Sample records for rhodopseudomonas palustris coupling
-
Final report: 'Rhodopseudomonas palustris' genome workshop to be held in Spring of 2001; FINAL
International Nuclear Information System (INIS)
Harwood, Caroline S.
2002-01-01
The 'Rhodopseudomonas palustris' genome workshop took place in Iowa City on April 6-8, 2001. The purpose of the meeting was to instruct members of the annotation working group in approaches to accomplishing the 'human' phase of the 'R. palustris' genome annotation. A partial draft of a paper describing the 'Rhodopseudomonas palustris' genome has been written and a full version of the paper should be ready for submission by the end of the summer 2002
-
Acclimation strategy of Rhodopseudomonas palustris to high light irradiance.
Muzziotti, Dayana; Adessi, Alessandra; Faraloni, Cecilia; Torzillo, Giuseppe; De Philippis, Roberto
2017-04-01
The ability of Rhodopseudomonas palustris cells to rapidly acclimate to high light irradiance is an essential issue when cells are grown under sunlight. The aim of this study was to investigate the photo-acclimation process in Rhodopseudomonas palustris 42OL under different culturing conditions: (i) anaerobic (AnG), (ii) aerobic (AG), and (iii) under H 2 -producing (HP) conditions both at low (LL) and high light (HL) irradiances. The results obtained clearly showed that the photosynthetic unit was significantly affected by the light irradiance at which Rp. palustris 42OL was grown. The synthesis of carotenoids was affected by both illumination and culturing conditions. At LL, lycopene was the main carotenoid synthetized under all conditions tested, while at HL under HP conditions, it resulted the predominant carotenoid. Oppositely, under AnG and AG at HL, rhodovibrin was the major carotenoid detected. The increase in light intensity produced a deeper variation in light-harvesting complexes (LHC) ratio. These findings are important for understanding the ecological distribution of PNSB in natural environments, mostly characterized by high light intensities, and for its growth outdoors. Copyright © 2017 Elsevier GmbH. All rights reserved.
-
Oda, Y; de Vries, YP; Forney, LJ; Gottschal, JC
2001-01-01
Three strains of Rhodopseudomonas palustris were isolated from phototrophic enrichment cultures containing 3-chlorobenzoate (3-CBA) and benzoate (BA). These new strains as well as several previously described strains of R. palustris were tested in this study and shown to degrade 3-CBA if grown in
-
Photometabolism of Heterocyclic Aromatic Compounds by Rhodopseudomonas palustris OU 11
Sasikala, C.; Ramana, C. V.; Rao, P. Raghuveer
1994-01-01
Rhodopseudomonas palustris OU 11 (ATCC 51186; DSM 7375) isolated from a pond of chemical industry effluent could anaerobically photometabolize heterocyclic aromatic compounds belonging to the pyridine and pyrazine groups only after a period of adaptation on pyrazinoic acid of 5 to 6 weeks. Growth on heterocyclic compounds was light dependent. The effects of various concentrations of heterocyclic compounds on growth suggest that higher concentrations of these compounds inhibit growth and are toxic. PMID:16349307
-
Batool, Kanza; Tuz Zahra, Fatima; Rehman, Yasir
2017-01-01
Arsenic (As) is a well-known toxic metalloid found naturally and released by different industries, especially in developing countries. Purple nonsulfur bacteria (PNSB) are known for wastewater treatment and plant growth promoting abilities. As-resistant PNSB were isolated from a fish pond. Based on As-resistance and plant growth promoting attributes, 2 isolates CS2 and SS5 were selected and identified as Rhodopseudomonas palustris and Rhodopseudomonas faecalis , respectively, through 16S rRNA gene sequencing. Maximum As(V) resistance shown by R. faecalis SS5 and R. palustris CS2 was up to 150 and 100 mM, respectively. R . palustris CS2 showed highest As(V) reduction up to 62.9% (6.29 ± 0.24 mM), while R. faecalis SS5 showed maximum As(III) oxidation up to 96% (4.8 ± 0.32 mM), respectively. Highest auxin production was observed by R. palustris CS2 and R. faecalis SS, up to 77.18 ± 3.7 and 76.67 ± 2.8 μ g mL -1 , respectively. Effects of these PNSB were tested on the growth of Vigna mungo plants. A statistically significant increase in growth was observed in plants inoculated with isolates compared to uninoculated plants, both in presence and in absence of As. R. palustris CS2 treated plants showed 17% (28.1 ± 0.87 cm) increase in shoot length and 21.7% (7.07 ± 0.42 cm) increase in root length, whereas R. faecalis SS5 treated plants showed 12.8% (27.09 ± 0.81 cm) increase in shoot length and 18.8% (6.9 ± 0.34 cm) increase in root length as compared to the control plants. In presence of As, R. palustris CS2 increased shoot length up to 26.3% (21.0 ± 1.1 cm), while root length increased up to 31.3% (5.3 ± 0.4 cm), whereas R. faecalis SS5 inoculated plants showed 25% (20.7 ± 1.4 cm) increase in shoot length and 33.3% (5.4 ± 0.65 cm) increase in root length as compared to the control plants. Bacteria with such diverse abilities could be ideal for plant growth promotion in As-contaminated sites.
-
The anaerobic phototrophic metabolism of 3-chlorobenzoate by Rhodopseudomonas palustris
Energy Technology Data Exchange (ETDEWEB)
Kamal, V S
1992-10-09
The degradation of chlorinated aromatic compounds by anaerobic bacteria is now known to be an important mechanism of bioremediation. In an experimental study, a mixed phototrophic culture was found to metabolize 3-chlorobenzoate in the presence of benzoate following adaptation on a benzoate and 3-chlorobenzoate medium for 7 weeks. The dominant bacterial isolate was identified as Rhodopseudomonas palustris. Radioisotopic studies showed [sup 14]C-3-chlorobenzoate was converted by the isolate to [sup 14]CO[sub 2] and cell biomass in the absence of oxygen and in the presence of a cosubstrate red light. Cyclohexane carboxylate was able to replace the cosubstrate, benzoate. The isolate also metabolized 3-chlorobenzoate in the presence of pimelic acid, sodium acetate, and sodium succinate; however, the metabolic rate was reduced. Gas chromatography mass spectrometry and high pressure liquid chromatography indicated the intracellular presence of 3-chlorobenzoate and benzoyl-CoA. Cell-free extracts produced benzoate and benzoyl-CoA. A probable route of 3-chlorobenzoate metabolism via dehalogenation followed by steps similar to the benzoate reductive ring fission pathway is suggested. Comparison of kinetic coefficients showed a higher affinity of the isolate for benzoate. Isolates from representative samples of various freshwater and wastewater ecosystems indicated widespread ecological distribution of R. palustris and the common occurrence of the 3-chlorobenzoate metabolic phenotype. R. palustris was found to grow in mixed anaerobic cultures and retained its 3-chlorobenzoate degradation property. 91 refs., 25 figs., 14 tabs.
-
Liu, Shuli; Zhang, Guangming; Li, Jianzheng; Li, Xiangkun; Zhang, Jie
2016-01-01
This work investigated the effects of eight metal ions on Rhodopseudomonas palustris growth and 5-aminolevulinic acid (ALA) yield in wastewater treatment. Results show that metal ions (Mg(2+) of 15 mmol/L, Fe(2+) of 400 μmol/L, Co(2+) of 4 μmol/L, Ni(2+) of 8 μmol/L and Zn(2+) of 4 μmol/L) could effectively improve the chemical oxygen demand (COD) removal, Rp. palustris biomass and ALA yield. The highest ALA yield of 13.1 mg/g-biomass was achieved with Fe(2+) of 400 μmol/L. ALA yields were differentially increased under different metal ions in the following order: Fe(2+) group > Mg(2+) group > Co(2+) group = Ni(2+) group > Zn(2+) group = Mo(2+) group > control. Cu(2+) and Mn(2+) inhibited Rp. palustris growth and ALA production. Mechanism analysis revealed that metal ions changed ALA yields by influencing the activities of ALA synthetase and ALA dehydratase.
-
Bi, Lei; Guan, Chun-jie; Yang, Guan-e; Yang, Fei; Yan, Hong-yu; Li, Qing-shan
2016-04-01
The purple photosynthetic bacterium Rhodopseudomonas palustris has been widely applied to enhance the therapeutic effects of traditional Chinese medicine using novel biotransformation technology. However, comprehensive studies of the R. palustris biotransformation mechanism are rare. Therefore, investigation of the expression patterns of genes involved in metabolic pathways that are active during the biotransformation process is essential to elucidate this complicated mechanism. To promote further study of the biotransformation of R. palustris, we assembled all R. palustris transcripts using Trinity software and performed differential expression analysis of the resulting unigenes. A total of 9725, 7341 and 10,963 unigenes were obtained by assembling the alpha-rhamnetin-3-rhamnoside-treated R. palustris (RPB) reads, control R. palustris (RPS) reads and combined RPB&RPS reads, respectively. A total of 9971 unigenes assembled from the RPB&RPS reads were mapped to the nr, nt, Swiss-Prot, Gene Ontology (GO), Clusters of Orthologous Groups (COGs) and Kyoto Encyclopedia of Genes and Genomes (KEGG) (E-value biotransformation in R. palustris. Furthermore, we propose two putative ARR biotransformation mechanisms in R. palustris. These analytical results represent a useful genomic resource for in-depth research into the molecular basis of biotransformation and genetic modification in R. palustris. Copyright © 2016 Elsevier GmbH. All rights reserved.
-
Inui, Masayuki; Roh, Jung Hyeob; Zahn, Kenneth; Yukawa, Hideaki
2000-01-01
A 15-kb cryptic plasmid was obtained from a natural isolate of Rhodopseudomonas palustris. The plasmid, designated pMG101, was able to replicate in R. palustris and in closely related strains of Bradyrhizobium japonicum and phototrophic Bradyrhizobium species. However, it was unable to replicate in the purple nonsulfur bacterium Rhodobacter sphaeroides and in Rhizobium species. The replication region of pMG101 was localized to a 3.0-kb SalI-XhoI fragment, and this fragment was stably maintained in R. palustris for over 100 generations in the absence of selection. The complete nucleotide sequence of this fragment revealed two open reading frames (ORFs), ORF1 and ORF2. The deduced amino acid sequence of ORF1 is similar to sequences of Par proteins, which mediate plasmid stability from certain plasmids, while ORF2 was identified as a putative rep gene, coding for an initiator of plasmid replication, based on homology with the Rep proteins of several other plasmids. The function of these sequences was studied by deletion mapping and gene disruptions of ORF1 and ORF2. pMG101-based Escherichia coli-R. palustris shuttle cloning vectors pMG103 and pMG105 were constructed and were stably maintained in R. palustris growing under nonselective conditions. The ability of plasmid pMG101 to replicate in R. palustris and its close phylogenetic relatives should enable broad application of these vectors within this group of α-proteobacteria. PMID:10618203
-
Directory of Open Access Journals (Sweden)
Chia-Wei Hu
Full Text Available BACKGROUND: Rhodopseudomonas palustris (R. palustris is a purple non-sulfur anoxygenic phototrophic bacterium that belongs to the class of proteobacteria. It is capable of absorbing atmospheric carbon dioxide and converting it to biomass via the process of photosynthesis and the Calvin-Benson-Bassham (CBB cycle. Transketolase is a key enzyme involved in the CBB cycle. Here, we reveal the functions of transketolase isoforms I and II in R. palustris using a systems biology approach. METHODOLOGY/PRINCIPAL FINDINGS: By measuring growth ability, we found that transketolase could enhance the autotrophic growth and biomass production of R. palustris. Microarray and real-time quantitative PCR revealed that transketolase isoforms I and II were involved in different carbon metabolic pathways. In addition, immunogold staining demonstrated that the two transketolase isoforms had different spatial localizations: transketolase I was primarily associated with the intracytoplasmic membrane (ICM but transketolase II was mostly distributed in the cytoplasm. Comparative proteomic analysis and network construction of transketolase over-expression and negative control (NC strains revealed that protein folding, transcriptional regulation, amino acid transport and CBB cycle-associated carbon metabolism were enriched in the transketolase I over-expressed strain. In contrast, ATP synthesis, carbohydrate transport, glycolysis-associated carbon metabolism and CBB cycle-associated carbon metabolism were enriched in the transketolase II over-expressed strain. Furthermore, ATP synthesis assays showed a significant increase in ATP synthesis in the transketolase II over-expressed strain. A PEPCK activity assay showed that PEPCK activity was higher in transketolase over-expressed strains than in the negative control strain. CONCLUSIONS/SIGNIFICANCE: Taken together, our results indicate that the two isoforms of transketolase in R. palustris could affect photoautotrophic growth
-
Hydrogen production under salt stress conditions by a freshwater Rhodopseudomonas palustris strain.
Adessi, Alessandra; Concato, Margherita; Sanchini, Andrea; Rossi, Federico; De Philippis, Roberto
2016-03-01
Hydrogen represents a possible alternative energy carrier to face the growing request for energy and the shortage of fossil fuels. Photofermentation for the production of H2 constitutes a promising way for integrating the production of energy with waste treatments. Many wastes are characterized by high salinity, and polluted seawater can as well be considered as a substrate. Moreover, the application of seawater for bacterial culturing is considered cost-effective. The aims of this study were to assess the capability of the metabolically versatile freshwater Rhodopseudomonas palustris 42OL of producing hydrogen on salt-containing substrates and to investigate its salt stress response strategy, never described before. R. palustris 42OL was able to produce hydrogen in media containing up to 3 % added salt concentration and to grow in media containing up to 4.5 % salinity without the addition of exogenous osmoprotectants. While the hydrogen production performances in absence of sea salts were higher than in their presence, there was no significant difference in performances between 1 and 2 % of added sea salts. Nitrogenase expression levels indicated that the enzyme was not directly inhibited during salt stress, but a regulation of its expression may have occurred in response to salt concentration increase. During cell growth and hydrogen production in the presence of salts, trehalose was accumulated as a compatible solute; it protected the enzymatic functionality against salt stress, thus allowing hydrogen production. The possibility of producing hydrogen on salt-containing substrates widens the range of wastes that can be efficiently used in production processes.
-
Zhang, Jian; Zhang, Wen-Xue; Li, Shun-Zhou; You, Ling; Zhang, Chao; Sun, Chuan-Ze; Liu, Xiao-Bin
2013-10-01
It is important to provide added value or to make full use of the co-product of grains from ethanol production. In order to convert distillers' grains into a high-quality feed, the Trichoderma viride and Rhodopseudomonas palustris fermentation were combined and investigated in this study. The T. viride fermentation was carried out in an aerobic fermentation installation in favoring of the growth of the fungi and the degradation of the cellulose, and then the fermentation of R. palustris was performed to increase the content of protein with an anaerobic installation. After the two step fermentations, the true protein content of dried distiller' grains increased from 11.4 to 33.6 % (w/w) (the content of crude protein from 14.5 to 39.7 %), the crude fiber content decreased from 21.3 to 7.6 % (w/w), the crude fat content increased from 5.5 to 7.9 % (w/w), the crude ash decreased from 14.6 to 10.2 % (w/w), the total phosphorus content increased from 0.4 to 1.2 % (w/w), and the water content was 11.8 % (w/w). The dried and fermented grains contain the R. palustris viable count of 5.3 × 10¹¹ CFU/g dry matter. The results may support a new application of an active photosynthetic bacteria fish feed in fisheries industry and offer a reference for the further study of lignocellulosic materials as raw materials converting into high-quality feed.
-
International Nuclear Information System (INIS)
Chi-Mei Lee; Kuo-Tsang Hung
2006-01-01
The possibility of utilizing the dark hydrogen fermentation stage effluents for photo hydrogen production using purple non-sulfur bacteria should be elucidated. In the previous experiments, Rhodopseudomonas palustris WP3-5 was proven to efficiently produce hydrogen from the effluent of hydrogen fermentation reactors. The highest hydrogen production rate was obtained at a HRT value of 48 h when feeding a 5 fold effluent dilution from anaerobic hydrogen fermentation. Besides, hydrogen production occurred only when the NH 4 + concentration was below 17 mg-NH 4 + /l. Therefore, for successful fermentation effluent utilization, the most important things were to decrease the optimal HRT, increase the optimal substrate concentration and increase the tolerable ammonia concentration. In this study, a lab-scale serial photo-bioreactor was constructed. The reactor overall hydrogen production efficiency with synthetic wastewater exhibiting an organic acid profile identical to that of anaerobic hydrogen fermentation reactor effluent and with effluent from two anaerobic hydrogen fermentation reactors was evaluated. (authors)
-
Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie
2012-01-01
Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations.
-
Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie
2012-01-01
Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations. PMID:23251623
-
Miller, Anthony R.; North, Justin A.; Wildenthal, John A.
2018-01-01
ABSTRACT 5′-Methyl-thioadenosine (MTA) is a dead-end, sulfur-containing metabolite and cellular inhibitor that arises from S-adenosyl-l-methionine-dependent reactions. Recent studies have indicated that there are diverse bacterial methionine salvage pathways (MSPs) for MTA detoxification and sulfur salvage. Here, via a combination of gene deletions and directed metabolite detection studies, we report that under aerobic conditions the facultatively anaerobic bacterium Rhodopseudomonas palustris employs both an MTA-isoprenoid shunt identical to that previously described in Rhodospirillum rubrum and a second novel MSP, both of which generate a methanethiol intermediate. The additional R. palustris aerobic MSP, a dihydroxyacetone phosphate (DHAP)-methanethiol shunt, initially converts MTA to 2-(methylthio)ethanol and DHAP. This is identical to the initial steps of the recently reported anaerobic ethylene-forming MSP, the DHAP-ethylene shunt. The aerobic DHAP-methanethiol shunt then further metabolizes 2-(methylthio)ethanol to methanethiol, which can be directly utilized by O-acetyl-l-homoserine sulfhydrylase to regenerate methionine. This is in contrast to the anaerobic DHAP-ethylene shunt, which metabolizes 2-(methylthio)ethanol to ethylene and an unknown organo-sulfur intermediate, revealing functional diversity in MSPs utilizing a 2-(methylthio)ethanol intermediate. When MTA was fed to aerobically growing cells, the rate of volatile methanethiol release was constant irrespective of the presence of sulfate, suggesting a general housekeeping function for these MSPs up through the methanethiol production step. Methanethiol and dimethyl sulfide (DMS), two of the most important compounds of the global sulfur cycle, appear to arise not only from marine ecosystems but from terrestrial ones as well. These results reveal a possible route by which methanethiol might be biologically produced in soil and freshwater environments. PMID:29636438
-
Jackson, Philip J; Hitchcock, Andrew; Swainsbury, David J K; Qian, Pu; Martin, Elizabeth C; Farmer, David A; Dickman, Mark J; Canniffe, Daniel P; Hunter, C Neil
2018-02-01
The X-ray crystal structure of the Rhodopseudomonas (Rps.) palustris reaction center-light harvesting 1 (RC-LH1) core complex revealed the presence of a sixth protein component, variably referred to in the literature as helix W, subunit W or protein W. The position of this protein prevents closure of the LH1 ring, possibly to allow diffusion of ubiquinone/ubiquinol between the RC and the cytochrome bc 1 complex in analogous fashion to the well-studied PufX protein from Rhodobacter sphaeroides. The identity and function of helix W have remained unknown for over 13years; here we use a combination of biochemistry, mass spectrometry, molecular genetics and electron microscopy to identify this protein as RPA4402 in Rps. palustris CGA009. Protein W shares key conserved sequence features with PufX homologs, and although a deletion mutant was able to grow under photosynthetic conditions with no discernible phenotype, we show that a tagged version of protein W pulls down the RC-LH1 complex. Protein W is not encoded in the photosynthesis gene cluster and our data indicate that only approximately 10% of wild-type Rps. palustris core complexes contain this non-essential subunit; functional and evolutionary consequences of this observation are discussed. The ability to purify uniform RC-LH1 and RC-LH1-protein W preparations will also be beneficial for future structural studies of these bacterial core complexes. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.
-
Directory of Open Access Journals (Sweden)
Tatiana V Karpinets
Full Text Available Anaerobic degradation of complex organic compounds by microorganisms is crucial for development of innovative biotechnologies for bioethanol production and for efficient degradation of environmental pollutants. In natural environments, the degradation is usually accomplished by syntrophic consortia comprised of different bacterial species. This strategy allows consortium organisms to reduce efforts required for maintenance of the redox homeostasis at each syntrophic level. Cellular mechanisms that maintain the redox homeostasis during the degradation of aromatic compounds by one organism are not fully understood. Here we present a hypothesis that the metabolically versatile phototrophic bacterium Rhodopseudomonas palustris forms its own syntrophic consortia, when it grows anaerobically on p-coumarate or benzoate as a sole carbon source. We have revealed the consortia from large-scale measurements of mRNA and protein expressions under p-coumarate, benzoate and succinate degrading conditions using a novel computational approach referred as phenotype fingerprinting. In this approach, marker genes for known R. palustris phenotypes are employed to determine the relative expression levels of genes and proteins in aromatics versus non-aromatics degrading condition. Subpopulations of the consortia are inferred from the expression of phenotypes and known metabolic modes of the R. palustris growth. We find that p-coumarate degrading conditions may lead to at least three R. palustris subpopulations utilizing p-coumarate, benzoate, and CO2 and H2. Benzoate degrading conditions may also produce at least three subpopulations utilizing benzoate, CO2 and H2, and N2 and formate. Communication among syntrophs and inter-syntrophic dynamics in each consortium are indicated by up-regulation of transporters and genes involved in the curli formation and chemotaxis. The N2-fixing subpopulation in the benzoate degrading consortium has preferential activation of the
-
Bernstein, Jeffrey R; Bulter, Thomas; Liao, James C
2008-01-01
This work demonstrates the transfer of the five-gene cyclohexane carboxylate (CHC) degradation pathway from the high-GC alphaproteobacterium Rhodopseudomonas palustris to Escherichia coli, a gammaproteobacterium. The degradation product of this pathway is pimeloyl-CoA, a key metabolite in E. coli's biotin biosynthetic pathway. This pathway is useful for biotin overproduction in E. coli; however, the expression of GC-rich genes is troublesome in this host. When the native R. palustris CHC degradation pathway is transferred to a DeltabioH pimeloyl-CoA auxotroph of E. coli, it is unable to complement growth in the presence of CHC. To overcome this expression problem we redesigned the operon with decreased GC content and removed stretches of high-GC intergenic DNA which comprise the 5' untranslated region of each gene, replacing these features with shorter low-GC sequences. We show this synthetic construct enables growth of the DeltabioH strain in the presence of CHC. When the synthetic degradation pathway is overexpressed in conjunction with the downstream genes for biotin biosynthesis, we measured significant accumulation of biotin in the growth medium, showing that the pathway transfer is successfully integrated with the host metabolism.
-
Energy Technology Data Exchange (ETDEWEB)
Jamil, Zadariana [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia); Faculty of Civil Engineering, Technology University of MARA (Malaysia); Mohamad Annuar, Mohamad Suffian; Vikineswary, S. [Institute of Biological Sciences, University of Malaya (Malaysia); Ibrahim, Shaliza [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia)
2009-09-15
Phototrophic hydrogen production by indigenous purple non-sulfur bacteria, Rhodopseudomonas palustris PBUM001 from palm oil mill effluent (POME) was optimized using response surface methodology (RSM). The process parameters studied include inoculum sizes (% v/v), POME concentration (% v/v), light intensity (klux), agitation (rpm) and pH. The experimental data on cumulative hydrogen production and COD reduction were fitted into a quadratic polynomial model using response surface regression analysis. The path to optimal process conditions was determined by analyzing response surface three-dimensional surface plot and contour plot. Statistical analysis on experimental data collected following Box-Behnken design showed that 100% (v/v) POME concentration, 10% (v/v) inoculum size, light intensity at 4.0 klux, agitation rate at 250 rpm and pH of 6 were the best conditions. The maximum predicted cumulative hydrogen production and COD reduction obtained under these conditions was 1.05 ml H{sub 2}/ml POME and 31.71% respectively. Subsequent verification experiments at optimal process values gave the maximum yield of cumulative hydrogen at 0.66 {+-} 0.07 ml H{sub 2}/ml POME and COD reduction at 30.54 {+-} 9.85%. (author)
-
Wong, Wai-Tak; Tseng, Ching-Han; Hsu, Shu-Hua; Lur, Huu-Sheng; Mo, Chia-Wei; Huang, Chu-Ning; Hsu, Shu-Chiung; Lee, Kung-Ta; Liu, Chi-Te
2014-09-17
Several Rhodopseudomonas palustris strains have been isolated from rice paddy fields in Taiwan by combining the Winogradsky column method and molecular marker detection. These isolates were initially screened by employing seed germination and seedling vigor assays to evaluate their potential as inoculants. To fulfill the demand in the present farming system for reducing the application of chemical fertilizers, we assessed the plant growth-promoting effects of the R. palustris YSC3, YSC4, and PS3 inoculants on Brassica rapa chinensis (Chinese cabbage) cultivated under a half quantity of fertilizer. The results obtained showed that supplementation with approximately 4.0×10(6) CFU g(-1) soil of the PS3 inoculant at half the amount of fertilizer consistently produced the same plant growth potential as 100% fertility, and also increased the nitrogen use efficiency of the applied fertilizer nutrients. Furthermore, we noted that the plant growth-promotion rate elicited by PS3 was markedly higher with old seeds than with new seeds, suggesting it has the potential to boost the development of seedlings that were germinated from carry-over seeds of poor quality. These beneficial traits suggest that the PS3 isolate may serve as a potential PGPR inoculant for integrated nutrient management in agriculture.
-
Heiniger, Erin K.; Oda, Yasuhiro; Samanta, Sudip K.
2012-01-01
Nitrogenase catalyzes the conversion of dinitrogen gas (N2) and protons to ammonia and hydrogen gas (H2). This is a catalytically difficult reaction that requires large amounts of ATP and reducing power. Thus, nitrogenase is not normally expressed or active in bacteria grown with a readily utilized nitrogen source like ammonium. nifA* mutants of the purple nonsulfur phototrophic bacterium Rhodopseudomonas palustris have been described that express nitrogenase genes constitutively and produce H2 when grown with ammonium as a nitrogen source. This raised the regulatory paradox of why these mutants are apparently resistant to a known posttranslational modification system that should switch off the activity of nitrogenase. Microarray, mutation analysis, and gene expression studies showed that posttranslational regulation of nitrogenase activity in R. palustris depends on two proteins: DraT2, an ADP-ribosyltransferase, and GlnK2, an NtrC-regulated PII protein. GlnK2 was not well expressed in ammonium-grown NifA* cells and thus not available to activate the DraT2 nitrogenase modification enzyme. In addition, the NifA* strain had elevated nitrogenase activity due to overexpression of the nif genes, and this increased amount of expression overwhelmed a basal level of activity of DraT2 in ammonium-grown cells. Thus, insufficient levels of both GlnK2 and DraT2 allow H2 production by an nifA* mutant grown with ammonium. Inactivation of the nitrogenase posttranslational modification system by mutation of draT2 resulted in increased H2 production by ammonium-grown NifA* cells. PMID:22179236
-
Brotosudarmo, Tatas H P; Kunz, Ralf; Böhm, Paul; Gardiner, Alastair T; Moulisová, Vladimíra; Cogdell, Richard J; Köhler, Jürgen
2009-09-02
Rhodopseudomonas palustris belongs to the group of purple bacteria that have the ability to produce LH2 complexes with unusual absorption spectra when they are grown at low-light intensity. This ability is often related to the presence of multiple genes encoding the antenna apoproteins. Here we report, for the first time to our knowledge, direct evidence that individual low-light LH2 complexes have a heterogeneous alphabeta-apoprotein composition that modulates the site energies of Bchl a molecules, producing absorption bands at 800, 820, and 850 nm. The arrangement of the Bchl a molecules in the "tightly coupled ring" can be modeled by nine alphabeta-Bchls dimers, such that the Bchls bound to six alphabeta-pairs have B820-like site energies and the remaining Bchl a molecules have B850-like site energies. Furthermore, the experimental data can only be satisfactorily modeled when these six alphabeta-pairs with B820 Bchl a molecules are distributed such that the symmetry of the assembly is reduced to C(3). It is also clear from the measured single-molecule spectra that the energies of the electronically excited states in the mixed B820/850 ring are mainly influenced by diagonal disorder.
-
Kanno, Nanako; Matsuura, Katsumi; Haruta, Shin
2018-03-29
Purple photosynthetic bacteria utilize light energy for growth. We previously demonstrated that light energy contributed to prolonging the survival of multiple purple bacteria under carbon-starved conditions. In order to clarify the effects of illumination on metabolic states under carbon-starved, non-growing conditions, we herein compared the metabolic profiles of starved cells in the light and dark using the purple bacterium, Rhodopseudomonas palustris. The metabolic profiles of starved cells in the light were markedly different from those in the dark. After starvation for 5 d in the light, cells showed increases in the amount of ATP and the NAD + /NADH ratio. Decreases in the amounts of most metabolites related to glycolysis and the TCA cycle in energy-rich starved cells suggest the active utilization of these metabolites for the modification of cellular components. Starvation in the dark induced the consumption of cellular compounds such as amino acids, indicating that the degradation of these cellular components produced ATP in order to maintain viability under energy-poor conditions. The present results suggest that intracellular energy levels alter survival strategies under carbon-starved conditions through metabolism.
-
Luo, Xiangwen; Zhang, Deyong; Zhou, Xuguo; Du, Jiao; Zhang, Songbai; Liu, Yong
2018-05-09
Full length open reading frame of pyrethroid detoxification gene, Est3385, contains 963 nucleotides. This gene was identified and cloned based on the genome sequence of Rhodopseudomonas palustris PSB-S available at the GneBank. The predicted amino acid sequence of Est3385 shared moderate identities (30-46%) with the known homologous esterases. Phylogenetic analysis revealed that Est3385 was a member in the esterase family I. Recombinant Est3385 was heterologous expressed in E. coli, purified and characterized for its substrate specificity, kinetics and stability under various conditions. The optimal temperature and pH for Est3385 were 35 °C and 6.0, respectively. This enzyme could detoxify various pyrethroid pesticides and degrade the optimal substrate fenpropathrin with a Km and Vmax value of 0.734 ± 0.013 mmol·l -1 and 0.918 ± 0.025 U·µg -1 , respectively. No cofactor was found to affect Est3385 activity but substantial reduction of enzymatic activity was observed when metal ions were applied. Taken together, a new pyrethroid degradation esterase was identified and characterized. Modification of Est3385 with protein engineering toolsets should enhance its potential for field application to reduce the pesticide residue from agroecosystems.
-
Energy Technology Data Exchange (ETDEWEB)
Piskorska, M. [Univ. of South Carolina, Aiken, SC (United States); Soule, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Gosse, J. L. [North Carolina State Univ., Raleigh, NC (United States); Milliken, C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Flickinger, M. C. [North Carolina State Univ., Raleigh, NC (United States); Smith, G. W. [Univ. of South Carolina, Aiken, SC (United States); Yeager, C. M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2013-01-21
To assess the applicability of latex cell coatings as an ‘off-the-shelf’ biocatalyst, the effect of osmoprotectants, temperature, humidity and O2 on preservation of H2 production in Rhodopseudomonas palustris coatings was evaluated. Immediately following latex coating coalescence (24 h) and for up to 2 weeks of dry storage, rehydrated coatings containing different osmoprotectants displayed similar rates of H2 production. Beyond 2 weeks of storage, sorbitol-treated coatings lost all H2 production activity, whereas considerable H2 production was still detected in sucrose- and trehalose-stabilized coatings. The relative humidity level at which the coatings were stored had a significant impact on the recovery and subsequent rates of H2 production. After 4 weeks storage under air at 60% humidity, coatings produced only trace amounts of H2 (0–0.1% headspace accumulation), whereas those stored at < 5% humidity retained 27–53% of their H2 production activity after 8 weeks of storage. In conWhen stored in argon at < 5% humidity and room temperature, R. palustris coatings retained full H2 production activity for 3 months, implicating oxidative damage as a key factor limiting coating storage. Overall, the results demonstrate that biocatalytic latex coatings are an attractive cell immobilization platform for preservation of bioactivity in the dry state.
-
Directory of Open Access Journals (Sweden)
Krishnaveni Venkidusamy
2016-07-01
Full Text Available An electrophototrophic, hydrocarbonoclastic bacterium Rhodopseudomonas palustris stain RP2 was isolated from the anodic biofilms of hydrocarbon fed microbial electrochemical remediation systems (MERS. Salient properties of the strain RP2 were direct electrode respiration, dissimilatory metal oxide reduction, spore formation, anaerobic nitrate reduction, free living diazotrophy and the ability to degrade n-alkane components of petroleum hydrocarbons in anoxic, photic environments. In acetate fed microbial electrochemical cells, a maximum current density of 305±10 mA/m2 (1000Ω was generated (power density 131.65±10 mW/m2 by strain RP2 with a coulombic efficiency of 46.7 ± 1.3%. Cyclic voltammetry studies showed that anaerobically grown cells of strain RP2 is electrochemically active and likely to transfer electrons extracellularly to solid electron acceptors through membrane bound compounds, however, aerobically grown cells lacked the electrochemical activity. The ability of strain RP2 to produce current (maximum current density 21±3 mA/m2; power density 720±7 µW/m2, 1000Ω using petroleum hydrocarbon (PH as a sole energy source was also examined using an initial concentration of 800 mg l-1 of diesel range hydrocarbons (C9- C36 with a concomitant removal of 47.4 ± 2.7% hydrocarbons in MERS. Here, we also report the first study that shows an initial evidence for the existence of a hydrocarbonoclastic behavior in the strain RP2 when grown in different electron accepting and illuminated conditions (anaerobic and MERS degradation. Such observations reveal the importance of photoorganotrophic growth in the utilization of hydrocarbons from contaminated environments. Identification of such novel petrochemical hydrocarbon degrading electricigens, not only expands the knowledge on the range of bacteria known for the hydrocarbon bioremediation but also shows a biotechnological potential that goes well beyond its applications to MERS.
-
International Nuclear Information System (INIS)
Pintucci, Cristina; Padovani, Giulia; Giovannelli, Alessio; Traversi, Maria Laura; Ena, Alba; Pushparaj, Benjamin; Carlozzi, Pietro
2015-01-01
Highlights: • Adsorbent matrices to convert fresh olive mill wastewater (OMW F ) in feedstock. • Dry-Azolla and granular active carbon for adsorbing polyphenols from OMW F . • Photofermentative processes for biohydrogen production. • Culture mixing by means of an impeller or a magnetic stir bar. • A 30% of dephenolised OMW containing medium suits the photofermentative process. - Abstract: Increasing costs of petroleum, associated with the escalating problems of global climate change, require always greater efforts in order to produce an energy carrier as bioH 2 . In this study, bioH 2 production using photofermentative process was investigated. Two culture broths were used: (a) a synthetic medium rich in sugars (glucose and fructose) and (b) a pre-treated fresh olive-mill wastewater (OMW F ) diluted with water (30%, v:v). The pre-treatment was carried out using two different vegetable matrices (dry-Azolla and granular active carbon) to decrease both the content of polyphenols and the dark colour of wastewater. Rhodopseudomonas palustris 6A isolated from soil spread with OMW was utilized for batch growth experiments, carried out indoors under continuous light (200 μE/m 2 /s). When synthetic medium was used, the culture mixing was performed using either (i) a magnetic stir bar, and (ii) an impeller equipped with five turbines. The latter system made it possible to increase the bioH 2 photo-evolution by 1.4 times. The specific hydrogen photo-evolution rate was 13.5 mL/g(dw)/h in the broth containing diluted OMW F and 11.8 mL/g(dw)/h in the synthetic medium containing sugars (glucose and fructose)
-
Hirakawa, Hidetada; Schaefer, Amy L; Greenberg, E Peter; Harwood, Caroline S
2012-04-01
The phenylpropanoid p-coumarate and structurally related aromatic compounds are produced in large amounts by green plants and are excellent carbon sources for many soil bacteria. Aerobic bacteria remove the acyl side chain from phenylpropanoids to leave an aromatic aldehyde, which then enters one of several possible central pathways of benzene ring degradation. We investigated the pathway for the anaerobic degradation of p-coumarate by the phototrophic bacterium Rhodopseudomonas palustris and found that it also follows this metabolic logic. We characterized enzymes for the conversion of p-coumarate to p-hydroxybenzaldehyde and acetyl coenzyme A (acetyl-CoA) encoded by the couAB operon. We also identified a MarR family transcriptional regulator that we named CouR. A couR mutant had elevated couAB expression. In addition, His-tagged CouR bound with high affinity to a DNA fragment encompassing the couAB promoter region, and binding was abrogated by the addition of nanomolar quantities of p-coumaroyl-CoA but not by p-coumarate. Footprinting demonstrated binding of CouR to an inverted repeat sequence that overlaps the -10 region of the couAB promoter. Our results provide evidence for binding of a CoA-modified aromatic compound by a MarR family member. Although the MarR family is widely distributed in bacteria and archaea and includes over 12,000 members, ligands have been identified for relatively few family members. Here we provide biochemical evidence for a new category of MarR ligand.
-
ORF Alignment: NC_004757 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Rhodopseudomonas palustris CGA009] ... Length = 102 ... Query: 14 ... ...MRDGEFLVSKTTAKGVITYINEPFIRMSGFTEQELVGQAHNIIRHPDMPPEAFADFWNTL 73 ... + DG ++VSKT ... KG +TY NE F++ SGF+EQ
-
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Rhodopseudomonas palustris CGA009] ... Length = 150 ... Query: 1 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSD...RHFRRSGMDYLDQVSIVRHD 60 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSD...RHFRRSGMDYLDQVSIVRHD Sbjct: 1 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSDRHFRRSGMDYLDQVSIVRHD 60 ... Qu
-
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Query: 350 RNEMTARRIVTADHTILVSGSGYVPKGDLTVDGKDNPEAVSSAMQLVRSALLCNDAQLRP 409 ... RNEMTARRIVTADHT...ILVSGSGYVPKGDLTVDGKDNPEAVSSAMQLVRSALLCNDAQLRP Sbjct: 1 ... RNEMTARRIVTADHTILVSGSGYVPKGDL... ... cation-transporting P-type ATPase [Rhodopseudomonas ... palustris CGA009] ... Length = 203 ...
