measurement of CP Violation, Mass Hierarchy, and $\\theta_{23}$ Octant in a Long-Baseline Neutrino Oscillation Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bass, M. [Colorado State U.; Bishai, M. [Brookhaven; Cherdack, D. [Colorado State U.; Diwan, M. [Brookhaven; Djurcic, Z. [Argonne; Hernandez, J. [Houston U.; Lundberg, B. [Fermilab; Paolone, V. [Pittsburgh U.; Qian, X. [Brookhaven; Rameika, R. [Fermilab; Whitehead, L. [Houston U.; Wilson, R. J. [Colorado State U.; Worcester, E. [Brookhaven; Zeller, G. [Fermilab

    2015-03-19

    Next-generation long-baseline electron neutrino appearance experiments will seek to discover CP violation, determine the mass hierarchy and resolve the θ23 octant. In light of the recent precision measurements of θ13, we consider the sensitivity of these measurements in a study to determine the optimal baseline, including practical considerations regarding beam and detector performance. We conclude that a detector at a baseline of at least 1000 km in a wide-band muon neutrino beam is the optimal configuration.

  4. Short-baseline electron antineutrino disappearance study by using neutrino sources from {sup 13}C + {sup 9}Be reaction

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Jae Won; Cheoun, Myung-Ki [Department of Physics and Origin of Matter and Evolution of Galaxies (OMEG) Institute, Soongsil University, Seoul 156-743 (Korea, Republic of); Kajino, Toshitaka [Division of Theoretical Astronomy, National Astronomical Observatory of Japan, Mitaka, Tokyo 181-8588 (Japan); Hayakawa, Takehito, E-mail: shine8199@skku.edu, E-mail: cheoun@ssu.ac.kr, E-mail: kajino@nao.ac.jp, E-mail: hayakawa.takehito@qst.go.jp [Quantum Beam Science Directorate (QUBS), Japan Atomic Energy Agency (JAEA), 2-4 Shirane, Shirakata, Tokai-mura, Naka-gun, Ibaraki 319-1195 (Japan)

    2017-04-01

    To investigate the existence of sterile neutrino, we propose a new neutrino production method using {sup 13}C beams and a {sup 9}Be target for short-baseline electron antineutrino (ν-bar {sub e} ) disappearance study. The production of secondary unstable isotopes which can emit neutrinos from the {sup 13}C + {sup 9}Be reaction is calculated with three different nucleus-nucleus (AA) reaction models. Different isotope yields are obtained using these models, but the results of the neutrino flux are found to have unanimous similarities. This feature gives an opportunity to study neutrino oscillation through shape analysis. In this work, expected neutrino flux and event rates are discussed in detail through intensive simulation of the light ion collision reaction and the neutrino flux from the beta decay of unstable isotopes followed by this collision. Together with the reactor and accelerator anomalies, the present proposed ν-bar {sub e} source is shown to be a practically alternative test of the existence of the Δ m {sup 2} ∼ 1 eV{sup 2} scale sterile neutrino.

  5. 78 FR 55121 - Submission for Review: Self-Certification of Full-Time School Attendance for the School Year, RI...

    Science.gov (United States)

    2013-09-09

    ... Attendance for the School Year, RI 25-14 and Information; and Instructions for Completing the Self...-0032, Self-Certification of Full-Time School Attendance For The School Year, RI 25-14; and Information... technological collection techniques or other forms of information technology, e.g., permitting electronic...

  6. Regional interaction between myocardial sympathetic denervation, contractile dysfunction, and fibrosis in heart failure with preserved ejection fraction: {sup 11}C-hydroxyephedrine PET study

    Energy Technology Data Exchange (ETDEWEB)

    Aikawa, Tadao; Naya, Masanao; Obara, Masahiko [Hokkaido University, Department of Cardiovascular Medicine, Faculty of Medicine and Graduate School of Medicine, Sapporo (Japan); Oyama-Manabe, Noriko [Hokkaido University Hospital, Department of Diagnostic and Interventional Radiology, Sapporo (Japan); Manabe, Osamu [Hokkaido University, Department of Nuclear Medicine, Faculty of Medicine and Graduate School of Medicine, Sapporo (Japan); Magota, Keiichi [Hokkaido University Hospital, Division of Medical Imaging and Technology, Sapporo (Japan); Ito, Yoichi M. [Hokkaido University, Department of Biostatistics, Faculty of Medicine and Graduate School of Medicine, Sapporo (Japan); Katoh, Chietsugu [Hokkaido University, Department of Biomedical Science and Engineering, Faculty of Health Sciences, Sapporo (Japan); Tamaki, Nagara [Kyoto Prefectural University of Medicine, Department of Radiology, Kyoto (Japan)

    2017-10-15

    This investigation aimed to identify significant predictors of regional sympathetic denervation quantified by {sup 11}C-hydroxyephedrine (HED) positron emission tomography (PET) in patients with heart failure with preserved left ventricular ejection fraction (HFpEF). Included in the study were 34 patients (age 63 ± 15 years, 23 men) with HFpEF (left ventricular ejection fraction ≥40%) and 11 age-matched volunteers without heart failure. Cardiac magnetic resonance imaging was performed to measure left ventricular size and function, and the extent of myocardial late gadolinium enhancement (LGE). {sup 11}C-HED PET was performed to quantify myocardial sympathetic innervation that was expressed as a {sup 11}C-HED retention index (RI, %/min). To identify predictors of regional {sup 11}C-HED RI in HFpEF patients, we propose a multivariate mixed-effects model for repeated measures over segments with an unstructured covariance matrix. Global {sup 11}C-HED RI was significantly lower and more heterogeneous in HFpEF patients than in volunteers (P < 0.01 for all). Regional {sup 11}C-HED RI was correlated positively with systolic wall thickening (r = 0.42, P < 0.001) and negatively with the extent of LGE (r = -0.43, P < 0.001). Segments in HFpEF patients with a large extent of LGE had the lowest regional {sup 11}C-HED RI among all segments (P < 0.001 in post hoc tests). Multivariate analysis demonstrated that systolic wall thickening and the extent of LGE were significant predictors of regional {sup 11}C-HED RI in HFpEF patients (both P ≤ 0.001). Regional sympathetic denervation was associated with contractile dysfunction and fibrotic burden in HFpEF patients, suggesting that regional sympathetic denervation may provide an integrated measure of myocardial damage in HFpEF. (orig.)

  7. Tornide väljaku müüriäärse ala tulevik endiselt ebaselge / Askur Alas

    Index Scriptorium Estoniae

    Alas, Askur, 1973-

    2004-01-01

    Tallinna linna ja ehitusfirma Restor vaheline tüli linnamüüri äärse maa täisehitamise suhtes Suurtüki kvartalis pole lahendust leidnud. Linnaosavalitsus soovib müüri äärde parki ja tahab algatada ala detaiplaneeringut. Restoril on Plate ja Eppingi torni vahel ridaelamuboksid juba välja ehitatud

  8. Blood Test: Hemoglobin A1C

    Science.gov (United States)

    ... Why Are Hemoglobin A1c Tests Done? When a child has diabetes, hemoglobin A1c levels are followed to see how well medicines are working. If a child with diabetes has a high hemoglobin A1c level, it may ...

  9. Two-dimensional echocardiographic and RI angiographic features of aneurysm of the ascending aorta in patients with annuloaortic ectasia

    International Nuclear Information System (INIS)

    Nakamura, Kenji; Suzuki, Shin; Satomi, Gengi

    1981-01-01

    The purpose of this study was to compare the diagnostic value of two-dimensional echocardiography with that of other methods in the detection and localization of aneurysm involving the ascending aorta in patients with annuloaortic ectasia. Two-dimensional echocardiography, RI angiography, CT scan and aortography were performed in 19 patients (12 patients with Marfan's syndrome, 4 with aortitis syndrome and 3 with postoperative perivalvular aneurysm). Eight of 12 patients with Marfan's syndrome had dissection in the ascending aorta which was confirmed at surgery or autopsy. The following observations were obtained. 1) Dissection of the ascending aorta was clearly demonstrated on the two-dimensional echocardiogram in 7 patients by recording the intinal tear and flap, and in these cases the short axis two-dimensional echocardiogram of the ascending aorta was more useful in identifying the site and extent of dissection. 2) In patients with postoperative perivalvular aneurysms, RI angiography proved to be a more useful and sensitive technique in differentiating a leakage into the aneurysm from clots in the aneurysm. 3) CT scanning proved to be an insensitive technique to detect dissection of the ascending aneurysm and to differentiate a leakage from clots in the perivalvular aneurysm. From these observations, we concluded that two-dimensional echocardiography and RI angiography proved to be sensitive techniques in detecting dissection of the ascending aneurysm and evaluating a postoperative aneurysm in patients with annuloaortic ectasia. (author)

  10. A Casa do Fim: um conto de José Riço Direitinho

    OpenAIRE

    Oliveira, Catarina Alexandra Monteiro de

    2003-01-01

    The book A Casa do Fim by young writer José Riço Direitinho is made up of ten short and independent stories, stories of life and, above all, of death, played by unusual characters. The writer shapes a strongly rural fictional universe, where he mingles what is real and what is fantastic. A Casa do Fim is a structurally and semantically fractured story, where deep wisdom and ancestral habits are passed on from mother to daughter. The son atones for the sins of the father, and suicide is sho...

  11. Characterization of ["1"1C]Lu AE92686 as a PET radioligand for phosphodiesterase 10A in the nonhuman primate brain

    International Nuclear Information System (INIS)

    Yang, Kai-Chun; Stepanov, Vladimir; Amini, Nahid; Martinsson, Stefan; Takano, Akihiro; Halldin, Christer; Nielsen, Jacob; Bundgaard, Christoffer; Bang-Andersen, Benny; Grimwood, Sarah; Farde, Lars; Finnema, Sjoerd J.

    2017-01-01

    ["1"1C]Lu AE92686 is a positron emission tomography (PET) radioligand that has recently been validated for examining phosphodiesterase 10A (PDE10A) in the human striatum. ["1"1C]Lu AE92686 has high affinity for PDE10A (IC_5_0 = 0.39 nM) and may also be suitable for examination of the substantia nigra, a region with low density of PDE10A. Here, we report characterization of regional ["1"1C]Lu AE92686 binding to PDE10A in the nonhuman primate (NHP) brain. A total of 11 PET measurements, seven baseline and four following pretreatment with unlabeled Lu AE92686 or the structurally unrelated PDE10A inhibitor MP-10, were performed in five NHPs using a high resolution research tomograph (HRRT). ["1"1C]Lu AE92686 binding was quantified using a radiometabolite-corrected arterial input function and compartmental and graphical modeling approaches. Regional time-activity curves were best described with the two-tissue compartment model (2TCM). However, the distribution volume (V_T) values for all regions were obtained by the Logan plot analysis, as reliable cerebellar V_T values could not be derived by the 2TCM. For cerebellum, a proposed reference region, V_T values increased by ∝30 % with increasing PET measurement duration from 63 to 123 min, while V_T values in target regions remained stable. Both pretreatment drugs significantly decreased ["1"1C]Lu AE92686 binding in target regions, while no significant effect on cerebellum was observed. Binding potential (BP_N_D) values, derived with the simplified reference tissue model (SRTM), were 13-17 in putamen and 3-5 in substantia nigra and correlated well to values from the Logan plot analysis. The method proposed for quantification of ["1"1C]Lu AE92686 binding in applied studies in NHP is based on 63 min PET data and SRTM with cerebellum as a reference region. The study supports that ["1"1C]Lu AE92686 can be used for PET examinations of PDE10A binding also in substantia nigra. (orig.)

  12. Improvement of HbA1c and stable weight loss 2 years after an outpatient treatment and teaching program for patients with type 2 diabetes without insulin therapy based on urine glucose self-monitoring

    Directory of Open Access Journals (Sweden)

    Müller N

    2012-03-01

    Full Text Available Nicolle Müller1, Daniela Stengel2, Christof Kloos1, Michael Ristow2, Gunter Wolf1, Ulrich A Müller11University Hospital of Jena, Department of Internal Medicine III, Jena, Germany; 2Friedrich-Schiller-University Jena, Institute of Nutrition, Department of Human Nutrition, Jena, GermanyObjective: Long-term outcomes after participation in a structured diabetes treatment and teaching program (DTTP for patients with diabetes without insulin use, primarily based upon postprandial urine glucose self-monitoring (UGSM.Methods: A total of 126 patients took part in the DTTP in a university outpatient department in 2004–2005. We re-evaluated 119 (94.4% at baseline and at 6 months, 12 months, and 24 months. Hemoglobin A1c (HbA1c was DCCT adjusted.Results: HbA1c decreased significantly 6 months after education from 7.33% (±1.59% to 6.89% (±0.98%; P = 0.001 versus baseline and was maintained for up to 12 months (7.02% ± 1.07%; P = 0.017 versus baseline as well as up to 24 months (6.96% ± 1.06%; P = 0.005 versus baseline. Weight decreased from 92.5 kg at baseline to 90.3 kg at 24 months (P = 0.014. A total of 36.5% of patients not on insulin therapy preferred UGSM, whereas 23.5% preferred blood glucose monitoring, at 24 months. Glucose control was similar in both groups at 24 months (HbA1c UGSM 7.03 versus blood glucose monitoring 6.97%; P = 0.807.Conclusion: Participation in the DTTP resulted in long-term behavior modification. HbA1c of patients without insulin met the target 24 months after the DTTP, irrespective of the type of glucose self-monitoring.Keywords: diabetes mellitus type 2, treatment and teaching program, patient education, HbA1c, body weight

  13. Nucleotide sequence of cloned cDNA for human sphingolipid activator protein 1 precursor

    International Nuclear Information System (INIS)

    Dewji, N.N.; Wenger, D.A.; O'Brien, J.S.