-
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available clase ... (GGDEF) [Rhodopseudomonas palustris CGA009] ... Length = 124 ... Query: 353 PDILWHETYACGEPTIDAQHRELFDLANVILGPEI...EMLEPARLSELVELLLTRVAEHFQY 412 ... PDILWHETYACGEPTIDAQHRELFDLANVILGPEI...EMLEPARLSELVELLLTRVAEHFQY Sbjct: 1 ... PDILWHETYACGEPTIDAQHRELFDLANVILGPEIEMLEPARLSELVELLLTRVAEHFQY 60 ... Query: 473 DRRF 476 ... DRRF Sbjct: 121 DRRF 124
-
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...
-
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...
-
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...
-
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...
-
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T
-
ORF Alignment: NC_002939 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T
-
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T
-
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy
-
ORF Alignment: NC_002939 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy
-
Variability of Caltha palustris L. populations in garden culture
Directory of Open Access Journals (Sweden)
Krystyna Falińska
2014-01-01
Full Text Available On the basis of studies performed in the experimental garden the character of the variability of Caltha palustris L. populations is described. Individuals were bred under uniform conditions from diaspores of meadow, springwood, flood-plain forest and alder forest populations. The results obtained allow to evaluate the hypothesis concerning the ecological preference of cytotypes (S m i t 1967, 1968 and the somewhat different ecological requirements of two subspecies: C. palustris ssp. palustris and C. palustris ssp. cornuta. It was found that each population includes individuals with different cytotypes. The situation is similar as far as subspecies are concerned, distinguished on the basis of fruit morphology (Fig. 1. It should be stressed, however, that, investigations of many years duration raised serious doubts as to the diagnostic value of fruit morphology (Figs. 2, 3. On the basis of the preserved differences between the populations in shoot habitus, reproduction and phenology in garden culture, a springwood and an alder forest ecotype were distinguished. Meadow and flood-plain populations exhibited a transitional character with certain similarities both to the alder forest and to the springwood populations.
-
Molecular Regulation of Photosynthetic Carbon Dioxide Fixation in Nonsulfur Purple Bacteria
Energy Technology Data Exchange (ETDEWEB)
Tabita, Fred Robert [The Ohio State Univ., Columbus, OH (United States)
2015-12-01
The overall objective of this project is to determine the mechanism by which a transcriptional activator protein affects CO2 fixation (cbb) gene expression in nonsulfur purple photosynthetic bacteria, with special emphasis to Rhodobacter sphaeroides and with comparison to Rhodopseudomonas palustris. These studies culminated in several publications which indicated that additional regulators interact with the master regulator CbbR in both R. sphaeroides and R. palustris. In addition, the interactive control of the carbon and nitrogen assimilatory pathways was studied and unique regulatory signals were discovered.
-
Directory of Open Access Journals (Sweden)
Richard Hrivnák
2015-10-01
Full Text Available Open and species-poor stands with a dominance of Alisma lanceolatum were recorded in periodically flooded habitats of the southern part of central Slovakia (Ipeľ River catchment area during the summer of 2013. Phytosociological relevés correspond to the association Eleocharito palustris-Alismatetum lanceolati (alliance Eleocharito palustris-Sagittarion sagittifoliae, which is reported and documented here for the first time from the territory of Slovakia. It inhabits predominantly temporarily flooded depressions on agricultural land – wet arable fields and extensively used pastures. Detrended correspondence analysis showed that the variability in species composition was most significantly influenced by water depth, the presence of arable fields in the contact area and water conductivity. Special attention was paid to a detailed description of the floristic composition, habitat requirements, distribution patterns and nomenclature of the community.
-
Louisiana’s Palustris Experimental Forest: 75 years of research that transformed the South
James P. Barnett; James D. Haywood; Henry A. Pearson
2011-01-01
The Palustris Experimental Forest, located on Kisatchie National Forest, has been in existence for 75 years. Research at Palustris has focused on southern pine reforestation technology, including seed production, bareroot nursery production, direct seeding, and planting container seedlings. After establishing pine plantations, researchers developed stand management...
-
Rutkauskas, D.; Novoderezkhin, V.; Cogdell, R.J.; van Grondelle, R.
2004-01-01
We have investigated the energy landscape of the bacterial photosynthetic peripheral light-harvesting complex LH2 of purple bacterium Rhodopseudomonas acidophila by monitoring sequences of fluorescence spectra of single LH2 assemblies, at room temperature, with different excitation intensities as
-
Ecosystem carbon stocks in Pinus palustris forests
Lisa Samuelson; Tom Stokes; John R. Butnor; Kurt H. Johnsen; Carlos A. Gonzalez-Benecke; Pete Anderson; Jason Jackson; Lorenzo Ferrari; Tim A. Martin; Wendell P. Cropper
2014-01-01
Longleaf pine (Pinus palustris Mill.) restoration in the southeastern United States offers opportunities for carbon (C) sequestration. Ecosystem C stocks are not well understood in longleaf pine forests, which are typically of low density and maintained by prescribed fire. The objectives of this research were to develop allometric equations for...
-
Characteristics of purple nonsulfur bacteria grown under Stevia residue extractions.
Xu, J; Feng, Y; Wang, Y; Lin, X
2013-11-01
As a consequence of the large-scale cultivation of Stevia plants, releases of plant residues, the byproduct after sweetener extraction, to the environment are inevitable. Stevia residue and its effluent after batching up contain large amounts of organic matters with small molecular weight, which therefore are a potential pollution source. Meanwhile, they are favourite substrates for micro-organism growths. This investigation was aimed to utilize the simulated effluent of Stevia residue to enrich the representative purple nonsulfur bacterium (PNSB), Rhodopseudomonas palustris (Rps. palustris), which has important economic values. The growth profile and quality of Rps. palustris were characterized by spectrophotometry, compared to those grown in common PNSB mineral synthetic medium. Our results revealed that the simulated effluent of Stevia residue not only stimulated Rps. palustris growth to a greater extent, but also increased its physiologically active cytochrome concentrations and excreted indole-3-acetic acid (IAA) content. This variation in phenotype of Rps. palustris could result from the shift in its genotype, further revealed by the repetitive sequence-based PCR (rep-PCR) fingerprinting analysis. Our results showed that the effluent of Stevia residue was a promising substrate for microbial growth. © 2013 The Society for Applied Microbiology.
-
Moessbauer spectroscopy on the reaction center of Rhodopseudomonas viridis
International Nuclear Information System (INIS)
Frolov, E.; Goldanskii, V.I.; Birk, A.; Parak, F.; Fritzsch, G.; Sinning, I.; Michel, H.
1992-01-01
Proteins called 'reaction centers' (RC) can be isolated from many photosynthetic bacteria. They have one non-heme iron in a quinone acceptor region. The RC of Rhodopseudomonas viridis contains an additional tightly bound tetra-heme cytochrome c subunit. The electronic configuration of both cytochrome and the non-heme iron has been studied in the crystallized protein by Moessbauer spectroscopy at different redox potentials, pH-values, and with an addition of o-phenanthroline. At high potentials (E h =+500 mV) all heme irons are in the low spin Fe 3+ -state, and at low potential (E h = 1 50 mV) they are low spin Fe 2+ with the same Moessbauer parameters for all hemes independent of pH. Redox titrations change the relative area of the reduced and oxidized states in agreement with other methods. The non-heme iron shows a high spin Fe 2+ configuration independent of E h and pH with parameters comparable to those of Rhodopseudomonas sphaeroides. Surprisingly, there is strong evidence for another non-heme iron species in part of the molecules with a Fe 2+ low spin configuration. Incubation with o-phenanthroline decreases the relative Fe 2+ hs-area and increases the contribution of Fe 2+ ls-area. Above 210 K the mean square displacement, 2 >, of the RC-crystals increases more than linearly with temperature. This may be correlated with the increase of the electron transfer rate and indicates that intramolecular mobility influences the functional activity of a protein. (orig.)
-
Development of antioxidative effect in ice cream with Kalakai (Stenochlaena palustris) water extract
Hadhiwaluyo, Kristania; Rahmawati, Della; Gunawan Puteri, Maria D. P. T.
2017-11-01
Kalakai (Stenochlaena. palustris) extract was used to develop the ice cream. The antioxidant activity of the extracts and its stability over process and storage were evaluated through various antioxidant assay including DPPH assay, Folin-Ciocalteau assay and aluminum chloride colorimetric method. In general, the leaves of S. palustris had a significantly higher antioxidant activity (p ice cream without affecting the sensory properties of the ice cream. In addition, the high phenolic and flavonoid content also suggest the more compounds that were capable to act as an antioxidant. The result of the stability test also suggested the ability low temperature storage and processing in maintaining the stability of the antioxidant activity of the extract (p > 0.05) over processing and storage. Thus, this strengthen the feasibility of S. palustris to be used as a potential functional food ingredient that is low cost and easily accessible with an antioxidant activity and safe iron content that is beneficial to increase the quality of food produced including in ice cream.
-
Aberrante Epigynenbildungen bei der Wolfspinne Pardosa palustris (Araneae, Lycosidae
Directory of Open Access Journals (Sweden)
Martin, Dieter
2013-11-01
Full Text Available Two cases of aberrant epigyne shape in Pardosa palustris (Linnaeus, 1758 are described. Characteristic is the absence of the posterior lateral parts of the septum. Possible causes, such as `genital damage` during mating or the effects of parasite infestation, are discussed.
-
Energy Technology Data Exchange (ETDEWEB)
Harwood, Caroline S
2012-12-17
The goal of this project is to identify gene networks that are critical for efficient biohydrogen production by leveraging variation in gene content and gene expression in independently isolated Rhodopseudomonas palustris strains. Coexpression methods were applied to large data sets that we have collected to define probabilistic causal gene networks. To our knowledge this a first systems level approach that takes advantage of strain-to strain variability to computationally define networks critical for a particular bacterial phenotypic trait.
-
Baier, J; Gabrielsen, M; Oellerich, S; Michel, H; van Heel, M; Cogdell, R J; Köhler, J
2009-11-04
We have investigated the spectral diffusion and the electron-phonon coupling of B800 bacteriochlorophyll a molecules in the peripheral light-harvesting complex LH2 for three different species of purple bacteria, Rhodobacter sphaeroides, Rhodospirillum molischianum, and Rhodopseudomonas acidophila. We come to the conclusion that B800 binding pockets for Rhodobacter sphaeroides and Rhodopseudomonas acidophila are rather similar with respect to the polarity of the protein environment but that the packaging of the alphabeta-polypeptides seems to be less tight in Rb. sphaeroides with respect to the other two species.
-
?-Oryzanols of North American Wild Rice (Zizania palustris)
Aladedunye, Felix; Przybylski, Roman; Rudzinska, Magdalena; Klensporf-Pawlik, Dorota
2013-01-01
?-Oryzanol, a natural mixture of ferulic acid esters of triterpene alcohols and sterols, are an important bioactive components present in rice bran oil. In light of the recent increase in the popularity of wild rice among consumers, and the possibility of a direct relationship between ?-oryzanol composition and its bioactivity, the oryzanol profile of major wild rice (Zizania palustris) grown in North America was studied and compared to regular brown rice (Oryza sativa L.). A total of twenty-...
-
Arsenic biotransformation and volatilization in transgenic rice
Meng, Xiang-Yan; Qin, Jie; Wang, Li-Hong; Duan, Gui-Lan; Sun, Guo-Xin; Wu, Hui-Lan; Chu, Cheng-Cai; Ling, Hong-Qing; Rosen, Barry P.; Zhu, Yong-Guan
2011-01-01
Summary Biotransformation of arsenic includes oxidation, reduction, methylation and conversion to more complex organic arsenicals. Members of the class of arsenite [As(III)] S-adenosylmethyltransferase enzymes catalyze As(III) methylation to a variety of mono-, di- and trimethylated species, some of which are less toxic than As(III) itself. However, no methyltransferase gene has been identified in plants. Here, an arsM gene from the soil bacterium Rhodopseudomonas palustris was expressed in Japonica rice (Oryza sativa L.) cultivar Nipponbare, and the transgenic rice produced methylated arsenic species, which were measured by inductively coupled plasma mass spectrometry (ICP-MS) and high performance liquid chromatography-inductively coupled plasma-mass spectrometry (HPLC-ICP-MS). Both monomethylarsenate [MAs(V)] and dimethylarsenate [DMAs(V)] were detected in the root and shoot of transgenic rice. After 12-d exposure to As(III), the transgenic rice gave off 10-fold more volatile arsenicals. The present study demonstrates that expression of an arsM gene in rice induces arsenic methylation and volatilization, providing a potential stratagem for phytoremediation theoretically. PMID:21517874
-
International Nuclear Information System (INIS)
Maudinas, B.; Chemardin, M.; Yovanovitch, E.; Gadal, P.
1981-01-01
An all glass tight growth chamber, entirely sterilizable, has been constructed to carry out axenic and gnotobiotic cultures of rice plants (Oryza sativa L.). When grown in liquid medium and in the absence of combined nitrogen but in the presence of the diazotrophs Azotobacter vinelandii and Rhodopseudomonas capsulata, rice plants exhibited a complete biological cycle from germination up to ear stage, during a period of time similiar to the one encountered in French paddy soil of Camargue. In one experiment, mannitol was given to rice culture medium together with Azotobacter vinelandii and Rhodopseudomonas capsulata. In another experiment, mannitol was not given together with Rhodopseudomonas, and still positive nitrogen gain was obtained, although it was less than culture with mannitol. When 15 N labeled cells of Rhodopseudomonas were added in rice culture medium, 15 N was partly transferred to rice plant. Among the nitrogen substances excreted from the bacteria in the rhizosphere medium, large organic molecules were shown to be the most abundant in our experimental conditions. Moreover, the concentration of free ammonia or aminoacids present in the rice rhizosphere were always compatible with a bacterial nitrogenase activity. (orig.)
-
Brouwer, Marius; Elferink, Marieke G.L.; Robillard, George T.
1982-01-01
The phosphotransferase system (PTS) of the phototrophic bacterium Rhodopseudomonas sphaeroides consists of a component located in the cytoplasmic membrane and a membrane-associated enzyme called “soluble factor” (SF). SF has been partially purified by a combination of hydrophobic interaction and
-
Mortalidade em florestas de Pinus palustris causada por tempestade de raios
Kenneth W. Outcalt; Jorge Paladino Corrêa de Lima; Jose Américo de Mello Filho
2002-01-01
The importance of lightning as an ignition source for the fire driven Pinus palustris ecosystem is widely recognized. Lightning also impacts this system on a smaller scale by causing individual tree mortality. The objective of this study was to determine the level of mortality due to lightning activity at the Department of Energy's Savannah...
-
Philp, R. P.; Brown, S.; Calvin, M.
1978-01-01
The potential of algae and photosynthetic bacteria to serve as precursors of kerogen was studied to determine what factors affect the relative rates of formation of precursor hydrocarbons. Cells of Nostoc muscorum and Rhodopseudomonas spheroides were subjected to thermal alteration (by heating samples in glass tubes sealed under nitrogen) for two, four, and twelve weeks. Both unextracted and extracted cells in the absence and presence of montmorillonite were investigated, and the isoprenoid hydrocarbons produced in these experiments were determined. Phytane and five isomeric phytenes were the main hydrocarbons observed; their relative rates of formation in the different experimental conditions are described. No phytadienes, pristane, or pristenes were detected.
-
Guesdon, Gaëlle; de Santiago-Martín, Ana; Galvez-Cloutier, Rosa
2016-10-01
Typha angustifolia, Juncus maritimus, and Eleocharis palustris were evaluated for de-icing salt removal from runoff water. Plants were exposed to a range of de-icing salt levels (0.2, 0.7, 4, 8, and 13 dS m(-1)) in laboratory-scale subsurface constructed wetlands (CWs) for 2 months under greenhouse conditions. Effluent characteristics, plant height, biomass, and Cl and Na removal rates and uptake were monitored. More water volume was retained in CWs of T. angustifolia (∼60 %) than of J. maritimus and E. palustris (∼37.5 %), which accounted for the electrical conductivity increase in effluents (1.3-1.9-fold). Based on the NaCl removal rate, T. angustifolia showed the greatest phytodesalinization ability (31-60 %) with the highest removal at the lowest salt levels (0.2-0.7 dS m(-1)), followed by J. maritimus (22-36 %) without differences in removal among levels, and E. palustris (3-26 %) presenting a removal rate highly decreased with increasing salt levels. Plant height and biomass were stimulated at low de-icing salt levels, but, at higher levels, T. angustifolia and E. palustris growth was inhibited (tolerance index ∼67 and 10 %, respectively, in the worst cases). Salt amounts in aboveground biomass in g m(-2) differed among levels and ranged as follows: 13.6-29.1 (Cl), 4.2-9.3 (Na; T. angustifolia); 7.0-12.0 (Cl), 2.7-6.4 (Na; J. maritimus); and 0.9-7.6 (Cl), 0.3-1.6 (Na; E. palustris). Chloride and Na translocation decreased with de-icing salt increase in T. angustifolia, while no significant differences were found in J. maritimus, which is interesting for harvesting purposes.
-
Forest floor depth mediates understory vigor in xeric Pinus palustris ecosystems
J. Kevin Hiers; Joseph J. O' Brien; Rodney E. Will; Robert J. Mitchell
2007-01-01
Longleaf pine (Pinus palustris) woodlands and savannas are among the most frequently burned ecosystems in the world with fire return intervals of 1â10 years. This fire regime has maintained high levels of biodiversity in terms of both species richness and endemism. Land use changes have reduced the area of this ecosystem by .95%, and inadequate fire...
-
Vignoles, P; Rondelaud, D; Dreyfuss, G
2016-06-01
Bimiracidial infections of Lymnaea palustris and Lymnaea stagnalis (shell height at exposure, 4 mm) with Fasciola hepatica were carried out during six successive snail generations to determine if prevalence and intensity of snail infection increased over time through descendants issuing from eggs laid by parents already exposed to this digenean. Controls were constituted by a French population of Galba truncatula (a single generation) infected according to the same protocol. In a first experiment performed with the F1 to F5 generations of L. palustris, the prevalence and intensity of F. hepatica infection in snails progressively increased. Immature rediae and a few cercariae-containing rediae of the digenean were observed in L. stagnalis from the F3 generation, but no free cercaria was noted in the bodies of this lymnaeid from the F4 to F6 generations. In another experiment carried out with the F6 generation of L. palustris, the prevalence of F. hepatica infection and the number of shed cercariae were significantly lower in L. palustris than in G. truncatula. This mode of snail infection suggests an explanation for cases of human fasciolosis occurring in central France after the collection of wild watercress from beds where L. palustris was the sole lymnaeid.
-
Energy Technology Data Exchange (ETDEWEB)
Yoon, Young Sue; Kim, Hyun Kyung; Rye, Hye Yeon; Lee, In Gu; Kim, Mi Sun [Biomass Research Team, Korea Institute of Energy Research, Taejeon (Korea)
2000-03-01
Anaerobic fermentation using Clostidium butyricum NCIB 9576, and phto-fermentation using Rhodopseudomonas sphaeroides E15-1 were studied for the production of hydrogen from Makkoli, fruits (orange and apple, watermelon and melon) and Tofu wastewaters. From the Makkoli wastewater, which contained 0.94 g/liter sugars and 2.74 g/liter solubel starch, approximately 49 mM H{sub 2}/liter wastewater was produced during the initial 18h of the anaerobic fermentation with pH control between 6.5-7.0. Several organic acids such as butyric acid, acetic acid, propionic acid, lactic acid and ethanol were also produced. From watermelon and melon wastewater, which contained 43 g/liter sugars, generated about approximately 71 mM H{sub 2}/liter wastewater was produced during the initial 24h of the anaerobic fermentation. Tofu wastewater, pH 6.5, containing 12.6 g/liter soluble starch and 0.74 g/liter sugars, generated about 30mM H{sub 2}/liter wastewater, along with some organic acids, during the initial 24 h of anaerobic fermentation. Makkoli and Tofu wastewaters as substrates for the photo-fermentation by Rhodopseudomonas sphaeroides E15-1 produced approximately 37.9 and 22.2 {mu}M H{sub 2}/ml wastewaters, respectively for 9 days of incubation under the average of 9,000010,000 lux illumination at the surface of reactor using tungsten halogen lamps. Orange and apple wastewater, which contained 93.4 g/l produced approximately 13.1 {mu}M H{sub 2}/ml wastewater only for 2 days of photo-fermentation and the growth of Rhodopseudomonas spnaeroides E15-1 and hydrogen production were stopped. 22 refs, 4 figs., 2 tabs.
-
Energy Technology Data Exchange (ETDEWEB)
Clayton, R.K.; Clayton, B.J.
1978-01-01
Reaction centers have been purified from chromatophores of Rhodopseudomonas viridis by treatment with lauryl dimethyl amine oxide followed by hydroxyapatite chromatography and precipitation with ammonium sulfate. The absorption spectrum at low temperature shows bands at 531 and 543 nm, assigned to two molecules of bacteriopheophytin b. The 600 nm band of bacteriochlorophyll b is resolved at low temperature into components at 601 and 606.5 nm. At room temperature the light-induced difference spectrum shows a negative band centered at 615 nm, where the absorption spectrum shows only a week shoulder adjacent to the 600 nm band. The fluorescence spectrum shows a band at 1000 nm and no fluorescence corresponding to the 830 nm absorption band. Two molecules of cytochrome 558 and three of cytochrome 552 accompany each reaction center. The differential extinction coefficient (reduced minus oxidized) of cytochrome 558 nm was estimated as 20 +- 2 mM/sup -1/.cm/sup -1/ through a coupled reaction with equine cytochrome c. The extinction coefficient of reaction centers at 960 nm was determined to be 123 +- 25 mM/sup -1/.cm/sup -1/ by measuring the light-induced bleaching of P-960 and the coupled oxidation of cytochrome 558. The corresponding extinction coefficient at 830 nm is 300 +- 65 mM/sup -1/.cm/sup -1/. The absorbance ratio ..cap alpha../sub 280nm/..cap alpha../sub 830nm/ in our preparations was 2.1, and there was 190 kg protein per mol of reaction centers. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis showed three major components of apparent molecular weights 31,000, 37,000, and 41,000.
-
Wang, Hong; Nie, Lei; Xu, Yan; Li, Miao; Lv, Yan
2018-04-26
Six traffic-emitted metals (Cr, Zn, Cu, Cd, Pb, and Ni) were determined in soil and plants for below- and aboveground parts along different distances from highway to evaluate their behavior and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in turfy swamps. The results indicated that the different plant tissues showed significantly different levels of metal content. Nonlinear regression analysis indicated that metal contents leveled off at constant values before they decreased as the distance from the roadside increased. The high R 2 values of the regression model indicated good fit of the exponential function applied to depict the distribution pattern of the metal elements. It was deduced that Cr, Cu, and Cd in Thelypteris palustris var. pubescens Fernald were mainly derived from the soil; Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald absorbed Pb mainly through the stomata from atmospheric depositions; Cr, Cu, and Cd in Carex meyeriana Kunth and Zn in Thelypteris palustris var. pubescens Fernald were mainly affected by soil and atmospheric depositions. After excluding the effects of traffic, only the bioaccumulation factor of Cd (1.34) in Carex meyeriana Kunth and the translocation factor of Zn (1.13) in Thelypteris palustris var. pubescens Fernald were greater than 1, suggesting that Carex meyeriana Kunth could be a good candidate for assimilating Cd from soils and Thelypteris palustris var. pubescens Fernald could be suitable for the phytoextraction of Zn.
-
Anderson, LaShunda L; Walsh, Maud; Roy, Amitava; Bianchetti, Christopher M; Merchan, Gregory
2011-02-01
The potential of two plants, Thelypteris palustris (marsh fern) and Asparagus sprengeri (asparagus fern), for phytoremediation of arsenic contamination was evaluated. The plants were chosen for this study because of the discovery of the arsenic hyperaccumulating fern, Pteris vittata (Ma et al., 2001) and previous research indicating asparagus fern's ability to tolerate > 1200 ppm soil arsenic. Objectives were (1) to assess if selected plants are arsenic hyperaccumulators; and (2) to assess changes in the species of arsenic upon accumulation in selected plants. Greenhouse hydroponic experiments arsenic treatment levels were established by adding potassium arsenate to solution. All plants were placed into the hydroponic experiments while still potted in their growth media. Marsh fern and Asparagus fern can both accumulate arsenic. Marsh fern bioaccumulation factors (> 10) are in the range of known hyperaccumulator, Pteris vittata Therefore, Thelypteris palustris is may be a good candidate for remediation of arsenic soil contamination levels of arsenic. Total oxidation of As (III) to As (V) does not occur in asparagus fern. The asparagus fern is arsenic tolerant (bioaccumulation factors phytoremediation candidate.
-
International Nuclear Information System (INIS)
Radziah Ariffin
2004-01-01
An indigenous strain of the purple non-sulphur photosynthetic bacterium, isolated from palm oil mill effluent was presumably identified as species of Rhodopseudomonas palustris. Cultivation in synthetic medium under different conditions indicated that it gave maximum carotenoid and bacteriophyll synthesis under anaerobic conditions in the light with values of 12.6 and 108.1 mg/g dry cell weight respectively. These values were significantly higher than the pigment content obtained from aerobic cultivation. The specific growth rates in anaerobic was twice those in aerobic conditions in the light. Growth was not occurred in anaerobic or aerobic conditions in the dark. (Author)
-
International Nuclear Information System (INIS)
Azbar, N.; Tuba, F.; Dokgoz, C.
2009-01-01
In this study, H 2 was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31 o C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121 o C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H 2 / g COD fed ). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H 2 / g COD fed ). It was found that, undiluted raw cheese whey wastewater effluent from dark hydrogen
-
AFM imaging of bacteria in liquid media immobilized on gelatin coated mica surfaces
Energy Technology Data Exchange (ETDEWEB)
Doktycz, M.J.; Sullivan, C.J.; Hoyt, P.R.; Pelletier, D.A.; Wu, S.; Allison, D.P
2003-10-15
Immobilization of particulates, especially biomolecules and cells, onto surfaces is critical for imaging with the atomic force microscope (AFM). In this paper, gelatin coated mica surfaces are shown to be suitable for immobilizing and imaging both gram positive, Staphylococcus aureus, and gram negative, Escherichia coli, bacteria in both air and liquid environments. Gelatin coated surfaces are shown to be superior to poly-L-lysine coated surfaces that are commonly used for the immobilization of cells. This cell immobilization technique is being developed primarily for live cell imaging of Rhodopseudomonas palustris. The genome of R. palustris has been sequenced and the organism is the target of intensive studies aimed at understanding genome function. Images of R. palustris grown both aerobically and anaerobically in liquid media are presented. Images in liquid media show the bacteria is rod shaped and smooth while images in air show marked irregularity and folding of the surface. Significant differences in the vertical dimension are also apparent with the height of the bacteria in liquid being substantially greater than images taken in air. In air immobilized bacterial flagella are clearly seen while in liquid this structure is not visible. Additionally, significant morphological differences are observed that depend on the method of bacterial growth.
-
Towards understanding the biological function of hopanoids (Invited)
Doughty, D. M.; Hunter, R.; Summons, R. E.; Newman, D. K.
2010-12-01
Rhodopseudomonas palustris TIE-1 expresses bacterial hopanoid lipids that are structurally similar and evolutionarily related to eukaryotic sterols. The genome of R. palustris TIE-1 contains two copies of the hpnN gene (hpnN1 and hpnN2) that are orthologs of genes encoding eukaryotic sterol and lipid transporters. Hopanoid localization to the outer membrane was found to be dependent upon hpnN1. Since the cell cycle of R. palustris TIE-1 is obligately bimodal with each cell division resulting in the generation of one mother and one swarmer cell, evidence was obtained that hopanoids where specifically localized to the outer membrane of mother cells. The sequestration of hopanoids to the mother cells was also disrupted by the deletion of the hpnN1 gene. Mutants lacking the hopanoid transporters were able to grow normally at 30 °C but showed decreased growth at 38 °C. The hopanoid transporter mutant formed cellular filaments when grown at elevated temperature. Because sedimentary steranes and hopanes comprise some of the earliest evidence for the emergence of distinct bacteria and eukaryotic phyla, a better appreciation of the function of hopanoids will improve our ability to interpret the evolution of life on Earth.
-
Meech, S.R.; Hoff, A.J.
1985-01-01
Two coherent spectroscopic methods, accumulated photon echo and population bottleneck hole-burning, have been employed in a study of the decay rate of the primary donor (P) of Rhodopseudomonas sphaeroides at 1.5 K. The decay rate is instrument-limited in the photon-echo experiment, implying a
-
Cochliobolus miyabeanus (Bipolaris oryzae) is the causal agent of fungal brown spot (FBS) in wild rice (Zizania palustris L.), an aquatic grass, endemic in Minnesota, Wisconsin, and parts of Canada. Grain yield losses can reach up to 74% when the disease starts at the boot stage and continues until ...
-
Energy Technology Data Exchange (ETDEWEB)
Azbar, N.; Tuba, F.; Dokgoz, C. [Bioengineering Dept., Faculty of Engineering, Ege Univ., Izmir (Turkey)], E-mail: nuri.azbar@ege.edu.tr
2009-07-01
In this study, H{sub 2} was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31{sup o}C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121{sup o}C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H{sub 2}/ g COD{sub fed}). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H{sub 2} / g COD{sub fed}). It was found that, undiluted raw cheese whey wastewater
-
HINDLE, ALLYSON G.; LAWLER, JOHN M.; CAMPBELL, KEVIN L.; HORNING, MARKUS
2015-01-01
Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H0: shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n = 17) and second-year (n = 17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: ~50%; B. brevicauda: ~60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris (~50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. PMID:19296507
-
Directory of Open Access Journals (Sweden)
Nelson Jeng-Yeou Chear
2016-04-01
Full Text Available Stenochlaena palustris fronds are popular as a vegetable in Southeast Asia. The objectives of this study were to evaluate the anticholinesterase properties and phytochemical profiles of the young and mature fronds of this plant. Both types of fronds were found to have selective inhibitory effect against butyrylcholinesterase compared with acetylcholinesterase. However, different sets of compounds were responsible for their activity. In young fronds, an antibutyrylcholinesterase effect was observed in the hexane extract, which was comprised of a variety of aliphatic hydrocarbons, fatty acids, and phytosterols. In the mature fronds, inhibitory activity was observed in the methanol extract, which contained a series of kaempferol glycosides. Our results provided novel information concerning the ability of S. palustris to inhibit cholinesterase and its phytochemical profile. Further research to investigate the potential use of this plant against Alzheimer's disease is warranted, however, young and mature fronds should be distinguished due to their phytochemical differences.
-
Hindle, Allyson G; Lawler, John M; Campbell, Kevin L; Horning, Markus
2009-06-01
Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H(0): shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n=17) and second-year (n=17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: approximately 50%; B. brevicauda: approximately 60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris ( approximately 50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. (c) 2009 Wiley-Liss, Inc.
-
Vreeburg, RAM; Benschop, JJ; Peeters, AJM; Colmer, TD; Ammerlaan, AHM; Staal, M; Elzenga, TM; Staals, RHJ; Darley, CP; McQueen-Mason, SJ; Voesenek, LACJ
The semi-aquatic dicot Rumex palustris responds to complete submergence by enhanced elongation of young petioles. This elongation of petiole cells brings leaf blades above the water surface, thus reinstating gas exchange with the atmosphere and increasing survival in flood-prone environments. We
-
The role of oxalic acid in tolerance to N’N-napthaloylhydroxylamine in Tyromyces palustris
R.A. Arango; C.A. Clausen; Frederick Green
2006-01-01
Certain wood decay fungi exhibit tolerance to one or more wood preservatives. Copper tolerance of brown-rot fungi has been studied in our laboratory for the past six years. We have observed some degree of tolerance to NâN-naphthaloylhydroxamine (NHA), a recently patented termite bait, by the brown-rot fungus Tyromyces palustris TYP-6137. In an effort to try and confirm...
-
D. Paul Jackson; R. Kasten Dumroese; James P. Barnett
2012-01-01
Container longleaf pine (Pinus palustris) seedlings often survive and grow better after outplanting than bareroot seedlings. Because of this, most longleaf pine are now produced in containers. Little is known about nursery fertilization effects on the quality of container longleaf pine seedlings and how that influences outplanting performance. We compared various...
-
J.-P. Berrill; C.M. Dagley
2010-01-01
A compact experimental design and analysis is presented of longleaf pine (Pinus palustris) survival and growth in a restoration project in the Piedmont region of Georgia, USA. Longleaf pine seedlings were planted after salvage logging and broadcast burning in areas of catastrophic southern pine beetle (Dendroctonus frontalis) attacks on even-aged mixed pine-hardwood...
-
[Construction and Characterization of B850-Only LH2 Energy Transfer System in Purple Bacteria].
Li, Kai; Zhao, Chun-gui; Yue, Hui-ying; Yang, Su-ping; Qu, Yin-bo; Jiao, Nian-zhi
2015-04-01
To seek microscopic molecular mechanism of energy transfer and complex reconstitution in the photosynthesis, the conditions for construction of B850-only peripheral light-harvesting complex (LH2) and their properties were investigated using absorption, fluorescence spectroscopy, molecular sieve chromatography, ultrafiltration and sodium dodecylsulfate polyacrylamide gel electrophoresis (SDS-PAGE) from the purple bacteria. The results indicated that bacteriochlorophylls (BChl) of B800 incubated in 10 mmo · L(-1) Tris-HCl (pH 8.0) buffer are selectively released from their binding sites of LH2 of Rhodobacter azotoformans (A-LH2) by 0.08% (W/V) SDS. B850-only A-LH2 was constructed after removing free BChl mixing with 10% methyl alcohol by ultrafiltration. B850 BChl was released after A-LH2 was incubated for 240 min in dark at room temperature (RT). While BChl of B800 incubated in pH 1.9 buffer were selectively released from their binding sites of LH2 of Rhodopseudomonas palustris (P-LH2). The authors acquired two components using molecular sieve chromatography. Free BChl of one component was not removed and self-assembled to P-LH2. The other removed free BChl and B850-only P-LH2 was constructed. B850 unchanged after P-LH2 was incubated. P-LH2 α and β subunits have different molecular weights, but those of A-LH2 are in the contrary. It is concluded that B850-only P-LH2 is more stable than A-LH2. The enigmatic split of the B800 absorption band was not observed in these LH2, but we acquired two kinds of B800-released LH2 from Rhodopseudomonas palustris. The authors' results may provide a new light to separate homogeneous Apoprotein LH2.
-
Energy Technology Data Exchange (ETDEWEB)
Penha-Lopes, Gil, E-mail: gil.penha-lopes@biology-research.co [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal); Department of Analytical and Environmental Chemistry, Vrije Universiteit Brussels, Brussels (Belgium); Bartolini, Fabrizio [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Limbu, Samwel [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Cannicci, Stefano [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Mgaya, Yunus [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Kristensen, Erik [Institute of Biology, University of Southern Denmark, DK-5230 Odense M (Denmark); Paula, Jose [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal)
2010-01-15
The effect of different sewage concentrations (0, 20, 60 and 100%), vegetation (Bare, Avicennia marina or Rhizophora mucronata) and immersion periods (immersion/emersion period of 12/12 h or 3/3 days just for 100%) conditions were studied for 6 months on survival and growth rates of Terebralia palustris (Linnaeus, 1767). Gastropods' activity and ecosystem engineering preformed at bare and A. marina planted cells and 3 sewage conditions (0, 20 and 60%) were determined. Survival rates were higher than 70% in all treatments. Growth rate decreased significantly with increasing sewage concentrations (mainly at unplanted conditions) and longer immersion periods. A complete shift (from immersion to emersion periods) and a significant decrease in mobility and consequently its engineer potential, due to sewage contamination, lead to a 3-4 fold decrease in the amount of sediment disturbed. Sewage contamination, primary producers' abundance and environmental conditions may have influenced the gastropods survival, growth and its ecosystem engineering potential. - Terebralia palustris high ecosystem engineering potential in constructed mangrove wetlands.
-
Brian J. Palik; Robert J. Mitchell; J. Kevin Hiers
2002-01-01
Modeling silviculture after natural disturbance to maintain biodiversity is a popular concept, yet its application remains elusive. We discuss difficulties inherent to this idea, and suggest approaches to facilitate implementation, using longleaf pine (Pinus palustris) as an example. Natural disturbance regimes are spatially and temporally variable. Variability...