    1987-01-01

    Two cDNA clones encoding prepro-sphingolipid activator protein 1 (SAP-1) were isolated from a λ gt11 human hepatoma expression library using polyclonal antibodies. These had inserts of ≅ 2 kilobases (λ-S-1.2 and λ-S-1.3) and both were both homologous with a previously isolated clone (λ-S-1.1) for mature SAP-1. The authors report here the nucleotide sequence of the longer two EcoRI fragments of S-1.2 and S-1.3 that were not the same and the derived amino acid sequences of mature SAP-1 and its prepro form. The open reading frame encodes 19 amino acids, which are colinear with the amino-terminal sequence of mature SAP-1, and extends far beyond the predicted carboxyl terminus of mature SAP-1, indicating extensive carboxyl-terminal processing. The nucleotide sequence of cDNA encoding prepro-SAP-1 includes 1449 bases from the assigned initiation codon ATG at base-pair 472 to the stop codon TGA at base-pair 1921. The first 23 amino acids coded after the initiation ATG are characteristic of a signal peptide. The calculated molecular mass for a polypeptide encoded by 1449 bases is ≅ 53 kDa, in keeping with the reported value for pro-SAP-1. The data indicate that after removal of the signal peptide mature SAP-1 is generated by removing an additional 7 amino acids from the amino terminus and ≅ 373 amino acids from the carboxyl terminus. One potential glycosylation site was previously found in mature SAP-1. Three additional potential glycosylation sites are present in the processed carboxyl-terminal polypeptide, which they designate as P-2

  14. Changes in HIV-1 subtypes B and C genital tract RNA in women and men after initiation of antiretroviral therapy.

    Science.gov (United States)

    Fiscus, Susan A; Cu-Uvin, Susan; Eshete, Abel Tilahun; Hughes, Michael D; Bao, Yajing; Hosseinipour, Mina; Grinsztejn, Beatriz; Badal-Faesen, Sharlaa; Dragavon, Joan; Coombs, Robert W; Braun, Ken; Moran, Laura; Hakim, James; Flanigan, Timothy; Kumarasamy, N; Campbell, Thomas B

    2013-07-01

    Combination antiretroviral therapy (cART) reduces genital tract human immunodeficiency virus type 1 (HIV-1) load and reduces the risk of sexual transmission, but little is known about the efficacy of cART for decreasing genital tract viral load (GTVL) and differences in sex or HIV-1 subtype. HIV-1 RNA from blood plasma, seminal plasma, or cervical wicks was quantified at baseline and at weeks 48 and 96 after entry in a randomized clinical trial of 3 cART regimens. One hundred fifty-eight men and 170 women from 7 countries were studied (men: 55% subtype B and 45% subtype C; women: 24% subtype B and 76% subtype C). Despite similar baseline CD4(+) cell counts and blood plasma viral loads, women with subtype C had the highest GTVL (median, 5.1 log10 copies/mL) compared to women with subtype B and men with subtype C or B (4.0, 4.0, and 3.8 log10 copies/mL, respectively; P female genital tract may serve as a reservoir of persistent HIV-1 replication during cART and affect the use of cART to prevent sexual and perinatal transmission of HIV-1.

  15. Deep sequencing analysis of HIV-1 reverse transcriptase at baseline and time of failure in patients receiving rilpivirine in the phase III studies ECHO and THRIVE.

    Science.gov (United States)

    Van Eygen, Veerle; Thys, Kim; Van Hove, Carl; Rimsky, Laurence T; De Meyer, Sandra; Aerssens, Jeroen; Picchio, Gaston; Vingerhoets, Johan

    2016-05-01

    Minority variants (1.0-25.0%) were evaluated by deep sequencing (DS) at baseline and virological failure (VF) in a selection of antiretroviral treatment-naïve, HIV-1-infected patients from the rilpivirine ECHO/THRIVE phase III studies. Linkage between frequently emerging resistance-associated mutations (RAMs) was determined. DS (llIumina®) and population sequencing (PS) results were available at baseline for 47 VFs and time of failure for 48 VFs; and at baseline for 49 responders matched for baseline characteristics. Minority mutations were accurately detected at frequencies down to 1.2% of the HIV-1 quasispecies. No baseline minority rilpivirine RAMs were detected in VFs; one responder carried 1.9% F227C. Baseline minority mutations associated with resistance to other non-nucleoside reverse transcriptase inhibitors (NNRTIs) were detected in 8/47 VFs (17.0%) and 7/49 responders (14.3%). Baseline minority nucleoside/nucleotide reverse transcriptase inhibitor (NRTI) RAMs M184V and L210W were each detected in one VF (none in responders). At failure, two patients without NNRTI RAMs by PS carried minority rilpivirine RAMs K101E and/or E138K; and five additional patients carried other minority NNRTI RAMs V90I, V106I, V179I, V189I, and Y188H. Overall at failure, minority NNRTI RAMs and NRTI RAMs were found in 29/48 (60.4%) and 16/48 VFs (33.3%), respectively. Linkage analysis showed that E138K and K101E were usually not observed on the same viral genome. In conclusion, baseline minority rilpivirine RAMs and other NNRTI/NRTI RAMs were uncommon in the rilpivirine arm of the ECHO and THRIVE studies. DS at failure showed emerging NNRTI resistant minority variants in seven rilpivirine VFs who had no detectable NNRTI RAMs by PS. © 2015 Wiley Periodicals, Inc.

  16. Update of the BIPM.RI(II)-K1.Rn-222 comparison of activity measurements for the radionuclide {sup 222}Rn to include the LNE-LNHB, France

    Energy Technology Data Exchange (ETDEWEB)

    Michotte, C.; Ratel, G. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Cassette, P. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Laboratoire national de metrologie et d' essais -Laboratoire national Henri Becquerel, 91191 Gif-sur-Yvette cedex (France)

    2012-02-15

    In 2007, the Laboratoire national de metrologie et d'essais - Laboratoire national Henri Becquerel (LNE-LNHB), France submitted a sample of known activity of {sup 222}Rn to the International Reference System (SIR) for comparison. The value of the activity submitted was about 90 kBq. This key comparison result joins that of Switzerland and Germany in the key comparison database that now contains three results, identifier BIPM.RI(II)-K1.Rn-222. Consequently, the KCRV has been updated and the degrees of equivalence with the KCRV have been evaluated. (authors)

  17. Kas Orase Shelley või Shelley Oras? / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1999-01-01

    Arvustus: Shelley, Percy Bysshe. Valik lüürikat / tlk. Ants Oras; toim. Anne Lange. Tln. : Hortus Litterarum, 1998. Ants Orase ja Minni Nurme tõlgete võrdlus (P. B. Shelley. Luuletusi. Tln., 1960). Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 408-416

  18. Synthesis of [2-13C, 2-14C] 2-aminoethanol, [1-13C, 1-14C] 2-chloroethylamine, N,N'-bis([1-13C, 1-14C] 2-chloroethyl)-N-nitrosourea(BCNU) and N-([1-13C, 1-14C] 2-chloroethyl)-N-nitrosourea(CNU)

    International Nuclear Information System (INIS)

    Narayan, R.; Chang, C-j.

    1982-01-01

    [2- 13 C, 2- 14 C]2-Aminoethanol hydrochloride was prepared in good yield from Na*CN in a two step sequence by first converting the Na*CN to OHCH 2 *CN and then reducing the nitrile directly with a solution of borane-tetrahydrofuran complex. The reaction procedure was simple and the pure product could be obtained readily. Using this specifically labelled precursor, the synthesis of [1- 13 C, 1- 14 C]2-chloroethylamine hydrochloride, N-([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(CNU) and N,N'-bis([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(BCNU) in good yield without isotope scrambling was also reported. (author)

  19. Beyond HbA1c.

    Science.gov (United States)

    Bloomgarden, Zachary

    2017-12-01

    It can scarcely be denied that the supreme goal of all theory is to make the irreducible basic elements as simple and as few as possible without having to surrender the adequate representation of a single datum of experience. The diaTribe Foundation convened a meeting on the topic of glycemic outcomes beyond HbA1c on 21 July 2017, in Bethesda (MD, USA), focusing on potential uses of continuous glucose monitoring (CGM). Understanding patterns of glycemia in people with diabetes has long been a focus of approaches to improving treatment, and over the past few years this has become an available modality for clinical practice. Glucose levels are not the only biologic parameters affecting HbA1c levels; HbA1c changes with anemia or, more subtly, with changes in rates of erythrocyte turnover not reflected in hemoglobin levels outside the normal range. Renal disease often is associated with lower HbA1c than would be predicted based on an individual's glycemic levels. Furthermore, HbA1c levels tend to increase with age and are higher in some ethnic groups; for example, people of African ethnicity have higher HbA1c levels than people of Northern European descent. Indeed, we have argued that even as a measure of mean glycemia HbA1c is inherently imprecise. Overall, for some 20% of people with diabetes, HbA1c levels are substantially higher, or substantially lower, than those that would be predicted from mean blood glucose levels. If one recognizes that HbA1c is, at best, a partial measure of mean glycemic exposure, one must surely accept that HbA1c does not reflect variability within a day, from day to day, and from period to period. Many glucose-lowering medicines, particularly the sulfonylureas and insulin, cause hypoglycemia, with consequent negative effects on quality of life and patient-reported outcomes, as well as association with weight gain and adverse macrovascular outcome; hypoglycemia will, of course, not be captured by HbA1c measurement. Based on these

  20. National Cyberethics, Cybersafety, Cybersecurity Baseline Study

    Science.gov (United States)

    Education Digest: Essential Readings Condensed for Quick Review, 2009

    2009-01-01

    This article presents findings from a study that explores the nature of the Cyberethics, Cybersafety, and Cybersecurity (C3) educational awareness policies, initiatives, curriculum, and practices currently taking place in the U.S. public and private K-12 educational settings. The study establishes baseline data on C3 awareness, which can be used…

  1. Improving access to HbA1c in sub-Saharan Africa (IA3) cohort: cohort profile.

    Science.gov (United States)

    Balde, Naby; Camara, Alioune; Sobngwi-Tambekou, Joelle; Balti, Eric Vounsia; Tchatchoua, Alain; Fezeu, Leopold; Limen, Serge; Ngamani, Sylvie; Ngapout, Suzanne; Kengne, Andre Pascal; Sobngwi, Eugene

    2017-01-01

    Glycated haemoglobin (HbA1c) is the best surrogate of average blood glucose control in diabetic patients, and lowering HbA1c significantly reduces diabetes complications. Moreover, immediate feedback of HbA1c measurement to patients may improve control. However, HbA1c is unavailable in most parts of Africa, a continent with one of the highest burden of diabetes. To translate these evidences, we are conducting a multicentric project in 10 health care facilities in Guinea and Cameroon to evaluate the feasibility and one-year benefit of affordable HbA1c measurement with immediate feedback to patients on diabetes control and related outcomes. We consecutively enrolled patients with diabetes mellitus independently of the type of disease. We hypothesised an average 1%-decrease in HbA1c in a 1000-patient study population, with a 20% increase in the number of patients reaching treatment goals within 12 months of intervention and follow-up. A total of 1, 349 diabetic patients aged 56.2±12.6 years are enrolled (813 in Cameroon and 536 in Guinea) of whom 59.8% are women. The mean duration of diabetes is 7.4±6.3 years and baseline HbA1c is 9.7±2.6% in Guinea and 8.6±2.5% in Cameroon. To investigate whether the introduction of routine HbA1c measurement with immediate feedback to patients and provision of relevant education would improve diabetes control after one year. The impact of the intervention on diabetes associated-complications and mortality warrant further assessment in the long term.

  2. 78 FR 52580 - Submission for Review: Request for Case Review for Enhanced Disability Annuity Benefit, RI 20-123

    Science.gov (United States)

    2013-08-23

    ... Disability Annuity Benefit, RI 20-123 AGENCY: U.S. Office of Personnel Management. ACTION: 60-Day notice and... Disability Annuity Benefit, RI 20-123. As required by the Paperwork Reduction Act of 1995, (Pub. L. 104-13... review the computations of disability annuities to include the formulae provided in law for individuals...

  3. Large short-baseline νμ disappearance

    International Nuclear Information System (INIS)

    Giunti, Carlo; Laveder, Marco

    2011-01-01

    We analyze the LSND, KARMEN, and MiniBooNE data on short-baseline ν μ →ν e oscillations and the data on short-baseline ν e disappearance obtained in the Bugey-3 and CHOOZ reactor experiments in the framework of 3+1 antineutrino mixing, taking into account the MINOS observation of long-baseline ν μ disappearance and the KamLAND observation of very-long-baseline ν e disappearance. We show that the fit of the data implies that the short-baseline disappearance of ν μ is relatively large. We obtain a prediction of an effective amplitude sin 2 2θ μμ > or approx. 0.1 for short-baseline ν μ disappearance generated by 0.2 2 2 , which could be measured in future experiments.

  4. Evaluation of RI images of hepatic blood flow using Tc-99m PMT

    Energy Technology Data Exchange (ETDEWEB)

    Fujiwara, Hiromichi; Iwasaki, Naoya; Ichikawa, Kesato

    1988-03-01

    To evaluate the clinical significance of RI images of hepatic blood flow using Tc-99m-PMT, analysis of the RI images and estimation of hepatic blood flow were carried out in patients with various liver diseases (37 cases). After intravenous injection of Tc-99m-PMT, hepatic accumulation curve of ROI positioned at whole liver area and time activity curve of ROI positioned at celiac artery were obtained through scintillation camera images with the computer-analysed system. Hepatic blood flow coefficient (K) was calculated from the hepatic accumulation curve. Based on the differential curve calculated from the time activity curve, chronological images of arterial, portal, parenchymal and saturated parenchymal phases were obtained. Results ; 1) K was 0.50 + 0.04, 0.35 + 0.02 and 0.26 + 0.04/min in normal type, CH type and LC type respectively. These coefficients well correlated with clinical severity of hepatic diseases. 2) Perfusional phase images of the liver became poorer in accordance with progression of liver disease, while images of spleen, portal venous system and collateral channels were more clearly obtained in liver cirrhosis. This method was shown to have a potential to understanding of severity of liver disease and hepatic blood flow dynamics.

  5. Exploring factors influencing HbA1c and psychosocial outcomes in people with type 1 diabetes after training in advanced carbohydrate counting.

    Science.gov (United States)

    Schmidt, Signe; Vistisen, Dorte; Almdal, Thomas; Hommel, Eva; Nørgaard, Kirsten

    2017-08-01

    The purpose of this secondary analysis of the StenoABC Study was to identify determinants of the changes in HbA1c observed after training of people with type 1 diabetes in advanced carbohydrate counting (ACC) and automated bolus calculator (ABC) use, and further to investigate psychosocial effects of these insulin dosing approaches. Validated diabetes-specific questionnaires were used to assess diabetes treatment satisfaction, problem areas in diabetes, fear of hypoglycemia and diabetes dependent quality of life before and one year after the training. In addition, numeracy was tested (using a non-validated test developed specifically for this study) and behavioral measures (number of daily blood glucose measurements and self-reported use of ACC) were obtained. Associations between change in HbA1c and these measures plus sex, age, diabetes duration and BMI were tested. Numeracy was the only baseline predictor of yearly change in HbA1c identified. Higher levels of numeracy were associated with greater reductions in HbA1c (P=0.031). No associations between change in HbA1c and the behavioral measures investigated were found, nor were any clinically relevant associations between changes in HbA1c and questionnaire scores. Treatment satisfaction increased in all users of ACC (PHbA1c after training in ACC were inversely related to numeracy. Use of an ABC did not compensate for poor numeracy skills. However, device use reduced fear of hypoglycemia compared with ACC without ABC use. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Itaalias vangistati peaprokuröri tappa tahtnud mafioosod / Ülle Toode

    Index Scriptorium Estoniae

    Toode, Ülle, 1969-

    2005-01-01

    Sitsiilias vahistati ligi poolsada maffiaorganisatsiooni Cosa Nostra väidetavat liiget. Politseini oli jõudnud info, et mafioosod kavatsevad lähiajal tappa Palermo peaprokuröri Pietro Grasso, tabamata on Cosa Nostra juht. Lisa: Kohtunik üksi sõjas maffia vastu

  7. The molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory: The DEC-RI-MP2 gradient

    Energy Technology Data Exchange (ETDEWEB)

    Bykov, Dmytro; Kristensen, Kasper; Kjærgaard, Thomas [Department of Chemistry, qLeap Center for Theoretical Chemistry, University of Aarhus, DK-8000 Århus C (Denmark)

    2016-07-14

    We report an implementation of the molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory (DEC-RI-MP2). The new DEC-RI-MP2 gradient method combines the precision control as well as the linear-scaling and massively parallel features of the DEC scheme with efficient evaluations of the gradient contributions using the RI approximation. We further demonstrate that the DEC-RI-MP2 gradient method is capable of calculating molecular gradients for very large molecular systems. A test set of supramolecular complexes containing up to 158 atoms and 1960 contracted basis functions has been employed to demonstrate the general applicability of the DEC-RI-MP2 method and to analyze the errors of the DEC approximation. Moreover, the test set contains molecules of complicated electronic structures and is thus deliberately chosen to stress test the DEC-RI-MP2 gradient implementation. Additionally, as a showcase example the full molecular gradient for insulin (787 atoms and 7604 contracted basis functions) has been evaluated.

  8. The molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory: The DEC-RI-MP2 gradient

    International Nuclear Information System (INIS)

    Bykov, Dmytro; Kristensen, Kasper; Kjærgaard, Thomas

    2016-01-01

    We report an implementation of the molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory (DEC-RI-MP2). The new DEC-RI-MP2 gradient method combines the precision control as well as the linear-scaling and massively parallel features of the DEC scheme with efficient evaluations of the gradient contributions using the RI approximation. We further demonstrate that the DEC-RI-MP2 gradient method is capable of calculating molecular gradients for very large molecular systems. A test set of supramolecular complexes containing up to 158 atoms and 1960 contracted basis functions has been employed to demonstrate the general applicability of the DEC-RI-MP2 method and to analyze the errors of the DEC approximation. Moreover, the test set contains molecules of complicated electronic structures and is thus deliberately chosen to stress test the DEC-RI-MP2 gradient implementation. Additionally, as a showcase example the full molecular gradient for insulin (787 atoms and 7604 contracted basis functions) has been evaluated.

  9. 48 CFR 352.234-1 - Notice of earned value management system-pre-award Integrated Baseline Review.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Notice of earned value management system-pre-award Integrated Baseline Review. 352.234-1 Section 352.234-1 Federal Acquisition... provision: Notice of Earned Value Management System—Pre-Award Integrated Baseline Review (October 2008) The...

  10. The Birth Satisfaction Scale-Revised Indicator (BSS-RI).

    Science.gov (United States)

    Martin, Colin R; Hollins Martin, Caroline; Redshaw, Maggie

    2017-08-29

    The current study sought to develop a short birth satisfaction indicator utilising items from the Birth Satisfaction Scale-Revised (BSS-R) for use as a brief measure of birth satisfaction and as a possible key performance indicator for perinatal service delivery evaluation. Building on the recently developed BSS-R, the study aimed to develop a simplified version of the instrument to assess birth satisfaction easily that could work as a short evaluative measure of clinical service delivery for labour and birth that is consistent with policy documents, placing women at the centre of the birth experience. The six item Birth Satisfaction Scale-Revised Indicator (BSS-RI) was embedded within the 2014 National Maternity Survey for England. A random selection of mothers who had given birth in a two week period in England were surveyed three months after the birth. Using a two-stage design and split-half dataset, exploratory factor analysis, confirmatory factor analysis, internal consistency, convergent, divergent and known-groups discriminant validity evaluation were conducted in a secondary analysis of the survey data. Using this large population based survey of recent mothers the short revised measure was found to comprise two distinct domains of birth satisfaction, 'stress and emotional response to labour and birth' and 'quality of care'. The psychometric qualities of the tool were robust as were the indices of validity and reliability evaluated. The BSS-RI represents a short easily administered and scored measure of women's satisfaction with care and the experience of labour and birth. The instrument is potentially useful for researchers, service evaluation and policy makers.

  11. 76 FR 8725 - Notice of Baseline Filings

    Science.gov (United States)

    2011-02-15

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Notice of Baseline Filings Enstor Grama Ridge Storage and Docket No. PR10-97-002. Transportation, L.L.C.. EasTrans, LLC Docket No. PR10-30-001... revised baseline filing of their Statement of Operating Conditions for services provided under section 311...

  12. Uudised : Tüüri Viiulikontsert Taanis. Lepo Sumera filmimuusika CD. Eesti muusikaauhinnad 2000

    Index Scriptorium Estoniae

    2001-01-01

    E.-S. Tüüri Viiulikontserdi Taani esiettekandest Kopenhaagenis. 2. märtsil esitleti Kinomajas L. Sumera filmimuusika plaati. 3. märtsil andis Eesti Fonogrammitootjate Ühing klubis Decolte üle 2000. a. eesti muusikaauhinnad

  13. Two prospective studies found that elevated 2-hr glucose predicted male mortality independent of fasting glucose and HbA1c.

    NARCIS (Netherlands)

    Qiao, Q.; Dekker, J.M.; Vegt, F. de; Nijpels, G.; Nissinen, A.; Stehouwer, C.D.A.; Bouter, L.M.; Heine, R.J.; Tuomilehto, J.

    2004-01-01

    OBJECTIVE: To quantify the relative contribution of elevated 2-hr glucose, fasting glucose (FPG), and HbA1c to all-cause mortality. STUDY DESIGN AND SETTING: A joint analysis of two prospective studies with baseline glycemia measurements. RESULTS: The multivariate adjusted hazard ratios (HRs)

  14. Two prospective studies found that elevated 2-hr glucose predicted male mortality independent of fasting glucose and HbA1c

    NARCIS (Netherlands)

    Qiao, Qing; Dekker, Jacqueline M; de Vegt, Femmie; Nijpels, Giel; Nissinen, Aulikki; Stehouwer, Coen D A; Bouter, Lex M; Heine, Robert J; Tuomilehto, Jaakko

    OBJECTIVE: To quantify the relative contribution of elevated 2-hr glucose, fasting glucose (FPG), and HbA1c to all-cause mortality. STUDY DESIGN AND SETTING: A joint analysis of two prospective studies with baseline glycemia measurements. RESULTS: The multivariate adjusted hazard ratios (HRs)

  15. Positive effects on hematological and biochemical imbalances in patients with metastatic breast cancer stage IV, of BP-C1, a new anticancer substance

    Directory of Open Access Journals (Sweden)

    Lindkær-Jensen S

    2015-03-01

    Full Text Available Steen Lindkær-Jensen,1 Stig Larsen,2 Nina Habib-Lindkær-Jensen,1 Hans E Fagertun3 1Department of Surgery and Cancer, Hammersmith Hospital Campus, Imperial College, London, UK; 2Center of Epidemiology and Biostatistics, Faculty of Veterinary Medicine, University of Life Science, Oslo, Norway; 3Meddoc Research AS, Skjetten, Norway Abstract: A benzene-poly-carboxylic acid complex with cis-diammineplatinum(II dihydrocholride, BP-C1 is currently used in clinical trials in treating metastatic breast cancer. BP-C1 controls tumor growth with a few mild side-effects, improving quality of life.Methods: The data consisted of prospectively collected laboratory results from 47 patients in two controlled clinical trials of daily intramuscular injections of BP-C1 for 32 days. Study I was performed as an open, nonrandomized, Phase I dose–response, multicenter study with a three-level, between-patient, response surface pathway design. The second study was a randomized, double-blind, and placebo-controlled, multicenter study with a stratified semi-crossover design.Results: Hemoglobin (Hb and hematocrit (Hct increased significantly (P<0.01 during BP-C1 treatment, while red blood cell (RBC count increased but not significantly. The most pronounced increase in Hb, RBC, Hct, and white blood cell (WBC was in anemic patients (P≤0.01. WBC count and neutrophils increased significantly (P=0.01 in the overall data. WBCs and neutrophils (P<0.01, eosinophils (P=0.05 and monocytes (P<0.01 increased significantly and markedly in patients with lowest baseline levels. Additionally, low levels of thrombocytes significantly increased. No changes in liver parameters, amylase, glucose, creatinine, or albumin, were detected except for albumin in the subgroup with low baseline levels, where levels increased significantly (P=0.04. An increase in K+, Ca2+, and PO43- was most pronounced in patients with low baseline levels (P≤0.02. A similar pattern detected for Mg2+, prothrombin

  16. Nõukogu kinnitas Türi kolledži õppetöö kolimise Tartusse

    Index Scriptorium Estoniae

    2010-01-01

    Novembrikuu istungil otsustas TÜ nõukogu Türi kolledžis oleva keskkonnakorralduse ja planeerimise õppekava liita Tartus loodus- ja tehnoloogiateaduskonna (LOTE) juurde. TÜ peahoone ees protestisid selle kava vastu kolledži üliõpilased

  17. Optimal screening interval for men with low baseline prostate-specific antigen levels (≤1.0 ng/mL) in a prostate cancer screening program.

    Science.gov (United States)

    Urata, Satoko; Kitagawa, Yasuhide; Matsuyama, Satoko; Naito, Renato; Yasuda, Kenji; Mizokami, Atsushi; Namiki, Mikio

    2017-04-01

    To optimize the rescreening schedule for men with low baseline prostate-specific antigen (PSA) levels, we evaluated men with baseline PSA levels of ≤1.0 ng/mL in PSA-based population screening. We enrolled 8086 men aged 55-69 years with baseline PSA levels of ≤1.0 ng/mL, who were screened annually. The relationships of baseline PSA and age with the cumulative risks and clinicopathological features of screening-detected cancer were investigated. Among the 8086 participants, 28 (0.35 %) and 18 (0.22 %) were diagnosed with prostate cancer and cancer with a Gleason score (GS) of ≥7 during the observation period, respectively. The cumulative probabilities of prostate cancer at 12 years were 0.42, 1.0, 3.4, and 4.3 % in men with baseline PSA levels of 0.0-0.4, 0.5-0.6, 0.7-0.8, and 0.9-1.0 ng/mL, respectively. Those with GS of ≥7 had cumulative probabilities of 0.42, 0.73, 2.8, and 1.9 %, respectively. The cumulative probabilities of prostate cancer were significantly lower when baseline PSA levels were 0.0-0.6 ng/mL compared with 0.7-1.0 ng/mL. Prostate cancer with a GS of ≥7 was not detected during the first 10 years of screening when baseline PSA levels were 0.0-0.6 ng/mL and was not detected during the first 2 years when baseline PSA levels were 0.7-1.0 ng/mL. Our study demonstrated that men with baseline PSA levels of 0.0-0.6 ng/mL might benefit from longer screening intervals than those recommended in the guidelines of the Japanese Urological Association. Further investigation is needed to confirm the optimal screening interval for men with low baseline PSA levels.

  18. Dicty_cDB: AFJ307 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *nsf ml*fiigtinlfillfkmekiykrsnlfkskgylwwyndvisssyfiidpfsrlssikd* ckikerifikyknn*ri*km*snfis*scyfsxknknnnnnn...irs*i*nsf ml*fiigtinlfillfkmekiykrsnlfkskgylwwyndvisssyfiidpfsrlssikd* ckikerifikyknn*ri*km*snfis*scyfsxknkn

  19. Baseline risk assessment for groundwater operable units at the Chemical Plant Area and the Ordnance Works Area, Weldon Spring, Missouri

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-07-14

    The U.S. Department of Energy (DOE) and the U.S. Department of the Army (DA) are evaluating conditions in groundwater and springs at the DOE chemical plant area and the DA ordnance works area near Weldon Spring, Missouri. The two areas are located in St. Charles County, about 48 km (30 mi) west of St. Louis. The 88-ha (217-acre) chemical plant area is chemically and radioactively contaminated as a result of uranium-processing activities conducted by the U.S. Atomic Energy Commission in the 1950s and 1960s and explosives-production activities conducted by the U.S. Army (Army) in the 1940s. The 6,974-ha (17,232-acre) ordnance works area is primarily chemically contaminated as a result of trinitrotoluene (TNT) and dinitrotoluene (DNT) manufacturing activities during World War II. This baseline risk assessment (BRA) is being conducted as part of the remedial investigation/feasibility study (RUFS) required under the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) of 1980, as amended. The purpose of the BRA is to evaluate potential human health and ecological impacts from contamination associated with the groundwater operable units (GWOUs) of the chemical plant area and ordnance works area. An RI/FS work plan issued jointly in 1995 by the DOE and DA (DOE 1995) analyzed existing conditions at the GWOUs. The work plan included a conceptual hydrogeological model based on data available when the report was prepared; this model indicated that the aquifer of concern is common to both areas. Hence, to optimize further data collection and interpretation efforts, the DOE and DA have decided to conduct a joint RI/BRA. Characterization data obtained from the chemical plant area wells indicate that uranium is present at levels slightly higher than background, with a few concentrations exceeding the proposed U.S. Environmental Protection Agency (EPA) maximum contaminant level (MCL) of 20 {micro}g/L (EPA 1996c). Concentrations of other radionuclides (e

  20. Two-dimensional echocardiographic and RI angiographic features of aneurysm of the ascending aorta in patients with annuloaortic ectasia

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, K.; Suzuki, S.; Satomi, G. (Tokyo Women' s Medical Coll. (Japan). Heart Inst. and Hospital)

    1981-03-01

    The purpose of this study was to compare the diagnostic value of two-dimensional echocardiography with that of other methods in the detection and localization of aneurysm involving the ascending aorta in patients with annuloaortic ectasia. Two-dimensional echocardiography, RI angiography, CT scan and aortography were performed in 19 patients (12 patients with Marfan's syndrome, 4 with aortitis syndrome and 3 with postoperative perivalvular aneurysm). Eight of 12 patients with Marfan's syndrome had dissection in the ascending aorta which was confirmed at surgery or autopsy. The following observations were obtained. 1) Dissection of the ascending aorta was clearly demonstrated on the two-dimensional echocardiogram in 7 patients by recording the intinal tear and flap, and in these cases the short axis two-dimensional echocardiogram of the ascending aorta was more useful in identifying the site and extent of dissection. 2) In patients with postoperative perivalvular aneurysms, RI angiography proved to be a more useful and sensitive technique in differentiating a leakage into the aneurysm from clots in the aneurysm. 3) CT scanning proved to be an insensitive technique to detect dissection of the ascending aneurysm and to differentiate a leakage from clots in the perivalvular aneurysm. From these observations, we concluded that two-dimensional echocardiography and RI angiography proved to be sensitive techniques in detecting dissection of the ascending aneurysm and evaluating a postoperative aneurysm in patients with annuloaortic ectasia.