-
Directory of Open Access Journals (Sweden)
O. Prokopchuk
2016-10-01
Full Text Available The problem of availability of quality water is highly relevant today, so the technologies of prediction and prevention of water pollution and purification are very important. Biological methods of cleaning, in paticular cleaning water by the so-called method of biosorption, have been increasingly used in the last decade. This method means the removal of dangerous substances and improvement of water condition by using aquatic organisms, in particular plants. Therefore, in view of the rich experience of research conducted in the biosorption sphere, we decided to predict the effectiveness of this method by using the cumulative ability of higher water plants to absorb phosphorus compounds. For this purpose, we selected water and plant samples (Glyceria maxima (C. Hartm. Holmb., Nasturtium officinale R. Br., Myosotis palustris (L. L. from the river Seret (Ternopil, Ukraine. The plants were placed into sterilized glass jars filled with 3 liters of water from the river Seret (control samples and still tap water with addition of sodium phosphate with phosphorus concentration of 3.5 mg/dm³ (research sample, which were cultured in laboratory conditions for four months. We determined the content of phosphates, permanganate and dichromate oxidation in the water and the total content of phosphorus in the plants. We traced the dynamic of organic substances and the content of phosphates in the water, the accumulation of phosphorus in plants and the rate of accumulation of phosphorus in the plants and in the water. We calculated correlation coefficients to detect the dependence between phosphorus indicators in the aquatic plants and the concentration of phosphate ions in the water. We found that M. palustris had the greatest capacity to accumulate phosphorus and the highest rate of phosphorus accumulation from water, which allows us to consider it the most effective aquatic plant for absorption of elements and decreasing water pollution. We also established
-
International Nuclear Information System (INIS)
Du Luchao; Weng Yuxiang; Hong Xinguo; Xian Dingchang; Kobayashi Katsumi
2006-01-01
Structures of membrane protein in solution are different from that in crystal phase. We present the primary results of small angle x-ray scattering (SAXS) resolved topological structures of a light harvesting antenna membrane protein complex LH2 from photosynthetic bacteria Rhodopseudomonas acidophila in detergent solution for the first time. Our results show that the elliptical shape of the LH2 complex in solution clearly deviates from its circular structure in crystal phase determined by x-ray diffraction. This result provides an insight into the structure and function interplay in LH2. (authors)
-
Rachel A. Arango; Patricia K. Lebow; Frederick III Green
2009-01-01
Eleven strains of T. palustris were evaluated for mass loss and production of phosphate buffer soluble oxalic acid on pine wood blocks treated with 0.5% Nâ,N-naphthaloylhydroxamine (NHA) in a soil-block test. After 12 weeks higher percentage mass loss was observed in control groups for 10 strains, while TYP-6137 was shown to be tolerant with no difference between the...
-
Georgakopoulou, S.; Gogdell, R.J.; Grondelle, van R.; Amerongen, van H.
2003-01-01
We have applied linear-dichroism experiments to determine the orientation of the transition dipole moment, corresponding to the main absorption band of the carotenoid, rhodopin glucoside, in the light-harvesting complex LH2 from Rhodopseudomonas acidophila strain 10050. The crystal structure of this
-
Chelcy R. Ford; Emily S. Minor; Gordon A. Fox
2010-01-01
We investigated the effect of fire and fire frequency on stand structure and longleaf pine (Pinus palustris P. Mill.) growth and population demography in an experimental research area in a southwest Florida sandhill community. Data were collected from replicated plots that had prescribed fire-return intervals of 1, 2, 5, or 7 years or were left...
-
Ferhat Kara; Edward F. Loewenstein
2015-01-01
Even-aged silvicultural methods have been successfully used to manage longleaf pine (Pinus palustris Mill.) forests for wood production; however, successful use of uneven-aged methods to manage this ecosystem is less well documented. In this study, the effects of varying levels of residual basal area (RBA) (9.2, 13.8, and 18.4 m2...
-
Cochliobolus miyabeanus causes a severe, yield-reducing leaf spot disease on rice (Oryza sativa) and two North American specialty crops, American wildrice (Zizania palustris) and switchgrass (Panicum virgatum). Despite the importance of the pathogen in wildrice, little is known about mechanisms of p...
-
James L. Hanula; R. Todd Engstrom
2000-01-01
Automatic cameras were used to record adult red-cockaded woodpecker (Picoides borealis) nest visits with food for nestlings. Diet of nestlings on or near an old-growth longleaf pine (Pinus palustris) remnant in southern Georgia was compared to that in longleaf pine stands established on old farm fields in western South Carolina....
-
Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker; Susan Cohen
2006-01-01
We tested the effects of eight site preparation treatments on early growth and survival of container-grown longleaf pine (Pinus palustris Mill.) seedlings. Treatments included an untreated check, six combinations of two initial vegetation control treatments (chopping or herbicide) with three planting site conditions (flat [no additional treatment],...
-
International Nuclear Information System (INIS)
Welle, Marlies E.W. van der; Niggebrugge, Karla; Lamers, Leon P.M.; Roelofs, Jan G.M.
2007-01-01
Sulfur pollution can lead to serious problems in freshwater wetlands, including phosphorus eutrophication and sulfide toxicity. We tested the effects of anaerobic iron-rich groundwater discharge in fens, simulated by iron injection, on two characteristic species (Juncus effusus and Caltha palustris) in a sulfidic environment. Biomass production of C. palustris roots showed an optimum response to the combined addition of iron and sulfide, with highest values at intermediate concentrations of both substances. Iron deficiency apparently occurred at low iron concentrations, while at high iron concentrations, growth was decreased. For J. effusus, in contrast, no toxic effects were found of both iron and sulfide. This could be explained by larger radial oxygen loss (ROL) of J. effusus and could not be explained by differences in phosphorous concentrations. The results of our experiments confirm that iron-rich groundwater discharge has the potential to affect vegetation composition through toxicity modification in sulfidic environments. - Toxicity of iron and sulfide are interacting with each other and have the potential to affect vegetation composition
-
Toxicity of sulfide to early life stages of wild rice (Zizania palustris).
Fort, Douglas J; Todhunter, Kevin; Fort, Troy D; Mathis, Michael B; Walker, Rachel; Hansel, Mike; Hall, Scott; Richards, Robin; Anderson, Kurt
2017-08-01
The sensitivity of wild rice (Zizania palustris) to sulfide is not well understood. Because sulfate in surface waters is reduced to sulfide by anaerobic bacteria in sediments and historical information indicated that 10 mg/L sulfate in Minnesota (USA) surface water reduced Z. palustris abundance, the Minnesota Pollution Control Agency established 10 mg/L sulfate as a water quality criterion in 1973. A 21-d daily-renewal hydroponic study was conducted to evaluate sulfide toxicity to wild rice and the potential mitigation of sulfide toxicity by iron (Fe). The hydroponic design used hypoxic test media for seed and root exposure and aerobic headspace for the vegetative portion of the plant. Test concentrations were 0.3, 1.6, 3.1, 7.8, and 12.5 mg/L sulfide in test media with 0.8, 2.8, and 10.8 mg/L total Fe used to evaluate the impact of iron on sulfide toxicity. Visual assessments (i.e., no plants harvested) of seed activation, mesocotyl emergence, seedling survival, and phytoxicity were conducted 10 d after dark-phase exposure. Each treatment was also evaluated for time to 30% emergence (ET30), total plant biomass, root and shoot lengths, and signs of phytotoxicity at study conclusion (21 d). The results indicate that exposure of developing wild rice to sulfide at ≥3.1 mg sulfide/L in the presence of 0.8 mg/L Fe reduced mesocotyl emergence. Sulfide toxicity was mitigated by the addition of Fe at 2.8 mg/L and 10.8 mg/L relative to the control value of 0.8 mg Fe/L, demonstrating the importance of iron in mitigating sulfide toxicity to wild rice. Ultimately, determination of site-specific sulfate criteria taking into account factors that alter toxicity, including sediment Fe and organic carbon, are necessary. Environ Toxicol Chem 2017;36:2217-2226. © 2017 SETAC. © 2017 SETAC.
-
DEFF Research Database (Denmark)
Wubshet, Sileshi Gizachew; Moresco, Henrique H.; Tahtah, Yousof
2015-01-01
, and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC–HRMS–SPE–NMR. This led to identification...
-
Dedysh, S N; Derakshani, M; Liesack, W
2001-10-01
Two 16S rRNA-targeted oligonucleotide probes, Mcell-1026 and Mcell-181, were developed for specific detection of the acidophilic methanotroph Methylocella palustris using fluorescence in situ hybridization (FISH). The fluorescence signal of probe Mcell-181 was enhanced by its combined application with the oligonucleotide helper probe H158. Mcell-1026 and Mcell-181, as well as 16S rRNA oligonucleotide probes with reported group specificity for either type I methanotrophs (probes M-84 and M-705) or the Methylosinus/Methylocystis group of type II methanotrophs (probes MA-221 and M-450), were used in FISH to determine the abundance of distinct methanotroph groups in a Sphagnum peat sample of pH 4.2. M. palustris was enumerated at greater than 10(6) cells per g of peat (wet weight), while the detectable population size of type I methanotrophs was three orders of magnitude below the population level of M. palustris. The cell counts with probe MA-221 suggested that only 10(4) type II methanotrophs per g of peat (wet weight) were present, while the use of probe M-450 revealed more than 10(6) type II methanotroph cells per g of the same samples. This discrepancy was due to the fact that probe M-450 targets almost all currently known strains of Methylosinus and Methylocystis, whereas probe MA-221, originally described as group specific, does not detect a large proportion of Methylocystis strains. The total number of methanotrophic bacteria detected by FISH was 3.0 (+/-0.2) x 10(6) cells per g (wet weight) of peat. This was about 0.8% of the total bacterial cell number. Thus, our study clearly suggests that M. palustris and a defined population of Methylocystis spp. were the predominant methanotrophs detectable by FISH in an acidic Sphagnum peat bog.
-
Directory of Open Access Journals (Sweden)
J.K. Mallick
2009-04-01
Full Text Available Marsh Mongoose Herpestes palustris is the only extant endemic mammal of the East Kolkata wetlands, which has been declared a RAMSAR site in 2002. Since its first description by the scientists of the Zoological Survey of India, the population of this species has dwindled to an alarming state due to reclamation of the Salt Lake City and Rajarhat expansion, as well as from other anthropogenic causes. Recently, during a field survey only a small population of this endangered mongoose was found in a single location. Immediate conservation measures are required to be taken by the concerned authorities to stop its probable extinction in the near future.
-
Kunz, Ralf; Timpmann, Kõu; Southall, June; Cogdell, Richard J; Köhler, Jürgen; Freiberg, Arvi
2013-10-10
The high sensitivity of optical spectra of pigment-protein complexes to temperature and pressure is well known. In the present study, we have demonstrated the significant influence of the environments commonly used in bulk and single-molecule spectroscopic studies at low temperatures on the LH2 photosynthetic antenna complex from Rhodopseudomonas acidophila. A transfer of this LH2 complex from a bulk-buffer solution into a spin-coated polymer film results in a 189 cm(-1) blue shift of the B850 excitonic absorption band at 5 K. Within the molecular exciton model, the origin of this shift could be disentangled into three parts, namely to an increase of the local site energies, a contraction of the exciton band, and a decrease of the displacement energy.
-
Energy Technology Data Exchange (ETDEWEB)
Yang, Jianming [Key Lab of Applied Mycology, College of Life Sciences, Qingdao Agricultural University, Qingdao Shandong Province People' s Republic of China; Department of Microbiology, University of Washington, Seattle WA USA; Yin, Liang [Department of Microbiology, University of Washington, Seattle WA USA; Lessner, Faith H. [Department of Biological Sciences, University of Arkansas, Fayetteville AR USA; Nakayasu, Ernesto S. [Biological Sciences Division, Pacific Northwest National Laboratory, Richland WA USA; Payne, Samuel H. [Biological Sciences Division, Pacific Northwest National Laboratory, Richland WA USA; Fixen, Kathryn R. [Department of Microbiology, University of Washington, Seattle WA USA; Gallagher, Larry [Department of Genome Sciences, University of Washington, Seattle WA USA; Harwood, Caroline S. [Department of Microbiology, University of Washington, Seattle WA USA
2017-07-24
Anoxygenic purple phototrophic bacteria have served as important models for studies of photophosphorylation. The pigment-protein complexes responsible for converting light energy to ATP are relatively simple and these bacteria can grow heterotrophically under aerobic conditions, thus allowing for the study of mutants defective in photophosphorylation. In the past, genes responsible for anoxygenic phototrophic growth have been identified in a number of different bacterial species. Here we systematically studied the genetic basis for this metabolism by using Tn-seq to identify genes essential for the anaerobic growth of the purple bacterium Rhodopseudomonas palustris on acetate in light. We identified 171 genes required for growth in this condition, 35 of which are annotated as photosynthesis genes. Among these are a few new genes not previously shown to be essential for phototrophic growth. We verified the essentiality of many of the genes we identified by analyzing the phenotypes of mutants we generated by Tn mutagenesis that had altered pigmentation. We used directed mutagenesis to verify that the R. palustris NADH:quinone oxidoreductase complex IE is essential for phototrophic growth. As a complement to the genetic data, we carried out proteomics experiments in which we found that 429 proteins were present in significantly higher amounts in cells grown anaerobically in light compared to aerobically. Among these were proteins encoded by subset of the phototrophic growth-essential genes.
-
International Nuclear Information System (INIS)
Hunter, C.N.; Pennoyer, J.D.; Niederman, R.A.
1982-01-01
The B875 and B800-850 light-harvesting pigment-protein complexes of Rhodopseudomonas sphaeroides are characterized further by lithium dodecyl sulfate/polyacrylamide gel electrophoresis at 4 degrees C. Bacteriochlorophyll a was shown in reconstruction studies to remain complexed with its respective binding proteins during this procedure. From distributions in these gels, a quantitative description for the arrangement of the complexes is proposed. Assembly of the complexes was examined in delta-aminolevulinate-requiring mutant H-5 after a shift from high- to low-light intensity. After 10 h of delta-[ 3 H]aminolevulinate labeling, the specific radioactivity of bacteriochlorophyll in a fraction containing putative membrane invaginations reached the maximal level, while that of the mature photosynthetic membrane was at only one-third this level. This suggests that membrane invaginations are sites of preferential bacteriochlorophyll synthesis in which completed pigment-proteins exist transiently. Analysis of the 3 H distribution after electrophoretic separation further suggests that photosynthetic membranes grow mainly by addition of B800-850 to preformed membrane consisting largely of B875 and photochemical reaction centers. These results corroborate the above model for the structural organization of the light-harvesting system and indicate that the structurally and functionally discrete B800-850 pool is not completely assembled until all B875 sites for B800-850 interactions are occupied
-
International Nuclear Information System (INIS)
Dailey, H.A.; Fleming, J.E.; Harbin, B.M.
1986-01-01
Purified ferrochelatase from the bacterium Rhodopseudomonas sphaeroides was examined to determine the roles of cationic and sulfhydryl residues in substrate binding. Reaction of the enzyme sulfhydryl residues with N-ethylmaleimide or monobromobimane resulted in a rapid loss of enzyme activity. Ferrous iron, but not porphyrin substrate, had a protective effect against inactivation by these two reagents. Quantitation with 3 H-labeled N-ethylmaleimide revealed that inactivation required one to two sulfhydryl groups to be modified. Modification of arginyl residues with either 2,3-butanedione or camphorquinone 10-sulfonate resulted in a loss of ferrochelatase activity. A kinetic analysis of the modified enzyme showed that the K/sub m/ for ferrous iron was not altered but that the K/sub m/ for the prophyrin substrate was increased. These data suggested that arginyl residues may be involved in porphyrin binding, possibly via charge pair interactions between the arginyl residue and the anionic porphyrin propionate side chain. Modification of lysyl residues had no effect on enzyme activity. The authors also examined the ability of bacterial ferrochelatase to use various 2,4-disubstituted porphyrins as substrates. The authors found that 2,4-bis-acetal- and 2,4-disulfonate deuteroporphyrins were effective substrates for the purified bacterial enzyme and that N-methylprotoporphyrin was an effective inhibitor of the enzyme. Data for the ferrochelatase of R. sphaeroides are compared with previously published data for the eucaryotic enzyme
-
Shimokawa, Tomoko; Shibuya, Hajime; Nojiri, Masanobu; Yoshida, Shigeki; Ishihara, Mitsuro
2008-09-01
A family 12 endoglucanase with a molecular mass of 23,926 Da (EG-II) from the brown-rot basidiomycete Fomitopsis palustris was purified and characterized. One of the roles of EG-II in wood degradation is thought to be to loosen the polysaccharide network in cell walls by disentangling hemicelluloses that are associated with cellulose.
-
Jacquemyn, Hans; Waud, Michael; Lievens, Bart; Brys, Rein
2016-07-01
In orchid species that have populations occurring in strongly contrasting habitats, mycorrhizal divergence and other habitat-specific adaptations may lead to the formation of reproductively isolated taxa and ultimately to species formation. However, little is known about the mycorrhizal communities associated with recently diverged sister taxa that occupy different habitats. In this study, 454 amplicon pyrosequencing was used to investigate mycorrhizal communities associating with Epipactis helleborine in its typical forest habitat and with its presumed sister species E. neerlandica that almost exclusively occurs in coastal dune habitats. Samples of the phylogenetically more distant E. palustris, which co-occurred with E. neerlandica, were also included to investigate the role of habitat-specific conditions on mycorrhizal communities. A total of 105 operational taxonomic units (OTUs) of putative orchid mycorrhizal fungi were observed in the three studied species. The majority of these fungi were endophytic fungi of Helotiales and ectomycorrhizal fungi belonging to Thelephoraceae, Sebacinaceae and Inocybaceae. In addition, a large number of other ectomycorrhizal taxa were detected, including Cortinarius, Cenococcum, Tuber, Geopora, Wilcoxina, Meliniomyces, Hebeloma, Tricholoma, Russula and Peziza Mycorrhizal communities differed significantly between the three species, but differences were most pronounced between the forest species (E. helleborine) and the two dune slack species (E. neerlandica and E. palustris). The results clearly showed that recently diverged orchid species that occupy different habitats were characterized by significantly different mycorrhizal communities and call for more detailed experiments that aim at elucidating the contribution of habitat-specific adaptations in general and mycorrhizal divergence in particular to the process of speciation in orchids. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany
-
Otiniano García, Nélida Milly Esther
2010-01-01
In order to evaluate the efficiency of Pseudomonas sp, Rhodopseudomonas sp, Micrococcus sp, Bacillus sp, and the consortium formed by these four microorganisms in the diesel II petroleum degradation, it was worked in 5 bioreactors of aerated and shaken tank of 1.5 litters of capacity, with speed agitation of 120 rpm, and air flow of 0.5 vvm; in which were placed; 940 mL of Minimum Broth of Davies pH 7.0; 50 mL of diesel II petroleum as source of carbon and 10 mL of a suspension of approx...
-
Electron uptake by iron-oxidizing phototrophic bacteria
Energy Technology Data Exchange (ETDEWEB)
Bose, A; Gardel, EJ; Vidoudez, C; Parra, EA; Girguis, PR
2014-02-26
Oxidation-reduction reactions underlie energy generation in nearly all life forms. Although most organisms use soluble oxidants and reductants, some microbes can access solid-phase materials as electron-acceptors or -donors via extracellular electron transfer. Many studies have focused on the reduction of solid-phase oxidants. Far less is known about electron uptake via microbial extracellular electron transfer, and almost nothing is known about the associated mechanisms. Here we show that the iron-oxidizing photoautotroph Rhodopseudomonas palustris TIE-1 accepts electrons from a poised electrode, with carbon dioxide as the sole carbon source/electron acceptor. Both electron uptake and ruBisCo form I expression are stimulated by light. Electron uptake also occurs in the dark, uncoupled from photosynthesis. Notably, the pioABC operon, which encodes a protein system essential for photoautotrophic growth by ferrous iron oxidation, influences electron uptake. These data reveal a previously unknown metabolic versatility of photoferrotrophs to use extracellular electron transfer for electron uptake.
-
Lolkema, Juke S.; Robillard, George T.
The bacterial phosphotransferase systems are believed to catalyze the concomitant transport and phosphorylation of hexoses and hexitols. The transport is from the outside to the inside of the cell. An absolute coupling between transport and phosphorylation has however been questioned in the
-
Directory of Open Access Journals (Sweden)
Alejandro Blanco
Full Text Available The controversial European genus Allodaposuchus is currently composed of two species (A. precedens, A. subjuniperus and it has been traditionally considered a basal eusuchian clade of crocodylomorphs. In the present work, the new species A. palustris is erected on the base of cranial and postcranial remains from the lower Maastrichtian of the southern Pyrenees. Phylogenetic analyses here including both cranial and postcranial data support the hypothesis that Allodaposuchus is included within Crocodylia. The studied specimen suggests little change in postcranial skeleton along the evolutionary history of crocodylians, except for some bone elements such as the axis, the first caudal vertebra and the ilium. The specimen was found in an organic mudstone corresponding to a coastal wetland environment. Thus, A. palustris from Fumanya is the first Allodaposuchus reported in lacustrine-palustrine settings that expand the ecological range for this genus. The S-DIVA palaeobiogeographic reconstruction of ancestral area suggests that early members of Crocodylia rapidly widespread for the Northern Hemisphere landmasses no later than the Campanian, leading the apparition of endemic groups. In that way "Allodaposuchia" represents an endemic European clade probably originated in the Ibero-Armorican domain in the late Campanian and dispersed by the Southern European archipelago prior to the early Maastrichtian.
-
Energy Technology Data Exchange (ETDEWEB)
Youvan, D C [Univ. of California, Berkeley; Elder, J T; Sandlin, D E; Zsebo, K; Alder, D P; Panopoulos, N J; Marrs, B L; Hearst, J E
1982-01-01
Site-directed mutagenesis of the photosynthetic apparatus (PSA) genes in Rhodopseudomonas capsulata is presented utilizing a transposon Tn7 mutagenized R-prime. The R-prime, pRPS404, bears most of the genes necessary for the differentiation of the photosynthetic apparatus. Mutagenesis of the R-prime with Tn7 in Escherichia coli, conjugation into R. capsulata, and homologous recombination with the wild-type alleles efficiently generates photosynthetic apparatus lesions. Wild-type alleles are lost spontaneously and the Tn7-induced lesions are revealed by subsequent intramolecular recombination between IS21 insertion elements that bracket the prime sequences in direct repeat. The molecular nature of the intermediates involved in the transposition, recombination and deletion have been investigated by Southern hybridization analysis. The spontaneous loss of wild-type alleles after homologous recombination with the chromosome may be of general use to other prokaryotic site-directed transposon mutagenesis schemes. The IS21-mediated deletion of the prime DNA is dependent on the RecA protein in E. coli, generating the parental R-factor bearing one IS21 element. A genetic-physical map exists for a portion of the prime photosynthetic apparatus DNA. When Tn7 is inserted into a bacteriochlorophyll gene in the R-prime and then crossed into R. capsulata, mutants are produced that accumulate a bacteriochlorophyll precursor, which is in excellent agreement with the existing genetic-physical map. This corroborates the mutagenesis scheme.
-
Directory of Open Access Journals (Sweden)
R. Vyas
2012-11-01
Full Text Available Data presented here is based on a three year study (2008-2010 on a population of Mugger Crocodylus palustris inhabiting Vishwamitri River near Vadodara City, Gujarat State, India. In total, 155 Muggers were counted in the 25km river stretch during 2010. In all, 40 burrows were observed along the river bank, and the same were clumped in certain sections of the river. Muggers fed eight species of birds, and domestic livestock in addition to scavenging. Eight instances of human-crocodile conflicts were observed including four human causalities. A total 90 Muggers were rescued from the urban areas and the same were relocated elsewhere in the river system. Various types of threats to Mugger were also noticed including habitat loss, alteration and soil erosion and mortality due to rail traffic. The present study suggests further research to propose strategies to conserve this population.
-
International Nuclear Information System (INIS)
Norris, J.R.; Budil, D.E.; Gast, P.; Chang, C.H.; El-Kabbani, O.; Schiffer, M.
1989-01-01
The orientation of the principal axes of the primary electron donor triplet state measured in single crystals of photosynthetic reaction centers is compared to the x-ray structures of the bacteria Rhodobacter (Rb.) sphaeroides R-26 and Rhodopseudomonas (Rps.) viridis. The primary donor of Rps. viridis is significantly different from that of Rb. sphaeroides. The measured directions of the axes indicate that triplet excitation is almost completely localized on the L-subunit half of the dimer in Rps. viridis but is more symmetrically distributed on the dimeric donor in Rb. sphaeroides R-26. The large reduction of the zero field splitting parameters relative to monomeric bacteriochlorophyll triplet in vitro suggests significant participation of asymmetrical charge transfer electronic configurations in the special pair triplet state of both organisms
-
The usage of sulfide and thiosulfate ions by purple non-sulfur bacteria Rhodopseudomonas yavorovii
Directory of Open Access Journals (Sweden)
O. V. Tarabas
2017-07-01
Full Text Available This article covers the patterns of oxidation of sulfide and thiosulfate ions by bacteria Rhodopseudomonas yavorovii Ya-2016 under different cultivation conditions. In the environments with 1.4–5.6 мМ Na2S2O3, R. yavorovii Ya-2016 bacteria accumulated biomass of 1.4–1.6 g/l, which was higher than biomass (1.2-0.6 g/l accumulated by the bacteria with the same concentrations of Na2S × 9H2O. The efficiency of oxidation of 1.4, 2.8, 5.6 мМ sulfide- and thiosulfate-ions as donors of electrons by the bacteria equaled 97.4, 42.6, 18.7 and 68.8, 28.0, 3.7%, respectively. As a result of bacterial oxidation of 1.4 мМ hydrogen sulfide and sodium thiosulphate in the environment accumulation of 0.13–1.30 мМ sulfate-ions occurs, and the element sulfur becomes an intermediate metabolite in the environment with Na2S×9H2O. R. yavorovii Ya-2016 bacteria are capable of using sulfate-ions as a single source of sulfate at increase in photptrophs. In the environment with 2.5 мМ sulfate-ions concentration the bacteria biomass was 1.4 g/l, the bacteria assimilated 17.7% of sulfates. Because purple non-sulfur bacteria R. yavorovii Ya-2016 are capable of using sulfide-ions as donors of electrons of anoxygenic photosynthesis and using sulfate-ions as a single source of sulfate, they could be successfully used in the technologies of remediating the environment from compounds of sulfur.
-
Energy Technology Data Exchange (ETDEWEB)
Vatsala, T.M.; Raj, S. Mohan; Manimaran, A. (Shri AMM Murugappa Chettiar Research Centre, Photosynthesis and Energy Division, Tharamani, Chennai, India, 600)
2008-10-15
We evaluated the feasibility of improving the scale of hydrogen (H{sub 2}) production from sugar cane distillery effluent using co-cultures of Citrobacter freundii 01, Enterobacter aerogenes E10 and Rhodopseudomonas palustris P2 at 100 m{sup 3} scale. The culture conditions at 100 ml and 2 L scales were optimized in minimal medium and we observed that the co-culture of the above three strains enhanced H{sub 2} productivity significantly. Results at the 100 m{sup 3} scale revealed a maximum of 21.38 kg of H{sub 2}, corresponding to 10692.6 mol, which was obtained through batch method at 40 h from reducing sugar (3862.3 mol) as glucose. The average yield of H{sub 2} was 2.76 mol mol{sup -1} glucose, and the rate of H{sub 2} production was estimated as 0.53 kg/100 m{sup 3}/h. Our results demonstrate the utility of distillery effluent as a source of clean alternative energy and provide insights into treatment for industrial exploitation. (author)
-
Montiel Corona, Virginia; Le Borgne, Sylvie; Revah, Sergio; Morales, Marcia
2017-02-01
A Rhodobacter capsulatus strain and a photoheterotrophic culture (IZT) were cultivated to produce hydrogen under different light-dark cycles. A dark fermentation effluent (DFE) was used as substrate. It was found that IZT culture had an average cumulative hydrogen production (Paccum H 2 ) of 1300±43mLH 2 L -1 under continuous illumination and light-dark cycles of 30 or 60min. In contrast, R. capsulatus reduced its Paccum H 2 by 20% under 30:30min light-dark cycles, but tripled its poly-β-hydroxybutyrate (PHB) content (308±2mgPHB gdw -1 ) compared to continuous illumination. The highest PHB content by IZT culture was 178±10mgPHB gdw -1 under 15:15min light-dark cycles. PCR-DGGE analysis revealed that the IZT culture was mainly composed of Rhodopseudomonas palustris identified with high nucleotide similarity (99%). The evaluated cultures might be used for hydrogen and PHB production. They might provide energy savings by using light-dark cycles and DFE valorization. Copyright © 2016 Elsevier Ltd. All rights reserved.
-
Liu, Shuli; Zhang, Guangming; Zhang, Jie; Li, Xiangkun; Li, Jianzheng
2016-01-01
Effects of hydraulic retention time (HRT) and influent organic loading rate (OLR) were investigated in a photobioreactor containing PNSB (Rhodopseudomonas palustris)-chemoheterotrophic bacteria to treat volatile fatty acid wastewater. Pollutants removal, biomass production and carotenoids yield in different phases were investigated in together with functional microbial population dynamics. The results indicated that properly decreasing HRT and increasing OLR improved the nutrient removal performance as well as the biomass and carotenoids productions. 85.7% COD, 89.9% TN and 91.8% TP removals were achieved under the optimal HRT of 48h and OLR of 2.51g/L/d. Meanwhile, the highest biomass production and carotenoids yield were 2719.3mg/L and 3.91mg/g-biomass respectively. In addition, HRT and OLR have obvious impacts on PNSB and total bacteria dynamics. Statistical analyses indicated that the COD removal exhibited a positive relationship with OLR, biomass and carotenoids production. PNSB/total bacteria ratio had a positive correlation with the carotenoids yield. Copyright © 2015 Elsevier Ltd. All rights reserved.
-
Pape, Ellen; Muthumbi, Agnes; Kamanu, Chomba Peter; Vanreusel, Ann
2008-03-01
The gastropod Terebralia palustris often dominates the surface of muddy to sandy substrates of intertidal mudflats and mangrove forests, where they clearly destabilize the sediment. In the present study, it was investigated whether and to what extent the behaviour of juvenile and adult snails differs among habitats (mudflat vs. mangrove stand) in a Sonneratia alba mangal at Gazi Bay, Kenya. For this purpose we: (1) examined their distribution along three land-sea transects; and (2) applied stable isotope analysis to determine the feeding patterns of different-sized snails from the mangrove and mudflat habitats. Additionally, we investigated if these gastropods exert an impact on microphytobenthic (diatom) biomass, and whether this is size-dependent. The latter objective was met by either enclosing or excluding different-sized snails from experimental cages on the intertidal mudflat and the subsequent assessment of a change in pigment concentration of the sediment surface. In agreement with several previous studies conducted in other mangroves and geographical locations, a spatial segregation was demonstrated between juveniles (more common on the mudflat) and adults (more common in the mangrove forest). On the intertidal mudflat juveniles avoided sediment patches characterized by highly saline water in intertidal pools and a high mud content, while adults tended to dwell on substrates covered by a high amount of leaf litter. Stable carbon isotope analysis of the foot tissue of snails sampled from the S. alba stand and the mudflat indicated a transition in food source when a shell length of 51 mm is reached. Considering the δ13C value of juveniles, it seems they might be selecting for microphytobenthos, which might explain their preference for the mudflat. The diet of size classes found in both habitats did not differ significantly, although juveniles inhabiting the mangrove forest were slightly more depleted in 13C compared to those residing on the mudflat
-
Pflock, Tobias J; Oellerich, Silke; Southall, June; Cogdell, Richard J; Ullmann, G Matthias; Köhler, Jürgen
2011-07-21
We have employed time-resolved spectroscopy on the picosecond time scale in combination with dynamic Monte Carlo simulations to investigate the photophysical properties of light-harvesting 2 (LH2) complexes from the purple photosynthetic bacterium Rhodopseudomonas acidophila. The variations of the fluorescence transients were studied as a function of the excitation fluence, the repetition rate of the excitation and the sample preparation conditions. Here we present the results obtained on detergent solubilized LH2 complexes, i.e., avoiding intercomplex interactions, and show that a simple four-state model is sufficient to grasp the experimental observations quantitatively without the need for any free parameters. This approach allows us to obtain a quantitative measure for the singlet-triplet annihilation rate in isolated, noninteracting LH2 complexes.
-
Clarke, I. R.; Jones, M. A.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.
2014-12-01
Wild rice (Zizania palustris, manoomin) is an emergent aquatic plant that grows annually in the northern Great Lakes region of North America. This region is also rich in iron ore deposits and correspondingly has an extensive history of mining activities. Wild rice no longer grows in some areas where it was previously abundant. Sandy Lake, located in St. Louis County on federally protected lands that are ceded territory of the Fond du Lac Band of Lake Superior Chippewa in Minnesota and downstream of the nearby U.S. Steel Minntac mine, was selected as a test site. This lake has a history of ricing activities by the Ojibwe (Chippewa) People, for whom manoomin has cultural importance. Lake cores were taken on June 17, 2014 by LacCore and FDLRM staff and samples were obtained. This project used phytolith analysis to answer the question of past wild rice presence and abundance in Sandy Lake. Phytoliths are microscopic opal silica deposits produced in some plants. Zizania palustris produces phytolith morphotypes that are unequivocally diagnostic of this species in this region. Microscopic slides were prepared and analyzed for wild rice phytoliths. Concentration values ranged from 25 to 4379 phytoliths per cm3/year, and wild rice accumulation figures ranged from 7 to 789 phytoliths/cm2/year, the maximum values of which occurred in the 1920s and generally declined to the current lowest levels observed. Mining has likely impacted wild rice populations by causing increased sulfate levels and possibly contributing to higher lake levels.
-
Pflock, Tobias J; Oellerich, Silke; Krapf, Lisa; Southall, June; Cogdell, Richard J; Ullmann, G Matthias; Köhler, Jürgen
2011-07-21
We performed time-resolved spectroscopy on homoarrays of LH2 complexes from the photosynthetic purple bacterium Rhodopseudomonas acidophila. Variations of the fluorescence transients were monitored as a function of the excitation fluence and the repetition rate of the excitation. These parameters are directly related to the excitation density within the array and to the number of LH2 complexes that still carry a triplet state prior to the next excitation. Comparison of the experimental observations with results from dynamic Monte Carlo simulations for a model cluster of LH2 complexes yields qualitative agreement without the need for any free parameter and reveals the mutual relationship between energy transfer and annihilation processes.
-
Dipasquale, L; Adessi, A; d'Ippolito, G; Rossi, F; Fontana, A; De Philippis, R
2015-01-01
Two-stage process based on photofermentation of dark fermentation effluents is widely recognized as the most effective method for biological production of hydrogen from organic substrates. Recently, it was described an alternative mechanism, named capnophilic lactic fermentation, for sugar fermentation by the hyperthermophilic bacterium Thermotoga neapolitana in CO2-rich atmosphere. Here, we report the first application of this novel process to two-stage biological production of hydrogen. The microbial system based on T. neapolitana DSM 4359(T) and Rhodopseudomonas palustris 42OL gave 9.4 mol of hydrogen per mole of glucose consumed during the anaerobic process, which is the best production yield so far reported for conventional two-stage batch cultivations. The improvement of hydrogen yield correlates with the increase in lactic production during capnophilic lactic fermentation and takes also advantage of the introduction of original conditions for culturing both microorganisms in minimal media based on diluted sea water. The use of CO2 during the first step of the combined process establishes a novel strategy for biohydrogen technology. Moreover, this study opens the way to cost reduction and use of salt-rich waste as feedstock.
-
Xing, Defeng
2009-09-01
Power densities produced by microbial fuel cells (MFCs) in natural systems are changed by exposure to light through the enrichment of photosynthetic microorganisms. When MFCs with brush anodes were exposed to light (4000 lx), power densities increased by 8-10% for glucose-fed reactors, and 34% for acetate-fed reactors. Denaturing gradient gel electrophoresis (DGGE) profiles based on the 16S rRNA gene showed that exposure to high light levels changed the microbial communities on the anodes. Based on 16S rRNA gene clone libraries of light-exposed systems the anode communities using glucose were also significantly different than those fed acetate. Dominant bacteria that are known exoelectrogens were identified in the anode biofilm, including a purple nonsulfur (PNS) photosynthetic bacterium, Rhodopseudomonas palustris, and a dissimilatory iron-reducing bacterium, Geobacter sulfurreducens. Pure culture tests confirmed that PNS photosynthetic bacteria increased power production when exposed to high light intensities (4000 lx). These results demonstrate that power production and community composition are affected by light conditions as well as electron donors in single-chamber air-cathode MFCs. © 2009 Elsevier B.V. All rights reserved.
-
Bioaugmentation for Electricity Generation from Corn Stover Biomass Using Microbial Fuel Cells
Wang, Xin
2009-08-01
Corn stover is usually treated by an energy-intensive or expensive process to extract sugars for bioenergy production. However, it is possible to directly generate electricity from corn stover in microbial fuel cells (MFCs) through the addition of microbial consortia specifically acclimated for biomass breakdown. A mixed culture that was developed to have a high saccharification rate with corn stover was added to singlechamber, air-cathode MFCs acclimated for power production using glucose. The MFC produced a maximum power of 331 mW/ m 2 with the bioaugmented mixed culture and corn stover, compared to 510 mW/m2 using glucose. Denaturing gradient gel electrophoresis (DGGE) showed the communities continued to evolve on both the anode and corn stover biomass over 60 days, with several bacteria identified including Rhodopseudomonas palustris. The use of residual solids from the steam exploded corn stover produced 8% more power (406 mW/m2) than the raw corn stover. These results show that it is possible to directly generate electricity from waste corn stover in MFCs through bioaugmentation using naturally occurring bacteria. © 2009 American Chemical Society.
-
Xing, Defeng; Cheng, Shaoan; Regan, John M.; Logan, Bruce E.
2009-01-01
Power densities produced by microbial fuel cells (MFCs) in natural systems are changed by exposure to light through the enrichment of photosynthetic microorganisms. When MFCs with brush anodes were exposed to light (4000 lx), power densities increased by 8-10% for glucose-fed reactors, and 34% for acetate-fed reactors. Denaturing gradient gel electrophoresis (DGGE) profiles based on the 16S rRNA gene showed that exposure to high light levels changed the microbial communities on the anodes. Based on 16S rRNA gene clone libraries of light-exposed systems the anode communities using glucose were also significantly different than those fed acetate. Dominant bacteria that are known exoelectrogens were identified in the anode biofilm, including a purple nonsulfur (PNS) photosynthetic bacterium, Rhodopseudomonas palustris, and a dissimilatory iron-reducing bacterium, Geobacter sulfurreducens. Pure culture tests confirmed that PNS photosynthetic bacteria increased power production when exposed to high light intensities (4000 lx). These results demonstrate that power production and community composition are affected by light conditions as well as electron donors in single-chamber air-cathode MFCs. © 2009 Elsevier B.V. All rights reserved.