  1. HindIII RFLP on chromosome 8 detected with a calbindin 27 kDa cDNA probe, HBSC21

    Energy Technology Data Exchange (ETDEWEB)

    Parmentier, M; Vassart, G

    1988-10-11

    A 1.8 kb for EcoRI fragment of the human calbindin cDNA clone HBSC21 was subcloned into M13mp18 and used as a probe. HindIII identifies a 2 allele polymorphism with a band at 4.7 kb (A1) and a band at 4.3 kb (A2). A constant band is located at 5.3 kb. The calbindin 27 kDa gene was assigned to chromosome 8 using chinese hamster-human and mouse-human cell hybrids. Co-dominant segregation was demonstrated in 3 families (total of 20 individuals).

  2. Nuclear structure physics at RI beam factory

    International Nuclear Information System (INIS)

    Otsuka, Takaharu

    1998-01-01

    The nuclear structure physics is becoming extremely interesting owing to recent development of RI beam factories. Among various interesting developments in this field, I will focus upon two subjects. One is the breaking of the usual magic numbers in unstable nuclei, and the other is the invention of a new method for quantum many-body problems: Quantum Monte Carlo diagonalization method (QMCD). For the first subject, I will discuss the vanishing of N=8 and 20 magic numbers in 11 Li and 32 Mg, respectively. For the latter, I will present brief description of the theory and results of some applications including the one to 64 Ge, a proton-rich unstable nucleus. (author)

  3. Dicty_cDB: SFD826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SLASINVNEASLIKLT FKQTDRTNEEVLPIIVSYQSPSTPTEFTNNNNNYYYYNYYQ*yn*rritknnkftnq*ri ln*ipkq*wfttisnnyfstnttinkf*cfnsnygh...DRTNEEVLPIIVSYQSPSTPTEFTNNNNNYYYYNYYQ*yn*rritknnkftnq*ri ln*ipkq*wfttisnnyfstnttinkf*cfnsnygh*ftis*kcrkitni*

  4. Genomic Locus Modulating IOP in the BXD RI Mouse Strains

    Directory of Open Access Journals (Sweden)

    Rebecca King

    2018-05-01

    Full Text Available Intraocular pressure (IOP is the primary risk factor for developing glaucoma, yet little is known about the contribution of genomic background to IOP regulation. The present study leverages an array of systems genetics tools to study genomic factors modulating normal IOP in the mouse. The BXD recombinant inbred (RI strain set was used to identify genomic loci modulating IOP. We measured the IOP in a total of 506 eyes from 38 different strains. Strain averages were subjected to conventional quantitative trait analysis by means of composite interval mapping. Candidate genes were defined, and immunohistochemistry and quantitative PCR (qPCR were used for validation. Of the 38 BXD strains examined the mean IOP ranged from a low of 13.2mmHg to a high of 17.1mmHg. The means for each strain were used to calculate a genome wide interval map. One significant quantitative trait locus (QTL was found on Chr.8 (96 to 103 Mb. Within this 7 Mb region only 4 annotated genes were found: Gm15679, Cdh8, Cdh11 and Gm8730. Only two genes (Cdh8 and Cdh11 were candidates for modulating IOP based on the presence of non-synonymous SNPs. Further examination using SIFT (Sorting Intolerant From Tolerant analysis revealed that the SNPs in Cdh8 (Cadherin 8 were predicted to not change protein function; while the SNPs in Cdh11 (Cadherin 11 would not be tolerated, affecting protein function. Furthermore, immunohistochemistry demonstrated that CDH11 is expressed in the trabecular meshwork of the mouse. We have examined the genomic regulation of IOP in the BXD RI strain set and found one significant QTL on Chr. 8. Within this QTL, there is one good candidate gene, Cdh11.

  5. 3D Scrape-off layer modelling with BoRiS

    International Nuclear Information System (INIS)

    Riemann, J.; Borchardt, M.; Schneider, R.; Mutzke, A.

    2005-01-01

    The 3D fluid transport code BoRiS is applied to a hydrogen plasma and a neutral fluid in a stellarator-like geometry equipped with a poloidal ring limiter. The results demonstrate the capability of dealing with 3D effects which can be related to both the influence of the geometry and the plasma-neutral interaction as well. The setup used has similarities with a poloidal gas target in a fusion device

  6. Characterization of the virus-cell interactions by HIV-1 subtype C variants from an antiretroviral therapy-naïve subject with baseline resistance to the CCR5 inhibitor maraviroc

    DEFF Research Database (Denmark)

    Jakobsen, Martin Roelsgaard

    The CCR5 inhibitor maraviroc (MVC) exerts its antiviral activity by binding to- and altering the conformation of the CCR5 extracellular loops such that HIV-1 gp120 no longer recognizes CCR5. Viruses that have become resistant to MVC through long-term in vitro culture, or from treatment failure...... in vivo, can use the MVCbound form of CCR5 for HIV-1 entry via adaptive alterations in gp120. Partial baseline resistance to another CCR5 inhibitor through this mechanism, AD101, has been noted recently in one subject (1). Here, we identified and characterized envelope (Env) clones with baseline...

  7. Dicty_cDB: Contig-U16580-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.0 10 ( DQ015713 ) Chlamydomonas chlamydogama strain UTEX 102 26S ri... 375 0.0 9 ( EU272562 ) Eudendrium racemosum voucher persona...A gene, part... 420 0.0 9 ( EU272561 ) Ectopleura dumortieri voucher personal:A. Lindner... 396 0.0 10 ( AY0...0 9 ( EU272552 ) Clava multicornis voucher personal:P. Schuchert:S... 396 0.0 9 ( EU272549 ) Bougainvillia carolinensis voucher perso... l... 396 0.0 9 ( EU272571 ) Koellikerina fasciculata voucher personal:P. Schu...... ribosoma... 357 0.0 10 ( EU272574 ) Lizzia blondina voucher personal:P. Schuchert:Sch... 396 0.0 9 ( EU2725

  8. Valitsus tahab kaotada üüri piirmäärad / Anne Oja

    Index Scriptorium Estoniae

    Oja, Anne, 1970-

    2004-01-01

    Valitsus kiitis heaks eelnõu üüri piirmäärade kaotamise kohta. Tallinna linnavalitsus on piirmäärade kaotamise vastu, kuna see halvendaks abilinnapea Aivar Pärna sõnul oluliselt sundüürnike olukorda

  9. Tagakiusamine ja kirjutamiskunst / Leo Strauss ; järelsõna Jüri Lipping

    Index Scriptorium Estoniae

    Strauss, Leo, 1899-1973

    2000-01-01

    Ajalooliste tekstide ridade vahele peidetud sõnumi lugemisest. Tsensuuri mõjust filosoofilistele tekstidele. Peidetud sõnumi lugemisest lähtuvast erinevusest eelmoodsate ja uusaegsete filosoofide teostes. Jüri Lipping'u järelsõna Leo Straussi filosoofilistest vaadetest.

  10. Updated global 3+1 analysis of short-baseline neutrino oscillations

    Science.gov (United States)

    Gariazzo, S.; Giunti, C.; Laveder, M.; Li, Y. F.

    2017-06-01

    We present the results of an updated fit of short-baseline neutrino oscillation data in the framework of 3+1 active-sterile neutrino mixing. We first consider ν e and {\\overline{ν}}_e disappearance in the light of the Gallium and reactor anomalies. We discuss the implications of the recent measurement of the reactor {\\overline{ν}}_e spectrum in the NEOS experiment, which shifts the allowed regions of the parameter space towards smaller values of | U e4|2. The β-decay constraints of the Mainz and Troitsk experiments allow us to limit the oscillation length between about 2 cm and 7 m at 3 σ for neutrinos with an energy of 1 MeV. The corresponding oscillations can be discovered in a model-independent way in ongoing reactor and source experiments by measuring ν e and {\\overline{ν}}_e disappearance as a function of distance. We then consider the global fit of the data on short-baseline {}_{ν_{μ}}^{(-)}{\\to}_{ν_e}^{(-)} transitions in the light of the LSND anomaly, taking into account the constraints from {}_{ν_e}^{(-)} and {}_{ν_{μ}}^{(-)} disappearance experiments, including the recent data of the MINOS and IceCube experiments. The combination of the NEOS constraints on | U e4|2 and the MINOS and IceCube constraints on | U μ4|2 lead to an unacceptable appearance-disappearance tension which becomes tolerable only in a pragmatic fit which neglects the MiniBooNE low-energy anomaly. The minimization of the global χ 2 in the space of the four mixing parameters Δ m 41 2 , | U e4|2, | U μ4|2, and | U τ4|2 leads to three allowed regions with narrow Δ m 41 2 widths at Δ m 41 2 ≈ 1.7 (best-fit), 1.3 (at 2 σ), 2.4 (at 3 σ) eV2. The effective amplitude of short-baseline {}_{ν_{μ}}^{(-)}{\\to}_{ν_e}^{(-)} oscillations is limited by 0.00048 ≲ sin2 2 ϑ eμ ≲ 0.0020 at 3 σ. The restrictions of the allowed regions of the mixing parameters with respect to our previous global fits are mainly due to the NEOS constraints. We present a comparison of the

  11. Positron Emission Tomographic Imaging of the Cannabinoid Type 1 Receptor System with [11C]OMAR ([11C]JHU75528: Improvements in Image Quantification Using Wild-Type and Knockout Mice

    Directory of Open Access Journals (Sweden)

    Raúl Herance

    2011-11-01

    Full Text Available In this study, we assessed the feasibility of using positron emission tomography (PET and the tracer [11C]OMAR ([11C]JHU75528, an analogue of rimonabant, to study the brain cannabinoid type 1 (CB1 receptor system. Wild-type (WT andCB1 knockout (KO animals were imaged at baseline and after pretreatment with blocking doses of rimonabant. Brain uptake in WT animals was higher (50% than in KO animals in baseline conditions. After pretreatment with rimonabant, WT uptake lowered to the level of KO animals. The results of this study support the feasibility of using PET with the radiotracer [11C]JHU75528 to image the brain CB1 receptor system in mice. In addition, this methodology can be used to assess the effect of new drugs in preclinical studies using genetically manipulated animals.

  12. RiSKi: A Framework for Modeling Cyber Threats to Estimate Risk for Data Breach Insurance

    OpenAIRE

    Panou, Angeliki; Ntantogian, Christoforos; Xenakis, Christos

    2017-01-01

    Historically, the financial benefits of cyber security investments have not been calculated with the same financial discipline used to evaluate other material investments. This was mainly due to a lack of readily available data on cyber incidents impacts and systematic methodology to support the efficacy of cyber investments. In this paper we propose an innovative, cyber investment management framework named RiSKi that incorporates detection and continuous monitoring of insiders societal beha...

  13. Radioiodine therapy of Graves' disease - a dosimetric comparison of different strategies concerning antithyroid drugs; Radioiodtherapie des Morbus Basedow - dosimetrischer Vergleich verschiedener Therapieregime bezueglich der Thyreostatikabgabe

    Energy Technology Data Exchange (ETDEWEB)

    Urbannek, V.; Voth, E.; Moka, D.; Schicha, H. [Klinik und Poliklinik fuer Nuklearmedizin, Medizinische Einrichtungen der Univ. zu Koeln (Germany)

    2001-08-01

    Aim: Premedication with antithyroid drugs (ATD) compared to patients not pretreated with ATD causes a higher failure rate of radioiodine therapy (RITh) or demands higher therapeutical dosage of radioiodine (RI). For clinical reasons and because of accelerated iodine metabolism in hyperthyreosis a compensated thyroid metabolism is desirable. Aim of this study was to investigate the influence of ATD on the biokinetics of RI in case of Graves' disease in order to improve RITh of patients pre-treated with ATD. Methods: 385 consecutive patients who underwent RITh because of Graves' disease for the first time were included: Group A (n = 74): RITh under continuous medication with ATD; Group B (n = 111): Application of RI under continuous medication with ATD, in case of insufficient RI-uptake or shortened effective RI-half-life ATD were stopped 1-5 days after RITh; Group C (n = 200): ATD were stopped 2 days prior to RITh in all patients. We examined the influence of ATD on RI-uptake and effective RI-half-life as well as the absorbed dose achieved on the thyroid in dependence of thyroid volume and applied RI-dosage [TEQ - therapy efficiency quotient, (2)]. Results: In the RI-pretest (all patients under ATD) the RI-uptake was comparable in all three groups. During RITh-RI-uptake, effective RI-half-life and therefore the TEQ were significantly higher in Group C as compared to Groups A and B (p<0,001, respectively). In Group B the medication with ATD was stopped in 61 of 111 cases 1-5 days after RITh. In this subgroup the effective RI-half-life increased from 4,4 {+-} 1,7 d to 5,1 {+-} 1,6 d after stopping of ATD (p = 0,001). Conclusion: Stopping of ATD 2 days prior to RITh leads to an increased efficiency of about 50% compared to RITh carried out under ATD and therefore to a clear reduction of radiation exposure to the rest of the body with equal absorbed doses of the thyroid. Stopping of ATD shortly after RITh increases efficiency in case of short effective RI

  14. Led Astray by Hemoglobin A1c

    Directory of Open Access Journals (Sweden)

    Jean Chen MD

    2016-01-01

    Full Text Available Hemoglobin A1c (A1c is used frequently to diagnose and treat diabetes mellitus. Therefore, it is important be aware of factors that may interfere with the accuracy of A1c measurements. This is a case of a rare hemoglobin variant that falsely elevated a nondiabetic patient’s A1c level and led to a misdiagnosis of diabetes. A 67-year-old male presented to endocrine clinic for further management after he was diagnosed with diabetes based on an elevated A1c of 10.7%, which is approximately equivalent to an average blood glucose of 260 mg/dL. Multiple repeat A1c levels remained >10%, but his home fasting and random glucose monitoring ranged from 92 to 130 mg/dL. Hemoglobin electrophoresis and subsequent genetic analysis diagnosed the patient with hemoglobin Wayne, a rare hemoglobin variant. This variant falsely elevates A1c levels when A1c is measured using cation-exchange high-performance liquid chromatography. When the boronate affinity method was applied instead, the patient’s A1c level was actually 4.7%. Though hemoglobin Wayne is clinically silent, this patient was erroneously diagnosed with diabetes and started on an antiglycemic medication. Due to this misdiagnosis, the patient was at risk of escalation in his “diabetes management” and hypoglycemia. Therefore, it is important that providers are aware of factors that may result in hemoglobin A1c inaccuracy including hemoglobin variants.