-
Dedysh, S N; Liesack, W; Khmelenina, V N; Suzina, N E; Trotsenko, Y A; Semrau, J D; Bares, A M; Panikov, N S; Tiedje, J M
2000-05-01
A new genus, Methylocella, and a new species, Methylocella palustris, are proposed for three strains of methane-oxidizing bacteria isolated from acidic Sphagnum peat bogs. These bacteria are aerobic, Gram-negative, colourless, non-motile, straight and curved rods that utilize the serine pathway for carbon assimilation, multiply by normal cell division and contain intracellular poly-beta-hydroxybutyrate granules (one at each pole). These strains use methane and methanol as sole sources of carbon and energy and are moderately acidophilic organisms with growth between pH 4.5 and pH 7.0, the optimum being at pH 5.0-5.5. The temperature range for growth is 10-28 degrees C with the optimum at 15-20 degrees C. The intracytoplasmic membrane system is different from those of type I and II methanotrophs. Cells contain an extensive periplasmic space and a vesicular membrane system connected to the cytoplasmic membrane. The strains grew only on media with a low salt content (0.2-0.5 g l(-1)). All three strains were found to possess soluble methane monooxygenase and are able to fix atmospheric nitrogen via an oxygen-sensitive nitrogenase. No products were observed in a PCR with particulate methane monooxygenase-targeted primers; hybridization with a pmoA probe was also negative. The major phospholipid fatty acids are 18:1 acids. The G+C content of the DNA is 61.2 mol%. The three strains share identical 16S rRNA gene sequences and represent a novel lineage of methane-oxidizing bacteria within the alpha-subclass of the class Proteobacteria and are only moderately related to type II methanotrophs of the Methylocystis-Methylosinus group. The three strains are most closely related to the acidophilic heterotrophic bacterium Beijerinckia indica subsp. indica (96.5% 16S rDNA sequence similarity). Collectively, these strains comprise a new species and genus Methylocella palustris gen. nov., sp. nov.; strain KT (= ATCC 700799T) is the type strain.
-
Energy Technology Data Exchange (ETDEWEB)
Sabachnikoff, V
1912-01-23
The following ornamental plants: Hepatica triloba, Helleborus orientalis, Vinca minor, Viola tricolor, Primula officinalis, Lilium candidum, Petunia, Pisum, Helleborus viridus, Galanthus nivealis, Vinca major, Convallaria maialis, Narcissus poeticus, Caltha palustris, Cystisus laburnum, Orchis maculata, Bilbergia, Eranthus, and Crocus were tested for seed production. Exposure to sulfuric acid ranged from three to forty-eight hours. Responses were noted for varying concentrations.
-
McCully, Alexandra L; LaSarre, Breah; McKinlay, James B
2017-11-28
Many mutualistic microbial relationships are based on nutrient cross-feeding. Traditionally, cross-feeding is viewed as being unidirectional, from the producer to the recipient. This is likely true when a producer's waste, such as a fermentation product, has value only for a recipient. However, in some cases the cross-fed nutrient holds value for both the producer and the recipient. In such cases, there is potential for nutrient reacquisition by producer cells in a population, leading to competition against recipients. Here, we investigated the consequences of interpartner competition for cross-fed nutrients on mutualism dynamics by using an anaerobic coculture pairing fermentative Escherichia coli and phototrophic Rhodopseudomonas palustris In this coculture, E. coli excretes waste organic acids that provide a carbon source for R. palustris In return, R. palustris cross-feeds E. coli ammonium (NH 4 + ), a compound that both species value. To explore the potential for interpartner competition, we first used a kinetic model to simulate cocultures with varied affinities for NH 4 + in each species. The model predicted that interpartner competition for NH 4 + could profoundly impact population dynamics. We then experimentally tested the predictions by culturing mutants lacking NH 4 + transporters in both NH 4 + competition assays and mutualistic cocultures. Both theoretical and experimental results indicated that the recipient must have a competitive advantage in acquiring cross-fed NH 4 + to sustain the mutualism. This recipient-biased competitive advantage is predicted to be crucial, particularly when the communally valuable nutrient is generated intracellularly. Thus, the very metabolites that form the basis for mutualistic cross-feeding can also be subject to competition between mutualistic partners. IMPORTANCE Mutualistic relationships, particularly those based on nutrient cross-feeding, promote stability of diverse ecosystems and drive global biogeochemical
-
Hydraulic architecture and tracheid allometry in mature Pinus palustris and Pinus elliottii trees.
Gonzalez-Benecke, C A; Martin, T A; Peter, G F
2010-03-01
Pinus palustris Mill. (longleaf pine, LL) and Pinus elliottii Engelm. var. elliottii (slash pine, SL) frequently co-occur in lower coastal plain flatwoods of the USA, with LL typically inhabiting slightly higher and better-drained microsites than SL. The hydraulic architecture and tracheid dimensions of roots, trunk and branches of mature LL and SL trees were compared to understand their role in species microsite occupation. Root xylem had higher sapwood-specific hydraulic conductivity (k(s)) and was less resistant to cavitation compared with branches and trunk sapwood. Root k(s) of LL was significantly higher than SL, whereas branch and trunk k(s) did not differ between species. No differences in vulnerability to cavitation were observed in any of the organs between species. Across all organs, there was a significant but weak trade-off between water conduction efficiency and safety. Tracheid hydraulic diameter (D(h)) was strongly correlated with k(s) across all organs, explaining >73% of the variation in k(s). In contrast, tracheid length (L(t)) explained only 2.4% of the variability. Nevertheless, for trunk xylem, k(s) was 39.5% higher at 20 m compared with 1.8 m; this increase in k(s) was uncorrelated with D(h) and cell-wall thickness but was strongly correlated with the difference in L(t). Tracheid allometry markedly changed between sapwood of roots, trunks and branches, possibly reflecting different mechanical constraints. Even though vulnerability to cavitation was not different for sapwood of roots, branches or the trunks of LL and SL, higher sapwood to leaf area ratio and higher maximum sapwood-specific hydraulic conductivity in roots of LL are functional traits that may provide LL with a competitive advantage on drier soil microsites.
-
Development of bacteria-based bioassays for arsenic detection in natural waters.
Diesel, Elizabeth; Schreiber, Madeline; van der Meer, Jan Roelof
2009-06-01
Arsenic contamination of natural waters is a worldwide concern, as the drinking water supplies for large populations can have high concentrations of arsenic. Traditional techniques to detect arsenic in natural water samples can be costly and time-consuming; therefore, robust and inexpensive methods to detect arsenic in water are highly desirable. Additionally, methods for detecting arsenic in the field have been greatly sought after. This article focuses on the use of bacteria-based assays as an emerging method that is both robust and inexpensive for the detection of arsenic in groundwater both in the field and in the laboratory. The arsenic detection elements in bacteria-based bioassays are biosensor-reporter strains; genetically modified strains of, e.g., Escherichia coli, Bacillus subtilis, Staphylococcus aureus, and Rhodopseudomonas palustris. In response to the presence of arsenic, such bacteria produce a reporter protein, the amount or activity of which is measured in the bioassay. Some of these bacterial biosensor-reporters have been successfully utilized for comparative in-field analyses through the use of simple solution-based assays, but future methods may concentrate on miniaturization using fiberoptics or microfluidics platforms. Additionally, there are other potential emerging bioassays for the detection of arsenic in natural waters including nematodes and clams.
-
Effects of probiotics on the growth performance and intestinal micro flora of broiler chickens.
Li, Yin-bo; Xu, Qian-qian; Yang, Cun-jin; Yang, Xin; Lv, Le; Yin, Chun-hua; Liu, Xiao-lu; Yan, Hai
2014-05-01
Antibiotics have been used in poultry industry for decades to promote growth and protect animals from diseases, followed by various side effects. In efforts of searching for a better alternative, probiotic is of extensive attention. We investigated the effects of Bacillus subtitles, Rhodopseudomonas palustris, Candida utilis and Lactobacillus acidophilus as 0.1% (W/W) feed additives on broiler growth performance and intestinal microflora. The results showed the probiotics treatments significantly improved growth of broilers. Broilers supplemented with B. subtilis and L. acidophilus weighed 18.4% and 10.1% more than birds in control group at 42 days of age. Furthermore the feed conversion ratios of the birds in the two groups were also improved, decreasing 9.1% and 12.9%, respectively. Further study indicated a significant increase of cecal Lactobacilli concentration in briolers supplemented with probiotics, expecially in L. acidophilus treatment group. Meanwhile, the count of cecal Actinomyces in birds treated with probiotics was significantly lower compared with the control group. In conclusion, probiotics such as B. subtitles and L. acidophilus are good alternatives to antibiotics in promoting growth resulting from a beneficial modulation of the intestinal micro flora, which leads to increased efficiency of intestinal digestion in the host animal.
-
Development of bacteria-based bioassays for arsenic detection in natural waters
Energy Technology Data Exchange (ETDEWEB)
Diesel, Elizabeth; Schreiber, Madeline [Virginia Tech, Department of Geosciences, Blacksburg, VA (United States); Meer, Jan Roelof van der [University of Lausanne, Department of Fundamental Microbiology, Lausanne (Switzerland)
2009-06-15
Arsenic contamination of natural waters is a worldwide concern, as the drinking water supplies for large populations can have high concentrations of arsenic. Traditional techniques to detect arsenic in natural water samples can be costly and time-consuming; therefore, robust and inexpensive methods to detect arsenic in water are highly desirable. Additionally, methods for detecting arsenic in the field have been greatly sought after. This article focuses on the use of bacteria-based assays as an emerging method that is both robust and inexpensive for the detection of arsenic in groundwater both in the field and in the laboratory. The arsenic detection elements in bacteria-based bioassays are biosensor-reporter strains; genetically modified strains of, e.g., Escherichia coli, Bacillus subtilis, Staphylococcus aureus, and Rhodopseudomonas palustris. In response to the presence of arsenic, such bacteria produce a reporter protein, the amount or activity of which is measured in the bioassay. Some of these bacterial biosensor-reporters have been successfully utilized for comparative in-field analyses through the use of simple solution-based assays, but future methods may concentrate on miniaturization using fiberoptics or microfluidics platforms. Additionally, there are other potential emerging bioassays for the detection of arsenic in natural waters including nematodes and clams. (orig.)
-
The social and economic drivers of the southeastern forest landscape
R. Kevin McIntyre; Barrett B. McCall; David N. Wear
2018-01-01
The last quarter century has witnessed an unprecedented resurgence of interest in the management of longleaf pine (Pinus palustris) forests, a phenomenon that has been coupled with increased understanding of the ecology, management, and restoration of these ecosystems. As interest in longleaf pine becomes more mainstream among landowners and the...
-
Brodin, Anders; Urhan, A Utku
2013-07-01
Laboratory studies of scatter hoarding birds have become a model system for spatial memory studies. Considering that such birds are known to have a good spatial memory, recovery success in lab studies seems low. In parids (titmice and chickadees) typically ranging between 25 and 60% if five seeds are cached in 50-128 available caching sites. Since these birds store many thousands of food items in nature in one autumn one might expect that they should easily retrieve five seeds in a laboratory where they know the environment with its caching sites in detail. We designed a laboratory set up to be as similar as possible with previous studies and trained wild caught marsh tits Poecile palustris to store and retrieve in this set up. Our results agree closely with earlier studies, of the first ten looks around 40% were correct when the birds had stored five seeds in 100 available sites both 5 and 24h after storing. The cumulative success curve suggests high success during the first 15 looks where after it declines. Humans performed much better, in the first five looks most subjects were 100% correct. We discuss possible reasons for why the birds were not doing better. Copyright © 2013 Elsevier B.V. All rights reserved.
-
Energy Technology Data Exchange (ETDEWEB)
Lockhart, D.J.; Boxer, S.G.
1987-02-10
The magnitude and direction of the change in dipole moment, ..delta mu.., associated with the Q/sub y/ transition of the dimeric primary electron donor (special pair or P870) in Rhodopseudomonas sphaeroides reaction centers have been measured by Stark spectroscopy at 20 /sup 0/C. The magnitude of ..delta mu.. is found to be f/sup -1/ (10.3 +/- 0.7) D, where f is a correction factor for the local dielectric properties of the protein matrix. With the spherical cavity approximation and an effective local dielectric constant of 2, f = 1.2, and absolute value of ..delta mu.. is 8.6 +/- 0.6 D. Absolute value of ..delta mu.. for the Q/sub y/ transition of the special pair is approximately a factor of 3.4 and 2 greater than for the monomeric bacteriochlorophylls and bacteriopheophytins, respectively, in the reaction center. The angle between ..delta mu.. and the transition dipole moment for excitation of the first singlet electron state of the special pair was found to be 24 +/- 2/sup 0/. The measured values are combined to suggest a physical model in which the lowest excited singlet state of the special pair has substantial charge-transfer character and where charge is separated between the two monomers comprising the dimeric special pair. This leads to the hypothesis that the first charge-separated state in bacterial photosynthesis is formed directly upon photoexcitation. These data provide stringent values for comparison with theoretical calculations of the electronic structure of the chromophores in the reaction center.
-
The quest for methods to identify longleaf pine stump relicts in Southeastern Virginia
Thomas L. Eberhardt; Philip M. Sheridan; Chi-Leung So; Arvind A.R. Bhuta; Karen G. Reed
2015-01-01
The discovery of lightwood and turpentine stumps in southeastern Virginia raised questions about the true historical range for longleaf pine (Pinus palustris Mill.). Several investigative studies were therefore carried out to develop a method to determine the taxa of these relicts. Chemical approaches included the use of near infrared (NIR) spectroscopy coupled with...
-
Myrbo, A.; Swain, E. B.; Engstrom, D. R.; Coleman Wasik, J.; Brenner, J.; Dykhuizen Shore, M.; Peters, E. B.; Blaha, G.
2017-11-01
Field observations suggest that surface water sulfate concentrations control the distribution of wild rice, an aquatic grass (Zizania palustris). However, hydroponic studies show that sulfate is not toxic to wild rice at even unrealistically high concentrations. To determine how sulfate might directly or indirectly affect wild rice, potential wild rice habitat was characterized for 64 chemical and physical variables in over 100 sites spanning a relatively steep climatic and geological gradient in Minnesota. Habitat suitability was assessed by comparing the occurrence of wild rice with the field variables, through binary logistic regression. This analysis demonstrated that sulfide in sediment pore water, generated by the microbial reduction of sulfate that diffuses or advects into the sediment, is the primary control of wild rice occurrence. Water temperature and water transparency independently control the suitability of habitat for wild rice. In addition to generating phytotoxic sulfide, sulfate reduction also supports anaerobic decomposition of organic matter, releasing nutrients that can compound the harm of direct sulfide toxicity. These results are important because they show that increases in sulfate loading to surface water can have multiple negative consequences for ecosystems, even though sulfate itself is relatively benign.
-
Brian K. Via; chi L. So; Leslie H. Groom; Todd F. Shupe; michael Stine; Jan. Wikaira
2007-01-01
A theoretical model was built predicting the relationship between microfibril angle and lignin content at the Angstrom (A) level. Both theoretical and statistical examination of experimental data supports a square root transformation of lignin to predict microfibril angle. The experimental material used came from 10 longleaf pine (Pinus palustris)...
-
Ricci, J. N.; Coleman, M. L.; Osburn, M. R.; Sessions, A. L.; Spear, J. R.; Newman, D. K.
2011-12-01
Hopanoids are a class of sterols produced by bacteria. Their hydrocarbon skeletons are resistant to degradation making their diagenetic products, hopanes, attractive biomarkers. Particular attention has been paid to 2-methylhopanes, which have been found at discrete times and locations in Earth history as far back as 2,500 Myr. Previously, they were inferred to be markers of oxygenic photosynthesis in cyanobacteria, but the discovery of an anoxygenic phototroph, Rhodopseudomonas palustris TIE-1, capable of producing significant quantities of 2-methylbacteriohopanetetrol, the parent molecule of the fossil 2-methylhopane, challenged this interpretation. In this study, we sought to determine the diversity and origin of the enzyme responsible for methylating hopanoids, HpnP. To accomplish this task, we surveyed a diversity of Yellowstone hot springs using degenerate PCR primers and searched publically available metagenomic databases for hpnP-like sequences. The Yellowstone hot spring samples were dominated by cyanobacterial-like hpnP sequences, while the metagenomic data contained many hpnP-like sequences from a diversity of environments that grouped with all known hpnP-containing phyla. With these additional hpnP sequences, we will report updated phylogenetic trees that attempt to determine the origin of hpnP. Understanding the distribution of 2-methylhopanoid production throughout the tree of life and its origin is important to be able to use 2-methylhopanes as biomarkers for any particular taxonomic group.
-
Wen, C Q; Xue, M; Liang, H F; Wu, Y; Li, X
2015-01-01
To develop high quality probiotics for shrimp larviculture, the effects of a photosynthetic purple sulphur bacterium WF identified as Ectothiorhodospira shaposhnikovii on survival and development of Litopenaeus vannamei larvae were evaluated in vivo. The larvae exhibited a better survival rate after administration of strain WF compared to the probiotic Rhodopseudomonas palustris. To investigate the effect of dose and dosing frequency, strain WF was added to larvae, stages nauplius 6 to zoea 3, at three different doses and dosing frequencies. Larval treatment with strain WF twice at 10(6) cfu/ml exhibited significantly higher survival compared to the other doses and dosing frequencies as well as the control. The effect on water quality was assessed by applying strain WF to larvae, stages nauplius 6 to postlarvae 1, under conditions of zero water exchange and one-third water exchange. The larvae exhibited higher survival and faster growth when treated under conditions of zero water exchange. No significant difference was detected in the levels of three water quality parameters and in vibrio counts between these two conditions. Therefore, E. shaposhnikovii WF acts both as a bioremediation agent and nutrient source and can benefit shrimp larvae if given at an appropriate dose and dosing frequency. Strain WF, a moderate halophile, shows great promise as a water additive in improving water quality and providing nutrition for shrimp larviculture.
-
Kovács, G; Burghardt, J; Pradella, S; Schumann, P; Stackebrandt, E; Màrialigeti, K
1999-01-01
Two Gram-positive, aerobic spherical actinobacteria were isolated from the rhizoplane of narrow-leaved cattail (Typha angustifolia) collected from a floating mat in the Soroksár tributary of the Danube river, Hungary. Sequence comparisons of the 16S rDNA indicated these isolates to be phylogenetic neighbours of members of the genus Kocuria, family Micrococcaceae, in which they represent two novel lineages. The phylogenetic distinctness of the two organisms TA68T and TAGA27T was supported by DNA-DNA similarity values of less than 55% between each other and with the type strains of Kocuria rosea, Kocuria kristinae and Kocuria varians. Chemotaxonomic properties supported the placement of the two isolates in the genus Kocuria. The diagnostic diamino acid of the cell-wall peptidoglycan is lysine, the interpeptide bridge is composed of three alanine residues. Predominant menaquinone was MK-7(H2). The fatty acid pattern represents the straight-chain saturated iso-anteiso type. Main fatty acid was anteiso-C15:0. The phospholipids are diphosphatidylglycerol, phosphatidylglycerol and an unknown component. The DNA base composition of strains TA68T and TAGA27T is 69.4 and 69.6 mol% G+C, respectively. Genotypic, morphological and physiological characteristics are used to describe two new species of Kocuria, for which we propose the names Kocuria palustris, type strain DSM 11925T and Kocuria rhizophila, type strain DSM 11926T.
-
Wubshet, Sileshi G; Moresco, Henrique H; Tahtah, Yousof; Brighente, Inês M C; Staerk, Dan
2015-08-01
Type 2 diabetes (T2D) is an endocrine metabolic disease with a worldwide prevalence of more than 8%, and an expected increase close to 50% in the next 15-20years. T2D is associated with severe and life-threatening complications like retinopathy, neuropathy, nephropathy, and cardiovascular diseases, and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC-HRMS-SPE-NMR. This led to identification of casuarinin, myricetin 3-O-β-d-(6″-galloyl)galactopyranoside, kaempferol 3-O-β-d-galactopyranoside, myricetin, and quercetin as α-glucosidase inhibitors. In addition, four acetylated ellagic acid rhamnosides, i.e., 4-O-(2″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(2″,3″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(3″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, and 4-O-(2″,3″,4″-O-triacetyl-α-l-rhamnopyranosyl)ellagic acid were identified. Copyright © 2015 Elsevier Ltd. All rights reserved.
-
International Nuclear Information System (INIS)
Wieloch, M.K.; Raszewska, M.W.; Drapikowska, M.
2017-01-01
The aim of the study was to compare two populations of Epipactis palustris (Orchidaceae) growing in the valley of Junikowski Stream, in the south-western part of the Poznan city (square of ATPOL BD08) and to compare current results to data on the species described in the literature. Group characteristics of both populations, such as population size, average density and congestion factor, as well as the average coefficient of dispersion, were defined. Specimen variability was determined by measuring 250 generative ramets in each population. The following plant traits were included: stem length, inflorescence length, number of flowers per inflorescence, number of leaves per stem and length and width of the largest leaf. Obtained data were subjected to statistical analyses. Descriptive statistics were calculated (arithmetic average, standard deviation, minimum and maximum). The variation coefficient (V) was established to determine the variation degree of each trait. In order to determine statistical significance of average values of traits of the samples in question, the factor variance ANOVA F-statistics was used. The significance degree was examined with Scheffe's test. Principal component analysis (PCA) enabled the examination of mutual relations between the samples in the system of two first principal components. This work confirmed previous information about low variability of marsh helleborine. Individual traits in both populations were very similar. The differences concerned the group characteristics. The plants were in good condition irrespective of occupied habitat. (author)
-
International Nuclear Information System (INIS)
Dewa, Takehisa; Sumino, Ayumi; Watanabe, Natsuko; Noji, Tomoyasu; Nango, Mamoru
2013-01-01
Highlights: ► Photosynthetic light-harvesting complexes were reconstituted into lipid membranes. ► Energy transfers between light-harvesting complexes were examined. ► Atomic force microscopy indicated cluster formation of light-harvesting complexes. ► Efficient energy transfer was observed for the clustered complexes in the membranes. - Abstract: In purple photosynthetic bacteria, light-harvesting complex 2 (LH2) and light harvesting/reaction centre core complex (LH1-RC) play the key roles of capturing and transferring light energy and subsequent charge separation. These photosynthetic apparatuses form a supramolecular assembly; however, how the assembly influences the efficiency of energy conversion is not yet clear. We addressed this issue by evaluating the energy transfer in reconstituted photosynthetic protein complexes LH2 and LH1-RC and studying the structures and the membrane environment of the LH2/LH1-RC assemblies, which had been embedded into various lipid bilayers. Thus, LH2 and LH1-RC from Rhodopseudomonas palustris 2.1.6 were reconstituted in phosphatidylglycerol (PG), phosphatidylcholine (PC), and phosphatidylethanolamine (PE)/PG/cardiolipin (CL). Efficient energy transfer from LH2 to LH1-RC was observed in the PC and PE/PG/CL membranes. Atomic force microscopy revealed that LH2 and LH1-RC were heterogeneously distributed to form clusters in the PC and PE/PG/CL membranes. The results indicated that the phospholipid species influenced the cluster formation of LH2 and LH1-RC as well as the energy transfer efficiency
-
Energy Technology Data Exchange (ETDEWEB)
Dewa, Takehisa, E-mail: takedewa@nitech.ac.jp [Department of Frontier Materials, Graduate School of Engineering, Nagoya Institute of Technology, Gokiso-cho, Showa-ku, Nagoya 466-8555 (Japan); Japan Science and Technology, PRESTO, 4-1-8 Honcho Kawaguchi, Saitama 332-0012 (Japan); Sumino, Ayumi; Watanabe, Natsuko; Noji, Tomoyasu [Department of Frontier Materials, Graduate School of Engineering, Nagoya Institute of Technology, Gokiso-cho, Showa-ku, Nagoya 466-8555 (Japan); Nango, Mamoru, E-mail: nango@nitech.ac.jp [Department of Frontier Materials, Graduate School of Engineering, Nagoya Institute of Technology, Gokiso-cho, Showa-ku, Nagoya 466-8555 (Japan)
2013-06-20
Highlights: ► Photosynthetic light-harvesting complexes were reconstituted into lipid membranes. ► Energy transfers between light-harvesting complexes were examined. ► Atomic force microscopy indicated cluster formation of light-harvesting complexes. ► Efficient energy transfer was observed for the clustered complexes in the membranes. - Abstract: In purple photosynthetic bacteria, light-harvesting complex 2 (LH2) and light harvesting/reaction centre core complex (LH1-RC) play the key roles of capturing and transferring light energy and subsequent charge separation. These photosynthetic apparatuses form a supramolecular assembly; however, how the assembly influences the efficiency of energy conversion is not yet clear. We addressed this issue by evaluating the energy transfer in reconstituted photosynthetic protein complexes LH2 and LH1-RC and studying the structures and the membrane environment of the LH2/LH1-RC assemblies, which had been embedded into various lipid bilayers. Thus, LH2 and LH1-RC from Rhodopseudomonas palustris 2.1.6 were reconstituted in phosphatidylglycerol (PG), phosphatidylcholine (PC), and phosphatidylethanolamine (PE)/PG/cardiolipin (CL). Efficient energy transfer from LH2 to LH1-RC was observed in the PC and PE/PG/CL membranes. Atomic force microscopy revealed that LH2 and LH1-RC were heterogeneously distributed to form clusters in the PC and PE/PG/CL membranes. The results indicated that the phospholipid species influenced the cluster formation of LH2 and LH1-RC as well as the energy transfer efficiency.
-
Structural characterization of core-bradavidin in complex with biotin
Agrawal, Nitin; Määttä, Juha A. E.; Kulomaa, Markku S.; Hytönen, Vesa P.; Johnson, Mark S.; Airenne, Tomi T.
2017-01-01
Bradavidin is a tetrameric biotin-binding protein similar to chicken avidin and bacterial streptavidin, and was originally cloned from the nitrogen-fixing bacteria Bradyrhizobium diazoefficiens. We have previously reported the crystal structure of the full-length, wild-type (wt) bradavidin with 138 amino acids, where the C-terminal residues Gly129-Lys138 (“Brad-tag”) act as an intrinsic ligand (i.e. Gly129-Lys138 bind into the biotin-binding site of an adjacent subunit within the same tetramer) and has potential as an affinity tag for biotechnological purposes. Here, the X-ray structure of core-bradavidin lacking the C-terminal residues Gly114-Lys138, and hence missing the Brad-tag, was crystallized in complex with biotin at 1.60 Å resolution [PDB:4BBO]. We also report a homology model of rhodavidin, an avidin-like protein from Rhodopseudomonas palustris, and of an avidin-like protein from Bradyrhizobium sp. Ai1a-2, both of which have the Brad-tag sequence at their C-terminus. Moreover, core-bradavidin V1, an engineered variant of the original core-bradavidin, was also expressed at high levels in E. coli, as well as a double mutant (Cys39Ala and Cys69Ala) of core-bradavidin (CC mutant). Our data help us to further engineer the core-bradavidin–Brad-tag pair for biotechnological assays and chemical biology applications, and provide deeper insight into the biotin-binding mode of bradavidin. PMID:28426764
-
Sakpirom, Jakkapan; Kantachote, Duangporn; Nunkaew, Tomorn; Khan, Eakalak
2017-04-01
This study was aimed at selecting purple non-sulfur bacteria (PNSB) isolated from various paddy fields, including Cd- and Zn-contaminated paddy fields, based on their biofertilizer properties. Among 235 PNSB isolates, strain TN110 was most effective in plant growth-promoting substance (PGPS) production, releasing 3.2 mg/L of [Formula: see text] , 4.11 mg/L of 5-aminolevulinic acid (ALA) and 3.62 mg/L of indole-3-acetic acid (IAA), and reducing methane emission up to 80%. This strain had nifH, vnfG and anfG, which are the Mo, V and Fe nitrogenase genes encoded for key enzymes in nitrogen fixation under different conditions. This strain provided 84% and 55% removal of Cd and Zn, respectively. Another isolate, TN414, not only produced PGPS (1.30 mg/L of [Formula: see text] , 0.94 mg/L of ALA and 0.65 mg/L of IAA), but was also efficient in removing both Cd and Zn at 72% and 74%, respectively. Based on 16S rDNA sequencing, strain TN110 was identified as Rhodopseudomonas palustris, while strain TN414 was Rubrivivax gelatinosus. A combination of TN110 and TN414 could potentially provide a biofertilizer, which is a greener alternative to commercial/chemical fertilizers and an agent for bioremediation of heavy metals and greenhouse gas mitigation in paddy fields. Copyright © 2016 Institut Pasteur. All rights reserved.
-
Structural characterization of core-bradavidin in complex with biotin.
Directory of Open Access Journals (Sweden)
Nitin Agrawal
Full Text Available Bradavidin is a tetrameric biotin-binding protein similar to chicken avidin and bacterial streptavidin, and was originally cloned from the nitrogen-fixing bacteria Bradyrhizobium diazoefficiens. We have previously reported the crystal structure of the full-length, wild-type (wt bradavidin with 138 amino acids, where the C-terminal residues Gly129-Lys138 ("Brad-tag" act as an intrinsic ligand (i.e. Gly129-Lys138 bind into the biotin-binding site of an adjacent subunit within the same tetramer and has potential as an affinity tag for biotechnological purposes. Here, the X-ray structure of core-bradavidin lacking the C-terminal residues Gly114-Lys138, and hence missing the Brad-tag, was crystallized in complex with biotin at 1.60 Å resolution [PDB:4BBO]. We also report a homology model of rhodavidin, an avidin-like protein from Rhodopseudomonas palustris, and of an avidin-like protein from Bradyrhizobium sp. Ai1a-2, both of which have the Brad-tag sequence at their C-terminus. Moreover, core-bradavidin V1, an engineered variant of the original core-bradavidin, was also expressed at high levels in E. coli, as well as a double mutant (Cys39Ala and Cys69Ala of core-bradavidin (CC mutant. Our data help us to further engineer the core-bradavidin-Brad-tag pair for biotechnological assays and chemical biology applications, and provide deeper insight into the biotin-binding mode of bradavidin.
-
Directory of Open Access Journals (Sweden)
Claudia V Castell-Miller
Full Text Available The fungus Cochliobolus miyabeanus causes severe leaf spot disease on rice (Oryza sativa and two North American specialty crops, American wildrice (Zizania palustris and switchgrass (Panicum virgatum. Despite the importance of C. miyabeanus as a disease-causing agent in wildrice, little is known about either the mechanisms of pathogenicity or host defense responses. To start bridging these gaps, the genome of C. miyabeanus strain TG12bL2 was shotgun sequenced using Illumina technology. The genome assembly consists of 31.79 Mbp in 2,378 scaffolds with an N50 = 74,921. It contains 11,000 predicted genes of which 94.5% were annotated. Approximately 10% of total gene number is expected to be secreted. The C. miyabeanus genome is rich in carbohydrate active enzymes, and harbors 187 small secreted peptides (SSPs and some fungal effector homologs. Detoxification systems were represented by a variety of enzymes that could offer protection against plant defense compounds. The non-ribosomal peptide synthetases and polyketide synthases (PKS present were common to other Cochliobolus species. Additionally, the fungal transcriptome was analyzed at 48 hours after inoculation in planta. A total of 10,674 genes were found to be expressed, some of which are known to be involved in pathogenicity or response to host defenses including hydrophobins, cutinase, cell wall degrading enzymes, enzymes related to reactive oxygen species scavenging, PKS, detoxification systems, SSPs, and a known fungal effector. This work will facilitate future research on C. miyabeanus pathogen-associated molecular patterns and effectors, and in the identification of their corresponding wildrice defense mechanisms.
-
Breton, J; Bibikova, M; Oesterhelt, D; Nabedryk, E
1999-08-31
The light-induced Fourier transform infrared (FTIR) difference spectra corresponding to the photoreduction of either the HA bacteriopheophytin electron acceptor (HA-/HA spectrum) or the QA primary quinone (QA-/QA spectrum) in photosynthetic reaction centers (RCs) of Rhodopseudomonas viridis are reported. These spectra have been compared for wild-type (WT) RCs and for two site-directed mutants in which the proposed interactions between the carbonyls on ring V of HA and the RC protein have been altered. In the mutant EQ(L104), the putative hydrogen bond between the protein and the 9-keto C=O of HA should be affected by changing Glu L104 to a Gln. In the mutant WF(M250), the van der Waals interactions between Trp M250 and the 10a-ester C=O of HA should be modified. The characteristic effects of both mutations on the FTIR spectra support the proposed interactions and allow the IR modes of the 9-keto and 10a-ester C=O of HA and HA- to be assigned. Comparison of the HA-/HA and QA-/QA spectra leads us to conclude that the QA-/QA IR signals in the spectral range above 1700 cm-1 are largely dominated by contributions from the electrostatic response of the 10a-ester C=O mode of HA upon QA photoreduction. A heterogeneity in the conformation of the 10a-ester C=O mode of HA in WT RCs, leading to three distinct populations of HA, appears to be related to differences in the hydrogen-bonding interactions between the carbonyls of ring V of HA and the RC protein. The possibility that this structural heterogeneity is related to the observed multiexponential kinetics of electron transfer and the implications for primary processes are discussed. The effect of 1H/2H exchange on the QA-/QA spectra of the WT and mutant RCs shows that neither Glu L104 nor any other exchangeable carboxylic residue changes appreciably its protonation state upon QA reduction.
-
International Nuclear Information System (INIS)
Raghu, G.; Maruthi Mohan, P.; Balaji, V.; Venkateswaran, G.; Rodrigue, A.; Lyon 1 Univ., 69
2008-01-01
Removal of radioactive cobalt at trace levels (∼nM) in the presence of large excess (10 6 -fold) of corrosion product ions of complexed Fe, Cr, and Ni in spent chemical decontamination formulations (simulated effluent) of nuclear reactors is currently done by using synthetic organic ion exchangers. A large volume of solid waste is generated due to the nonspecific nature of ion sorption. Our earlier work using various fungi and bacteria, with the aim of nuclear waste volume reduction, realized up to 30% of Co removal with specific capacities calculated up to 1 μg/g in 6-24 h. In the present study using engineered Escherichia coli expressing NiCoT genes from Rhodopseudomonas palustris CGA009 (RP) and Novosphingobium aromaticivorans F-199 (NA), we report a significant increase in the specific capacity for Co removal (12 μg/g) in 1-h exposure to simulated effluent. About 85% of Co removal was achieved in a two-cycle treatment with the cloned bacteria. Expression of NiCoT genes in the E. coli knockout mutant of NiCoT efflux gene (rcnA) was more efficient as compared to expression in wild-type E. coli MC4100, JM109 and BL21 (DE3) hosts. The viability of the E. coli strains in the formulation as well as at different doses of gamma rays exposure and the effect of gamma dose on their cobalt removal capacity are determined. The potential application scheme of the above process of bioremediation of cobalt from nuclear power reactor chemical decontamination effluents is discussed. (orig.)
-
Energy Technology Data Exchange (ETDEWEB)
Chen, Chun-Yen; Chang, Jo-Shu [Department of Chemical Engineering, National Cheng Kung University, Tainan (China); Sustainable Environment Research Center, National Cheng Kung University, Tainan (China); Yeh, Kuei-Ling; Lo, Yung-Chung [Department of Chemical Engineering, National Cheng Kung University, Tainan (China); Wang, Hui-Min [Department of Fragrance and Cosmetic Science, Kaohsiung Medical University, Kaohsiung (China)
2010-12-15
The major obstacle of combining dark and photo fermentation for high-yield biohydrogen production is substrate inhibition while using dark fermentation effluent as the sole substrate. To solve this problem, the dark fermentation broth was diluted with different dilution ratio to improve photo-H{sub 2} production performance of an indigenous purple nonsulfur bacterium Rhodopseudomonas palustris WP3-5. The best photo-H{sub 2} production performance occurred at a dilution ratio of 1:2, giving a highest overall H{sub 2} production rate of 10.72 ml/l/h and a higher overall H{sub 2} yield of 6.14 mol H{sub 2}/mol sucrose. The maximum H{sub 2} content was about 88.1% during the dilution ratio of 1:2. The photo-H{sub 2} production performance was further improved by supplying yeast extract and glutamic acid as the nutrient. The results indicate that the overall H{sub 2} production rate and H{sub 2} yield increased to 17.02 ml/l/h and 10.25 mol H{sub 2}/mol sucrose, respectively. Using a novel solar-energy-excited optical fiber photobioreactor (SEEOFP) with supplementing tungsten filament lamp (TL) irradiation, the overall H{sub 2} production rate was improved to 17.86 ml/l/h. Meanwhile, the power consumption by combining SEEOFP and TL was about 37.1% lower than using TL alone. This study demonstrates that using optimal light sources and proper dilution of dark fermentation effluent, the performance of photo-H{sub 2} production can be markedly enhanced along with a reduction of power consumption. (author)
-
Liu, Wenhui; Yuan, Linjiang; Wei, Bo
2016-09-01
In the present study, a new type of interior optical fiber illuminating reactor was developed for H2 production to solve the problem of luminous intensity attenuation at the center portion of a reactor, and an immobilization technique was used to enhance the stability of a continuous hydrogen production process with attached photosynthetic bacteria, using glucose as a sole carbon substrate for the indigenous photosynthetic bacteria (PSB) Rhodopseudomonas palustris SP-6. Results of the experiments showed that the interior optical fiber illuminating reactor produces H2 more efficiently and productively than the exterior light source reactor, with the cumulative H2 production, the maximum H2 production rate and H2 yield increased by 813ml, 11.3ml l-1 h-1 and 22.3%, respectively. The stability of the product of continuous hydrogen was realized by immobilizing PSB on the surface of powder active carbon(PAC). After adding the dosage of 2.0g l-1 PAC, the continuous steady operation of H2 production gave a high H2 yield of 1.398 mol H2 mol-1 glucose and an average H2 production rate of 35.1ml l-1 h-1 illuminating with a single interior optical fiber light source. Meanwhile, a higher H2 yield of 1.495 mol H2 mol-1 glucose and an average H2 production rate of 38.7ml l-1 h-1 were attained illuminating with a compound lamp in the continuous H2 production for 20 days.