  15. Utilities and offsites design baseline. Outside Battery Limits Facility 6000 tpd SRC-I Demonstration Plant. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    None

    1984-05-25

    As part of the overall Solvent Refined Coal (SRC-1) project baseline being prepared by International Coal Refining Company (ICRC), the RUST Engineering Company is providing necessary input for the Outside Battery Limits (OSBL) Facilities. The project baseline is comprised of: design baseline - technical definition of work; schedule baseline - detailed and management level 1 schedules; and cost baseline - estimates and cost/manpower plan. The design baseline (technical definition) for the OSBL Facilities has been completed and is presented in Volumes I, II, III, IV, V and VI. The OSBL technical definition is based on, and compatible with, the ICRC defined statement of work, design basis memorandum, master project procedures, process and mechanical design criteria, and baseline guidance documents. The design basis memorandum is included in Paragraph 1.3 of Volume I. The baseline design data is presented in 6 volumes. Volume I contains the introduction section and utility systems data through steam and feedwater. Volume II continues with utility systems data through fuel system, and contains the interconnecting systems and utility system integration information. Volume III contains the offsites data through water and waste treatment. Volume IV continues with offsites data, including site development and buildings, and contains raw materials and product handling and storage information. Volume V contains wastewater treatment and solid wastes landfill systems developed by Catalytic, Inc. to supplement the information contained in Volume III. Volume VI contains proprietary information of Resources Conservation Company related to the evaporator/crystallizer system of the wastewater treatment area.

  16. Kuidas käib kultuuri suurandmete äri maailmas? / Indrek Ibrus

    Index Scriptorium Estoniae

    Ibrus, Indrek

    2016-01-01

    Septembri lõpus Eestis toimuvast konverentsist "Culture 4D: Digitisation, Data, Disruptions, Diversity", mille korraldavad Euroopa Nõukogu, kultuuriministeerium ja Tallinna Ülikool. Konverentsi tähelepanu keskmes on kultuurivaldkonna suurandmete majandamine, suurandmete äri, andmete kasutamine üldiseks hüvanguks ning kultuuri digiteerimisega kaasnevad väljakutsed

  17. Jukose kriis toob äikesepilved vaguniäri kohale / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2004-01-01

    Russian Estonian Rail Services AS - kõige konkurentsivõimelisem transpordi-, side- ja logistikaettevõtete hulgas, Hansapanga kõrgepalgalise eksportööri eriauhinna laureaat. Lisa: Russian Estonian Rail Services 2003. Kommenteerib Indrek Neivelt. Tabel: Transpordi-, side- ja logistikaettevõtted

  18. Is more lordosis associated with improved outcomes in cervical laminectomy and fusion when baseline alignment is lordotic?

    Science.gov (United States)

    Sielatycki, John A; Armaghani, Sheyan; Silverberg, Arnold; McGirt, Matthew J; Devin, Clinton J; O'Neill, Kevin

    2016-08-01

    In cervical spondylotic myelopathy (CSM), cervical sagittal alignment (CSA) is associated with disease severity. Increased kyphosis and C2-C7 sagittal vertical axis (SVA) correlate with worse myelopathy and poor outcomes. However, when alignment is lordotic, it is unknown whether these associations persist. The study aimed to investigate the associations between CSA parameters and patient-reported outcomes (PROs) following posterior decompression and fusion for CSM when baseline lordosis is maintained. This is an analysis of a prospective surgical cohort at a single academic institution. The sample includes adult patients undergoing primary cervical laminectomy and fusion for CSM over a 3-year period. The PROs included EuroQol-5D, Short-Form-12 (SF-12) physical composite (PCS) and mental composite scales (MCS), Neck Disability Index, and the modified Japanese Orthopaedic Association scores. Radiographic CSA parameters measured included C1-C2 Cobb, C2-C7 Cobb, C1-C7 Cobb, C2-C7 SVA, C1-C7 SVA, and T1 slope. The PROs were recorded at baseline and at 3 and 12 months postoperatively. The CSA parameters were measured on standing radiographs in the neutral position at baseline and 3 months. Wilcoxon rank test was used to test for changes in PROs and CSA parameters, and Pearson correlation coefficients were calculated for CSA parameters and PROs preoperatively and at 12 months. No external sources of funding were used for this work. There were 45 patients included with an average age of 63 years who underwent posterior decompression and fusion of 3.7±1.3 levels. Significant improvements were found in all PROs except SF-12 MCS (p=.06). Small but statistically significant changes were found in C2-C7 Cobb (mean change: +3.6°; p=.03) and C2-C7 SVA (mean change: +3 mm; p=.01). At baseline, only C2-C7 SVA associated with worse SF-12 PCS scores (r=-0.34, p=.02). Postoperatively, there were no associations found between PROs and any CSA parameters. Similarly, no CSA

  19. 76 FR 50771 - Submission for Review: RI 25-37, Evidence To Prove Dependency of a Child, 3206-0206

    Science.gov (United States)

    2011-08-16

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: RI 25-37, Evidence To Prove Dependency of a...) 3206-0206, Evidence to Prove Dependency of a Child. As required by the Paperwork Reduction Act of 1995... or faxed to (202) 395-6974. SUPPLEMENTARY INFORMATION: Evidence to Prove Dependency of a Child is...

  20. Evidences for balancing selection from PAH-BglII and PAH-EcoRI polymorphisms in Isfahan population

    Directory of Open Access Journals (Sweden)

    Zahra Fazeli Attar

    2010-01-01

    Full Text Available Two polymorphic markers including BglII and EcoRI, were identified at intron 1 and intron 5 of PAH gene. In order to test whether these polymorphisms are behaving as neutral alleles or are being subjected to selective pressures in Isfahan population, 110 individuals were genotyped by PCR-RFLP. The Arlequin input file was prepared by use of phase-known haplotype data and Neutrality tests (Tajima D test and Fu’s Fs test were done using Arlequin program. 42 individuals were found heterozygous for both polymorphisms whose haplotype phase remained unknown. The BglII-EcoRI haplotype phase was known only at 68 individuals who were used for preparation of input file. Tajima's D value and Fs value at Isfahan population were 1.7 and 1.02, respectively. Positive values of Fs and D>0 indicated that these polymorphisms are under selection pressure at Isfahan population. Although these polymorphisms were in the non-coding region of PAH gene, but these were not neutral alleles and positive values of these tests provided evidence for balancing selection of these polymorphisms at Isfahan population. The results of this study could improve our understanding of evolutionary history and structure of Isfahan population.

  1. Establishing a store baseline during interim storage of waste packages and a review of potential technologies for base-lining

    Energy Technology Data Exchange (ETDEWEB)

    McTeer, Jennifer; Morris, Jenny; Wickham, Stephen [Galson Sciences Ltd. Oakham, Rutland (United Kingdom); Bolton, Gary [National Nuclear Laboratory Risley, Warrington (United Kingdom); McKinney, James; Morris, Darrell [Nuclear Decommissioning Authority Moor Row, Cumbria (United Kingdom); Angus, Mike [National Nuclear Laboratory Risley, Warrington (United Kingdom); Cann, Gavin; Binks, Tracey [National Nuclear Laboratory Sellafield (United Kingdom)

    2013-07-01

    Interim storage is an essential component of the waste management lifecycle, providing a safe, secure environment for waste packages awaiting final disposal. In order to be able to monitor and detect change or degradation of the waste packages, storage building or equipment, it is necessary to know the original condition of these components (the 'waste storage system'). This paper presents an approach to establishing the baseline for a waste-storage system, and provides guidance on the selection and implementation of potential base-lining technologies. The approach is made up of two sections; assessment of base-lining needs and definition of base-lining approach. During the assessment of base-lining needs a review of available monitoring data and store/package records should be undertaken (if the store is operational). Evolutionary processes (affecting safety functions), and their corresponding indicators, that can be measured to provide a baseline for the waste-storage system should then be identified in order for the most suitable indicators to be selected for base-lining. In defining the approach, identification of opportunities to collect data and constraints is undertaken before selecting the techniques for base-lining and developing a base-lining plan. Base-lining data may be used to establish that the state of the packages is consistent with the waste acceptance criteria for the storage facility and to support the interpretation of monitoring and inspection data collected during store operations. Opportunities and constraints are identified for different store and package types. Technologies that could potentially be used to measure baseline indicators are also reviewed. (authors)

  2. Eluruumi üürniku õiguste kaitse üüri ühepoolse suurendamise ja ebamõistliku suuruse korral : [bakalaureusetöö] / Martin Kalberg ; Tartu Ülikooli Õigusinstituut ; juhendaja: Kalev Saare

    Index Scriptorium Estoniae

    Kalberg, Martin

    2006-01-01

    Üüri suuruse ajalooline ülevaade ja võrdlus, üüri suurus eluruumi üürilepingu olulise osana, üüri ühepoolse suurendamise võimalused, üürniku vaidlustamisvõimalused üüri suurendamise korral

  3. Biosorption of Congo Red from aqueous solution by Bacillus weihenstephanensis RI12; effect of SPB1 biosurfactant addition on biodecolorization potency.

    Science.gov (United States)

    Mnif, Inès; Fendri, Raouia; Ghribi, Dhouha

    2015-01-01

    Bacillus weihenstephanensis RI12, isolated from hydrocarbon contaminated soil, was assessed for Congo Red bio-treatment potency. Results suggested the potential of this bacterium for use in effective treatment of Congo Red contaminated wastewaters under shaking conditions at acidic and neutral pH value. The strain could tolerate higher doses of dyes as it could decolorize up to 1,000 mg/l of Congo Red. When used as microbial surfactant to enhance Congo Red biodecolorization, Bacillus subtilis SPB1-derived lipopeptide accelerated the decolorization rate and maximized the decolorization efficiency at an optimal concentration of biosurfactant of about 0.075%. Studies ensured that Congo Red removal by this strain could be due to an adsorption phenomena. Germination potencies of tomato seeds using the treated dyes under different conditions showed the efficient biotreatment of the azo dye Congo Red especially with the addition of SPB1 biosurfactant. To conclude, the addition of SPB1 bioemulsifier reduced energy costs by reducing the effective decolorization period; the biosurfactant stimulated bacterial decolorization method may provide a highly efficient, inexpensive and time-saving procedure in the treatment of textile effluents.

  4. Tulevane linnapea kavandab kainestusmaja ja Kalevipoega / Jüri Ratas ; interv. Urmas Seaver

    Index Scriptorium Estoniae

    Ratas, Jüri, 1978-

    2005-01-01

    Ilmunud ka: Postimees : na russkom jazõke 14. nov., lk 6. Tõenäoline Tallinna linnapea kandidaat vastab küsimustele, mis puudutavad uue linnavalitsuse esimest istungit, pealinna 2006. aasta eelarvet ning Keskerakonna valimislubadusi linna valitsemisel. Lisa: Jüri Ratas

  5. The Role of Metformin Response in Lipid Metabolism in Patients with Recent-Onset Type 2 Diabetes: HbA1c Level as a Criterion for Designating Patients as Responders or Nonresponders to Metformin.

    Directory of Open Access Journals (Sweden)

    Zahra Kashi

    Full Text Available In this study, we investigated whether response to metformin, the most frequently drug for diabetes treatment, influences the therapeutic effects of antilipidemic medication in newly diagnosed patients with type 2 diabetes mellitus (T2DM.A total of 150 patients with T2DM were classified into two groups following 3 months of metformin therapy (1000 mg twice daily: responders (patients showing ≥1% reduction in HbA1c from baseline and nonresponders (patients showing <1% reduction in HbA1c from baseline. The patients received atorvastatin 20 mg, gemfibrozil 300 mg, or atorvastatin 20 mg and gemfibrozil 300 mg daily.HbA1c and fasting glucose levels were significantly different between baseline and 3 months among responders receiving atorvastatin; however, these differences were not statistically significant in nonresponders. Atherogenic ratios of low-density lipoprotein cholesterol to high-density lipoprotein cholesterol (LDL-C/HDL-C; p = 0.002, total cholesterol to HDL-C (TC/HDL-C; p<0.001 and AIP (the atherogenic index of plasma; p = 0.004 decreased significantly in responders receiving atorvastatin than in nonresponders. Moreover, responders receiving atorvastatin showed a significant increase in HDL-C levels but nonresponders receiving atorvastatin did not (p = 0.007. The multivariate model identified a significant association between metformin response (as the independent variable and TG, TC, HDL-C and LDL-C (dependent variables; Wilk's λ = 0.927, p = 0.036.Metformin response affects therapeutic outcomes of atorvastatin on atherogenic lipid markers in patients newly diagnosed with T2DM. Metformin has a greater impact on BMI in responders of metformin compared to nonresponders. Adoption of better therapeutic strategies for reducing atherogenic lipid markers may be necessary for metformin nonresponders.

  6. Integrating Research-Informed Teaching within an Undergraduate Level 4 (Year 1) Diagnostic Radiography Curriculum: A Pilot Study

    Science.gov (United States)

    Higgins, Robert; Hogg, Peter; Robinson, Leslie

    2013-01-01

    This article discusses the piloting and evaluation of the Research-informed Teaching experience (RiTe) project. The aim of RiTe was to link teaching and learning with research within an undergraduate diagnostic radiography curriculum. A preliminary pilot study of RiTe was undertaken with a group of level 4 (year 1) volunteer BSc (Hons) diagnostic…

  7. Baseline sensitivity of lepidopteran corn pests in India to Cry1Ab insecticidal protein of Bacillus thuringiensis.

    Science.gov (United States)

    Jalali, Sushil K; Lalitha, Yadavalli; Kamath, Subray P; Mohan, Komarlingam S; Head, Graham P

    2010-08-01

    Genetically engineered corn (Bt corn) expressing Bacillus thuringiensis Berliner insecticidal protein Cry1Ab is a biotechnological option being considered for management of lepidopteran corn pests in India. As a resistance management practice it was essential to determine the sensitivity of multiple populations of the stalk borer Chilo partellus (Swinhoe), pink borer Sesamia inferens (Walker) and the cob borer Helicoverpa armigera (Hübner) to Cry1Ab protein through bioassays. The insect populations were collected during growing seasons of Rabi 2005 (October 2005 to February 2006) and Kharif 2006 (May to September 2006). Multiple populations of the three lepidopteran corn pests were found to be susceptible to Cry1Ab. Median lethal concentrations (LC(50)) ranged between 0.008 and 0.068 microg Cry1Ab mL(-1) diet for 18 populations of C. partellus (across two seasons), between 0.12 and 1.99 microg mL(-1) for seven populations of H. armigera and between 0.46 and 0.56 microg mL(-1) for two populations of S. inferens. Dose-response concentrations for lethality and growth inhibition have been determined to mark baseline sensitivity of multiple populations of key lepidopteran corn pests in India to Cry1Ab protein. These benchmark values will be referenced while monitoring resistance to Cry1Ab should Bt corn hybrids expressing Cry1Ab be approved for commercial cultivation in India. Copyright (c) 2010 Society of Chemical Industry.