-
Apo-bacteriophytochromes modulate bacterial photosynthesis in response to low light.
Fixen, Kathryn R; Baker, Anna W; Stojkovic, Emina A; Beatty, J Thomas; Harwood, Caroline S
2014-01-14
Bacteriophytochromes (BphPs) are light-sensing regulatory proteins encoded by photosynthetic and nonphotosynthetic bacteria. This protein class has been characterized structurally, but its biological activities remain relatively unexplored. Two BphPs in the anoxygenic photosynthetic bacterium Rhodopseudomonas palustris, designated regulatory proteins RpBphP2 and RpBphP3, are configured as light-regulated histidine kinases, which initiate a signal transduction system that controls expression of genes for the low light harvesting 4 (LH4) antenna complex. In vitro, RpBphP2 and RpBphP3 respond to light quality by reversible photoconversion, a property that requires the light-absorbing chromophore biliverdin. In vivo, RpBphP2 and RpBphP3 are both required for the expression of the LH4 antenna complex under anaerobic conditions, but biliverdin requires oxygen for its synthesis by heme oxygenase. On further investigation, we found that the apo-bacteriophytochrome forms of RpBphP2 and RpBphP3 are necessary and sufficient to control LH4 expression in response to light intensity in conjunction with other signal transduction proteins. One possibility is that the system senses a reduced quinone pool generated when light energy is absorbed by bacteriochlorophyll. The biliverdin-bound forms of the BphPs have the additional property of being able to fine-tune LH4 expression in response to light quality. These observations support the concept that some bacteriophytochromes can function with or without a chromophore and may be involved in regulating physiological processes not directly related to light sensing.
-
Theory of Excitonic Delocalization for Robust Vibronic Dynamics in LH2.
Caycedo-Soler, Felipe; Lim, James; Oviedo-Casado, Santiago; van Hulst, Niek F; Huelga, Susana F; Plenio, Martin B
2018-06-11
Nonlinear spectroscopy has revealed long-lasting oscillations in the optical response of a variety of photosynthetic complexes. Different theoretical models that involve the coherent coupling of electronic (excitonic) or electronic-vibrational (vibronic) degrees of freedom have been put forward to explain these observations. The ensuing debate concerning the relevance of either mechanism may have obscured their complementarity. To illustrate this balance, we quantify how the excitonic delocalization in the LH2 unit of Rhodopseudomonas acidophila purple bacterium leads to correlations of excitonic energy fluctuations, relevant coherent vibronic coupling, and importantly, a decrease in the excitonic dephasing rates. Combining these effects, we identify a feasible origin for the long-lasting oscillations observed in fluorescent traces from time-delayed two-pulse single-molecule experiments performed on this photosynthetic complex and use this approach to discuss the role of this complementarity in other photosynthetic systems.
-
Rare, threatened and relict species in flora of SNR Zasavica
Directory of Open Access Journals (Sweden)
Stanković, M.
2011-09-01
Full Text Available In group of biodiversity important plant species there are 23 taxa. 20 taxa are mentioned in „Preliminary Red List of flora of Serbia and Montenegro with IUCN 2001 Conservation Statuses“ in following categories: two as critically endangered (Aldrovanda vesiculosa L. and Hottonia palustris L., four as endangered (Hippuris vulgaris L., Lindernia palustris Hartm., Ranunculus lingua L. and Urtica kioviensis Rogow., five as vulnerable (Achillea aspleniifolia Vent., Dryopteris carthusiana (Vill. H. P. Fuchs, Leucojum aestivum L. subsp. aestivum, Stratiotes aloides L. and Thelypteris palustris (Schott subsp.palustris, while 9 are with indefinite categories (CR-VU, due to data deficient (DD. Special Nature Reserve „Zasavica“ is the only habitat in Serbia for Aldrovanda vesiculosa L., which was until 2005. considered as extinct from Serbia.
-
Insight into the structure of photosynthetic LH2 aggregate from spectroscopy simulations.
Rancova, Olga; Sulskus, Juozas; Abramavicius, Darius
2012-07-12
Using the electrostatic model of intermolecular interactions, we obtain the Frenkel exciton Hamiltonian parameters for the chlorophyll Qy band of a photosynthetic peripheral light harvesting complex LH2 of a purple bacteria Rhodopseudomonas acidophila from structural data. The intermolecular couplings are mostly determined by the chlorophyll relative positions, whereas the molecular transition energies are determined by the background charge distribution of the whole complex. The protonation pattern of titratable residues is used as a tunable parameter. By studying several protonation state scenarios for distinct protein groups and comparing the simulated absorption and circular dichroism spectra to experiment, we determine the most probable configuration of the protonation states of various side groups of the protein.
-
Directory of Open Access Journals (Sweden)
DWI SURYANTO
2001-01-01
Full Text Available Three anoxygenic photosyn thetic bacter ia, DS-1, DS-4 and Cas-13, have been exam in ated for their morphological and physiolog ical propert ies. All s trains were rod-sh ape ce lls with a swollen terminal end, Gram nega tive , motile, non-hal ophilic, non-alkal ophilic a n d non- acid ophilic , a nd capable of utilizing benzoate aerobically and photo-anaerobically. Sequ ence analysis of part of 16S rRNA genes showed that DS-1 and Cas- 13 we re cl osel y relate d to Rhodopseudomonas palustris Stra in 7 w ith a simila ri ty of 97%, where a s DS-4 ma y not be c losel y rela te d t o the former t wo str ai ns wit h a si milarit y of 78% based on t he constr ucte d phyloge nic tree . Sp ec tral anal ys is ind ica te d that the thr ee ba cter ia ha d ba cter io ch lorophyl a and norm al sp ir il loxa nthi n ser ies. Growth in med ium enriched with vitamin and supplemen ted with ben zoa te as their s ole C-s ources wa s bette r t han in me di um witho ut vita min. Benz oate deg ra dati on in me di u m with vita min was ac ce lerated. The ab ility to grow on benzoate withou t added vitam ins ind icated that the bacteria were able to s ynthesize th eir own vitamins.
-
Battistuzzi, G; Borsari, M; Sola, M; Francia, F
1997-12-23
The reduction potentials of beef heart cytochrome c and cytochromes c2 from Rhodopseudomonas palustris, Rhodobacter sphaeroides, and Rhodobacter capsulatus were measured through direct electrochemistry at a surface-modified gold electrode as a function of temperature in nonisothermal experiments carried out at neutral and alkaline pH values. The thermodynamic parameters for protein reduction (DeltaS degrees rc and DeltaH degrees rc) were determined for the native and alkaline conformers. Enthalpy and entropy terms underlying species-dependent differences in E degrees and pH- and temperature-induced E degrees changes for a given cytochrome were analyzed. The difference of about +0.1 V in E degrees between cytochromes c2 and the eukaryotic species can be separated into an enthalpic term (-DeltaDeltaH degrees rc/F) of +0.130 V and an entropic term (TDeltaDeltaS degrees rc/F) of -0.040 V. Hence, the higher potential of the bacterial species appears to be determined entirely by a greater enthalpic stabilization of the reduced state. Analogously, the much lower potential of the alkaline conformer(s) as compared to the native species is by far enthalpic in origin for both protein families, and is largely determined by the substitution of Met for Lys in axial heme ligation. Instead, the biphasic E degrees /temperature profile for the native cytochromes is due to a difference in reduction entropy between the conformers at low and high temperatures. Temperature-dependent 1H NMR experiments suggest that the temperature-induced transition also involves a change in orientation of the axial methionine ligand with respect to the heme plane.
-
Directory of Open Access Journals (Sweden)
M Mohammadi
2017-02-01
Full Text Available Background & aim: Couple burnout is one of the phenomena which involve many couples, it is among the main causes of emotional divorce, and without proper management and treatment, and it can lay the ground for formal divorce among couples. Cognitive behavioral couple therapy is one of the existing approaches in the couple therapy field, the efficiency of which has been established for resolving many marital problems. The present study was designed by the aim of investigating the effect of group cognitive behavioral couple therapy on couple burnout and divorce tendency in couples. Methods: The present research was of applied research type. The research method was semi-empirical with a pretest-posttest with control group design. The research population included all the couples with marital conflict and problems who, after a recall announcement of the researcher, visited the counseling and psychological services center located in Gorgan city in 2014. By using the available sampling method, 20 couples were selected among the volunteer and qualified couples for the research, and they were assigned into experiment and control groups (10 couples per group by random assignment. In the present research, the Pines burnout questionnaire (1996 and divorce tendency scale of Rouswelt, Johnson, and Mouro (1986 were used for gathering the data. After taking the pretest, the group cognitive behavioral couple therapy based on the couple therapy model of Baucom and colleagues (2008 was held in 10 2-hour weekly sessions for the experiment group couples, while the control group couples received no intervention. The data were analyzed through descriptive statistics method and multivariate covariance analysis (MANCOVA in SPSS v.20. Results: The multivariate covariance analysis results for couple burnout (F= 28.80 and divorce tendency (F= 51.25 suggested that there was a significant difference between the couples of experiment and control groups (P< 0
-
Path coupling and aggregate path coupling
Kovchegov, Yevgeniy
2018-01-01
This book describes and characterizes an extension to the classical path coupling method applied to statistical mechanical models, referred to as aggregate path coupling. In conjunction with large deviations estimates, the aggregate path coupling method is used to prove rapid mixing of Glauber dynamics for a large class of statistical mechanical models, including models that exhibit discontinuous phase transitions which have traditionally been more difficult to analyze rigorously. The book shows how the parameter regions for rapid mixing for several classes of statistical mechanical models are derived using the aggregate path coupling method.
-
Czech Academy of Sciences Publication Activity Database
Šída, O.; Štěpánková, Jitka
2015-01-01
Roč. 50, č. 1 (2015), s. 100-101 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : floristics * distribution * endangered species Subject RIV: EF - Botanics
-
Directory of Open Access Journals (Sweden)
Csengele E. Barta
2017-10-01
Full Text Available Mature oak (Quercus spp. leaves, although abundantly available during the plants’ developmental cycle, are rarely exploited as viable sources of genomic DNA. These leaves are rich in metabolites difficult to remove during standard DNA purification, interfering with downstream molecular genetics applications. The current work assessed whether in situ dark adaptation, to deplete sugar reserves and inhibit secondary metabolite synthesis could compensate for the difficulties encountered when isolating DNA from mature leaves rich in secondary metabolites. We optimized a rapid, commercial kit based method to extract genomic DNA from dark- and light-adapted leaves. We demonstrated that in situ dark adaptation increases the yield and quality of genomic DNA obtained from mature oak leaves, yielding templates of sufficiently high quality for direct downstream applications, such as PCR amplification and gene identification. The quality of templates isolated from dark-adapted pin oak leaves particularly improved the amplification of larger fragments in our experiments. From DNA extracts prepared with our optimized method, we identified for the first time partial segments of the genes encoding 18S rRNA and isoprene synthase (IspS from pin oak (Quercus palustris, whose full genome has not yet been sequenced.
-
Expressed Peptide Tags: An additional layer of data for genome annotation
Energy Technology Data Exchange (ETDEWEB)
Savidor, Alon [ORNL; Donahoo, Ryan S [ORNL; Hurtado-Gonzales, Oscar [University of Tennessee, Knoxville (UTK); Verberkmoes, Nathan C [ORNL; Shah, Manesh B [ORNL; Lamour, Kurt H [ORNL; McDonald, W Hayes [ORNL
2006-01-01
While genome sequencing is becoming ever more routine, genome annotation remains a challenging process. Identification of the coding sequences within the genomic milieu presents a tremendous challenge, especially for eukaryotes with their complex gene architectures. Here we present a method to assist the annotation process through the use of proteomic data and bioinformatics. Mass spectra of digested protein preparations of the organism of interest were acquired and searched against a protein database created by a six frame translation of the genome. The identified peptides were mapped back to the genome, compared to the current annotation, and then categorized as supporting or extending the current genome annotation. We named the classified peptides Expressed Peptide Tags (EPTs). The well annotated bacterium Rhodopseudomonas palustris was used as a control for the method and showed high degree of correlation between EPT mapping and the current annotation, with 86% of the EPTs confirming existing gene calls and less than 1% of the EPTs expanding on the current annotation. The eukaryotic plant pathogens Phytophthora ramorum and Phytophthora sojae, whose genomes have been recently sequenced and are much less well annotated, were also subjected to this method. A series of algorithmic steps were taken to increase the confidence of EPT identification for these organisms, including generation of smaller sub-databases to be searched against, and definition of EPT criteria that accommodates the more complex eukaryotic gene architecture. As expected, the analysis of the Phytophthora species showed less correlation between EPT mapping and their current annotation. While ~77% of Phytophthora EPTs supported the current annotation, a portion of them (7.2% and 12.6% for P. ramorum and P. sojae, respectively) suggested modification to current gene calls or identified novel genes that were missed by the current genome annotation of these organisms.
-
Fonseca, Jose Pedro; Hoffmann, Luisa; Cabral, Bianca Catarina Azeredo; Dias, Victor Hugo Giordano; Miranda, Marcio Rodrigues; de Azevedo Martins, Allan Cezar; Boschiero, Clarissa; Bastos, Wanderley Rodrigues; Silva, Rosane
2018-02-05
Pristine forest ecosystems provide a unique perspective for the study of plant-associated microbiota since they host a great microbial diversity. Although the Amazon forest is one of the hotspots of biodiversity around the world, few metagenomic studies described its microbial community diversity thus far. Understanding the environmental factors that can cause shifts in microbial profiles is key to improving soil health and biogeochemical cycles. Here we report a taxonomic and functional characterization of the microbiome from the rhizosphere of Brosimum guianense (Snakewood), a native tree, and bulk soil samples from a pristine Brazilian Amazon forest reserve (Cuniã), for the first time by the shotgun approach. We identified several fungi and bacteria taxon significantly enriched in forest rhizosphere compared to bulk soil samples. For archaea, the trend was the opposite, with many archaeal phylum and families being considerably more enriched in bulk soil compared to forest rhizosphere. Several fungal and bacterial decomposers like Postia placenta and Catenulispora acidiphila which help maintain healthy forest ecosystems were found enriched in our samples. Other bacterial species involved in nitrogen (Nitrobacter hamburgensis and Rhodopseudomonas palustris) and carbon cycling (Oligotropha carboxidovorans) were overrepresented in our samples indicating the importance of these metabolic pathways for the Amazon rainforest reserve soil health. Hierarchical clustering based on taxonomic similar microbial profiles grouped the forest rhizosphere samples in a distinct clade separated from bulk soil samples. Principal coordinate analysis of our samples with publicly available metagenomes from the Amazon region showed grouping into specific rhizosphere and bulk soil clusters, further indicating distinct microbial community profiles. In this work, we reported significant shifts in microbial community structure between forest rhizosphere and bulk soil samples from an Amazon
-
International Nuclear Information System (INIS)
Wu, Liyou; Yi, T.Y.; Van Nostrand, Joy; Zhou, Jizhong
2010-01-01
Phylogenetic analyses were done for the Shewanella strains isolated from Baltic Sea (38 strains), US DOE Hanford Uranium bioremediation site (Hanford Reach of the Columbia River (HRCR), 11 strains), Pacific Ocean and Hawaiian sediments (8 strains), and strains from other resources (16 strains) with three out group strains, Rhodopseudomonas palustris, Clostridium cellulolyticum, and Thermoanaerobacter ethanolicus X514, using DNA relatedness derived from WCGA-based DNA-DNA hybridizations, sequence similarities of 16S rRNA gene and gyrB gene, and sequence similarities of 6 loci of Shewanella genome selected from a shared gene list of the Shewanella strains with whole genome sequenced based on the average nucleotide identity of them (ANI). The phylogenetic trees based on 16S rRNA and gyrB gene sequences, and DNA relatedness derived from WCGA hybridizations of the tested Shewanella strains share exactly the same sub-clusters with very few exceptions, in which the strains were basically grouped by species. However, the phylogenetic analysis based on DNA relatedness derived from WCGA hybridizations dramatically increased the differentiation resolution at species and strains level within Shewanella genus. When the tree based on DNA relatedness derived from WCGA hybridizations was compared to the tree based on the combined sequences of the selected functional genes (6 loci), we found that the resolutions of both methods are similar, but the clustering of the tree based on DNA relatedness derived from WMGA hybridizations was clearer. These results indicate that WCGA-based DNA-DNA hybridization is an idea alternative of conventional DNA-DNA hybridization methods and it is superior to the phylogenetics methods based on sequence similarities of single genes. Detailed analysis is being performed for the re-classification of the strains examined.
-
Energy Technology Data Exchange (ETDEWEB)
Wu, Liyou; Yi, T. Y.; Van Nostrand, Joy; Zhou, Jizhong
2010-05-17
Phylogenetic analyses were done for the Shewanella strains isolated from Baltic Sea (38 strains), US DOE Hanford Uranium bioremediation site [Hanford Reach of the Columbia River (HRCR), 11 strains], Pacific Ocean and Hawaiian sediments (8 strains), and strains from other resources (16 strains) with three out group strains, Rhodopseudomonas palustris, Clostridium cellulolyticum, and Thermoanaerobacter ethanolicus X514, using DNA relatedness derived from WCGA-based DNA-DNA hybridizations, sequence similarities of 16S rRNA gene and gyrB gene, and sequence similarities of 6 loci of Shewanella genome selected from a shared gene list of the Shewanella strains with whole genome sequenced based on the average nucleotide identity of them (ANI). The phylogenetic trees based on 16S rRNA and gyrB gene sequences, and DNA relatedness derived from WCGA hybridizations of the tested Shewanella strains share exactly the same sub-clusters with very few exceptions, in which the strains were basically grouped by species. However, the phylogenetic analysis based on DNA relatedness derived from WCGA hybridizations dramatically increased the differentiation resolution at species and strains level within Shewanella genus. When the tree based on DNA relatedness derived from WCGA hybridizations was compared to the tree based on the combined sequences of the selected functional genes (6 loci), we found that the resolutions of both methods are similar, but the clustering of the tree based on DNA relatedness derived from WMGA hybridizations was clearer. These results indicate that WCGA-based DNA-DNA hybridization is an idea alternative of conventional DNA-DNA hybridization methods and it is superior to the phylogenetics methods based on sequence similarities of single genes. Detailed analysis is being performed for the re-classification of the strains examined.
-
Helical Propensity Affects the Conformational Properties of the Denatured State of Cytochrome c'.
Danielson, Travis A; Bowler, Bruce E
2018-01-23
Changing the helical propensity of a polypeptide sequence might be expected to affect the conformational properties of the denatured state of a protein. To test this hypothesis, alanines at positions 83 and 87 near the center of helix 3 of cytochrome c' from Rhodopseudomonas palustris were mutated to serine to decrease the stability of this helix. A set of 13 single histidine variants in the A83S/A87S background were prepared to permit assessment of the conformational properties of the denatured state using histidine-loop formation in 3 M guanidine hydrochloride. The data are compared with previous histidine-heme loop formation data for wild-type cytochrome c'. As expected, destabilization of helix 3 decreases the global stabilities of the histidine variants in the A83S/A87S background relative to the wild-type background. Loop stability versus loop size data yields a scaling exponent of 2.1 ± 0.2, similar to the value of 2.3 ± 0.2 obtained for wild-type cytochrome c'. However, the stabilities of all histidine-heme loops, which contain the helix 3 sequence segment, are increased in the A83S/A87S background compared to the wild-type background. Rate constants for histidine-heme loop breakage are similar for the wild-type and A83S/A87S variants. However, for histidine-heme loops that contain the helix 3 sequence segment, the rate constants for loop formation increase in the A83S/A87S background compared to the wild-type background. Thus, residual helical structure appears to stiffen the polypeptide chain slowing loop formation in the denatured state. The implications of these results for protein folding mechanisms are discussed. Copyright © 2017 Biophysical Society. Published by Elsevier Inc. All rights reserved.
-
International Nuclear Information System (INIS)
Untereiner, G.
2008-11-01
Uranium is both a radiological and a chemical toxic. Its concentration in the environment is low except when human activities have caused pollution. Uranium is a heavy reactive element, and thus it is easily complexed with soil component like minerals or organic molecules. These different complexes can be more or less bioavailable for microorganisms and plants, and then get in the human food chain. The knowledge and the understanding of transfer mechanisms and also the fate of toxic elements in the biosphere are a key issue to estimate health and ecological hazards. The knowledge of the speciation is very important for bioremediation processes. Here, we focused on the microorganisms effects onto uranium speciation in environment. Bacteria can accumulate and/or transform uranium depending on the initial form of the element. Thus, its bioavailability could be changed. The species used in this work are Cupriavidus metallidurans CH34, which is an environmental bacteria with a high resistance to heavy metal, Deinococcus radiodurans R1, which is known for his radiological resistance, and Rhodopseudomonas palustris, which is a purple photo-trophic bacteria capable of degrading aromatic compounds. Two forms of uranium were used with these bacteria, a mineral one, uranyl carbonate, and an organic one, uranyl citrate. In a first step, the growth media were modified in order to stabilize uranium complexes thanks to a simulation program. Then, the capacity of the bacteria to accumulate or transform uranium was studied. We saw a difference between minimal inhibition concentrations of these two speciation which is due to a difference between phosphate bioavailability. No accumulation was observed with environmental pH but uranium precipitation was observed with acidic pH (pH 1). Uranium speciation seemed to be well controlled in the growth media and the precipitates were uranyl phosphate. (author)
-
2010-07-01
If contamination, drought or natural disaster, such as a hurricane, impacted one water supply, an interconnection with neighboring municipalities...Scientific Name Sandhills Ecological Association Longleaf Pine Pinus palustris Red-cockaded Woodpecker Picoides borealis Turkey Oak Quercus laevis...canadensis Flatwoods Ecological Association Longleaf Pine Pinus palustris Wood Duck Aix sponsa Runner Oak Quercus pumila Red-winged Blackbird Agelaius
-
Intermediate coupling collision strengths from LS coupled R-matrix elements
International Nuclear Information System (INIS)
Clark, R.E.H.
1978-01-01
Fine structure collision strength for transitions between two groups of states in intermediate coupling and with inclusion of configuration mixing are obtained from LS coupled reactance matrix elements (R-matrix elements) and a set of mixing coefficients. The LS coupled R-matrix elements are transformed to pair coupling using Wigner 6-j coefficients. From these pair coupled R-matrix elements together with a set of mixing coefficients, R-matrix elements are obtained which include the intermediate coupling and configuration mixing effects. Finally, from the latter R-matrix elements, collision strengths for fine structure transitions are computed (with inclusion of both intermediate coupling and configuration mixing). (Auth.)
-
Biofilm Formation by a Metabolically Versatile Bacterium
National Research Council Canada - National Science Library
Harwood, Caroline S
2005-01-01
.... The goal of this project is to conduct basic studies that will facilitate the development of a process wherein Rhodopseudomonas cells grown on surfaces as biofilms, produce hydrogen with energy...
-
Directory of Open Access Journals (Sweden)
Betancourt Gandul, Martha
1999-12-01
Full Text Available A study of the Haloragaceae in Cuba is presented. The presence of Proserpinaca palustris, P. pectinata. Myriophyllum laxum and M. pinnatum is confirmed, and the possible extinction of M. sparsiflorum is suggestedEstudio de la familia Haloragaceae en Cuba. Se confirma la existencia de Proserpinaca palustris, P. pectinata. Myriophyllum laxum y M, pinnatum, y se plantea la posible extinción de M. sparsiflorum.
-
Using the Model Coupling Toolkit to couple earth system models
Warner, J.C.; Perlin, N.; Skyllingstad, E.D.
2008-01-01
Continued advances in computational resources are providing the opportunity to operate more sophisticated numerical models. Additionally, there is an increasing demand for multidisciplinary studies that include interactions between different physical processes. Therefore there is a strong desire to develop coupled modeling systems that utilize existing models and allow efficient data exchange and model control. The basic system would entail model "1" running on "M" processors and model "2" running on "N" processors, with efficient exchange of model fields at predetermined synchronization intervals. Here we demonstrate two coupled systems: the coupling of the ocean circulation model Regional Ocean Modeling System (ROMS) to the surface wave model Simulating WAves Nearshore (SWAN), and the coupling of ROMS to the atmospheric model Coupled Ocean Atmosphere Prediction System (COAMPS). Both coupled systems use the Model Coupling Toolkit (MCT) as a mechanism for operation control and inter-model distributed memory transfer of model variables. In this paper we describe requirements and other options for model coupling, explain the MCT library, ROMS, SWAN and COAMPS models, methods for grid decomposition and sparse matrix interpolation, and provide an example from each coupled system. Methods presented in this paper are clearly applicable for coupling of other types of models. ?? 2008 Elsevier Ltd. All rights reserved.
-
Coupled assimilation for an intermediated coupled ENSO prediction model
Zheng, Fei; Zhu, Jiang
2010-10-01
The value of coupled assimilation is discussed using an intermediate coupled model in which the wind stress is the only atmospheric state which is slavery to model sea surface temperature (SST). In the coupled assimilation analysis, based on the coupled wind-ocean state covariance calculated from the coupled state ensemble, the ocean state is adjusted by assimilating wind data using the ensemble Kalman filter. As revealed by a series of assimilation experiments using simulated observations, the coupled assimilation of wind observations yields better results than the assimilation of SST observations. Specifically, the coupled assimilation of wind observations can help to improve the accuracy of the surface and subsurface currents because the correlation between the wind and ocean currents is stronger than that between SST and ocean currents in the equatorial Pacific. Thus, the coupled assimilation of wind data can decrease the initial condition errors in the surface/subsurface currents that can significantly contribute to SST forecast errors. The value of the coupled assimilation of wind observations is further demonstrated by comparing the prediction skills of three 12-year (1997-2008) hindcast experiments initialized by the ocean-only assimilation scheme that assimilates SST observations, the coupled assimilation scheme that assimilates wind observations, and a nudging scheme that nudges the observed wind stress data, respectively. The prediction skills of two assimilation schemes are significantly better than those of the nudging scheme. The prediction skills of assimilating wind observations are better than assimilating SST observations. Assimilating wind observations for the 2007/2008 La Niña event triggers better predictions, while assimilating SST observations fails to provide an early warning for that event.
-
Gay and lesbian couples in Italy: comparisons with heterosexual couples.
Antonelli, Paolo; Dèttore, Davide; Lasagni, Irene; Snyder, Douglas K; Balderrama-Durbin, Christina
2014-12-01
Assessing couple relationships across diverse languages and cultures has important implications for both clinical intervention and prevention. This is especially true for nontraditional relationships potentially subject to various expressions of negative societal evaluation or bias. Few empirically validated measures of relationship functioning have been developed for cross-cultural applications, and none have been examined for their psychometric sufficiency for evaluating same-sex couples across different languages and cultures. The current study examined the psychometric properties of an Italian translation of the Marital Satisfaction Inventory - Revised (MSI-R), a 150-item 13-scale measure of couple relationship functioning, for its use in assessing the intimate relationships of gay and lesbian couples in Italy. Results for these couples were compared to data from heterosexual married and unmarried cohabiting couples from the same geographical region, as well as to previously published data for gay, lesbian, and unmarried heterosexual couples from the United States. Findings suggest that, despite unique societal pressures confronting Italian same-sex couples, these relationships appear resilient and fare well both overall and in specific domains of functioning compared to heterosexual couples both in Italy and the United States. © 2014 Family Process Institute.
-
Fort Bragg Old Post Historic District Landscape Report
2011-01-01
proved to be of substantial economic value (Lefler and Powell 1973). Lon- gleaf pines ( Pinus palustris) produce higher quality pine resin/crude gum than...plants that have the same characteristics as the historic varieties; na- tive plants require relatively little upkeep, are drought tolerant, and can... Pinus palustris Longleaf Pine 1933/IDG 2009 Native Quercus alba White Oak Large Evergreen Trees 1933/IDG 2009 Native Magnolia grandiflora Southern
-
Pfleger, Brian; Mendez-Perez, Daniel
2013-11-05
Disclosed are systems and methods for coupling translation of a target gene to a detectable response gene. A version of the invention includes a translation-coupling cassette. The translation-coupling cassette includes a target gene, a response gene, a response-gene translation control element, and a secondary structure-forming sequence that reversibly forms a secondary structure masking the response-gene translation control element. Masking of the response-gene translation control element inhibits translation of the response gene. Full translation of the target gene results in unfolding of the secondary structure and consequent translation of the response gene. Translation of the target gene is determined by detecting presence of the response-gene protein product. The invention further includes RNA transcripts of the translation-coupling cassettes, vectors comprising the translation-coupling cassettes, hosts comprising the translation-coupling cassettes, methods of using the translation-coupling cassettes, and gene products produced with the translation-coupling cassettes.
-
Wright, J K; Williams, M; Starr, G; McGee, J; Mitchell, R J
2013-02-01
Environmental controls on carbon dynamics operate at a range of interacting scales from the leaf to landscape. The key questions of this study addressed the influence of water and nitrogen (N) availability on Pinus palustris (Mill.) physiology and primary productivity across leaf and canopy scales, linking the soil-plant-atmosphere (SPA) model to leaf and stand-scale flux and leaf trait/canopy data. We present previously unreported ecophysiological parameters (e.g. V(cmax) and J(max)) for P. palustris and the first modelled estimates of its annual gross primary productivity (GPP) across xeric and mesic sites and under extreme drought. Annual mesic site P. palustris GPP was ∼23% greater than at the xeric site. However, at the leaf level, xeric trees had higher net photosynthetic rates, and water and light use efficiency. At the canopy scale, GPP was limited by light interception (canopy level), but co-limited by nitrogen and water at the leaf level. Contrary to expectations, the impacts of an intense growing season drought were greater at the mesic site. Modelling indicated a 10% greater decrease in mesic GPP compared with the xeric site. Xeric P. palustris trees exhibited drought-tolerant behaviour that contrasted with mesic trees' drought-avoidance behaviour. © 2012 Blackwell Publishing Ltd.
-
Yuan, Naichang; He, Jianguo; Yao, Demiao; Dai, Qin; Lin, Weigan
1995-06-01
Two types of coplanar transmission lines, rectangular microshield coplanar coupled lines (RMCCL) and coplanar coupled rectangular microshield lines (CCRML), are proposed for MMIC applications. These are developed from coplanar coupled lines (CCL) and coplanar coupled strip lines (CCS). Analytic formulas are presented for calculating the quasistatic TEM parameters of these coupled lines by means of exact conformal mapping techniques. Numerical results are also presented to illustrate the properties of these coplanar transmission lines.
-
Couple Support Schemata in Couples with and without Spinal Cord Injury
Gilad, Dvorit; Lavee, Yoav
2010-01-01
This article describes the cognitive schemata of couples' support relationships among 65 couples in which the husband had a long-term spinal cord injury and 65 couples without disability. The structure of the support relations schemata were examined by means of smallest-space analysis. Similarities between men and women in couples with and without…
-
Munoz, R.; Caylor, E.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.
2014-12-01
Wild rice (Zizania palustris L.) is an aquatic grass with spiritual and subsistence significance to Native people of the Great Lakes region of North America. Mud Lake (Mashkiigwaagamaag), located on the Fond du Lac Band of Lake Superior Chippewa Reservation in Carlton County, Minnesota, USA, once supported an extensive population of wild rice (manoomin). However, early 20th century attempts to ditch and drain surrounding wetlands for landuse intensification severely altered the natural hydrological system that supports wild rice. Fond du Lac Resource Management (FDLRM) technicians are currently working to increase the wild rice population in Mud Lake. As part of these efforts, this phytolith study was undertaken to better understand how wild rice abundance has fluctuated over the past 400 years, with particular emphasis on the 19th and 20th centuries. Phytoliths are microscopic opal silica plant remains that are incorporated into soils and lake sediments after the plant-parts that contain them decay. Wild rice produces phytolith morphotypes that are unequivocally diagnostic. Mud Lake core MNMN-MUD11-1C-1P-1 (46°43'38.39"N, 92°42'2.45"W) was piston cored by LacCore (National Lacustrine Core Facility) and FDLRM technicians on 24 May 2011. Initial core descriptions, multi-sensor core logging, phytolith sampling and phytolith extractions were completed during the summer of 2014 at LacCore. Wild rice phytolith identification and quantification was conducted on twelve samples using brightfield microscopy at 400x magnification. Wild rice phytolith concentration values ranged from 68 to 2,300 phytoliths/cm3. Wild rice accumulation rates ranged from 9 to 383 phytoliths/ cm2/yr, peaking in 1952 AD. Wild rice abundance in Mud Lake appears to be influenced by a complex set of variables that include anthropogenic disturbance, climatic events and aquatic plant community succession.
-
Coupling detrended fluctuation analysis for analyzing coupled nonstationary signals
Hedayatifar, L.; Vahabi, M.; Jafari, G. R.
2011-08-01
When many variables are coupled to each other, a single case study could not give us thorough and precise information. When these time series are stationary, different methods of random matrix analysis and complex networks can be used. But, in nonstationary cases, the multifractal-detrended-cross-correlation-analysis (MF-DXA) method was introduced for just two coupled time series. In this article, we have extended the MF-DXA to the method of coupling detrended fluctuation analysis (CDFA) for the case when more than two series are correlated to each other. Here, we have calculated the multifractal properties of the coupled time series, and by comparing CDFA results of the original series with those of the shuffled and surrogate series, we can estimate the source of multifractality and the extent to which our series are coupled to each other. We illustrate the method by selected examples from air pollution and foreign exchange rates.
-
International Nuclear Information System (INIS)
Pittner, Jiri; Lischka, Hans; Barbatti, Mario
2009-01-01
The usage of time-derivative non-adiabatic coupling terms and partially coupled time-dependent equations are investigated to accelerate non-adiabatic dynamics simulations at multireference configuration interaction (MRCI) level. The quality of the results and computational costs are compared against non-adiabatic benchmark dynamics calculations using non-adiabatic coupling vectors. In the comparison between the time-derivative couplings and coupling vectors, deviations in the adiabatic population of individual trajectories were observed in regions of rapid variation of the coupling terms. They, however, affected the average adiabatic population to only about 5%. For small multiconfiguration spaces, dynamics with time-derivative couplings are significantly faster than those with coupling vectors. This relation inverts for larger configuration spaces. The use of the partially coupled equations approach speeds up the simulations significantly while keeping the deviations in the population below few percent. Imidazole and the methaniminium cation are used as test examples
-
Coupled-resonator optical waveguides
DEFF Research Database (Denmark)
Raza, Søren; Grgic, Jure; Pedersen, Jesper Goor
2010-01-01
Coupled-resonator optical waveguides hold potential for slow-light propagation of optical pulses. The dispersion properties may adequately be analyzed within the framework of coupled-mode theory. We extend the standard coupled-mode theory for such structures to also include complex-valued paramet......Coupled-resonator optical waveguides hold potential for slow-light propagation of optical pulses. The dispersion properties may adequately be analyzed within the framework of coupled-mode theory. We extend the standard coupled-mode theory for such structures to also include complex...
-
Fluorescence spectroscopy of conformational changes of single LH2 complexes
Rutkauskas, D.; Novoderezhkin, V.; Cogdell, R.J.; van Grondelle, R.
2005-01-01
We have investigated the energy landscape of the bacterial photosynthetic peripheral light-harvesting complex LH2 of purple bacterium Rhodopseudomonas acidophila by monitoring sequences of fluorescence spectra of single LH2 assemblies, at room temperature, with different excitation intensities as
-
Ouraou, Ahmimed; The ATLAS collaboration
2016-01-01
Latest results on the measurement of gauge boson couplings, from ATLAS and CMS at the LHC, are presented. This review starts with an introduction to boson couplings, then the measurements of Triple and Quartic Couplings are described. And finally, limits on anomalous couplings are summarized.
-
DEFF Research Database (Denmark)
Dahl, Michael S.; Van Praag, Mirjam; Thompson, Peter
with a selected set of comparable firms and couples. We find evidence that couples often establish a business together because one spouse – most commonly the female – has limited outside opportunities in the labor market. However, the financial benefits for each of the spouses, and especially the female......We study possible motivations for co-entrepenurial couples to start up a joint firm, using a sample of 1,069 Danish couples that established a joint enterprise between 2001 and 2010. We compare their pre-entry characteristics, firm performance and postdissolution private and financial outcomes......, are larger in co-entrepreneurial firms, both during the life of the business and post-dissolution. The start-up of co-entrepreneurial firms seems therefore a sound investment in the human capital of both spouses as well as in the reduction of income inequality in the household. We find no evidence of non...
-
DEFF Research Database (Denmark)
Dahl, Michael S.; Van Praag, Mirjam; Thompson, Peter
with a selected set of comparable firms and couples. We find evidence that couples often establish a business together because one spouse - most commonly the female - has limited outside opportunities in the labor market. However, the financial benefits for each of the spouses, and especially the female......We study possible motivations for co-entrepenurial couples to start up a joint firm, us-ing a sample of 1,069 Danish couples that established a joint enterprise between 2001 and 2010. We compare their pre-entry characteristics, firm performance and post-dissolution private and financial outcomes......, are larger in co-entrepreneurial firms, both during the life of the business and post-dissolution. The start-up of co-entrepreneurial firms seems therefore a sound in-vestment in the human capital of both spouses as well as in the reduction of income inequality in the household. We find no evidence of non...
-
DEFF Research Database (Denmark)
Dahl, Michael S.; Van Praag, Mirjam; Thompson, Peter
2015-01-01
We study possible motivations for co-entreprenurial couples to start up a joint firm, using a sample of 1,069 Danish couples that established a joint enterprise between 2001 and 2010. We compare their pre-entry characteristics, firm performance and post-dissolution private and financial outcomes...
-
Outcomes of couples with infidelity in a community-based sample of couple therapy.
Atkins, David C; Marín, Rebeca A; Lo, Tracy T Y; Klann, Notker; Hahlweg, Kurt
2010-04-01
Infidelity is an often cited problem for couples seeking therapy, but the research literature to date is very limited on couple therapy outcomes when infidelity is a problem. The current study is a secondary analysis of a community-based sample of couple therapy in Germany and Austria. Outcomes for 145 couples who reported infidelity as a problem in their relationship were compared with 385 couples who sought therapy for other reasons. Analyses based on hierarchical linear modeling revealed that infidelity couples were significantly more distressed and reported more depressive symptoms at the start of therapy but continued improving through the end of therapy and to 6 months posttherapy. At the follow-up assessment, infidelity couples were not statistically distinguishable from non-infidelity couples, replicating previous research. Sexual dissatisfaction did not depend on infidelity status. Although there was substantial missing data, sensitivity analyses suggested that the primary findings were not due to missing data. The current findings based on a large community sample replicated previous work from an efficacy trial and show generally optimistic results for couples in which there has been an affair. 2010 APA, all rights reserved
-
Inflationary magneto-(non)genesis, increasing kinetic couplings, and the strong coupling problem
Bazrafshan Moghaddam, Hossein; McDonough, Evan; Namba, Ryo; Brandenberger, Robert H.
2018-05-01
We study the generation of magnetic fields during inflation making use of a coupling of the inflaton and moduli fields to electromagnetism via the photon kinetic term, and assuming that the coupling is an increasing function of time. We demonstrate that the strong coupling problem of inflationary magnetogenesis can be avoided by incorporating the destabilization of moduli fields after inflation. The magnetic field always dominates over the electric one, and thus the severe constraints on the latter from backreaction, which are the demanding obstacles in the case of a decreasing coupling function, do not apply to the current scenario. However, we show that this loophole to the strong coupling problem comes at a price: the normalization of the amplitude of magnetic fields is determined by this coupling term and is therefore suppressed by a large factor after the moduli destabilization completes. From this we conclude that there is no self-consistent and generic realization of primordial magnetogenesis producing scale-invariant fields in the case of an increasing kinetic coupling.
-
Electromagnetic clutches and couplings
Vorob'Yeva, T M; Fry, D W; Higinbotham, W
2013-01-01
Electromagnetic Clutches and Couplings contains a detailed description of U.S.S.R. electromagnetic friction clutches, magnetic couplings, and magnetic particle couplings. This book is divided into four chapters. The first chapter discusses the design and construction of magnetic (solenoid-operated) couplings, which are very quick-acting devices and used in low power high-speed servo-systems. Chapter 2 describes the possible fields of application, design, construction, and utilization of magnetic particle couplings. The aspects of construction, design, and utilization of induction clutches (sli
-
Directory of Open Access Journals (Sweden)
D. M. Taher
2009-01-01
Full Text Available Composting offers a convenient and environmentally acceptable safe, effective method for the disposal of carcasses as an alternative method to burning, burial and rendering. This study was conducted to evaluate the effects of a natural biological products containing an effective microorganisms namily; Lactic acid bacill (Lactobacillus plantarum; L. casei Streptococcus Lactis., Photosynthetic bacteria (Rhodopseudomonas palustris; Rhodobacter sphaeroides,Yeast (Saccharomyces cerevisiae; Candida utilis Toula, Pichia Jadinii, Actinomycetes (Streptomyces albus; S. griseus., and Fermenting fungi (Aspergillus oryzae; Mucor hiemalis in the composting activity of poultry carcasses. The composting stacks constitute multi alternative layers of wood shaves, hay, poultry carcasses and then wood shaves and so on. The layers have been bypassed with plastic tubes for oxygen supply. Moreover, a petri dishes of salmonella and E. coli colonies were introduced within poultry carcasses layer. After 8 days of the experimental period this study follows the physical properties of the composting process according to its odor intesity, color and pH level as well as the bacterial reisolation from the stored colonies. Results indicate that the biological products increase the temperature of the composting stack (66-68° C with a minimal odors as the pH meters recording 5.4 as compared to the control composting stack (52-64° C and pH 6.8 with offender odors. On the other hand ,the biological product inhibit the bacterial reisolation offers since the 10the day of the experiment, however, in the normal composting stack that periods will prolonged till the 17 days of the experiment. Interestingly, the biological product induce high and rapid digestable rate for the poultry carcasses which shown within 25 days of the experiment, in comparison to the normal composting stack which induce that effects in 60 days. In conclusion, the addition of effective microorganism to the
-
A Tightly Coupled Non-Equilibrium Magneto-Hydrodynamic Model for Inductively Coupled RF Plasmas
2016-02-29
development a tightly coupled magneto-hydrodynamic model for Inductively Coupled Radio- Frequency (RF) Plasmas. Non Local Thermodynamic Equilibrium (NLTE...for Inductively Coupled Radio-Frequency (RF) Plasmas. Non Local Thermodynamic Equilibrium (NLTE) effects are described based on a hybrid State-to-State...Inductively Coupled Plasma (ICP) torches have wide range of possible applications which include deposition of metal coatings, synthesis of ultra-fine powders
-
Coupling Strength and System Size Induce Firing Activity of Globally Coupled Neural Network
International Nuclear Information System (INIS)
Wei Duqu; Luo Xiaoshu; Zou Yanli
2008-01-01
We investigate how firing activity of globally coupled neural network depends on the coupling strength C and system size N. Network elements are described by space-clamped FitzHugh-Nagumo (SCFHN) neurons with the values of parameters at which no firing activity occurs. It is found that for a given appropriate coupling strength, there is an intermediate range of system size where the firing activity of globally coupled SCFHN neural network is induced and enhanced. On the other hand, for a given intermediate system size level, there exists an optimal value of coupling strength such that the intensity of firing activity reaches its maximum. These phenomena imply that the coupling strength and system size play a vital role in firing activity of neural network
-
Directory of Open Access Journals (Sweden)
Svetlana Shabalkina
2014-04-01
Full Text Available Latent, pregenerative and generative periods in the ontogeny of Rorippa amphibia (L. Bess., R. palustris (L. Bess. and R. ×anceps (Wahlenb. Reichenb. were described. Skipping of a postgenerative stage, and some of ontogenetic states demonstrates the dynamic multiplicity of individual development; while the combination of seed and vegetative reproductions – multiplicity of the ways of reproduction and generation. The ontogeny of R. palustris individuals corresponds to A-type, R. amphibia and R. ×anceps – to G-type, and R. ×anceps – to D-type.
-
Atkins, David C.; Dimidjian, Sona; Bedics, Jamie D.; Christensen, Andrew
2009-01-01
The association between depression and relationship distress as well as the impact of treatment for the one on the other was examined across 2 treatment-seeking samples: individuals seeking treatment for depression (N = 120) and couples seeking marital therapy (N = 134 couples). Although there was a baseline association between depression and…
-
Direct interaction between linear electron transfer chains and solute transport systems in bacteria
Elferink, Marieke G.L.; Hellingwerf, Klaas J.; Belkum, Marco J. van; Poolman, Bert; Konings, Wil N.
1984-01-01
In studies on alanine and lactose transport in Rhodopseudomonas sphaeroides we have demonstrated that the rate of solute uptake in this phototrophic bacterium is regulated by the rate of light-induced cyclic electron transfer. In the present paper the interaction between linear electron transfer
-
Improved fluid-structure coupling
International Nuclear Information System (INIS)
McMaster, W.H.; Gong, E.Y.; Landram, C.S.
1981-01-01
In the computer code PELE-IC, an incompressible Eulerian hydrodynamic algorithm was coupled to a Lagrangian finite element shell algorithm for the analysis of pressure suppression in boiling water reactors. This effort also required the development of a free surface algorithm capable of handling expanding gas bubbles. These algorithms have been improved to strengthen the coupling and to add the capability for following the more complex free surfaces resulting from steam condensation. These improvements have also permitted more economical 2D calculations and have made it feasible to develop a 3D version. A compressible option using the acoustic approximation has also been added, furthering the usefulness of the code. The coupling improvements were made in three areas which are identified as (1) preferential coupling, (2) merged cell coupling, and (3) free surface-structure coupling, and are described. These algorithms have been additionally implemented in a three dimensional version of the code called PELE3D. This version has a free surface capability to follow expanding and contracting bubbles and is coupled to a curved rigid surface
-
Coupled intertwiner dynamics: A toy model for coupling matter to spin foam models
Steinhaus, Sebastian
2015-09-01
The universal coupling of matter and gravity is one of the most important features of general relativity. In quantum gravity, in particular spin foams, matter couplings have been defined in the past, yet the mutual dynamics, in particular if matter and gravity are strongly coupled, are hardly explored, which is related to the definition of both matter and gravitational degrees of freedom on the discretization. However, extracting these mutual dynamics is crucial in testing the viability of the spin foam approach and also establishing connections to other discrete approaches such as lattice gauge theories. Therefore, we introduce a simple two-dimensional toy model for Yang-Mills coupled to spin foams, namely an Ising model coupled to so-called intertwiner models defined for SU (2 )k. The two systems are coupled by choosing the Ising coupling constant to depend on spin labels of the background, as these are interpreted as the edge lengths of the discretization. We coarse grain this toy model via tensor network renormalization and uncover an interesting dynamics: the Ising phase transition temperature turns out to be sensitive to the background configurations and conversely, the Ising model can induce phase transitions in the background. Moreover, we observe a strong coupling of both systems if close to both phase transitions.
-
Stošić, Dušan; Auroux, Aline
Basic principles of calorimetry coupled with other techniques are introduced. These methods are used in heterogeneous catalysis for characterization of acidic, basic and red-ox properties of solid catalysts. Estimation of these features is achieved by monitoring the interaction of various probe molecules with the surface of such materials. Overview of gas phase, as well as liquid phase techniques is given. Special attention is devoted to coupled calorimetry-volumetry method. Furthermore, the influence of different experimental parameters on the results of these techniques is discussed, since it is known that they can significantly influence the evaluation of catalytic properties of investigated materials.
-
Role of charge-transfer states in bacterial photosynthesis
Meech, S.R.; Hoff, A.J.
1986-01-01
Photon echo, photon-echo excitation, and "hole-burning" data recorded in the 800-990 nm region of Rhodobacter sphaeroides R26 and Rhodopseudomonas viridis reaction centers are reported. The primary process in these reaction centers, following excitation, was found to occur in ≈25 fsec; the
-
Stability regions for synchronized τ-periodic orbits of coupled maps with coupling delay τ
Energy Technology Data Exchange (ETDEWEB)
Karabacak, Özkan, E-mail: ozkan2917@gmail.com [Department of Electronics and Communication Engineering, Istanbul Technical University, 34469 Istanbul (Turkey); Department of Electronic Systems, Aalborg University, 9220 Aalborg East (Denmark); Alikoç, Baran, E-mail: alikoc@itu.edu.tr [Department of Control and Automation Engineering, Istanbul Technical University, 34469 Istanbul (Turkey); Atay, Fatihcan M., E-mail: atay@member.ams.org [Department of Mathematics, Bilkent University, 06800 Ankara (Turkey)
2016-09-15
Motivated by the chaos suppression methods based on stabilizing an unstable periodic orbit, we study the stability of synchronized periodic orbits of coupled map systems when the period of the orbit is the same as the delay in the information transmission between coupled units. We show that the stability region of a synchronized periodic orbit is determined by the Floquet multiplier of the periodic orbit for the uncoupled map, the coupling constant, the smallest and the largest Laplacian eigenvalue of the adjacency matrix. We prove that the stabilization of an unstable τ-periodic orbit via coupling with delay τ is possible only when the Floquet multiplier of the orbit is negative and the connection structure is not bipartite. For a given coupling structure, it is possible to find the values of the coupling strength that stabilizes unstable periodic orbits. The most suitable connection topology for stabilization is found to be the all-to-all coupling. On the other hand, a negative coupling constant may lead to destabilization of τ-periodic orbits that are stable for the uncoupled map. We provide examples of coupled logistic maps demonstrating the stabilization and destabilization of synchronized τ-periodic orbits as well as chaos suppression via stabilization of a synchronized τ-periodic orbit.
-
Controllable nonlinearity in a dual-coupling optomechanical system under a weak-coupling regime
Zhu, Gui-Lei; Lü, Xin-You; Wan, Liang-Liang; Yin, Tai-Shuang; Bin, Qian; Wu, Ying
2018-03-01
Strong quantum nonlinearity gives rise to many interesting quantum effects and has wide applications in quantum physics. Here we investigate the quantum nonlinear effect of an optomechanical system (OMS) consisting of both linear and quadratic coupling. Interestingly, a controllable optomechanical nonlinearity is obtained by applying a driving laser into the cavity. This controllable optomechanical nonlinearity can be enhanced into a strong coupling regime, even if the system is initially in the weak-coupling regime. Moreover, the system dissipation can be suppressed effectively, which allows the appearance of phonon sideband and photon blockade effects in the weak-coupling regime. This work may inspire the exploration of a dual-coupling optomechanical system as well as its applications in modern quantum science.
-
International Nuclear Information System (INIS)
Glover, J.B.
1980-07-01
A method is described of making a pipe coupling of the type comprising a plastics socket and a resilient annular sealing member secured in the mouth thereof, in which the material of at least one component of the coupling is subjected to irradiation with high energy radiation whereby the material is caused to undergo cross-linking. As examples, the coupling may comprise a polyethylene or plasticised PVC socket the material of which is subjected to irradiation, and the sealing member may be moulded from a thermoplastic elastomer which is subjected to irradiation. (U.K.)
-
International Nuclear Information System (INIS)
Liu Ping; Jia Man; Lou Senyue
2007-01-01
A modified Korteweg-de Vries (mKdV) lattice is also found to be a discrete Korteweg-de Vries (KdV) equation in this paper. The Lax pair for the discrete equation is found with the help of the Lax pair for a similar discrete equation. A Lax-integrable coupled extension of the lattice is posed, which is a common discrete version of both the coupled KdV and coupled mKdV systems. Some rational expansions of the Jacobian elliptic, trigonometric and hyperbolic functions are used to construct cnoidal waves, negaton and positon solutions of the discrete coupled system
-
Effect of Couple Therapy Based on the Choice Theory on Social Commitment of Couples
Directory of Open Access Journals (Sweden)
Hossein Abbasi
2017-09-01
Full Text Available Background and Objective: Commitment to spouse, marriage, and family is one of the most important factors ensuring the continuity of marriage and strength of family bonds that has attracted considerable attention in the contemporary family and marriage studies. In this study, we sought to determine the effect of couple therapy based on the choice theory on the social commitment of couples. Materials and Methods: This was a quasi-experimental study with pretest-posttest design and a control group that was performed among volunteer couples visiting Isfahan Counseling and Psychology Centers in Isfahan, Iran, during 2015. The subjects consisted of 32 incompatible couples who were selected through convenience sampling and were randomly assigned into experimental (16 couples and control (16 couples groups. Then, the experimental group received nine sessions of group couple therapy during three months on family life skills based on choice theory. It is worth mentioning that the dependent variable was the social commitment of couples evaluated by the dimensions of commitment inventory of Adams and Jones (1997. The collected data were analyzed by multivariate analysis of covariance in SPSS, version 20. Results: At the post-test stage, couple therapy based on choice theory significantly enhanced social commitment in the experimental group compared to the control group (P<0.001. Conclusion: According to the findings of this study, couple therapy based on the choice theory is an effective strategy in promoting commitment and loyalty to spouse, marriage, and family and can decrease and prevent family-related problems and threats such as divorce and marital infidelity.
-
Running couplings and operator mixing in the gravitational corrections to coupling constants
International Nuclear Information System (INIS)
Anber, Mohamed M.; Donoghue, John F.; El-Houssieny, Mohamed
2011-01-01
The use of a running coupling constant in renormalizable theories is well known, but the implementation of this idea for effective field theories with a dimensional coupling constant is, in general, less useful. Nevertheless, there are multiple attempts to define running couplings, including the effects of gravity, with varying conclusions. We sort through many of the issues involved, most particularly the idea of operator mixing and also the kinematics of crossing, using calculations in Yukawa and λφ 4 theories as illustrative examples. We remain in the perturbative regime. In some theories with a high permutation symmetry, such as λφ 4 , a reasonable running coupling can be defined. However, in most cases, such as Yukawa and gauge theories, a running coupling fails to correctly account for the energy dependence of the interaction strength. As a by-product we also contrast on-shell and off-shell renormalization schemes and show that operators which are normally discarded, such as those that vanish by the equations of motion, are required for off-shell renormalization of effective field theories. Our results suggest that the inclusion of gravity in the running of couplings is not useful or universal in the description of physical processes.
-
Multilocus phylogeography and systematic revision of North American water shrews (genus: Sorex)
Hope, Andrew G.; Panter, Nicholas; Cook, Joseph A.; Talbot, Sandra L.; Nagorsen, David W.
2014-01-01
North American water shrews, which have traditionally included Sorex alaskanus, S. bendirii, and S. palustris, are widely distributed through Nearctic boreal forests and adapted for life in semiaquatic environments. Molecular mitochondrial signatures for these species have recorded an evolutionary history with variable levels of regional divergence, suggesting a strong role of Quaternary environmental change in speciation processes. We expanded molecular analyses, including more-comprehensive rangewide sampling of specimens representing North American water shrew taxa, except S. alaskanus, and sequencing of 4 independent loci from the nuclear and mitochondrial genomes. We investigated relative divergence of insular populations along the North Pacific Coast, and newly recognized diversity from southwestern montane locations, potentially representing refugial isolates. Congruent independent genealogies, lack of definitive evidence for contemporary gene flow, and high support from coalescent species trees indicated differentiation of 4 major geographic lineages over multiple glacial cycles of the late Quaternary, similar to a growing number of boreal taxa. Limited divergence of insular populations suggested colonization following the last glacial. Characterization of southwestern montane diversity will require further sampling but divergence over multiple loci is indicative of a relictual sky-island fauna. We have reviewed and revised North American water shrew taxonomy including the recognition of 3 species within what was previously known as S. palustris. The possibility of gene flow between most distantly related North American water shrew lineages coupled with unresolved early diversification of this group and other sibling species reflects a complex but potentially productive system for investigating speciation processes.
-
Role of contact couples and couple stress in the behaviour of granular media
International Nuclear Information System (INIS)
Dedecker, F.; Dubujet, P.; Cambou, B.
1998-01-01
This paper analyses the interest of taking into account contact couples in the granular material description as well as considering the inadequacy of the micropolar description. The study is made on two types of samples: one which takes into account contact couples, and the other which does not. The response of these two media, which are submitted to a biaxial test, is analysed from both the micromechanic and macroscopic viewpoints. A numerical study which is performed on these two samples shows the influence of the presence of couples on the local static variables as well as on the macroscopic behaviour. A statistical homogenization approach is analysed to simulate the effects of couples. Due to the presence of an internal variable, a numerical study proves that this approach is relevant. This internal variable allows the taking into consideration of the influence of contact couples. A first step in the description of couples versus contact orientation is made by the introduction of the standard deviation. Finally, the inadequacy of the micropolar description which takes into account micropolar stresses is pointed out. (orig.)
-
Yang, Dongzheng; Hu, Xixi; Zhang, Dong H.; Xie, Daiqian
2018-02-01
Solving the time-independent close coupling equations of a diatom-diatom inelastic collision system by using the rigorous close-coupling approach is numerically difficult because of its expensive matrix manipulation. The coupled-states approximation decouples the centrifugal matrix by neglecting the important Coriolis couplings completely. In this work, a new approximation method based on the coupled-states approximation is presented and applied to time-independent quantum dynamic calculations. This approach only considers the most important Coriolis coupling with the nearest neighbors and ignores weaker Coriolis couplings with farther K channels. As a result, it reduces the computational costs without a significant loss of accuracy. Numerical tests for para-H2+ortho-H2 and para-H2+HD inelastic collision were carried out and the results showed that the improved method dramatically reduces the errors due to the neglect of the Coriolis couplings in the coupled-states approximation. This strategy should be useful in quantum dynamics of other systems.
-
Vibronic coupling density and related concepts
International Nuclear Information System (INIS)
Sato, Tohru; Uejima, Motoyuki; Iwahara, Naoya; Haruta, Naoki; Shizu, Katsuyuki; Tanaka, Kazuyoshi
2013-01-01
Vibronic coupling density is derived from a general point of view as a one-electron property density. Related concepts as well as their applications are presented. Linear and nonlinear vibronic coupling density and related concepts, orbital vibronic coupling density, reduced vibronic coupling density, atomic vibronic coupling constant, and effective vibronic coupling density, illustrate the origin of vibronic couplings and enable us to design novel functional molecules or to elucidate chemical reactions. Transition dipole moment density is defined as an example of the one-electron property density. Vibronic coupling density and transition dipole moment density open a way to design light-emitting molecules with high efficiency.
-
Treating infidelity in same-sex couples.
Martell, Christopher R; Prince, Stacey E
2005-11-01
Psychotherapy with same-sex couples does not differ markedly from standard couple therapies; this is also true for treating couples facing infidelity. However, same-sex couples often design their relationships differently, without tradition and formal marital contracts to prescribe behavior. Based on clinical experience and the empirical research, this article addresses the differing norms involved in affirmatively treating infidelity in gay and lesbian couples within the framework of integrative behavioral couple therapy (IBCT). Two cases illustrate the process and outcome of IBCT with same-sex couples.
-
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... palustris CGA009] ... Length = 77 ... Query: 195 NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDS...MMKTARPPP 254 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTA...RPPP Sbjct: 1 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTARPPP 60 ...
-
Conversation, coupling and complexity
DEFF Research Database (Denmark)
Fusaroli, Riccardo; Abney, Drew; Bahrami, Bahador
We investigate the linguistic co-construction of interpersonal synergies. By applying a measure of coupling between complex systems to an experimentally elicited corpus of joint decision dialogues, we show that interlocutors’ linguistic behavior displays increasing signature of multi-scale coupling......, known as complexity matching, over the course of interaction. Furthermore, we show that stronger coupling corresponds with more effective interaction, as measured by collective task performance....
-
Plazy, M.; Orne-Gliemann, J.; Balestre, E.; Miric, M.; Darak, S.; Butsashvili, M.; Tchendjou, P.; Dabis, F.; du Lou, A. Desgrees
Background. - The Prenahtest study investigated the efficacy of a couple-oriented HIV counselling session (COC) in encouraging couple HIV counselling and testing, and improving intra-couple communication about sexual and reproductive health. We report here on the effect of COC on intra-couple
-
Achieving Synchronization in Arrays of Coupled Differential Systems with Time-Varying Couplings
Directory of Open Access Journals (Sweden)
Xinlei Yi
2013-01-01
Full Text Available We study complete synchronization of the complex dynamical networks described by linearly coupled ordinary differential equation systems (LCODEs. Here, the coupling is timevarying in both network structure and reaction dynamics. Inspired by our previous paper (Lu et al. (2007-2008, the extended Hajnal diameter is introduced and used to measure the synchronization in a general differential system. Then we find that the Hajnal diameter of the linear system induced by the time-varying coupling matrix and the largest Lyapunov exponent of the synchronized system play the key roles in synchronization analysis of LCODEs with identity inner coupling matrix. As an application, we obtain a general sufficient condition guaranteeing directed time-varying graph to reach consensus. Example with numerical simulation is provided to show the effectiveness of the theoretical results.
-
Center vortices at strong couplings and all couplings
International Nuclear Information System (INIS)
Greensite, J.
2001-01-01
Motivations for the center vortex theory of confinement are discussed. In particular, it is noted that the abelian dual Meissner effect, which is the signature of dual superconductivity, cannot adequately describe the confining force at large distance scales. A long-range effective action is derived from strong-coupling lattice gauge theory in D=3 dimensions, and it is shown that center vortices emerge as the stable saddlepoints of this action. Thus, in the case of strong couplings, the vortex picture is arrived at analytically. I also respond briefly to a recent criticism regarding maximal center gauge. (author)
-
Balsam, Kimberly F.; Beauchaine, Theodore P.; Rothblum, Esther D.; Solomon, Sondra E.
2008-01-01
This study was a 3-year follow-up of 65 male and 138 female same-sex couples who had civil unions in Vermont during the 1st year of that legislation. These couples were compared with 23 male and 61 female same-sex couples in their friendship circles who did not have civil unions and with 55 heterosexual married couples (1 member of each was a…
-
Directory of Open Access Journals (Sweden)
Alireza Karimpour Vazifehkhorani
2017-10-01
Full Text Available Background and Objectives: This study aimed to compare Gary Behavioral Systems (behavioral activation system and behavioral inhibition system in normal couples and those engaged in marital infidelity. Material and Methods: The research was descriptive and causal-comparative. Study population consisted of normal couples and couples who were betrayed in the cities of Tehran, Karaj and Tabriz that were referred to counseling clinics. Study sample consisted of 100 clients; 50 normal couples and 50 couples who were involved in marital infidelity. Sampling was targeted. To collect data, Grey-Wilson's and wife infidelity questionnaires were used. Results: Inhibition of behavior in normal couples was higher than couples involved in marital infidelity which was significant at P Conclusion: Couples who have activation system of high sensitivity are more involved in the phenomenon of marital infidelity compared to the couples who are at high behavioral inhibition system.
-
Energy Technology Data Exchange (ETDEWEB)
Yang, Lihui [Department of Environmental Science and Engineering, College of Life and Environmental Science, Shanghai Normal University, Shanghai 200234 (China); Zhang, Yongming, E-mail: zhym@shnu.edu.cn [Department of Environmental Science and Engineering, College of Life and Environmental Science, Shanghai Normal University, Shanghai 200234 (China); Bai, Qi; Yan, Ning; Xu, Hua [Department of Environmental Science and Engineering, College of Life and Environmental Science, Shanghai Normal University, Shanghai 200234 (China); Rittmann, Bruce E. [Swette Center for Environmental Biotechnology, Biodesign Institute, Arizona State University, Tempe, AZ 85287-5701 (United States)
2015-04-28
Highlights: • Intimately coupled UV photolysis accelerated nitrobenzene biodegradation. • NB biodegradation was slowed by accumulation of nitrophenol. • Oxalic acid was a key product of UV photolysis. • Oxalic acid accelerated biodegradation of nitrobenzene and nitrophenol by a co-substrate effect. • Intimate coupling of UV and biodegradation accentuated the benefits of oxalic acid. - Abstract: Photo(cata)lysis coupled with biodegradation is superior to photo(cata)lysis or biodegradation alone for removal of recalcitrant organic compounds. The two steps can be carried out sequentially or simultaneously via intimate coupling. We studied nitrobenzene (NB) removal and mineralization to evaluate why intimate coupling of photolysis with biodegradation was superior to sequential coupling. Employing an internal circulation baffled biofilm reactor, we compared direct biodegradation (B), biodegradation after photolysis (P + B), simultaneous photolysis and biodegradation (P&B), and biodegradation with nitrophenol (NP) and oxalic acid (OA) added individually and simultaneously (B + NP, B + OA, and B + NP + OA); NP and OA were NB’s main UV-photolysis products. Compared with B, the biodegradation rate P + B was lower by 13–29%, but intimately coupling (P&B) had a removal rate that was 10–13% higher; mineralization showed similar trends. B + OA gave results similar to P&B, B + NP gave results similar to P + B, and B + OA + NP gave results between P + B and P&B, depending on the amount of OA and NP added. The photolysis product OA accelerated NB biodegradation through a co-substrate effect, but NP was inhibitory. Although decreasing the UV photolysis time could minimize the inhibition impact of NP in P + B, P&B gave the fastest removal of NB by accentuating the co-substrate effect of OA.
-
International Nuclear Information System (INIS)
Yang, Lihui; Zhang, Yongming; Bai, Qi; Yan, Ning; Xu, Hua; Rittmann, Bruce E.
2015-01-01
Highlights: • Intimately coupled UV photolysis accelerated nitrobenzene biodegradation. • NB biodegradation was slowed by accumulation of nitrophenol. • Oxalic acid was a key product of UV photolysis. • Oxalic acid accelerated biodegradation of nitrobenzene and nitrophenol by a co-substrate effect. • Intimate coupling of UV and biodegradation accentuated the benefits of oxalic acid. - Abstract: Photo(cata)lysis coupled with biodegradation is superior to photo(cata)lysis or biodegradation alone for removal of recalcitrant organic compounds. The two steps can be carried out sequentially or simultaneously via intimate coupling. We studied nitrobenzene (NB) removal and mineralization to evaluate why intimate coupling of photolysis with biodegradation was superior to sequential coupling. Employing an internal circulation baffled biofilm reactor, we compared direct biodegradation (B), biodegradation after photolysis (P + B), simultaneous photolysis and biodegradation (P&B), and biodegradation with nitrophenol (NP) and oxalic acid (OA) added individually and simultaneously (B + NP, B + OA, and B + NP + OA); NP and OA were NB’s main UV-photolysis products. Compared with B, the biodegradation rate P + B was lower by 13–29%, but intimately coupling (P&B) had a removal rate that was 10–13% higher; mineralization showed similar trends. B + OA gave results similar to P&B, B + NP gave results similar to P + B, and B + OA + NP gave results between P + B and P&B, depending on the amount of OA and NP added. The photolysis product OA accelerated NB biodegradation through a co-substrate effect, but NP was inhibitory. Although decreasing the UV photolysis time could minimize the inhibition impact of NP in P + B, P&B gave the fastest removal of NB by accentuating the co-substrate effect of OA
-
Belpex and trilateral market coupling
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-01-15
This document describes the operation of Belpex, the Belgian power transmission spot market, and its linking with the French (Powernext) and Dutch (APX) auction-style day-ahead spot markets. A last part deals with the extension of this trilateral market to other European countries. Content: Belpex day-ahead market (DAM) (Goals of the DAM: Provide consumers with a wider choice of electrical energy sources, Enable the ARP's to optimize their portfolio in terms of imbalance costs, Reduce trade and credit risks for market players compared with the risks involved in concluding bilateral contracts, Provide economic players with a transparent price benchmark, Stimulate the opening of the electricity market); Market model Product (description, Contracts, Collateral calculation, From 12 January to launch date Corporate and Legal Aspects, Next developments); Trilateral Market Coupling (What is market coupling and what are the benefits?, Implementation of trilateral market coupling ('TLC') in France/Belgium/Netherlands, From Trilateral to Multilateral, Implementation of Trilateral Market Coupling (TLC) in France/Belgium/Netherlands, Decentralized market coupling mechanism, influence of import and export on area prices); Decentralized market coupling (2 countries Situations: unconstrained/constrained, Decentralized market coupling: 3 countries, High Level Properties of Market Coupling, Maximize flow until prices across link converge (or ATC limit reached), Power flows from low price area to high price area, Implementing a decentralized technical approach, Market Coupling Daily Process, Impact on Existing Exchange Arrangements, Implementing a decentralized contractual approach, TLC Project Process); From Trilateral to Multilateral (Geographic extensions, Towards an Open and Multilateral Market Coupling, Management of Interconnection Capacities, Interconnection Capacities: current situation, TSO Roles and Responsibilities in the TLC, Other Import/Export products
-
Belpex and trilateral market coupling
International Nuclear Information System (INIS)
2006-01-01
This document describes the operation of Belpex, the Belgian power transmission spot market, and its linking with the French (Powernext) and Dutch (APX) auction-style day-ahead spot markets. A last part deals with the extension of this trilateral market to other European countries. Content: Belpex day-ahead market (DAM) (Goals of the DAM: Provide consumers with a wider choice of electrical energy sources, Enable the ARP's to optimize their portfolio in terms of imbalance costs, Reduce trade and credit risks for market players compared with the risks involved in concluding bilateral contracts, Provide economic players with a transparent price benchmark, Stimulate the opening of the electricity market); Market model Product (description, Contracts, Collateral calculation, From 12 January to launch date Corporate and Legal Aspects, Next developments); Trilateral Market Coupling (What is market coupling and what are the benefits?, Implementation of trilateral market coupling ('TLC') in France/Belgium/Netherlands, From Trilateral to Multilateral, Implementation of Trilateral Market Coupling (TLC) in France/Belgium/Netherlands, Decentralized market coupling mechanism, influence of import and export on area prices); Decentralized market coupling (2 countries Situations: unconstrained/constrained, Decentralized market coupling: 3 countries, High Level Properties of Market Coupling, Maximize flow until prices across link converge (or ATC limit reached), Power flows from low price area to high price area, Implementing a decentralized technical approach, Market Coupling Daily Process, Impact on Existing Exchange Arrangements, Implementing a decentralized contractual approach, TLC Project Process); From Trilateral to Multilateral (Geographic extensions, Towards an Open and Multilateral Market Coupling, Management of Interconnection Capacities, Interconnection Capacities: current situation, TSO Roles and Responsibilities in the TLC, Other Import/Export products on the
-
Synchronizability of coupled PWL maps
International Nuclear Information System (INIS)
Polynikis, A.; Di Bernardo, M.; Hogan, S.J.
2009-01-01
In this paper we discuss the phenomenon of synchronization of chaotic systems in the case of coupled piecewise linear (PWL) continuous and discontinuous one-dimensional maps. We present numerical results for two examples of coupled systems consisting of two PWL maps. We illustrate how the coupled system can achieve synchronization and discuss the nature of the bifurcation that occurs at a critical value of the coupling strength. We then determine this critical coupling using linear stability analysis. We discuss the effects of variation of the parameters of the PWL maps on the critical coupling and present different bifurcation scenarios obtained for different sets of values of these parameters. Finally, we discuss an extension of our work to the synchronizability of networks consisting of two or more PWL maps. We show how the synchronizability of a network of PWL maps can be improved by tuning the map parameters.
-
Cognitive-behavioral couple therapy.
Epstein, Norman B; Zheng, Le
2017-02-01
This article describes how cognitive-behavioral couple therapy (CBCT) provides a good fit for intervening with a range of stressors that couples experience from within and outside their relationship. It takes an ecological perspective in which a couple is influenced by multiple systemic levels. We provide an overview of assessment and intervention strategies used to modify negative behavioral interaction patterns, inappropriate or distorted cognitions, and problems with the experience and regulation of emotions. Next, we describe how CBCT can assist couples in coping with stressors involving (a) a partner's psychological disorder (e.g. depression), (b) physical health problems (e.g. cancer), (c) external stressors (e.g. financial strain), and (d) severe relational problems (e.g. partner aggression). Copyright © 2016 Elsevier Ltd. All rights reserved.
-
Cosmological tests of coupled Galileons
International Nuclear Information System (INIS)
Brax, Philippe; Burrage, Clare; Davis, Anne-Christine; Gubitosi, Giulia
2015-01-01
We investigate the cosmological properties of Galileon models which admit Minkowski space as a stable solution in vacuum. This is motivated by stable, positive tension brane world constructions that give rise to Galileons. We include both conformal and disformal couplings to matter and focus on constraints on the theory that arise because of these couplings. The disformal coupling to baryonic matter is extremely constrained by astrophysical and particle physics effects. The disformal coupling to photons induces a cosmological variation of the speed of light and therefore distorsions of the Cosmic Microwave Background spectrum which are known to be very small. The conformal coupling to baryons leads to a variation of particle masses since Big Bang Nucleosynthesis which is also tightly constrained. We consider the background cosmology of Galileon models coupled to Cold Dark Matter (CDM), photons and baryons and impose that the speed of light and particle masses respect the observational bounds on cosmological time scales. We find that requiring that the equation of state for the Galileon models must be close to -1 now restricts severely their parameter space and can only be achieved with a combination of the conformal and disformal couplings. This leads to large variations of particle masses and the speed of light which are not compatible with observations. As a result, we find that cosmological Galileon models are viable dark energy theories coupled to dark matter but their couplings, both disformal and conformal, to baryons and photons must be heavily suppressed making them only sensitive to CDM
-
Directory of Open Access Journals (Sweden)
Hiroshi Toda
2017-11-01
Full Text Available The novel cryptic pKPAL3 plasmid was isolated from the Gram-positive microorganism Kocuria palustris IPUFS-1 and characterized in detail. pKPAL3 is a circular plasmid that is 4,443 bp in length. Open reading frame (ORF and homology search analyses indicated that pKPAL3 possesses four ORFs; however, there were no replication protein coding genes predicted in the plasmid. Instead, there were two nucleotide sequence regions that showed significant identities with untranslated regions of K. rhizophila DC2201 (NBRC 103217 genomic sequences, and these sequences were essential for autonomous replication of pKPAL3 in Kocuria cells. Based on these findings, we constructed the novel Escherichia coli–Kocuria shuttle vectors pKITE301 (kanamycin resistant and pKITE303 (thiostrepton resistant from pKPAL3. The copy numbers of the constructed shuttle vectors were estimated to be 20 per cell, and they exhibited low segregation stability in Kocuria transformant cells in the absence of antibiotics. Moreover, constructed vectors showed compatibility with the other K. rhizophila shuttle vector pKITE103. We successfully expressed multiple heterologous genes, including the styrene monooxygenase gene from Rhodococcus sp. ST-10 (rhsmo and alcohol dehydrogenase gene from Leifsonia sp. S749 (lsadh, in K. rhizophila DC2201 using the pKITE301P and pKITE103P vectors under the control of the glyceraldehyde 3-phosphate dehydrogenase (gapdh promotor. The RhSMO–LSADH co-expressing K. rhizophila was used as a biocatalyst in an organic solvent–water biphasic reaction system to efficiently convert styrene into (S-styrene oxide with 99% ee in the presence of 2-propanol as a hydrogen donor. The product concentration of the reaction in the organic solvent reached 235 mM after 30 h under optimum conditions. Thus, we demonstrated that this novel shuttle vector is useful for developing biocatalysts based on organic solvent-tolerant Kocuria cells.