  8. Baseline risk assessment for the groundwater operable units at the Chemical Plant Area and the Ordnance Works Area, Weldon Spring, Missouri

    International Nuclear Information System (INIS)

    1999-01-01

    The U.S. Department of Energy (DOE) and the U.S. Department of the Army (DA) are evaluating conditions in groundwater and springs at the DOE chemical plant area and the DA ordnance works area near Weldon Spring, Missouri. The two areas are located in St. Charles County, about 48 km (30 mi) west of St. Louis. The 88-ha (217-acre) chemical plant area is chemically and radioactively contaminated as a result of uranium-processing activities conducted by the U.S. Atomic Energy Commission in the 1950s and 1960s and explosives-production activities conducted by the U.S. Army (Army) in the 1940s. The 6,974-ha (17,232-acre) ordnance works area is primarily chemically contaminated as a result of trinitrotoluene (TNT) and dinitrotoluene (DNT) manufacturing activities during World War II. This baseline risk assessment (BRA) is being conducted as part of the remedial investigation/feasibility study (RUFS) required under the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) of 1980, as amended. The purpose of the BRA is to evaluate potential human health and ecological impacts from contamination associated with the groundwater operable units (GWOUs) of the chemical plant area and ordnance works area. An RI/FS work plan issued jointly in 1995 by the DOE and DA (DOE 1995) analyzed existing conditions at the GWOUs. The work plan included a conceptual hydrogeological model based on data available when the report was prepared; this model indicated that the aquifer of concern is common to both areas. Hence, to optimize further data collection and interpretation efforts, the DOE and DA have decided to conduct a joint RI/BRA. Characterization data obtained from the chemical plant area wells indicate that uranium is present at levels slightly higher than background, with a few concentrations exceeding the proposed U.S. Environmental Protection Agency (EPA) maximum contaminant level (MCL) of 20 microg/L (EPA 1996c). Concentrations of other radionuclides (e

  9. Application of STORMTOOLS's simplified flood inundation model with sea level rise to assess impacts to RI coastal areas

    Science.gov (United States)

    Spaulding, M. L.

    2015-12-01

    The vision for STORMTOOLS is to provide access to a suite of coastal planning tools (numerical models et al), available as a web service, that allows wide spread accessibly and applicability at high resolution for user selected coastal areas of interest. The first product developed under this framework were flood inundation maps, with and without sea level rise, for varying return periods for RI coastal waters. The flood mapping methodology is based on using the water level vs return periods at a primary NOAA water level gauging station and then spatially scaling the values, based on the predictions of high resolution, storm and wave simulations performed by Army Corp of Engineers, North Atlantic Comprehensive Coastal Study (NACCS) for tropical and extratropical storms on an unstructured grid, to estimate inundation levels for varying return periods. The scaling for the RI application used Newport, RI water levels as the reference point. Predictions are provided for once in 25, 50, and 100 yr return periods (at the upper 95% confidence level), with sea level rises of 1, 2, 3, and 5 ft. Simulations have also been performed for historical hurricane events including 1938, Carol (1954), Bob (1991), and Sandy (2012) and nuisance flooding events with return periods of 1, 3, 5, and 10 yr. Access to the flooding maps is via a web based, map viewer that seamlessly covers all coastal waters of the state at one meter resolution. The GIS structure of the map viewer allows overlays of additional relevant data sets (roads and highways, wastewater treatment facilities, schools, hospitals, emergency evacuation routes, etc.) as desired by the user. The simplified flooding maps are publically available and are now being implemented for state and community resilience planning and vulnerability assessment activities in response to climate change impacts.

  10. Shielding design of RIKEN RI Beam Factory

    Energy Technology Data Exchange (ETDEWEB)

    Uwamino, Yoshitomo; Fukunishi, Nobuhisa [Institute of Physical and Chemical Research, Wako, Saitama (Japan); Oishi, Koji [Shimizu Corp., Tokyo (Japan)

    2000-03-01

    Construction of the RIKEN RI Beam Factory is started, and the phase 1 will be finished by the end of March 2003. Two ring cyclotrons including one superconducting machine and two Big RIPSs will be constructed in the phase 1. Heavy ions of proton to uranium will be accelerated up to 400 MeV/u (A<40) and 150 MeV/u for uranium at an intensity of 10{sup 13} pps. Neutron production by the 400 MeV/u {sup 20}Ne beam was measured at HIMAC of NIRS and it was used for the source term of the shielding calculations. The deep penetration of high-energy neutrons was calculated by using the ANISN code with the DLC-119/HILO86R group constants and also by using the HETC code. The ANISN results were modified by using the HETC results and the shielding experiment at ISIS, and they were fitted by a simple formula for practical use. High-energy neutron penetrations of slantwise injection and the reflection probabilities of iron slab were calculated with the HETC code, and these results were used for the estimation of the thickness for the iron local shielding of Big RIPSs. Induced radioactivity in the air, accelerator components and the building, and the skyshine effect were also estimated. (author)

  11. Feasibility study on RI biochip Application to detection of risk factors of atherosclerosis

    International Nuclear Information System (INIS)

    Ko, Kyong Cheol; Choi, Mi Hee; Park, Sang Hyun; Cho, Kyung Hyun; Lee, Ki Teak

    2009-01-01

    Microarrays can be used to screen thousands of binding events in a parallel and high throughput fashion and are of major importance in discase diagnosis and drug discovery. The use of radioisotope is conventionally regarded as one of the most sensitive detection methods. Atherosclerosis is a common disorder affecting arterial blood vessels. It happens when fat, cholesterol, and other substances made in the arterial blood vessels form a hard substances called plaque. Lipoprotein-associated phospholipase A 2 (Lp-PLA 2 ), a phospholipase A 2 enzyme, is used as a marker for cardiac disease. The detection of Lp-PLA 2 was accomplished by using radioactive [ 3 H-acetyl] PAF as a substrate and a feasibility study on RI biochip application to detection of Lp-PLA 2 , a risk factors of atherosclerosis was performed. Inhibitive activity of a native plant extract was also determined by using the RI biochip. It was found to be applicable to a high-throughput screening of inhibitors for developing atherosclerosis therapeutic agents

  12. Radioiodine therapy of Graves' disease - a dosimetric comparison of different strategies concerning antithyroid drugs

    International Nuclear Information System (INIS)

    Urbannek, V.; Voth, E.; Moka, D.; Schicha, H.

    2001-01-01

    Aim: Premedication with antithyroid drugs (ATD) compared to patients not pretreated with ATD causes a higher failure rate of radioiodine therapy (RITh) or demands higher therapeutical dosage of radioiodine (RI). For clinical reasons and because of accelerated iodine metabolism in hyperthyreosis a compensated thyroid metabolism is desirable. Aim of this study was to investigate the influence of ATD on the biokinetics of RI in case of Graves' disease in order to improve RITh of patients pre-treated with ATD. Methods: 385 consecutive patients who underwent RITh because of Graves' disease for the first time were included: Group A (n = 74): RITh under continuous medication with ATD; Group B (n = 111): Application of RI under continuous medication with ATD, in case of insufficient RI-uptake or shortened effective RI-half-life ATD were stopped 1-5 days after RITh; Group C (n = 200): ATD were stopped 2 days prior to RITh in all patients. We examined the influence of ATD on RI-uptake and effective RI-half-life as well as the absorbed dose achieved on the thyroid in dependence of thyroid volume and applied RI-dosage [TEQ - therapy efficiency quotient, (2)]. Results: In the RI-pretest (all patients under ATD) the RI-uptake was comparable in all three groups. During RITh-RI-uptake, effective RI-half-life and therefore the TEQ were significantly higher in Group C as compared to Groups A and B (p [de

  13. Maamesilasena maailmas ehk lihtsalt Jüri Talveti meetodist / On Jüri Talvet’s Comparative Method

    Directory of Open Access Journals (Sweden)

    Arne Merilai

    2016-12-01

    Full Text Available Teesid: Artikkel defineerib maailmakirjanduse professor Jüri Talveti komparativistlikku meetodit nii maamesilase metafoori kui ka tema poolt tutvustatud mõistete edaphos (’pind’ ja episteme (’teadmine’ kaudu. Võrdleva kirjandusteadlase ülesanne on kahesuunaline: tutvustada eesti kirjandust maailmas ja vahendada mujal loodut meie kultuurile. Kuigi õpetlaste teoreetiline metasüsteem ja mõistevõrk – episteme – võib areneda väga keeruliseks, peab see alati juurduma edaphos’es kui toitvas pinnases, mille loovad sõnakunstiteosed ja rahvuslikud kirjanduslood. Avardades võrdlevat edaphos’t, aktiveerime ja rikastame ka maailma episteme’t.   The article aims at defining the comparative method of Jüri Talvet, professor of comparative literature. This can be carried out by an application of Talvet’s own metaphor for himself – a bumble bee, or via two concepts elaborated by him – edaphos (base and episteme (knowledge. The bumble bee, by nature more reclusive and peaceful but somehow more attractive looks than a regular bee flies out from its modest sod nest across blooming meadows, disseminating homely pollen among the leaves of grass of the wide world. Then it faithfully returns with nourishing nectar that feeds its family. As chairman of the Estonian Comparative Literature Association, and founder and editor-in-chief of the comparative literature journal Interlitteraria, Talvet has written: “Its purpose is to channel new literary-philosophical ideas from the international area to Estonia and, at the same time, to spread knowledge about Estonian literary and philosophical studies outside Estonia, as well as to let the wider world have some idea of Estonian literature itself which, because of the language barrier, has belonged traditionally to the majority of “silent” literatures of the world, unjustly ignored by the area of the dominant Western languages.” Yet, no matter how complex our theoretical meta

  14. Spontaneous food allergy in Was-/- mice occurs independent of FcεRI-mediated mast cell activation.

    Science.gov (United States)

    Lexmond, W S; Goettel, J A; Sallis, B F; McCann, K; Rings, E H H M; Jensen-Jarolim, E; Nurko, S; Snapper, S B; Fiebiger, E

    2017-12-01

    Food allergies are a growing health problem, and the development of therapies that prevent disease onset is limited by the lack of adjuvant-free experimental animal models. We compared allergic sensitization in patients with food allergy or Wiskott-Aldrich syndrome (WAS) and defined whether spontaneous disease in Was -/- mice recapitulates the pathology of a conventional disease model and/or human food allergy. Comparative ImmunoCAP ISAC microarray was performed in patients with food allergy or WAS. Spontaneous food allergy in Was -/- mice was compared to an adjuvant-based model in wild-type mice (WT-OVA/alum). Intestinal and systemic anaphylaxis was assessed, and the role of the high-affinity IgE Fc receptor (FcεRI) in allergic sensitization was evaluated using Was -/- Fcer1a -/- mice. Polysensitization to food was detected in both WAS and food-allergic patients which was recapitulated in the Was -/- model. Oral administration of ovalbumin (OVA) in Was -/- mice induced low titers of OVA-specific IgE compared to the WT-OVA/alum model. Irrespectively, 79% of Was -/- mice developed allergic diarrhea following oral OVA challenge. Systemic anaphylaxis occurred in Was -/- mice (95%) with a mortality rate >50%. Spontaneous sensitization and intestinal allergy occurred independent of FcεRI expression on mast cells (MCs) and basophils. Was -/- mice provide a model of food allergy with the advantage of mimicking polysensitization and low food-antigen IgE titers as observed in humans with clinical food allergy. This model will facilitate studies on aberrant immune responses during spontaneous disease development. Our results imply that therapeutic targeting of the IgE/FcεRI activation cascade will not affect sensitization to food. © 2017 EAACI and John Wiley and Sons A/S. Published by John Wiley and Sons Ltd.

  15. Physical activity and change in fasting glucose and HbA1c: a quantitative meta-analysis of randomized trials.

    Science.gov (United States)

    Boniol, Mathieu; Dragomir, Miruna; Autier, Philippe; Boyle, Peter

    2017-11-01

    A systematic review was conducted of randomized trials which evaluated the impact of physical activity on the change in fasting glucose and HbA1c. A literature search was conducted in PubMed until December 2015. Studies reporting glucose or HbA1c at baseline and at the end of study were included, and the change and its variance were estimated from studies with complete data. Mixed-effect random models were used to estimate the change of fasting glucose (mg/dl) and HbA1c (%) per additional minutes of physical activity per week. A total of 125 studies were included in the meta-analysis. Based on 105 studies, an increase of 100 min in physical activity per week was associated with an average change of -2.75 mg/dl of fasting glucose (95% CI -3.96; -1.55), although there was a high degree of heterogeneity (83.5%). When restricting the analysis on type 2 diabetes and prediabetes subjects (56 studies), the average change in fasting glucose was -4.71 mg/dl (95% CI -7.42; -2.01). For HbA1c, among 76 studies included, an increase of 100 min in physical activity per week was associated with an average change of -0.14% of HbA1c (95% CI -0.18; -0.09) with heterogeneity (73%). A large degree of publication bias was identified (Egger test p HbA1c was -0.16% (95% CI -0.21; -0.11). This analysis demonstrates that moderate increases in physical activity are associated with significant reductions in both fasting glucose and HbA1c.

  16. Postvaccination C-Reactive Protein and C5/gp41732-744 Antibody Level Fold-Changes Over Baseline Are Independent Predictors of Therapeutic HIV Vaccine Effect in a Phase 2 Clinical Study of Vacc-4x.

    Science.gov (United States)

    Huang, Yunda; Zhang, Lily; Jolliffe, Darren; Sanchez, Brittany; Stjernholm, Grete; Jelmert, Øyvind; Ökvist, Mats; Sommerfelt, Maja A

    2018-03-01

    Therapeutic vaccination has the potential to contribute to functional HIV cure strategies. However, to show functional HIV cure, study participants must be taken off combination antiretroviral therapy (cART). The availability of suitable biomarkers that can predict viral load (VL) or CD4 count outcomes following therapeutic HIV vaccination would reduce the risks associated with cART interruption in such studies. This report sought to determine baseline and postvaccination biomarker predictors of vaccine effect (VE) on VL and CD4 counts following cART interruption in a double-blind, randomized phase 2 study of the peptide-based therapeutic HIV vaccine, Vacc-4x (n = 93), versus placebo (n = 43). Antibody responses to a novel envelope glycoprotein antigen, C5/gp41 732-744 , and three safety marker measurements [C-reactive protein (CRP), white blood cell, and lactate dehydrogenase] were considered. Interaction tests in univariate and multivariate linear regression models were used to estimate the effect of biomarkers on VE, defined as the VL or CD4 count difference in Vacc-4x versus placebo groups. The reported q-values (considered significant for hypothesis-generating purposes if ≤0.2) accounted for multiple comparisons using the false discovery rate method. Data were analyzed from all available 58 Vacc-4x and 25 placebo recipients before cART resumption. Lower postvaccination fold-change over baseline of CRP concentration (interaction p- (q-) value = 0.005 (0.11) for VL) and higher fold-change of anti-C5/gp41 732-744 antibody levels (0.005 (0.11) for VL and 0.009 (0.20) for CD4) were associated with Vacc-4x benefit. These findings suggest potential roles for inflammation and immune activation markers in predicting therapeutic HIV VE.