-
Plazy, M; Orne-Gliemann, J; Balestre, E; Miric, M; Darak, S; Butsashvili, M; Tchendjou, P; Dabis, F; Desgrées du Loû, A
2013-08-01
The Prenahtest study investigated the efficacy of a couple-oriented HIV counselling session (COC) in encouraging couple HIV counselling and testing, and improving intra-couple communication about sexual and reproductive health. We report here on the effect of COC on intra-couple communication about HIV. Within this 4-country trial (India, Georgia, Dominican Republic and Cameroon), 484 to 491 pregnant women per site were recruited and individually randomized to receive either the COC intervention, enhanced counselling with role playing, or standard post-test HIV counselling. Women were interviewed at recruitment, before HIV testing (T0), and 2 to 8 weeks after post-test HIV counselling (T1). Four dichotomous variables documented intra-couple communication about HIV at T1: 1) discussion about HIV, 2) discussion about condom use, 3) suggesting HIV testing and 4) suggesting couple HIV counselling to the partner. An intra-couple HIV communication index was created: low degree of communication ("yes" response to zero or one of the four variables), intermediate degree of communication ("yes" to two or three variables) or high degree of communication ("yes" to the four variables). To estimate the impact of COC on the intra-couple HIV communication index, multivariable logistic regressions were conducted. One thousand six hundred and seven women were included in the analysis of whom 54 (3.4%) were HIV-infected (49 in Cameroon). In the four countries, the counselling group was associated with intra-couple HIV communication (P≤0.03): women allocated to the COC group were significantly more likely to report high or intermediate degrees of intra-couple communication about HIV (versus low degree of communication) than women allocated to standard counselling. COC improved short-term communication about HIV within couples in different sociocultural contexts, a positive finding for a couple approach to HIV prevention. Copyright © 2013 Elsevier Masson SAS. All rights reserved.
-
Tool-change coupling for robots
International Nuclear Information System (INIS)
Cooper, C.
1988-01-01
A coupling device for use in enabling a robotic unit to couple automatically with any one of a number of tools, comprises two coupling parts connected respectively to the tool and the arm. The two parts can be brought into interengaged relationship by appropriate manipulation of the arm and can be locked together by means of a locking element, controlled by piston and cylinder assembly which enters a tapered bore in a spigot after the spigot, which is mounted on the coupling part, has entered a bore in the other coupling part. The parts also incorporate registering passages for providing continuity of pressurised air supply between the robotic unit and a fluid-powered device incorporated in the tool. (author)
-
Anisotropic inflation with derivative couplings
Holland, Jonathan; Kanno, Sugumi; Zavala, Ivonne
2018-05-01
We study anisotropic power-law inflationary solutions when the inflaton and its derivative couple to a vector field. This type of coupling is motivated by D-brane inflationary models, in which the inflaton, and a vector field living on the D-brane, couple disformally (derivatively). We start by studying a phenomenological model where we show the existence of anisotropic solutions and demonstrate their stability via a dynamical system analysis. Compared to the case without a derivative coupling, the anisotropy is reduced and thus can be made consistent with current limits, while the value of the slow-roll parameter remains almost unchanged. We also discuss solutions for more general cases, including D-brane-like couplings.
-
Coop Gordon, Kristina; Roberson, Patricia N E; Hughes, Jessica A; Khaddouma, Alexander M; Swamy, Geeta K; Noonan, Devon; Gonzalez, Alicia M; Fish, Laura; Pollak, Kathryn I
2018-03-30
Many couples tend to report steadily decreasing relationship quality following the birth of a child. However, little is known about the postpartum period for Latino couples, a rapidly growing ethnic group who are notably underserved by mental and physical health caregivers in the United States. Thus, this study investigated whether a brief couples' intervention focused on helping couples support each other while increasing healthy behaviors might improve dyadic functioning postpartum. This study presents secondary analyses of data regarding couple functioning from a larger randomized controlled trial with 348 Latino couples to promote smoking cessation. Portions of the intervention taught the couple communication and problem-solving skills to increase healthy behavior. Couples participated in four face-to-face assessments across 1 year starting at the end of the first trimester. Latent growth curve analyses revealed that the treatment group reported an increase in relationship satisfaction and constructive communication after the intervention, which diminished by 1-year follow-up, returning couples to their baseline levels of satisfaction. Results suggest that incorporating a brief couple intervention as part of a larger health intervention for Latinos may prevent postpartum decreases in relationship satisfaction. © 2018 Family Process Institute.
-
Biological couplings: Classification and characteristic rules
Institute of Scientific and Technical Information of China (English)
无
2009-01-01
The phenomena that biological functions originate from biological coupling are the important biological foundation of multiple bionics and the significant discoveries in the bionic fields. In this paper, the basic concepts related to biological coupling are introduced from the bionic viewpoint. Constitution, classification and characteristic rules of biological coupling are illuminated, the general modes of biological coupling studies are analyzed, and the prospects of multi-coupling bionics are predicted.
-
Rogers, Anna Joy; Achiro, Lillian; Bukusi, Elizabeth A; Hatcher, Abigail M; Kwena, Zachary; Musoke, Pamela L; Turan, Janet M; Weke, Elly; Darbes, Lynae A
2016-01-01
HIV infection is frequently transmitted within stable couple partnerships. In order to prevent HIV acquisition in HIV-negative couples, as well as improve coping in couples with an HIV-positive diagnosis, it has been suggested that interventions be aimed at strengthening couple relationships, in addition to addressing individual behaviours. However, little is known about factors that influence relationships to impact joint decision-making related to HIV. We conducted qualitative in-depth interviews with 40 pregnant women and 40 male partners in southwestern Kenya, an area of high HIV prevalence. Drawing from the interdependence model of communal coping and health behaviour change, we employed thematic analysis methods to analyze interview transcripts in Dedoose software with the aim of identifying key relationship factors that could contribute to the development of a couples-based intervention to improve health outcomes for pregnant women and their male partners. In accordance with the interdependence model, we found that couples with greater relationship-centred motivations described jointly engaging in more health-enhancing behaviours, such as couples HIV testing, disclosure of HIV status, and cooperation to improve medication and clinic appointment adherence. These couples often had predisposing factors such as stronger communication skills and shared children, and were less likely to face potential challenges such as polygamous marriages, wife inheritance, living separately, or financial difficulties. For HIV-negative couples, joint decision-making helped them face the health threat of acquiring HIV together. For couples with an HIV-positive diagnosis, communal coping helped reduce risk of interspousal transmission and improve long-term health prospects. Conversely, participants felt that self-centred motivations led to more concurrent sexual partnerships, reduced relationship satisfaction, and mistrust. Couples who lacked interdependence were more likely to
-
Finite-element simulations of coupling capacitances in capacitively coupled pixel detectors
AUTHOR|(SzGeCERN)755510
2017-01-01
Capacitively coupled hybrid silicon pixel-detector assemblies are under study for the vertex detector at the proposed future CLIC linear electron-positron collider. The assemblies consist of active CCPDv3 sensors, with 25 μm pixel pitch implemented in a 180 nm High- Voltage CMOS process, which are glued to the CLICpix readout ASIC, with the same pixel pitch and processed in a commercial 65 nm CMOS technology. The signal created in the silicon bulk of the active sensors passes a two-stage amplifier, in each pixel, and gets transferred as a voltage pulse to metal pads facing the readout chip (ROC). The coupling of the signal to the metal pads on the ROC side proceeds through the capacitors formed between the two chips by a thin layer of epoxy glue. The coupling strength and the amount of unwanted cross coupling to neighbouring pixels depends critically on the uniformity of the glue layer, its thickness and on the alignment precision during the flip-chip assembly process. Finite-element calculations of the coup...
-
Clinical processes in behavioral couples therapy.
Fischer, Daniel J; Fink, Brandi C
2014-03-01
Behavioral couples therapy is a broad term for couples therapies that use behavioral techniques based on principles of operant conditioning, such as reinforcement. Behavioral shaping and rehearsal and acceptance are clinical processes found across contemporary behavioral couples therapies. These clinical processes are useful for assessment and case formulation, as well as teaching couples new methods of conflict resolution. Although these clinical processes assist therapists in achieving efficient and effective therapeutic change with distressed couples by rapidly stemming couples' corrosive affective exchanges, they also address the thoughts, emotions, and issues of trust and intimacy that are important aspects of the human experience in the context of a couple. Vignettes are provided to illustrate the clinical processes described. (PsycINFO Database Record (c) 2014 APA, all rights reserved).
-
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... palustris CGA009] ... Length = 157 ... Query: 95 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDA...KIETVLSDNGREFCGRP 154 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDAKIETV...LSDNGREFCGRP Sbjct: 1 ... YLQTAIDCHSRYAFARLYSSKLPVTAVHLMNNDVLPTFEAHDAKIETVLSDNGREFCGRP 60 ... Query: 215 LDDYLVGY
-
Simultaneous viscous-inviscid coupling via transpiration
International Nuclear Information System (INIS)
Yiu, K.F.C.; Giles, M.B.
1995-01-01
In viscous-inviscid coupling analysis, the direct coupling technique and the inverse coupling technique are commonly adopted. However, stability and convergence of the algorithms derived are usually very unsatisfactory. Here, by using the transpiration technique to simulate the effect of the displacement thickness, a new simultaneous coupling method is derived. The integral boundary layer equations and the full potential equation are chosen to be the viscous-inviscid coupled system. After discretization, the Newton-Raphson technique is proposed to solve the coupled nonlinear system. Several numerical results are used to demonstrate the accuracy and efficiency of the proposed method. 15 refs., 23 figs
-
Development of annular coupled structure
International Nuclear Information System (INIS)
Kageyama, T.; Morozumi, Y.; Yoshino, K.; Yamazaki, Y.
1992-01-01
A π/2-mode standing-wave linac of an Annular Coupled Structure (ACS) has been developed for the 1-GeV proton linac of the Japanese Hadron Project (JHP). This ACS has four coupling slots between accelerating and coupling cells in order to overcome difficulties in putting the ACS to practical use. Two prototypes of a four-slot ACS (f = 1296 MHz, β = v/c = 0.8) have been constructed and tested: one with a staggered slot-orientation from cell to cell; and the other with a uniform one. The staggered configuration gives a larger coupling constant and a larger shunt impedance than the uniform one with the same size of coupling slot. Both models have been conditioned up to the design input RF power. The four-slot ACS gives a distortion-free accelerating field around the beam axis, while a Side-Coupled Structure cavity gives an accelerating field mixed with a TE111-like mode. (Author) 7 figs., 2 tabs., 9 refs
-
Coupled intertwiner dynamics: A toy model for coupling matter to spin foam models
Steinhaus, Sebastian
2015-01-01
The universal coupling of matter and gravity is one of the most important features of general relativity. In quantum gravity, in particular spin foams, matter couplings have been defined in the past, yet the mutual dynamics, in particular if matter and gravity are strongly coupled, are hardly explored, which is related to the definition of both matter and gravitational degrees of freedom on the discretisation. However extracting this mutual dynamics is crucial in testing the viability of the ...
-
Coherence Phenomena in Coupled Optical Resonators
Smith, D. D.; Chang, H.
2004-01-01
We predict a variety of photonic coherence phenomena in passive and active coupled ring resonators. Specifically, the effective dispersive and absorptive steady-state response of coupled resonators is derived, and used to determine the conditions for coupled-resonator-induced transparency and absorption, lasing without gain, and cooperative cavity emission. These effects rely on coherent photon trapping, in direct analogy with coherent population trapping phenomena in atomic systems. We also demonstrate that the coupled-mode equations are formally identical to the two-level atom Schrodinger equation in the rotating-wave approximation, and use this result for the analysis of coupled-resonator photon dynamics. Notably, because these effects are predicted directly from coupled-mode theory, they are not unique to atoms, but rather are fundamental to systems of coherently coupled resonators.
-
Ladd, Benjamin O; McCrady, Barbara S
2016-01-01
This study aimed to examine whether classification of couples in which one partner has an alcohol problem is similar to that reported in the general couples literature. Typologies of couples seeking alcohol behavioral couple therapy (ABCT) were developed via hierarchical cluster analysis using behavioral codes of couple interactions during their first ABCT session. Four couples types based on in-session behavior were established reliably, labeled avoider, validator, hostile, and ambivalent-detached. These couple types resembled couples types found in previous research. Couple type was associated with baseline relationship satisfaction, but not alcohol use. Results suggest heterogeneity in couples with alcohol problems presenting to treatment; further study is needed to investigate the function of alcohol within these different types. © 2015 American Association for Marriage and Family Therapy.
-
Magnetically Coupled Magnet-Spring Oscillators
Donoso, G.; Ladera, C. L.; Martin, P.
2010-01-01
A system of two magnets hung from two vertical springs and oscillating in the hollows of a pair of coils connected in series is a new, interesting and useful example of coupled oscillators. The electromagnetically coupled oscillations of these oscillators are experimentally and theoretically studied. Its coupling is electromagnetic instead of…
-
Development of Side Coupled Cavities
International Nuclear Information System (INIS)
Conto, J.M. de; Carretta, J.M.; Gomez-Martinez, Y.; Micoud, R.
2008-01-01
Side coupled Cavities are good candidates for proton accelerations in the 90-180 MeV range, as it has been first proposed for the CERN LINAC4 project. A side coupled Linac is made of a lump chain of resonant cavities, alternatively accelerating and coupling. A side coupled cavity has been designed in a CERN-LPSC collaboration to achieve LINAC4 requirements. After RF studies, a complete thermal study has been done, showing that 10-15% is the absolute maximum duty-cycle achievable by such a cavity. Error studies have been developed. They have shown that a tuning ring is mandatory and that a K equals 3% coupling factor is a good choice. A prototype has been built and each cell has been measured and tuned. A simple and accurate method has been used to get both the resonant frequency and the coupling factor, with a movable tuner and a linear fit. A similar method has been used to get the second order coupling factor. A large dispersion is observed on K. This is mainly due to the shape of the coupling apertures, which are very sensitive to mechanical errors. A future and realistic design must be very careful to guarantee a constant aperture (the important parameter is more the dispersion of k than its exact value). Finally, we analyse how to tune the cavity. This has to checked carefully and probably improved or corrected. Results are expected for mid-2008
-
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available LGETGSGKDVFARRVHAESARRNKPFVPVNCAALPEGLIES 387 ... MAQLSRTVRLVEAGIPVLLLGETGSGKDVFARRVHAESARRNKPFVPVNCA...ALPEGLIES Sbjct: 1 ... MAQLSRTVRLVEAGIPVLLLGETGSGKDVFARRVHAESARRNKPFVPVNCAALPEGLIES 60 ... Query: 448 GRPVPVDFALI...domonas palustris CGA009] ... Length = 229 ... Query: 328 MAQLSRTVRLVEAGIPVLL
-
Tremblay, Joël; Dufour, Magali; Bertrand, Karine; Blanchette-Martin, Nadine; Ferland, Francine; Savard, Annie-Claude; Saint-Jacques, Marianne; Côté, Mélissa
2018-01-01
Context: Couple treatment for pathological gambling is an innovative strategy. There are some results supporting its potential effectiveness, but little is known about the subjective experiences of the participants. Objective: The aim of this article is to document the experiences of gamblers and their partners participating in one of two treatments, namely individual or couple. Method: In a study aiming to evaluate the efficacy of the Integrative Couple Treatment for Pathological Gambling (ICT-PG), couples who were entering specialized treatment for the addiction of one member who was a pathological gambler were randomly assigned to individual or ICT-PG. Nine months after their admission to treatment, gamblers and partners (n = 21 couples; n = 13 ICT-PG; n = 8 individual treatment) were interviewed in semi-structured interviews. A sequenced thematization method was used to extract the major themes. Results: This study highlighted five major themes in the therapeutic process noted by the gamblers and their partners mainly after the couple treatment but also partly through the individual therapy. These were: (1) the gamblers' anxiety about having to reveal their gambling problems in couple therapy; (2) the wish to develop a mutually beneficial understanding of gambling and its effects on the partners in the two types of treatments; (3) the transformation of negative attributions through a more effective intra-couple communication fostered by the couple therapy; (4) the partners' contribution to changes in gambling behavior and prevention of relapses, which were both better supported in couple therapy; and (5) the interpersonal nature of gambling and its connections with the couples' relationship. However, gamblers who were in individual treatment were more likely to mention that their partners' involvement was not necessary. Participants likewise made a few recommendations about the conditions underlying the choice of one treatment method or the other. Discussion
-
Directory of Open Access Journals (Sweden)
Joël Tremblay
2018-01-01
Full Text Available Context: Couple treatment for pathological gambling is an innovative strategy. There are some results supporting its potential effectiveness, but little is known about the subjective experiences of the participants.Objective: The aim of this article is to document the experiences of gamblers and their partners participating in one of two treatments, namely individual or couple.Method: In a study aiming to evaluate the efficacy of the Integrative Couple Treatment for Pathological Gambling (ICT-PG, couples who were entering specialized treatment for the addiction of one member who was a pathological gambler were randomly assigned to individual or ICT-PG. Nine months after their admission to treatment, gamblers and partners (n = 21 couples; n = 13 ICT-PG; n = 8 individual treatment were interviewed in semi-structured interviews. A sequenced thematization method was used to extract the major themes.Results: This study highlighted five major themes in the therapeutic process noted by the gamblers and their partners mainly after the couple treatment but also partly through the individual therapy. These were: (1 the gamblers' anxiety about having to reveal their gambling problems in couple therapy; (2 the wish to develop a mutually beneficial understanding of gambling and its effects on the partners in the two types of treatments; (3 the transformation of negative attributions through a more effective intra-couple communication fostered by the couple therapy; (4 the partners' contribution to changes in gambling behavior and prevention of relapses, which were both better supported in couple therapy; and (5 the interpersonal nature of gambling and its connections with the couples' relationship. However, gamblers who were in individual treatment were more likely to mention that their partners' involvement was not necessary. Participants likewise made a few recommendations about the conditions underlying the choice of one treatment method or the other
-
Do Couple-Based Interventions Make a Difference for Couples Affected by Cancer?: A Systematic Review
Directory of Open Access Journals (Sweden)
Regan Tim W
2012-07-01
Full Text Available Abstract Background With the growing recognition that patients and partners react to a cancer diagnosis as an interdependent system and increasing evidence that psychosocial interventions can be beneficial to both patients and partners, there has been a recent increase in the attention given to interventions that target couples. The aim of this systematic review was to identify existing couple-based interventions for patients with cancer and their partners and explore the efficacy of these interventions (including whether there is added value to target the couple versus individuals, the content and delivery of couple-based interventions, and to identify the key elements of couple-based interventions that promote improvement in adjustment to cancer diagnosis. Method A systematic review of the cancer literature was performed to identify experimental and quasi-experimental couple-based interventions published between 1990 and 2011. To be considered for this review, studies had to test the efficacy of a psychosocial intervention for couples affected by cancer. Studies were excluded if they were published in a language other than English or French, focused on pharmacological, exercise, or dietary components combined with psychosocial components, or did not assess the impact of the intervention on psychological distress (e.g., depression, anxiety or quality of life. Data were extracted using a standardised data collection form, and were analysed independently by three reviewers. Results Of the 709 articles screened, 23 were included in this review. Couple-based interventions were most efficacious in improving couple communication, psychological distress, and relationship functioning. Interventions had a limited impact on physical distress and social adjustment. Most interventions focused on improving communication and increasing understanding of the cancer diagnosis within couples. Interventions were most often delivered by masters-level nurses or
-
Projected coupled cluster theory.
Qiu, Yiheng; Henderson, Thomas M; Zhao, Jinmo; Scuseria, Gustavo E
2017-08-14
Coupled cluster theory is the method of choice for weakly correlated systems. But in the strongly correlated regime, it faces a symmetry dilemma, where it either completely fails to describe the system or has to artificially break certain symmetries. On the other hand, projected Hartree-Fock theory captures the essential physics of many kinds of strong correlations via symmetry breaking and restoration. In this work, we combine and try to retain the merits of these two methods by applying symmetry projection to broken symmetry coupled cluster wave functions. The non-orthogonal nature of states resulting from the application of symmetry projection operators furnishes particle-hole excitations to all orders, thus creating an obstacle for the exact evaluation of overlaps. Here we provide a solution via a disentanglement framework theory that can be approximated rigorously and systematically. Results of projected coupled cluster theory are presented for molecules and the Hubbard model, showing that spin projection significantly improves unrestricted coupled cluster theory while restoring good quantum numbers. The energy of projected coupled cluster theory reduces to the unprojected one in the thermodynamic limit, albeit at a much slower rate than projected Hartree-Fock.
-
Carl, Douglas
1986-01-01
The Acquired Immune Deficiency Syndrome (AIDS) epidemic significantly influences attitudes about life and lifestyles. Homosexuals have to give increased consideration to coupling, the nature of coupled relationships, sex and intimacy, and death long before the normal time. Discusses impact of AIDS on the early stages of gay coupling and on the…
-
Myers, William N. (Inventor); Hein, Leopold A. (Inventor)
1987-01-01
A first annular ring of a tube coupling device has a keyed opening sized to fit around the nut region of a male coupling, and a second annular ring has a keyed opening sized to fit around the nut of a female coupling. Each ring has mating ratchet teeth and these rings are biased together, thereby engaging these teeth and preventing rotation of these rings. This in turn prevents the rotation of the male nut region with respect to the female nut. For tube-to-bulkhead locking, one facet of one ring is notched, and a pin is pressed into an opening in the bulkhead. This pin is sized to fit within one of the notches in the ring, thereby preventing rotation of this ring with respect to the bulkhead.
-
Fusco, Rachel A.
2010-01-01
The number of interracial couples in the U.S. is growing, but they often receive little support. Although previous studies have explored the relationship between low social support and decreased relationship satisfaction in interracial couples, there are few studies on intimate partner violence (IPV) in these couples. To better understand IPV in…
-
Instabilities in strongly coupled plasmas
Kalman, G J
2003-01-01
The conventional Vlasov treatment of beam-plasma instabilities is inappropriate when the plasma is strongly coupled. In the strongly coupled liquid state, the strong correlations between the dust grains fundamentally affect the conditions for instability. In the crystalline state, the inherent anisotropy couples the longitudinal and transverse polarizations, and results in unstable excitations in both polarizations. We summarize analyses of resonant and non-resonant, as well as resistive instabilities. We consider both ion-dust streaming and dust beam-plasma instabilities. Strong coupling, in general, leads to an enhancement of the growth rates. In the crystalline phase, a resonant transverse instability can be excited.
-
International Nuclear Information System (INIS)
Teng, L.C.
1989-01-01
The magnetic field in an accelerator or a storage ring is usually so designed that the horizontal (x) and the vertical (y) motions of an ion are uncoupled. However, because of imperfections in construction and alignment, some small coupling is unavoidable. In this lecture, we discuss in a general way what is known about the behaviors of coupled motions in two degrees-of-freedom. 11 refs., 6 figs
-
International Nuclear Information System (INIS)
Badnell, N.R.; Pindzola, M.S.
1989-01-01
We have calculated dielectronic recombination cross sections and rate coefficients for the Ne-like ions P 5+ and Cl 7+ in configuration-average, LS-coupling, and intermediate-coupling approximations. Autoionization into excited states reduces the cross sections and rate coefficients by substantial amounts in all three methods. There is only rough agreement between the configuration-average cross-section results and the corresponding intermediate-coupling results. There is good agreement, however, between the LS-coupling cross-section results and the corresponding intermediate-coupling results. The LS-coupling and intermediate-coupling rate coefficients agree to better than 5%, while the configuration-average rate coefficients are about 30% higher than the other two coupling methods. External electric field effects, as calculated in the configuration-average approximation, are found to be relatively small for the cross sections and completely negligible for the rate coefficients. Finally, the general formula of Burgess was found to overestimate the rate coefficients by roughly a factor of 5, mainly due to the neglect of autoionization into excited states
-
Stochastic coupled cluster theory: Efficient sampling of the coupled cluster expansion
Scott, Charles J. C.; Thom, Alex J. W.
2017-09-01
We consider the sampling of the coupled cluster expansion within stochastic coupled cluster theory. Observing the limitations of previous approaches due to the inherently non-linear behavior of a coupled cluster wavefunction representation, we propose new approaches based on an intuitive, well-defined condition for sampling weights and on sampling the expansion in cluster operators of different excitation levels. We term these modifications even and truncated selections, respectively. Utilising both approaches demonstrates dramatically improved calculation stability as well as reduced computational and memory costs. These modifications are particularly effective at higher truncation levels owing to the large number of terms within the cluster expansion that can be neglected, as demonstrated by the reduction of the number of terms to be sampled when truncating at triple excitations by 77% and hextuple excitations by 98%.
-
Infidelity in couples seeking marital therapy.
Atkins, David C; Yi, Jean; Baucom, Donald H; Christensen, Andrew
2005-09-01
The revelation of an affair is often an emotionally explosive event for a couple, yet little is known about specific individual and relationship factors that accompany infidelity. The present study examined the qualities of individuals and couples that differentiate couples with (n = 19) and without (n = 115) infidelity using couples from a randomized clinical trial of marital therapy. Findings indicated that couples with infidelity showed greater marital instability, dishonesty, arguments about trust, narcissism, and time spent apart. Gender also proved to be a significant moderator of several effects. Men who had participated in affairs showed increased substance use, were older, and were more sexually dissatisfied. Results offer initial clues to concomitants of affairs for couple therapists. (c) 2005 APA, all rights reserved
-
International Nuclear Information System (INIS)
Gelfand, N.M.
1994-12-01
The performance of the Fermilab Tevatron Collider at the commencement of run Ib was far below expectations. After a frustrating period of several months, a low-β quad downstream of the interaction point at B0 was found to be rolled. This rolled quadrupole coupled the horizontal and vertical motion of the Tevatron beams. It also made matching the beam from the Main Ring to the Tevatron impossible, resulting in emittance blow up on injection. The net result of the roll was a significant reduction in the Tevatron luminosity. When the roll in the quadrupole was corrected the performance of the Tevatron improved dramatically. This note will discuss the experimental data indicating the presence of coupling and subsequent calculations which show how coupling an affect the luminosity. It is not intended to exhaust a discussion of coupling, which hopefully will be understood well enough to be discussed in a subsequent note
-
RNA structure and scalar coupling constants
Energy Technology Data Exchange (ETDEWEB)
Tinoco, I. Jr.; Cai, Z.; Hines, J.V.; Landry, S.M.; SantaLucia, J. Jr.; Shen, L.X.; Varani, G. [Univ. of California, Berkeley, CA (United States)
1994-12-01
Signs and magnitudes of scalar coupling constants-spin-spin splittings-comprise a very large amount of data that can be used to establish the conformations of RNA molecules. Proton-proton and proton-phosphorus splittings have been used the most, but the availability of {sup 13}C-and {sup 15}N-labeled molecules allow many more coupling constants to be used for determining conformation. We will systematically consider the torsion angles that characterize a nucleotide unit and the coupling constants that depend on the values of these torsion angles. Karplus-type equations have been established relating many three-bond coupling constants to torsion angles. However, one- and two-bond coupling constants can also depend on conformation. Serianni and coworkers measured carbon-proton coupling constants in ribonucleosides and have calculated their values as a function of conformation. The signs of two-bond coupling can be very useful because it is easier to measure a sign than an accurate magnitude.
-
Bertolotti, M.; Symes, W.W.; Stoffer, Remco; Hiremath, K.R.; Driessen, A.; Michelotti, F; Hammer, Manfred
Analysis of integrated optical cylindrical microresonators involves the coupling between a straight waveguide and a bent waveguide. Our (2D) variant of coupled mode theory is based on analytically represented mode profiles. With the bend modes expressed in Cartesian coordinates, coupled mode
-
Elnaggar, Sameh Y.; Tervo, Richard; Mattar, Saba M.
2014-01-01
Probes consisting of a dielectric resonator (DR) inserted in a cavity are important integral components of electron paramagnetic resonance (EPR) spectrometers because of their high signal-to-noise ratio. This article studies the behavior of this system, based on the coupling between its dielectric and cavity modes. Coupled-mode theory (CMT) is used to determine the frequencies and electromagnetic fields of this coupled system. General expressions for the frequencies and field distributions are derived for both the resulting symmetric and anti-symmetric modes. These expressions are applicable to a wide range of frequencies (from MHz to THz). The coupling of cavities and DRs of various sizes and their resonant frequencies are studied in detail. Since the DR is situated within the cavity then the coupling between them is strong. In some cases the coupling coefficient, κ, is found to be as high as 0.4 even though the frequency difference between the uncoupled modes is large. This is directly attributed to the strong overlap between the fields of the uncoupled DR and cavity modes. In most cases, this improves the signal to noise ratio of the spectrometer. When the DR and the cavity have the same frequency, the coupled electromagnetic fields are found to contain equal contributions from the fields of the two uncoupled modes. This situation is ideal for the excitation of the probe through an iris on the cavity wall. To verify and validate the results, finite element simulations are carried out. This is achieved by simulating the coupling between a cylindrical cavity's TE011 and the dielectric insert's TE01δ modes. Coupling between the modes of higher order is also investigated and discussed. Based on CMT, closed form expressions for the fields of the coupled system are proposed. These expressions are crucial in the analysis of the probe's performance.
-
Study of gain-coupled distributed feedback laser based on high order surface gain-coupled gratings
Gao, Feng; Qin, Li; Chen, Yongyi; Jia, Peng; Chen, Chao; Cheng, LiWen; Chen, Hong; Liang, Lei; Zeng, Yugang; Zhang, Xing; Wu, Hao; Ning, Yongqiang; Wang, Lijun
2018-03-01
Single-longitudinal-mode, gain-coupled distributed feedback (DFB) lasers based on high order surface gain-coupled gratings are achieved. Periodic surface metal p-contacts with insulated grooves realize gain-coupled mechanism. To enhance gain contrast in the quantum wells without the introduction of effective index-coupled effect, groove length and depth were well designed. Our devices provided a single longitudinal mode with the maximum CW output power up to 48.8 mW/facet at 971.31 nm at 250 mA without facet coating, 3dB linewidth (39 dB). Optical bistable characteristic was observed with a threshold current difference. Experimentally, devices with different cavity lengths were contrasted on power-current and spectrum characteristics. Due to easy fabrication technique and stable performance, it provides a method of fabricating practical gain-coupled distributed feedback lasers for commercial applications.
-
International Nuclear Information System (INIS)
Wu, C.W.
2003-01-01
In a recent paper, wavelet analysis is used to perturb the coupling matrix in an array of identical chaotic systems in order to improve its synchronization. When the coupling matrix is symmetric, the synchronization criterion is determined by the second smallest eigenvalue λ 2 of the coupling matrix and the problem is reduced to studying how λ 2 of the coupling matrix changes with perturbation. In the aforementioned paper, a small percentage of the wavelet coefficients are modified. However, this results in a perturbed matrix where every element is modified and nonzero. The purpose of this Letter is to present some results on the change of λ 2 due to perturbation. In particular, we show that as the number of systems n→∞, perturbations which only add local coupling will not change λ 2 . On the other hand, we show that there exists perturbations which modify an arbitrarily small percentage of matrix elements, each of which is changed by an arbitrarily small amount and yet can make λ 2 arbitrarily large. These results give conditions on what the perturbation should be in order to improve the synchronizability in an array of coupled chaotic systems. This analysis allows us to justify and explain some of the synchronization phenomena observed in a recently studied network where random coupling is added to a locally connected array. We propose to classify various classes of coupling matrices such as small world networks and scale free networks according to their synchronizability in the limit. Finally, we briefly discuss the case of time-varying coupling
-
Spin reorientation via antiferromagnetic coupling
Energy Technology Data Exchange (ETDEWEB)
Ranjbar, M., E-mail: mojtaba.ranjbar@physics.gu.se [Data Storage Institute, A-STAR (Agency for Science, Technology and Research), 5, Engineering Drive 1, Singapore 117608 (Singapore); Department of Physics, University of Gothenburg, 412 96 Gothenburg (Sweden); Sbiaa, R. [Data Storage Institute, A-STAR (Agency for Science, Technology and Research), 5, Engineering Drive 1, Singapore 117608 (Singapore); Department of Physics, Sultan Qaboos University, P.O. Box 36, PC 123, Muscat (Oman); Dumas, R. K. [Department of Physics, University of Gothenburg, 412 96 Gothenburg (Sweden); Åkerman, J. [Department of Physics, University of Gothenburg, 412 96 Gothenburg (Sweden); Materials Physics, School of ICT, Royal Institute of Technology (KTH), 164 40 Kista (Sweden); Piramanayagam, S. N. [Data Storage Institute, A-STAR (Agency for Science, Technology and Research), 5, Engineering Drive 1, Singapore 117608 (Singapore)
2014-05-07
Spin reorientation in antiferromagnetically coupled (AFC) Co/Pd multilayers, wherein the thickness of the constituent Co layers was varied, was studied. AFC-Co/Pd multilayers were observed to have perpendicular magnetic anisotropy even for a Co sublayer thickness of 1 nm, much larger than what is usually observed in systems without antiferromagnetic coupling. When similar multilayer structures were prepared without antiferromagnetic coupling, this effect was not observed. The results indicate that the additional anisotropy energy contribution arising from the antiferromagnetic coupling, which is estimated to be around 6 × 10{sup 6} ergs/cm{sup 3}, induces the spin-reorientation.
-
Coupling spin qubits via superconductors
DEFF Research Database (Denmark)
Leijnse, Martin; Flensberg, Karsten
2013-01-01
We show how superconductors can be used to couple, initialize, and read out spatially separated spin qubits. When two single-electron quantum dots are tunnel coupled to the same superconductor, the singlet component of the two-electron state partially leaks into the superconductor via crossed...... Andreev reflection. This induces a gate-controlled singlet-triplet splitting which, with an appropriate superconductor geometry, remains large for dot separations within the superconducting coherence length. Furthermore, we show that when two double-dot singlet-triplet qubits are tunnel coupled...... to a superconductor with finite charging energy, crossed Andreev reflection enables a strong two-qubit coupling over distances much larger than the coherence length....
-
Coupled oscillators with parity-time symmetry
Energy Technology Data Exchange (ETDEWEB)
Tsoy, Eduard N., E-mail: etsoy@uzsci.net
2017-02-05
Different models of coupled oscillators with parity-time (PT) symmetry are studied. Hamiltonian functions for two and three linear oscillators coupled via coordinates and accelerations are derived. Regions of stable dynamics for two coupled oscillators are obtained. It is found that in some cases, an increase of the gain-loss parameter can stabilize the system. A family of Hamiltonians for two coupled nonlinear oscillators with PT-symmetry is obtained. An extension to high-dimensional PT-symmetric systems is discussed. - Highlights: • A generalization of a Hamiltonian system of linear coupled oscillators with the parity-time (PT) symmetry is suggested. • It is found that an increase of the gain-loss parameter can stabilize the system. • A family of Hamiltonian functions for two coupled nonlinear oscillators with PT-symmetry is obtained.
-
Methylocella silvestris sp. nov., a novel methanotroph isolated from an acidic forest cambisol.
Dunfield, Peter F; Khmelenina, Valentina N; Suzina, Natalia E; Trotsenko, Yuri A; Dedysh, Svetlana N
2003-09-01
Two strains of Gram-negative, aerobic, non-pigmented, non-motile, rod-shaped, methane-oxidizing bacteria were isolated from an acidic forest cambisol near Marburg, Germany, and were designated as strains BL2(T) and A1. These bacteria were morphologically and phenotypically similar to Methylocella palustris K(T). The cells possess a highly specific bipolar appearance. They lack the intracytoplasmic membranes common to all methane-oxidizing bacteria except Methylocella, but contain a vesicular membrane system connected to the cytoplasmic membrane. A soluble methane monooxygenase was present, but no particulate methane monooxygenase could be detected. These bacteria utilize the serine pathway for carbon assimilation. Strains BL2(T) and A1 are moderately acidophilic, mesophilic organisms capable of growth at pH values between 4.5 and 7 (with an optimum at pH 5.5) and at temperatures between 4 and 30 degrees C. Compared with Methylocella palustris K(T), these strains have greater tolerance of cold temperatures, dissolved salts and methanol. On the basis of 16S rRNA gene sequence identity, of species with validly published names, strain BL2(T) is most closely related to Methylocella palustris K(T) (97.3 % identity), Beijerinckia indica subsp. indica ATCC 9039(T) (97.1 %) and Methylocapsa acidiphila B2(T) (96.2 %). The DNA G+C content is 60 mol% and the major phospholipid fatty acid is 18 : 1omega7. Strain BL2(T) showed only 21-22 % DNA-DNA hybridization with Methylocella palustris K(T). The data therefore suggest that strains BL2(T) and A1 represent a novel species of Methylocella; the name Methylocella silvestris sp. nov. is proposed, with strain BL2(T) (=DSM 15510(T)=NCIMB 13906(T)) as the type strain.