  17. Baseline MELD score predicts hepatic decompensation during antiviral therapy in patients with chronic hepatitis C and advanced cirrhosis.

    Directory of Open Access Journals (Sweden)

    Georg Dultz

    Full Text Available In patients with advanced liver cirrhosis due to chronic hepatitis C virus (HCV infection antiviral therapy with peginterferon and ribavirin is feasible in selected cases only due to potentially life-threatening side effects. However, predictive factors associated with hepatic decompensation during antiviral therapy are poorly defined.In a retrospective cohort study, 68 patients with HCV-associated liver cirrhosis (mean MELD score 9.18 ± 2.72 were treated with peginterferon and ribavirin. Clinical events indicating hepatic decompensation (onset of ascites, hepatic encephalopathy, upper gastrointestinal bleeding, hospitalization as well as laboratory data were recorded at baseline and during a follow up period of 72 weeks after initiation of antiviral therapy. To monitor long term sequelae of end stage liver disease an extended follow up for HCC development, transplantation and death was applied (240 weeks, ± SD 136 weeks.Eighteen patients (26.5% achieved a sustained virologic response. During the observational period a hepatic decompensation was observed in 36.8%. Patients with hepatic decompensation had higher MELD scores (10.84 vs. 8.23, p14, respectively. Baseline MELD score was significantly associated with the risk for transplantation/death (p<0.001.Our data suggest that the baseline MELD score predicts the risk of hepatic decompensation during antiviral therapy and thus contributes to decision making when antiviral therapy is discussed in HCV patients with advanced liver cirrhosis.

  18. Information Technology Sector Baseline Risk Assessment

    Science.gov (United States)

    2009-08-01

    alternative root be economically advantageous , an actor’s ability to exploit market forces and create an alternative root would be significantly improved...conduct their operations. Therefore, a loss or disruption to Internet services would not be advantageous for the desired outcomes of these syndicates.26... eCommerce Service loss or disruption [C] Traffic Redirection [C] = Undesired consequence Information Technology Sector Baseline Risk Assessment

  19. Unelõiv ja Saarepiiga: Jüri Talveti kirjanduslik "Kalevipoeg" / The Rhisomes of „Kalevipoeg“: Literary Interpretation of the Estonian National Epic by Jüri Talvet

    Directory of Open Access Journals (Sweden)

    Marin Laak

    2016-12-01

    Full Text Available Teesid: Artikkel keskendub eepose „Kalevipoeg“ käsitlusele võrdleva kirjandusteaduse vaatepunktist. „Kalevipoja“ uurimine ilukirjandusliku teosena muutis paradigmaatiliselt rahvuseepose senist tõlgendust ja seda tänu Jüri Talveti käsitlustele „Kalevipojast“ kui suurest Euroopa eeposest, silmapaistavast maailmakirjanduse kunsteeposte seas. Eepose teksti ja poeetika kirjandusteaduslik uurimine on selgitanud, kuidas eepose tekst on üles ehitatud sisemistele, intratekstuaalsetele seostele, mis korduvad gradatsiooniliselt ja toetuvad teatud kindlatele tekstuaalsetele sõlmpunktidele, näiteks „Saarepiiga“, „uni“ jpt. Enam kui autentsed allikad, on „Kalevipoja“ kui kirjandusliku teksti puhul oluline eepose toimimine pidevalt uusi tekste ärgitava tüvitekstina. Eepose analüüs näitab, kuidas selliste seoste alusel tekivad uued kultuurilised ühikud, kauneid näiteid selliste motiivikordustele rajatud seosteahelate kohta leidub ka Jüri Talveti luules.   The article focuses on the treatment of the epic The Kalevipoeg from the viewpoint of comparative literature. This approach is a continuation of the study of literary relations of the epic which, on the one hand is opposite to, but on the other hand continues the present folkloristic approach to The Kalevipoeg as a folklore-based epic, which is based on the comparative-historical method of studying folklore. F. R. Kreutzwald’s role in creating the national epic was enormous; the epic can be conceived as a fictional and intentional piece, emphasising the role of its author. Although different genres of genuine folklore can be recognised in the epic, works of fiction of European and world classics have also been used in its construction, and the text of the epic has itself become an intertextual foundation for new works of fiction. The paradigm of discussing the epic changed due to Jüri Talvet’s groundbreaking treatment of The Kalevipoeg as a great European epic and

  20. Síndrome de lisis tumoral en un paciente con cáncer de riñón tratado con sunitinib Tumor lysis syndrome in a patient with a renal carcinoma treated with sunitinib

    Directory of Open Access Journals (Sweden)

    Ezequiel Rodríguez-Reimúndes

    2011-04-01

    Full Text Available El síndrome de lisis tumoral (SLT es un trastorno metabólico que ocurre como consecuencia de una destrucción celular masiva. Se caracteriza por la presencia de hiperuricemia, hiperfosfatemia, hipocalcemia e hiperkalemia, y predispone al desarrollo de insuficiencia renal aguda. En la mayoría de los casos el SLT ocurre luego de instaurarse un tratamiento antitumoral y es más frecuente en tumores de alto grado de malignidad y alta sensibilidad a la quimioterapia. Presentamos el caso de un paciente con diagnóstico de cáncer de riñón recidivado que presenta un SLT e insuficiencia renal aguda luego de iniciar tratamiento con sunitinib.The tumor mor lysis syndrome (TLS is a metabolic disorder resulting from a massive tumor breakdown. It is characterized by hyperuricemia, hyperphosphatemia, hypocalcemia and hyperkalemia and predisposes to acute renal failure. TLS usually occurs after the initiation of cytotoxic therapy and is more frequent in the case of neoplasias with a high proliferative rate or that are highly chemo-sensitive. We report the case of a man with a recurrent kidney cancer who presented with a TLS and acute renal failure after initiation of sunitinib.

  1. Real-world efficacy and safety of ritonavir-boosted paritaprevir, ombitasvir, dasabuvir ± ribavirin for hepatitis C genotype 1 - final results of the REV1TAL study.

    Science.gov (United States)

    Lubel, John; Strasser, Simone; Stuart, Katherine A; Dore, Gregory; Thompson, Alexander; Pianko, Stephen; Bollipo, Steven; Mitchell, Joanne L; Fragomeli, Vincenzo; Jones, Tracey; Chivers, Sarah; Gow, Paul; Iser, David; Levy, Miriam; Tse, Edmund; Gazzola, Alessia; Cheng, Wendy; Nazareth, Saroj; Galhenage, Sam; Wade, Amanda; Weltman, Martin; Wigg, Alan; MacQuillan, Gerry; Sasadeusz, Joe; George, Jacob; Zekry, Amany; Roberts, Stuart K

    2017-01-01

    Limited data exist on the outcomes of ritonavir-boosted paritaprevir with ombitasvir and dasabuvir (PrOD) ± ribavirin in a real-world setting. The aim of this study was to compare the efficacy and safety of PrOD-based therapy in hepatitis C genotype 1 patients with and without cirrhosis, and to explore pre-treatment factors predictive of sustained viral response (SVR) and serious adverse events (SAEs) on treatment. 451 patients with hepatitis C genotype 1 treated in 20 centres across Australia were included. Baseline demographic, clinical and laboratory information, on-treatment biochemical, virological and haematological indices and details on serious adverse events were collected locally. Cirrhosis was present in 340 patients (75.4%). Overall SVR was 95.1% with no differences in SVR between the cirrhosis and non-cirrhosis groups (94.7% versus 96.4%). SVR in subgenotypes 1a and 1b was 93.1% and 99.2%, respectively. On multivariate analysis, baseline bilirubin level and early treatment cessation predicted SVR. SAEs occurred in 10.9% of patients including hepatic decompensation (2.7%) and hepatocellular carcinoma (1.8%). On multivariate analysis of factors predictive of SAEs in the overall group, Child-Turcotte-Pugh (CTP) B was the only significant factor, while in those with cirrhosis, baseline albumin and creatinine levels were significant. In this large real-world cohort of HCV genotype 1 subjects, treatment with PrOD was highly effective and similar to clinical trials. Important determinants of reduced SVR include early cessation of therapy and baseline bilirubin concentration. SAEs were not infrequent with CTP B patients being at greatest risk.

  2. Quaternary fault in Hwalseong-ri, Oedong-up, Gyeongju, Korea.

    Energy Technology Data Exchange (ETDEWEB)

    Ryoo, Chung-Ryul; Chwae, Uee-Chan; Choi, Sung-Ja [Korea Institute of Geoscience and Mineral Resources, Taejeon(Korea); Son, Moon [Pusan National University, Pusan(Korea)

    2001-09-01

    We describe a Quaternary fault occurring in Hwalseong-ri, Oedong-up, Gyeongju in the eastern part of Ulsan Fault Zone, Korea. This fault (Hwalseongri Fault) is developed around the contact between the early Tertiary granite and the Quaternary gravel layer. Four different faults are distinguished from west to east: (1) fault within Quaternary gravel layer, (2) fault between Quaternary gravel layer and granite, (3) fault between Quaternary gravel layer overlying granite and granite, (4) fault between granite and Quaternary layer. General strike of the fault zone vary from NNW to NE, dipping to east. Two striations, E-W and N-S, are developed. The former is related mainly to the reverse faulting, and the latter to the sinistral shearing. This fault zone was reactivated, and considered as a positive flower structure mainly by the results of the E-W compression in the southeastern part of the Korean Peninsula during Quaternary. (author). 45 refs., 6 figs.

  3. Reduced Fc∊RI-Mediated Release of Asthma-Promoting Cytokines and Chemokines from Human Basophils during Omalizumab Therapy

    Science.gov (United States)

    Oliver, Janet M.; Tarleton, Christy A.; Gilmartin, Laura; Archibeque, Tereassa; Qualls, Clifford R.; Diehl, Lorena; Wilson, Bridget S.; Schuyler, Mark

    2010-01-01

    Background Treating asthmatics with the humanized IgE-scavenging antibody, omalizumab (rhuMAb-E25, Xolair®), reduces airways inflammation and asthma symptoms. Previously, omalizumab was shown to cause a dramatic and reversible loss of cell surface high-affinity IgE receptors, Fc∊RI, from the peripheral blood basophils of asthmatics. The consequences of receptor loss for the Fc∊RI-mediated synthesis and release of cytokines implicated in allergic asthma have not been examined. Methods Fifteen asthmatic volunteers each received omalizumab for 12 weeks. Peripheral blood basophils were isolated before, during, 2 weeks after and 6 months after omalizumab. Basophils were assayed for the basal and anti-IgE-stimulated release of cytokines, chemokines and histamine. Pooled data were analyzed by repeated measures ANOVA and by paired t tests. Results Anti-IgE-stimulated human basophils synthesize and release Th2 cytokines (IL-4, IL-13) and chemokines (IL-8, RANTES). The anti-IgE-stimulated release of IL-4, IL-13 and IL-8 was reduced during omalizumab treatment and returned to pretreatment levels after omalizumab withdrawal. Omalizumab did not alter basophil histamine levels or basal and anti-IgE-stimulated histamine release. Conclusions Omalizumab may reduce asthma symptoms in part by suppressing the Fc∊RI-mediated production by basophils of Th2 cytokines and selected chemokines. Anti-IgE-stimulated basophil cytokine synthesis appears more sensitive than histamine release to the loss of Fc∊RI caused by omalizumab treatment. PMID:19844128

  4. Increased risk of coronary artery calcification progression in subjects with high baseline Lp(a) levels: The Kangbuk Samsung Health Study.

    Science.gov (United States)

    Cho, Jung Hwan; Lee, Da Young; Lee, Eun Seo; Kim, Jihyun; Park, Se Eun; Park, Cheol-Young; Lee, Won-Young; Oh, Ki-Won; Park, Sung-Woo; Rhee, Eun-Jung

    2016-11-01

    Results from previous studies support the association of lipoprotein(a) [Lp(a)] levels and coronary artery disease risk. In this study, we analyzed the association between baseline Lp(a) levels and future progression of coronary artery calcification (CAC) in apparently healthy Korean adults. A total of 2611 participants (mean age: 41years, 92% mend) who underwent a routine health check-up in 2010 and 2014 were enrolled. Coronary artery calcium score (CACS) were measured by multi-detector computed tomography. Baseline Lp(a) was measured by high-sensitivity immunoturbidimetric assay. Progression of CAC was defined as a change in CACS >0 over four years. Bivariate correlation analyses with baseline Lp(a) and other metabolic parameters revealed age, total cholesterol, HDL-C, LDL-C and CACS to have a significant positive correlation, while body weight, fasting glucose level, blood pressure and triglyceride level were negatively correlated with baseline Lp(a) level. After four years of follow-up, 635 subjects (24.3%) had CAC progression. The participants who had CAC progression were older, composed of more men, more obese, and had higher fasting glucose levels and worse baseline lipid profiles compared to those who did not have CAC progression. The mean serum Lp(a) level was significantly higher in subjects who had CAC progression compared to those who did not (32.5 vs. 28.9mg/dL, p<0.01). When the risk for CAC progression according to baseline Lp(a) was calculated, those with Lp(a) level≥50mg/dL had an odds ratio of 1.333 (95% CI 1.027-1.730) for CAC progression compared to those with Lp(a)<50mg/dL after adjusting for confounding factors. In this study, the subjects who had higher Lp(a) were at significantly higher risk for CAC progression after four years of follow-up, suggesting the role of high Lp(a) in CAC progression. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  5. Associations of HbA1c and fasting plasma glucose with incident diabetes: Implications for pre-diabetes thresholds in a Japanese population.

    Science.gov (United States)

    Nakagami, Tomoko; Tanaka, Yuki; Oya, Junko; Kurita, Moritoshi; Isago, Chisato; Hasegawa, Yukiko; Ito, Arata; Hirota, Naoki; Tsuzura, Reika; Uchigata, Yasuko

    2016-12-01

    This study assessed pre-diabetes (pre-DM) cutoffs for HbA1c and fasting plasma glucose (FPG) that were associated with an increased risk of incident DM. We evaluated 2267 non-diabetic Japanese health-check examinees (HbA1c: HbA1c of ≥6.5% (≥48mmol/mol), FPG of ≥7.0mmol/L, or physician-diagnosed DM. During 11047 person-years, we identified 99 incident DM cases (4.3%). The incidence of DM increased with increasing baseline HbA1c or FPG levels, and the change points (95% confidence intervals) were 5.7% (5.6-5.7%; 39mmol/mol [38-39mmol/mol]) for HbA1c and 5.5mmol/L (5.5-5.6mmol/L) for FPG. The adjusted hazard ratios (HRs) for incident DM per one standard deviation-increase in HbA1c and FPG were 5.5 (4.4-6.8) and 4.0 (3.2-4.8), respectively. The adjusted HRs for incident DM were significantly higher at HbA1c of 5.7-6.4% (39-46mmol/mol) or FPG of 5.5-6.9mmol/L, compared to HbA1c of HbA1c and 5.5mmol/L for FPG in this Japanese population. Copyright © 2016 Primary Care Diabetes Europe. Published by Elsevier Ltd. All rights reserved.

  6. Hepatitis C Virus Resistance Testing in Genotype 1: The Changing Role in Clinical Utility.

    Science.gov (United States)

    Molino, Suzanne; Martin, Michelle T

    2017-09-01

    To review the role and utility of baseline resistance testing with currently available and pipeline genotype 1 hepatitis C virus (HCV) treatment. Authors reviewed liver meeting abstracts for data on currently-available and pipeline genotype 1 retreatment regimens from January 1, 2015, to March 23, 2017. Additional trials were identified from a review of clinicaltrials.gov using the pipeline medication names. Authors identified reports of current and pipeline genotype 1 retreatment regimens. Seven references were clinical study results presented at the meetings of the American Association for the Study of Liver Diseases and the European Association for the Study of the Liver, and 2 studies were from clinicaltrials.gov . Retreatment trial data of currently available salvage regimens indicate that baseline NS5A resistance-associated substitutions (RASs) may decrease sustained virological response (SVR) rates when retreating with ledipasvir/sofosbuvir but are not affected when using elbasvir/grazoprevir + sofosbuvir + ribavirin, paritaprevir/ritonavir/ombitasvir + dasabuvir + sofosbuvir, or sofosbuvir/velpatasvir + ribavirin. Pipeline data indicate that baseline NS5A RASs do not affect SVR rates when retreating with sofosbuvir/velpatasvir/voxilaprevir or glecaprevir/pibrentasvir. Baseline resistance testing was used for decisional support for 3 clinical scenarios in patients with HCV genotype 1 infection at the time of manuscript submission. Pending the approval of 2 new direct-acting antiviral regimens in the third quarter of 2017, the rapidly evolving HCV treatment guidelines will likely reflect a decreased clinical utility for resistance testing.

  7. Project W-320 thermal hydraulic model benchmarking and baselining

    International Nuclear Information System (INIS)

    Sathyanarayana, K.

    1998-01-01

    Project W-320 will be retrieving waste from Tank 241-C-106 and transferring the waste to Tank 241-AY-102. Waste in both tanks must be maintained below applicable thermal limits during and following the waste transfer. Thermal hydraulic process control models will be used for process control of the thermal limits. This report documents the process control models and presents a benchmarking of the models with data from Tanks 241-C-106 and 241-AY-102. Revision 1 of this report will provide a baselining of the models in preparation for the initiation of sluicing

  8. Integrated planning: A baseline development perspective

    International Nuclear Information System (INIS)

    Clauss, L.; Chang, D.

    1994-01-01

    The FEMP Baseline establishes the basis for integrating environmental activity technical requirements with their cost and schedule elements. The result is a path forward to successfully achieving the FERMCO mission. Specific to cost management, the FEMP Baseline has been incorporate into the FERMCO Project Control System (PCS) to provide a time-phased budget plan against which contractor performance is measured with an earned value management system. The result is the Performance Measurement Baseline (PMB), an important tool for keeping cost under control

  9. Puugravüüriklotsid kõnelevad / Jüri Hain

    Index Scriptorium Estoniae

    Hain, Jüri, 1941-

    2007-01-01

    Näitus "Sajand eesti puugravüüri klotsidel Eesti Rahvusraamatukogu kollektsioonist" rahvusraamatukogus 15. I - 3. II. Näitusel on vanim klots aastast 1842, noorim 1941. aastast. Kunstnikest (Aleksander Otto Gern, Bogdan Gottlieb Friedrich Kally, August Daugell, Eduard Magnus Jakobson, Mart Pukits, Andres Kuusk, Anton Suurkask, Arkadio Laigo, Hando Mugasto, Eduard Järv, Paul Liivak, Salome Trei, Ott Kangilaski), töödest. Näitust täiendavad Eduard Wiiralti "Tüdruku pea" (1919) kaks linoollõikeplaati

  10. Proceeding of the workshop on gamma-ray spectroscopy utilizing heavy-ion, photon and RI beams

    Energy Technology Data Exchange (ETDEWEB)

    Oshima, Masumi; Sugita, Michiaki; Hayakawa, Takehito [eds.

    1998-03-01

    Three time since 1992, we have held the symposia entitled `Joint Spectroscopy Experiments Utilizing JAERI Tandem-Booster Accelerator` at the Tokai Research Establishment. In the symposia, we have mainly discussed the plans of experiments to be done in this joint program. The joint program started in 1994. Several experiments have been made since and some new results have already come up. This symposium `Gamma-ray Spectroscopy utilizing heavy-ion, Photon and RI beams` was held at Tokai Research Establishment of JAERI. Because this symposium is the first occasion after the program started, the first purpose of the symposium is to present and discuss the experimental results so far obtained using the JAERI Tandem-Booster. The second purpose of the symposium is to discuss new possibilities of gamma-ray spectroscopy using new resources such as RI-beam and Photon-beam. The participants from RIKEN, Tohoku University and JAERI Neutron Science Research Center presented the future plans of experiments with RI-beam at each facility. Compared with these nuclear beams, photon beam provides a completely new tool for the {gamma}-ray spectroscopy, which is achieved by inverse Compton scattering between high-energy electron and laser beams. The 23 of the presented papers are indexed individually. (J.P.N.)

  11. Imputation of Baseline LDL Cholesterol Concentration in Patients with Familial Hypercholesterolemia on Statins or Ezetimibe.

    Science.gov (United States)

    Ruel, Isabelle; Aljenedil, Sumayah; Sadri, Iman; de Varennes, Émilie; Hegele, Robert A; Couture, Patrick; Bergeron, Jean; Wanneh, Eric; Baass, Alexis; Dufour, Robert; Gaudet, Daniel; Brisson, Diane; Brunham, Liam R; Francis, Gordon A; Cermakova, Lubomira; Brophy, James M; Ryomoto, Arnold; Mancini, G B John; Genest, Jacques

    2018-02-01

    Familial hypercholesterolemia (FH) is the most frequent genetic disorder seen clinically and is characterized by increased LDL cholesterol (LDL-C) (>95th percentile), family history of increased LDL-C, premature atherosclerotic cardiovascular disease (ASCVD) in the patient or in first-degree relatives, presence of tendinous xanthomas or premature corneal arcus, or presence of a pathogenic mutation in the LDLR , PCSK9 , or APOB genes. A diagnosis of FH has important clinical implications with respect to lifelong risk of ASCVD and requirement for intensive pharmacological therapy. The concentration of baseline LDL-C (untreated) is essential for the diagnosis of FH but is often not available because the individual is already on statin therapy. To validate a new algorithm to impute baseline LDL-C, we examined 1297 patients. The baseline LDL-C was compared with the imputed baseline obtained within 18 months of the initiation of therapy. We compared the percent reduction in LDL-C on treatment from baseline with the published percent reductions. After eliminating individuals with missing data, nonstandard doses of statins, or medications other than statins or ezetimibe, we provide data on 951 patients. The mean ± SE baseline LDL-C was 243.0 (2.2) mg/dL [6.28 (0.06) mmol/L], and the mean ± SE imputed baseline LDL-C was 244.2 (2.6) mg/dL [6.31 (0.07) mmol/L] ( P = 0.48). There was no difference in response according to the patient's sex or in percent reduction between observed and expected for individual doses or types of statin or ezetimibe. We provide a validated estimation of baseline LDL-C for patients with FH that may help clinicians in making a diagnosis. © 2017 American Association for Clinical Chemistry.

  12. Towards a research informed teaching experience within a diagnostic radiography curriculum: The level 4 (year 1) student holistic experience

    International Nuclear Information System (INIS)

    Higgins, Robert; Hogg, Peter; Robinson, Leslie

    2013-01-01

    Aim: This article discusses the level 4 (year 1) diagnostic radiography student holistic experience of the Research-informed Teaching experience (RiTe) at the University of Salford, UK. The purpose of RiTe is to expose undergraduate radiography students to more formal research, as part of their normal teaching and learning experience. Method: A grounded theory approach was adopted and a focus group with eight level 4 students was used to explore and evaluate the student experience and perception of RiTe. Results: Open coding defined categories and sub-categories, with axial and selective coding used to interrogate and explore the relationships between the focus group data. A number of insights were gained into the student holistic experience of RiTe. The issue of leadership for level 4 students was also identified. Discussion: The focus group participants found RiTe to be an extremely positive learning experience. RiTe also facilitated their translation of learnt theory into clinical skills knowledge alongside their understanding of and desire to participate in more research as undergraduates. The article also highlights areas for future research.

  13. ri Arrak nüüdis- ja vanamuusikas / Igor Garšnek

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    2011-01-01

    8. novembril Niguliste kirikus toimunud Hortus Musicuse Jüri Arraku 75. sünnipäevale pühendatud kontserdist, kus tulid esiettekandele Rene Eespere, Tõnis Kaumanni ja Peeter Vähi kunstnikule pühendatud uudisteosed

  14. A Secure and Efficient Communications Architecture for Global Information Grid Users Via Cooperating Space Assets

    Science.gov (United States)

    2008-06-19

    Di Pietro , Roberto, Antonio Durante, and...MLD) for IPv6, http://tools.ietf.org/html/2710, Accessed: May 22, 2006. [DiC05] Di Pietro , Roberto, Stefano Chessa, and Piero Maestrini, "Computation...Simultaneous Leaves Per Time Step To ta l K ey s Di st ri bu te d in th e Sy st em (l og s ca le ) Baseline Cluster Hubenko To ta l K ey s Di

  15. Äriühinguõiguse ühtlustamine Euroopa Liidus ja selle mõju Eesti õigusele : [magistritöö] / Greete-Kristiine Kuru ; Tartu Ülikool, õigusteaduskond ; juhendaja: Andres Vutt

    Index Scriptorium Estoniae

    Kuru, Greete-Kristiine, 1989-

    2013-01-01

    Äriühinguõiguse ühtlustamise alustest ja läbiviimisest Euroopa Liidus, äriühingute piiriülesest asukohavahetusest Euroopa Liidus, äriühingute piiriülese ühinemise regulatsioonist Euroopa Liidus

  16. Maarjamäe loss (Marienberg) / Robert Gödicke, Nikolai vanem Thamm, Jüri Renter

    Index Scriptorium Estoniae

    Gödicke, Robert

    2004-01-01

    5 välisvaadet, üks 1930. aastast; mõisa ajaloost, omanikest, lossi arhitektuurist, interjöörist, pargist; 1975. a. anti loss üle Eesti Ajaloomuuseumile; hoone restaureeriti aastatel 1983-88 (arhitekt Jüri Renter, sisearhitekt Helle Gans)

  17. RI: Rheology as a Tool for Understanding the Mechanics of Live Ant Aggregations, Part 2

    Science.gov (United States)

    2016-11-04

    earwax of pigs, dogs , cows, and humans. We find that earwax is shear-thinning for all these animals. This ability enables it to cling to the ear in low...self-cleaning.” Society for Integrative and Comparative Biology annual meeting, 2017.  P. Yang, D. Dao, R. Lehner, D. Hu, “ The hydrodynamics of...RI: Rheology as a Tool for Understanding the Mechanics of Live Ant Aggregations, Part 2 An Anton Paarr MCR 501 rheometer was purchased in order to

  18. The impact of extended release exenatide as adjuvant therapy on hemoglobin A1C, weight, and total daily dose of insulin in patients with type 2 diabetes mellitus using U-500 insulin.

    Science.gov (United States)

    Farwig, Phillip A; Zielinski, Angela J; Accursi, Mallory L; Burant, Christopher J

    2017-12-01

    To evaluate the efficacy and safety of adjuvant exenatide extended release (ER) therapy in patients treated with regular U-500 insulin. In this retrospective chart review at an ambulatory care center in the Midwest, 18 patients with type 2 diabetes being treated with regular U-500 insulin and adjuvant exenatide ER were identified. These patients were evaluated for outcomes following the addition of exenatide ER. The primary outcome was change in HbA 1C from baseline to 3, 6, and 12months. Secondary outcomes included change in weight, total daily dose (TDD) of insulin, and hypoglycemia. Repeated measures ANOVA was performed to assess the differences in mean scores over four time periods. A total of 18 of 50 patients met inclusion criteria with sufficient data to be included in analysis. HbA 1C showed non-significant findings from baseline to 12months (8.08% vs. 8.23%; p=0.75). A non-significant, modest weight loss occurred (146.4kgvs. 144.2kg; -2.2kg; p=0.31). A significant decrease in TDD of insulin was observed (378 units vs. 326 units; p1). There was a trend towards hypoglycemia from baseline to month 3 post addition of exenatide ER (0.33 events vs. 1.33 events; p=0.055). In patients treated with regular U-500 insulin, adjuvant exenatide ER therapy showed no significant improvement in HbA 1C , but did show modest weight loss as well as decreased insulin requirements to achieve a HbA 1C that was comparable to baseline. Published by Elsevier B.V.

  19. Pelaksanaan PP RI No.19/2008 Sebagai Acuan Kinerja Camat pada Aspek Pemerintahan dan Pendidikan

    Directory of Open Access Journals (Sweden)

    Merry Chairina DM. Sinaga

    2015-06-01

    Full Text Available This study aims to determine the performance camat in the governance and education, which refers to PP RI No.19 / 2008. Researchers used descriptive method implemented in the District Percut Sei Tuan. The sample was the whole population is with 37 employees and only have a single variable: the implementation of PP RI No.19 / 2008 as a reference to the performance of district head in the governance and education in the District Percut Sei Tuan, Deli Serdang regency. Data collection techniques by observation through the observation either directly or indirectly to the subject under study. In this study the authors conducted interviews with respondents who considered berkopetensi in this study. The results showed that the performance camat in the governance and education, which refers to PP RI No.19 / 2008 can be categorized as good, such as the active role undertaken whenever a meeting / conference with employees and citizens. Often talked about the problem of improving the quality of work and education, an invitation to attend the big day, receiving the proposal / opinion of the district head in the field of government development issues of education, accepted the proposal of the villagers regarding the development of education, and play an active role in. arrangements regarding the education in collaboration with third parties.

  20. 76 FR 15246 - Anchorage Regulations; Narragansett Bay and Rhode Island Sound, RI

    Science.gov (United States)

    2011-03-21

    ...-AA01 Anchorage Regulations; Narragansett Bay and Rhode Island Sound, RI AGENCY: Coast Guard, DHS... Rhode Island Sound south of Brenton Point, Rhode Island, for use by vessels waiting to enter... Sound that under current informal practice is routinely used by mariners as an anchorage while waiting...