-
Florentín, Javier Elias; Cabaña Fader, Andrea Alejandra; Salas, Roberto Manuel; Janssens, Steven; Dessein, Steven; Cabral, Elsa Leonor
2017-01-01
Galianthe (Rubiaceae) is a neotropical genus comprising 50 species divided into two subgenera, Galianthe subgen. Galianthe, with 39 species and Galianthe subgen. Ebelia , with 11 species. The diagnostic features of the genus are: usually erect habit with xylopodium, distylous flowers arranged in lax thyrsoid inflorescences, bifid stigmas, 2-carpellate and longitudinally dehiscent fruits, with dehiscent valves or indehiscent mericarps, plump seeds or complanate with a wing-like strophiole, and pollen with double reticulum, rarely with a simple reticulum. This study focused on two species that were originally described under Diodia due to the occurrence of fruits indehiscent mericarps: Diodia palustris and D. spicata . In the present study, classical taxonomy is combined with molecular analyses. As a result, we propose that both Diodia species belong to Galianthe subgen. Ebelia . The molecular position within Galianthe , based on ITS and ETS sequences, has been supported by the following morphological characters: thyrsoid, spiciform or cymoidal inflorescences, bifid stigmas, pollen grains with a double reticulum, and indehiscent mericarps. However, both species, unlike the remainder of the genus Galianthe , have homostylous flowers, so the presence of this type of flower significantly modifies the generic concept. In this framework, a third homostylous species, Galianthe vasquezii , from the Andean region is also described. Until now, this species remained cryptic under specimens of Galianthe palustris It differs however from the latter by having longer calyx lobes, the presence of dispersed trichomes inside the corolla lobes (vs. glabrous), fruits that are acropetally dehiscent (vs. basipetally dehiscent), and its Andean geographical distribution (vs. Paranaense). Additionally, a lectotype has been chosen for Diodia palustris , Borreria pterophora has been placed under synonymy of Galianthe palustris , and Galianthe boliviana is reported for the first time from Peru
-
Coupling regularizes individual units in noisy populations
International Nuclear Information System (INIS)
Ly Cheng; Ermentrout, G. Bard
2010-01-01
The regularity of a noisy system can modulate in various ways. It is well known that coupling in a population can lower the variability of the entire network; the collective activity is more regular. Here, we show that diffusive (reciprocal) coupling of two simple Ornstein-Uhlenbeck (O-U) processes can regularize the individual, even when it is coupled to a noisier process. In cellular networks, the regularity of individual cells is important when a select few play a significant role. The regularizing effect of coupling surprisingly applies also to general nonlinear noisy oscillators. However, unlike with the O-U process, coupling-induced regularity is robust to different kinds of coupling. With two coupled noisy oscillators, we derive an asymptotic formula assuming weak noise and coupling for the variance of the period (i.e., spike times) that accurately captures this effect. Moreover, we find that reciprocal coupling can regularize the individual period of higher dimensional oscillators such as the Morris-Lecar and Brusselator models, even when coupled to noisier oscillators. Coupling can have a counterintuitive and beneficial effect on noisy systems. These results have implications for the role of connectivity with noisy oscillators and the modulation of variability of individual oscillators.
-
International Nuclear Information System (INIS)
Thorson, W.R.; Bandarage, G.
1988-01-01
We formulate a close-coupling theory of slow ion-atom collisions based on molecular (adiabatic) electronic states, and including the electronic continuum. The continuum is represented by packet states spanning it locally and constructed explicitly from exact continuum states. Particular attention is given to two fundamental questions: (1) Unbound electrons can escape from the local region spanned by the packet states. We derive close-coupled integral equations correctly including the escape effects; the ''propagator'' generated by these integral equations does not conserve probability within the close-coupled basis. Previous molecular-state formulations including the continuum give no account of escape effects. (2) Nonadiabatic couplings of adiabatic continuum states with the same energy are singular, reflecting the fact that an adiabatic description of continuum behavior is not valid outside a local region. We treat these singularities explicitly and show that an accurate representation of nonadiabatic couplings within the local region spanned by a set of packet states is well behaved. Hence an adiabatic basis-set description can be used to describe close coupling to the continuum in a local ''interaction region,'' provided the effects of escape are included. In principle, the formulation developed here can be extended to a large class of model problems involving many-electron systems and including models for Penning ionization and collisional detachment processes
-
Optimizing Chromatic Coupling Measurement in the LHC
Persson, Tobias
2016-01-01
Optimizing chromatic coupling measurement in the LHC Chromatic coupling introduces a dependency of transverse coupling with energy. LHC is equipped with skew sextupoles to compensate the possible adverse effects of chromatic coupling. In 2012 a beam-based correction was calculated and applied successfully for the fist time. However, the method used to reconstruct the chromatic coupling was dependent on stable tunes and equal chromaticities between the horizontal and vertical planes. In this article an improved method to calculate the chromatic coupling without these constraints is presented.
-
Miscarriage experiences of lesbian couples.
Wojnar, Danuta
2007-01-01
This was a descriptive phenomenological study of 10 self-identified lesbian couples who had experienced miscarriage in the context of a committed relationship. Analysis of individual and joint open-ended interviews revealed that the experience of miscarriage for lesbian couples must be viewed from the perspective of the difficulties surrounding conception as well as the actual pregnancy loss. The overarching theme, "We are not in control," captures the struggles lesbian couples faced in conceiving their pregnancies and the sense of loss that accompanied miscarrying. These experiences constituted two sub-themes: "We work so hard to get a baby" and "It hurts so bad: The sorrow of miscarriage." Our results indicate that the experience of miscarriage is compounded by the complexities of planning and achieving pregnancy. Practitioners need to be aware of the unique perspectives lesbian couples have on pregnancy and miscarriage and remain sensitive to their unique needs. Findings may serve as an intervention framework for nurse midwives and others caring for lesbian couples after miscarriage.
-
String dynamics at strong coupling
International Nuclear Information System (INIS)
Hull, C.M.
1996-01-01
The dynamics of superstring, supergravity and M-theories and their compactifications are probed by studying the various perturbation theories that emerge in the strong and weak-coupling limits for various directions in coupling constant space. The results support the picture of an underlying non-perturbative theory that, when expanded perturbatively in different coupling constants, gives different perturbation theories, which can be perturbative superstring theories or superparticle theories. The p-brane spectrum is considered in detail and a criterion found to establish which p-branes govern the strong-coupling dynamics. In many cases there are competing conjectures in the literature, and this analysis decides between them. In other cases, new results are found. The chiral 6-dimensional theory resulting from compactifying the type IIB string on K 3 is studied in detail and it is found that certain strong-coupling limits appear to give new theories, some of which hint at the possibility of a 12-dimensional origin. (orig.)
-
Further development of the coupling model
International Nuclear Information System (INIS)
Kreuser, A.; Stiller, J.C.; Peschke, J.
2006-01-01
Uncertainties arising from different sources have to be considered for the quantification of common cause failures (CCFs). At GRS a CCF model (coupling model) has been developed for the estimation of CCF probabilities. An essential feature of the coupling model is the consideration of these uncertainties by using Bayesian estimation methods. Experiences from applying the coupling model to CCF event data over several years and analyzing the results in detail has led to improvements in the application of the model. In this paper the improved methodology of the coupling model is presented. Special emphasis is given to the description of the sources of uncertainties which are considered in the coupling model and the mathematical methodology, how these uncertainties are represented and propagated through the model. In closing topics of future improvements of the coupling models are discussed. (orig.)
-
COUPLING MEASUREMENT AND CORRECTION AT RHIC
International Nuclear Information System (INIS)
PILAT, F.; BEEBE-WANG, J.; FISCHER, W.; PTITSYN, V.; SATOGATA, T.
2002-01-01
Coupling correction at RHIC has been operationally achieved through a two-step process: using local triplet skew quadrupoles to compensate coupling corn rolled low-beta triplet quadrupoles, and minimizing the tune separation and residual coupling with orthogonal global skew quadrupole families. An application has been developed for global correction that allows skew quadrupole tuning and tune display with a choice of different tune measurement techniques, including tune-meter, Schottky and phase lock loop (PLL). Coupling effects have been analyzed by using 1024-turn (TBT) information from the beam position monitor (BPM) system. These data allow the reconstruction of the off-diagonal terms of the transfer matrix, a measure of global coupling. At both injection and storage energies, coordination of tune meter kicks with TBT acquisition at 322 BPW's in each ring allows the measurement of local coupling at all BPM locations
-
Dark forces coupled to nonconserved currents
Dror, Jeff A.; Lasenby, Robert; Pospelov, Maxim
2017-10-01
New light vectors with dimension-4 couplings to Standard Model states have (energy/vectormass)2-enhanced production rates unless the current they couple to is conserved. These processes allow us to derive new constraints on the couplings of such vectors, that are significantly stronger than the previous literature for a wide variety of models. Examples include vectors with axial couplings to quarks and vectors coupled to currents (such as baryon number) that are only broken by the chiral anomaly. Our new limits arise from a range of processes, including rare Z decays and flavor-changing meson decays, and rule out a number of phenomenologically motivated proposals.
-
Distributed coupling high efficiency linear accelerator
Tantawi, Sami G.; Neilson, Jeffrey
2016-07-19
A microwave circuit for a linear accelerator includes multiple monolithic metallic cell plates stacked upon each other so that the beam axis passes vertically through a central acceleration cavity of each plate. Each plate has a directional coupler with coupling arms. A first coupling slot couples the directional coupler to an adjacent directional coupler of an adjacent cell plate, and a second coupling slot couples the directional coupler to the central acceleration cavity. Each directional coupler also has an iris protrusion spaced from corners joining the arms, a convex rounded corner at a first corner joining the arms, and a corner protrusion at a second corner joining the arms.
-
Khazaei, Somayeh; Sebastiani, Daniel
2017-11-01
We study the influence of rotational coupling between a pair of methyl rotators on the tunneling spectrum in condensed phase. Two interacting adjacent methyl groups are simulated within a coupled-pair model composed of static rotational potential created by the chemical environment and the interaction potential between two methyl groups. We solve the two-dimensional time-independent Schrödinger equation analytically by expanding the wave functions on the basis set of two independent free-rotor functions. We investigate three scenarios which differ with respect to the relative strength of single-rotor and coupling potential. For each scenario, we illustrate the dependence of the energy level scheme on the coupling strength. It is found that the main determinant of splitting energy levels tends to be a function of the ratio of strengths of coupling and single-rotor potential. The tunnel splitting caused by coupling is maximized for the coupled rotors in which their total hindering potential is relatively shallow. Such a weakly hindered methyl rotational potential is predicted for 4-methylpyridine at low temperature. The experimental observation of multiple tunneling peaks arising from a single type of methyl group in 4-methylpyridine in the inelastic neutron scattering spectrum is widely attributed to the rotor-rotor coupling. In this regard, using a set of first-principles calculations combined with the nudged elastic band method, we investigate the rotational potential energy surface (PES) of the coaxial pairs of rotors in 4-methylpyridine. A Numerov-type method is used to numerically solve the two-dimensional time-independent Schrödinger equation for the calculated 2D-density functional theory profile. Our computed energy levels reproduce the observed tunneling transitions well. Moreover, the calculated density distribution of the three methyl protons resembles the experimental nuclear densities obtained from the Fourier difference method. By mapping the
-
Strong-coupling theory of superconductivity
International Nuclear Information System (INIS)
Rainer, D.; Sauls, J.A.
1995-01-01
The electronic properties of correlated metals with a strong electron-phonon coupling may be understood in terms of a combination of Landau''s Fermi liquid theory and the strong-coupling theory of Migdal and Eliashberg. In these lecture notes we discuss the microscopic foundations of this phenomenological Fermi-liquid model of correlated, strong-coupling metals. We formulate the basic equations of the model, which are quasiclassical transport equations that describe both equilibrium and non-equilibrium phenomena for the normal and superconducting states of a metal. Our emphasis is on superconductors close to equilibrium, for which we derive the general linear response theory. As an application we calculate the dynamical conductivity of strong-coupling superconductors. (author)
-
Performance assessment of coupled processes
International Nuclear Information System (INIS)
Pigford, T.H.
1987-01-01
The author considers all processes to be coupled. For example, a waste package heats the surrounding rock and its pore water, creating gradients in density and pressure that result in increased water flow. That process can be described as coupled, in that the flow is a consequence of heating. In a narrower sense, one speaks also of the more weakly coupled transport processes, expressed by the Onsager reciprocal relations, that state that a transport current, i.e., flux, of heat is accompanied by a small transport current of material, as evidenced in isotope separation by thermal diffusion, the Thompson effect in thermoelectricity, etc. This paper presents a performance assessment of coupled processes
-
International Nuclear Information System (INIS)
Yin Shao-Ying; Song Jie; Xu Xue-Xin; Zhou Ke-Ya; Liu Shu-Tian; Liu Qing-Xin
2017-01-01
We investigate the prominent impacts of coupling strengths on the evolution of entanglement and quantum discord for a three-qubit system coupled to an XY spin-chain environment. In the case of a pure W state, more robust, even larger nonzero quantum correlations can be obtained by tailoring the coupling strengths between the qubits and the environment. For a mixed state consisting of the GHZ and W states, the dynamics of entanglement and quantum discord can characterize the critical point of quantum phase transition. Remarkably, a large nonzero quantum discord is generally retained, while the nonzero entanglement can only be obtained as the system-environment coupling satisfies certain conditions. We also find that the impact of each qubit’s coupling strength on the quantum correlation dynamics strongly depends on the variation schemes of the system-environment couplings. (paper)
-
Ahmad, Saunia; Reid, David W
2016-10-01
The effectiveness of systemic-constructivist couple therapy (SCCT) in improving the relationship adjustment of South Asian Canadian couples in ways that attend to their culture was evaluated. The SCCT interventions engage partners in reflexive processing of both their own and their partner's ways of construing, and the reciprocity between these two. A core change mechanism of SCCT, couple identity ("we-ness"), that connotes the ability for thinking and experiencing relationally, was coded from verbatim transcripts of partners' within-session dialogue. As predicted, South Asian partners' relationship adjustment improved significantly from the first to final session of SCCT, and concurrent increases in each partner's couple identity mediated such improvements. The implications for considering culture and couple identity in couple therapy are discussed. Video Abstract is found in the online version of the article. © 2016 American Association for Marriage and Family Therapy.
-
Couples coping with discordant HIV status.
Beckerman, Nancy L
2002-02-01
As we start the third decade of the human immunodeficiency virus/acquired immunodeficiency syndrome (HIV/AIDS) epidemic, how does HIV/AIDS affect the emotional lives of couples of mixed HIV status? This is a case report based on the findings of an exploratory research study of serodiscordant couples in the New York City area. It focuses on the issues confronting a particular couple who represent the salient issues in the lives of serodiscordant couples. This case report discusses the findings of a study that attempted to ascertain the central emotional challenges facing couples of mixed HIV status and discusses one case in particular that illustrates how these issues might commonly manifest themselves. Fear of HIV transmission, coping with uncertainty of potential illness, shifts in emotional intimacy, and dilemmas regarding how HIV has impacted reproductive alternatives were identified as the most commonly experienced emotional issues for the serodiscordant couple.
-
Circuit electromechanics with single photon strong coupling
Energy Technology Data Exchange (ETDEWEB)
Xue, Zheng-Yuan, E-mail: zyxue@scnu.edu.cn; Yang, Li-Na [Guangdong Provincial Key Laboratory of Quantum Engineering and Quantum Materials, and School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Zhou, Jian, E-mail: jianzhou8627@163.com [Department of Electronic Communication Engineering, Anhui Xinhua University, Hefei 230088 (China); Guangdong Provincial Key Laboratory of Quantum Engineering and Quantum Materials, and School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China)
2015-07-13
In circuit electromechanics, the coupling strength is usually very small. Here, replacing the capacitor in circuit electromechanics by a superconducting flux qubit, we show that the coupling among the qubit and the two resonators can induce effective electromechanical coupling which can attain the strong coupling regime at the single photon level with feasible experimental parameters. We use dispersive couplings among two resonators and the qubit while the qubit is also driven by an external classical field. These couplings form a three-wave mixing configuration among the three elements where the qubit degree of freedom can be adiabatically eliminated, and thus results in the enhanced coupling between the two resonators. Therefore, our work constitutes the first step towards studying quantum nonlinear effect in circuit electromechanics.
-
Techniques for heavy-ion coupled-channels calculations. I. Long-range Coulomb coupling
International Nuclear Information System (INIS)
Rhoades-Brown, M.; Macfarlane, M.H.; Pieper, S.C.
1980-01-01
Direct-reaction calculations for heavy ions require special computational techniques that take advantage of the physical peculiarities of heavy-ion systems. This paper is the first of a series on quantum-mechanical coupled-channels calculations for heavy ions. It deals with the problems posed by the long range of the Coulomb coupling interaction. Our approach is to use the Alder-Pauli factorization whereby the channel wave functions are expressed as products of Coulomb functions and modulating amplitudes. The equations for the modulating amplitudes are used to integrate inwards from infinity to a nuclear matching radius ( approx. = 20 fm). To adequate accuracy, the equations for the amplitudes can be reduced to first order and solved in first Born approximation. The use of the Born approximation leads to rapid recursion relations for the solutions of the Alder-Pauli equations and hence to a great reduction in computational labor. The resulting coupled-channels Coulomb functions can then be matched in the usual way to solutions of the coupled radial equations in the interior region of r space. Numerical studies demonstrate the reliability of the various techniques introduced
-
Non-minimally coupled tachyon and inflation
International Nuclear Information System (INIS)
Piao Yunsong; Huang Qingguo; Zhang Xinmin; Zhang Yuanzhong
2003-01-01
In this Letter, we consider a model of tachyon with a non-minimal coupling to gravity and study its cosmological effects. Regarding inflation, we show that only for a specific coupling of tachyon to gravity this model satisfies observations and solves various problems which exist in the single and multi tachyon inflation models. But noting in the string theory the coupling coefficient of tachyon to gravity is of order g s , which in general is very small, we can hardly expect that the non-minimally coupling of tachyon to gravity could provide a reasonable tachyon inflation scenario. Our work may be a meaningful try for the cosmological effect of tachyon non-minimally coupled to gravity
-
Screening of 18 species for digestate phytodepuration.
Pavan, Francesca; Breschigliaro, Simone; Borin, Maurizio
2015-02-01
This experiment assesses the aptitude of 18 species in treating the digestate liquid fraction (DLF) in a floating wetland treatment system. The pilot system was created in NE Italy in 2010 and consists of a surface-flow system with 180 floating elements (Tech-IA®) vegetated with ten halophytes and eight other wetland species. The species were transplanted in July 2011 in basins filled with different proportions of DLF/water (DLF/w); periodic increasing of the DLF/w ratio was imposed after transplanting, reaching the worst conditions for plants in summer 2012 (highest EC value 7.3 mS cm/L and NH4-N content 225 mg/L). It emerged that only Cynodon dactylon, Typha latifolia, Elytrigia atherica, Halimione portulacoides, Salicornia fruticosa, Artemisia caerulescens, Spartina maritima and Puccinellia palustris were able to survive under the system conditions. Halophytes showed higher dry matter production than other plants. The best root development (up to 40-cm depth) was recorded for Calamagrostis epigejos, Phragmites australis, T. latifolia and Juncus maritimus. The highest nitrogen (10-15 g/m(2)) and phosphorus (1-4 g/m(2)) uptakes were obtained with P. palustris, Iris pseudacorus and Aster tripolium. In conclusion, two halophytes, P. palustris and E. atherica, present the highest potential to be used to treat DLF in floating wetlands.
-
Synchronization of indirectly coupled Lorenz oscillators
Indian Academy of Sciences (India)
Synchronization of indirectly coupled Lorenz oscillators: An experimental study. Amit Sharma Manish Dev Shrimali. Synchronization, Coupled Systems and Networks Volume 77 Issue 5 November 2011 pp 881-889 ... The in-phase and anti-phase synchronization of indirectly coupled chaotic oscillators reported in Phys. Rev ...
-
Coupled-Beam and Coupled-Bunch Instabilities
Energy Technology Data Exchange (ETDEWEB)
Burov, Alexey [Fermilab
2016-06-23
A problem of coupled-beam instability is solved for two multibunch beams with slightly different revolution frequencies, as in the Fermilab Recycler Ring (RR). Sharing of the inter-bunch growth rates between the intra-bunch modes is described. The general analysis is applied to the RR; possibilities to stabilize the beams by means of chromaticity, feedback and Landau damping are considered.
-
DEFF Research Database (Denmark)
Jørgensen, Kasper Lüthje; Jakobsen, Kaj Bjarne
2016-01-01
A novel slot-coupled barbel antenna is designed and analyzed. A sensitivity analysis performed in order to improve the bandwidth, while the center frequency is kept constant.......A novel slot-coupled barbel antenna is designed and analyzed. A sensitivity analysis performed in order to improve the bandwidth, while the center frequency is kept constant....
-
ESPC Coupled Global Prediction System
2015-09-30
through an improvement to the sea ice albedo . Fig. 3: 2-m Temperature bias (deg C) of 120-h forecasts for the month of May 2014 for the Arctic...forecast system (NAVGEM) and ocean- sea ice forecast system (HYCOM/CICE) have never been coupled at high resolution. The coupled processes will be...winds and currents across the interface. The sea - ice component of this project requires modification of CICE versions 4 and 5 to run in the coupled
-
A micro-coupling for micro mechanical systems
Li, Wei; Zhou, Zhixiong; Zhang, Bi; Xiao, Yunya
2016-05-01
The error motions of micro mechanical systems, such as micro-spindles, increase with the increasing of the rotational speed, which not only decreases the rotational accuracy, but also promotes instability and limits the maximum operational speed. One effective way to deal with it is to use micro-flexible couplings between the drive and driven shafts so as to reduce error motions of the driven shaft. But the conventional couplings, such as diaphragm couplings, elastomeric couplings, bellows couplings, and grooved couplings, etc, cannot be directly used because of their large and complicated structures. This study presents a novel micro-coupling that consists of a flexible coupling and a shape memory alloy (SMA)-based clamp for micro mechanical systems. It is monolithic and can be directly machined from a shaft. The study performs design optimization and provides manufacturing considerations, including thermo-mechanical training of the SMA ring for the desired Two-Way-Shape-Memory effect (TWSMe). A prototype micro-coupling and a prototype micro-spindle using the proposed coupling are fabricated and tested. The testing results show that the prototype micro-coupling can bear a torque of above 5 N • mm and an axial force of 8.5 N and be fitted with an SMA ring for clamping action at room temperature (15 °C) and unclamping action below-5 °C. At the same time, the prototype micro-coupling can work at a rotational speed of above 200 kr/min with the application to a high-speed precision micro-spindle. Moreover, the radial runout error of the artifact, as a substitute for the micro-tool, is less than 3 μm while that of turbine shaft is above 7 μm. It can be concluded that the micro-coupling successfully accommodates misalignment errors of the prototype micro-spindle. This research proposes a micro-coupling which is featured with an SMA ring, and it is designed to clamp two shafts, and has smooth transmission, simple assembly, compact structure, zero-maintenance and
-
Ge, Li; Zhao, Nan
2018-04-01
We study the coherence dynamics of a qubit coupled to a harmonic oscillator with both linear and quadratic interactions. As long as the linear coupling strength is much smaller than the oscillator frequency, the long time behavior of the coherence is dominated by the quadratic coupling strength g 2. The coherence decays and revives at a period , with the width of coherence peak decreasing as the temperature increases, hence providing a way to measure g 2 precisely without cooling. Unlike the case of linear coupling, here the coherence dynamics never reduces to the classical limit in which the oscillator is classical. Finally, the validity of linear coupling approximation is discussed and the coherence under Hahn-echo is evaluated.
-
Perinatal outcomes among Asian-white interracial couples.
Nystrom, Michael J; Caughey, Aaron B; Lyell, Deirdre J; Druzin, Maurice L; El-Sayed, Yasser Y
2008-10-01
To investigate whether perinatal outcomes among interracial Asian-white couples are different than among Asian-Asian and white-white couples. This was a retrospective study of Asian, white, and Asian-white couples delivered at the Lucile Packard Children's Hospital from 2000-2005. Asian-white couples were subdivided into white-mother/Asian-father or Asian-mother/white-father. Perinatal outcomes included gestational diabetes, hypertensive disorders of pregnancy, preterm delivery, birth weight >4000 g and interracial Asian-white couples.
-
Emotional Awareness and Couples' Relationship Satisfaction
Croyle, Kristin L.; Waltz, Jennifer
2002-01-01
This study examined the role of emotional awareness in couples' relationships and the effects of a tendency to respond to difficult couples' situations with "soft" emotions (including sadness and fear) versus "hard" emotions (including anger and resentment). Participants were 56 heterosexual couples who completed a measure of relationship…
-
RF and microwave coupled-line circuits
Mongia, R K; Bhartia, P; Hong, J; Gupta, K C
2007-01-01
This extensively revised edition of the 1999 Artech House classic, RF and Microwave Coupled-Line Circuits, offers you a thoroughly up-to-date understanding of coupled line fundamentals, explaining their applications in designing microwave and millimeter-wave components used in today's communications, microwave, and radar systems. The Second Edition includes a wealth of new material, particularly relating to applications. You find brand new discussions on a novel simple design technique for multilayer coupled circuits, high pass filters using coupled lines, software packages used for filter des
-
Improving hydrogen production from cassava starch by combination of dark and photo fermentation
Energy Technology Data Exchange (ETDEWEB)
Su, Huibo; Cheng, Jun; Zhou, Junhu; Song, Wenlu; Cen, Kefa [State Key Laboratory of Clean Energy Utilization, Zhejiang University, Hangzhou 310027 (China)
2009-02-15
The combination of dark and photo fermentation was studied with cassava starch as the substrate to increase the hydrogen yield and alleviate the environmental pollution. The different raw cassava starch concentrations of 10-25 g/l give different hydrogen yields in the dark fermentation inoculated with the mixed hydrogen-producing bacteria derived from the preheated activated sludge. The maximum hydrogen yield (HY) of 240.4 ml H{sub 2}/g starch is obtained at the starch concentration of 10 g/l and the maximum hydrogen production rate (HPR) of 84.4 ml H{sub 2}/l/h is obtained at the starch concentration of 25 g/l. When the cassava starch, which is gelatinized by heating or hydrolyzed with {alpha}-amylase and glucoamylase, is used as the substrate to produce hydrogen, the maximum HY respectively increases to 258.5 and 276.1 ml H{sub 2}/g starch, and the maximum HPR respectively increases to 172 and 262.4 ml H{sub 2}/l/h. Meanwhile, the lag time ({lambda}) for hydrogen production decreases from 11 h to 8 h and 5 h respectively, and the fermentation duration decreases from 75-110 h to 44-68 h. The metabolite byproducts in the dark fermentation, which are mainly acetate and butyrate, are reused as the substrates in the photo fermentation inoculated with the Rhodopseudomonas palustris bacteria. The maximum HY and HPR are respectively 131.9 ml H{sub 2}/g starch and 16.4 ml H{sub 2}/l/h in the photo fermentation, and the highest utilization ratios of acetate and butyrate are respectively 89.3% and 98.5%. The maximum HY dramatically increases from 240.4 ml H{sub 2}/g starch only in the dark fermentation to 402.3 ml H{sub 2}/g starch in the combined dark and photo fermentation, while the energy conversion efficiency increases from 17.5-18.6% to 26.4-27.1% if only the heat value of cassava starch is considered as the input energy. When the input light energy in the photo fermentation is also taken into account, the whole energy conversion efficiency is 4.46-6.04%. (author)
-
Could photosynthesis function on Proxima Centauri b?
Ritchie, Raymond J.; Larkum, Anthony W. D.; Ribas, Ignasi
2018-04-01
Could oxygenic and/or anoxygenic photosynthesis exist on planet Proxima Centauri b? Proxima Centauri (spectral type - M5.5 V, 3050 K) is a red dwarf, whereas the Sun is type G2 V (5780 K). The light regimes on Earth and Proxima Centauri b are compared with estimates of the planet's suitability for Chlorophyll a (Chl a) and Chl d-based oxygenic photosynthesis and for bacteriochlorophyll (BChl)-based anoxygenic photosynthesis. Proxima Centauri b has low irradiance in the oxygenic photosynthesis range (400-749 nm: 64-132 µmol quanta m-2 s-1). Much larger amounts of light would be available for BChl-based anoxygenic photosynthesis (350-1100 nm: 724-1538 µmol quanta m-2 s-1). We estimated primary production under these light regimes. We used the oxygenic algae Synechocystis PCC6803, Prochlorothrix hollandica, Acaryochloris marina, Chlorella vulgaris, Rhodomonas sp. and Phaeodactylum tricornutum and the anoxygenic photosynthetic bacteria Rhodopseudomonas palustris (BChl a), Afifella marina (BChl a), Thermochromatium tepidum (BChl a), Chlorobaculum tepidum (BChl a + c) and Blastochloris viridis (BChl b) as representative photosynthetic organisms. Proxima Centauri b has only ~3% of the PAR (400-700 nm) of Earth irradiance, but we found that potential gross photosynthesis (P g) on Proxima Centauri b could be surprisingly high (oxygenic photosynthesis: earth ~0.8 gC m-2 h-1 Proxima Centauri b ~0.14 gC m-2 h-1). The proportion of PAR irradiance useable by oxygenic photosynthetic organisms (the sum of Blue + Red irradiance) is similar for the Earth and Proxima Centauri b. The oxygenic photic zone would be only ~10 m deep in water compared with ~200 m on Earth. The P g of an anoxic Earth (gC m-2 h-1) is ~0.34-0.59 (land) and could be as high as ~0.29-0.44 on Proxima Centauri b. 1 m of water does not affect oxygenic or anoxygenic photosynthesis on Earth, but on Proxima Centauri b oxygenic P g is reduced by ~50%. Effective elimination of near IR limits P g by photosynthetic
-
Energy Technology Data Exchange (ETDEWEB)
Jiao, Y. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Navid, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2014-12-19
Rising energy demands and the imperative to reduce carbon dioxide (CO2) emissions are driving research on biofuels development. Hydrogen gas (H2) is one of the most promising biofuels and is seen as a future energy carrier by virtue of the fact that 1) it is renewable, 2) does not evolve the “greenhouse gas” CO2 in combustion, 3) liberates large amounts of energy per unit weight in combustion (having about 3 times the energy content of gasoline), and 4) is easily converted to electricity by fuel cells. Among the various bioenergy strategies, environmental groups and others say that the concept of the direct manufacture of alternative fuels, such as H2, by photosynthetic organisms is the only biofuel alternative without significant negative criticism [1]. Biological H2 production by photosynthetic microorganisms requires the use of a simple solar reactor such as a transparent closed box, with low energy requirements, and is considered as an attractive system to develop as a biocatalyst for H2 production [2]. Various purple bacteria including Rhodopseudomonas palustris, can utilize organic substrates as electron donors to produce H2 at the expense of solar energy. Because of the elimination of energy cost used for H2O oxidation and the prevention of the production of O2 that inhibits the H2-producing enzymes, the efficiency of light energy conversion to H2 by anoxygenic photosynthetic bacteria is in principle much higher than that by green algae or cyanobacteria, and is regarded as one of the most promising cultures for biological H2 production [3]. Here implemented a simple and relatively straightforward strategy for hydrogen production by photosynthetic microorganisms using sunlight, sulfur- or iron-based inorganic substrates, and CO2 as the feedstock. Carefully selected microorganisms with bioengineered beneficial
-
Kuntze, Kevin; Shinoda, Yoshifumi; Moutakki, Housna; McInerney, Michael J; Vogt, Carsten; Richnow, Hans-Hermann; Boll, Matthias
2008-06-01
In anaerobic bacteria, most aromatic growth substrates are channelled into the benzoyl-coenzyme A (CoA) degradation pathway where the aromatic ring is dearomatized and cleaved into an aliphatic thiol ester. The initial step of this pathway is catalysed by dearomatizing benzoyl-CoA reductases yielding the two electron-reduction product, cyclohexa-1,5-diene-1-carbonyl-CoA, to which water is subsequently added by a hydratase. The next two steps have so far only been studied in facultative anaerobes and comprise the oxidation of the 6-hydroxyl-group to 6-oxocyclohex-1-ene-1-carbonyl-CoA (6-OCH-CoA), the addition of water and hydrolytic ring cleavage yielding 3-hydroxypimelyl-CoA. In this work, two benzoate-induced genes from the obligately anaerobic bacteria, Geobacter metallireducens (bamA(Geo)) and Syntrophus aciditrophicus (bamA(Syn)), were heterologously expressed in Escherichia coli, purified and characterized as 6-OCH-CoA hydrolases. Both enzymes consisted of a single 43 kDa subunit. Some properties of the enzymes are presented and compared with homologues from facultative anaerobes. An alignment of the nucleotide sequences of bamA(Geo) and bamA(Syn) with the corresponding genes from facultative anaerobes identified highly conserved DNA regions, which enabled the discrimination of genes coding for 6-OCH-CoA hydrolases from those coding for related enzymes. A degenerate oligonucleotide primer pair was deduced from conserved regions and applied in polymerase chain reaction reactions. Using these primers, the expected DNA fragment of the 6-OCH-CoA hydrolase genes was specifically amplified from the DNA of nearly all known facultative and obligate anaerobes that use aromatic growth substrates. The only exception was the aromatic compound-degrading Rhodopseudomonas palustris, which uniquely uses a modified benzoyl-CoA degradation pathway. Using the oligonucleotide primers, the expected DNA fragment was also amplified in a toluene-degrading and a m
-
Energy Technology Data Exchange (ETDEWEB)
Elnaggar, Sameh Y. [School of Engineering and Information Technology, University of New South Wales, Canberra (Australia); Tervo, Richard J. [Department of Electrical and Computer Engineering, University of New Brunswick, Fredericton, NB, E3B 5A3 Canada (Canada); Mattar, Saba M., E-mail: mattar@unb.ca [Chemistry Department, University of New Brunswick, Fredericton, NB, E3B 5A3 Canada (Canada)
2015-11-21
The theory and operation of various devices and systems, such as wireless power transfer via magnetic resonant coupling, magneto-inductive wave devices, magnetic resonance spectroscopy probes, and metamaterials can rely on coupled tuned resonators. The coupling strength is usually expressed in terms of the coupling coefficient κ, which can have electrical κ{sub E} and/or magnetic κ{sub M} components. In the current article, general expressions of κ are derived. The relation between the complex Poynting equation in its microscopic form and κ is made and discussed in detail. It is shown that κ can be expressed in terms of the interaction energy between the resonators' modes. It thus provides a general form that combines the magnetic and electric components of κ. The expressions make it possible to estimate the frequencies and fields of the coupled modes for arbitrarily oriented and spaced resonators. Thus, enabling the calculation of system specific parameters such as the transfer efficiency of wireless power transfer systems, resonator efficiency for electron spin resonance probes, and dispersion relations of magneto-inductive and stereo-metamaterials structures.
-
International Nuclear Information System (INIS)
Elnaggar, Sameh Y.; Tervo, Richard J.; Mattar, Saba M.
2015-01-01
The theory and operation of various devices and systems, such as wireless power transfer via magnetic resonant coupling, magneto-inductive wave devices, magnetic resonance spectroscopy probes, and metamaterials can rely on coupled tuned resonators. The coupling strength is usually expressed in terms of the coupling coefficient κ, which can have electrical κ E and/or magnetic κ M components. In the current article, general expressions of κ are derived. The relation between the complex Poynting equation in its microscopic form and κ is made and discussed in detail. It is shown that κ can be expressed in terms of the interaction energy between the resonators' modes. It thus provides a general form that combines the magnetic and electric components of κ. The expressions make it possible to estimate the frequencies and fields of the coupled modes for arbitrarily oriented and spaced resonators. Thus, enabling the calculation of system specific parameters such as the transfer efficiency of wireless power transfer systems, resonator efficiency for electron spin resonance probes, and dispersion relations of magneto-inductive and stereo-metamaterials structures
-
An analytic Pade-motivated QCD coupling
International Nuclear Information System (INIS)
Martinez, H. E.; Cvetic, G.
2010-01-01
We consider a modification of the Minimal Analytic (MA) coupling of Shirkov and Solovtsov. This modified MA (mMA) coupling reflects the desired analytic properties of the space-like observables. We show that an approximation by Dirac deltas of its discontinuity function ρ is equivalent to a Pade(rational) approximation of the mMA coupling that keeps its analytic structure. We propose a modification to mMA that, as preliminary results indicate, could be an improvement in the evaluation of low-energy observables compared with other analytic couplings.
-
Topology Optimisation for Coupled Convection Problems
DEFF Research Database (Denmark)
Alexandersen, Joe; Andreasen, Casper Schousboe; Aage, Niels
stabilised finite elements implemented in a parallel multiphysics analysis and optimisation framework DFEM [1], developed and maintained in house. Focus is put on control of the temperature field within the solid structure and the problems can therefore be seen as conjugate heat transfer problems, where heat...... conduction governs in the solid parts of the design domain and couples to convection-dominated heat transfer to a surrounding fluid. Both loosely coupled and tightly coupled problems are considered. The loosely coupled problems are convection-diffusion problems, based on an advective velocity field from...
-
Strong-coupling approximations
International Nuclear Information System (INIS)
Abbott, R.B.
1984-03-01
Standard path-integral techniques such as instanton calculations give good answers for weak-coupling problems, but become unreliable for strong-coupling. Here we consider a method of replacing the original potential by a suitably chosen harmonic oscillator potential. Physically this is motivated by the fact that potential barriers below the level of the ground-state energy of a quantum-mechanical system have little effect. Numerically, results are good, both for quantum-mechanical problems and for massive phi 4 field theory in 1 + 1 dimensions. 9 references, 6 figures
-
Energy Technology Data Exchange (ETDEWEB)
Chandra, J; Scott, A C
1983-01-01
Topics discussed include transitions in weakly coupled nonlinear oscillators, singularly perturbed delay-differential equations, and chaos in simple laser systems. Papers are presented on truncated Navier-Stokes equations in a two-dimensional torus, on frequency locking in Josephson point contacts, and on soliton excitations in Josephson tunnel junctions. Attention is also given to the nonlinear coupling of radiation pulses to absorbing anharmonic molecular media, to aspects of interrupted coarse-graining in stimulated excitation, and to a statistical analysis of long-term dynamic irregularity in an exactly soluble quantum mechanical model.
-
International Nuclear Information System (INIS)
Russell, G.J.; Pitcher, E.J.; Ferguson, P.D.
1995-01-01
Optimizing the neutronic performance of a coupled-moderator system for a Long-Pulse Spallation Source is a new and challenging area for the spallation target-system designer. For optimal performance of a neutron source, it is essential to have good communication with instrument scientists to obtain proper design criteria and continued interaction with mechanical, thermal-hydraulic, and materials engineers to attain a practical design. A good comprehension of the basics of coupled-moderator neutronics will aid in the proper design of a target system for a Long-Pulse Spallation Source
-
Similar Others in Same-Sex Couples' Social Networks.
LeBlanc, Allen J; Frost, David M; Alston-Stepnitz, Eli; Bauermeister, Jose; Stephenson, Rob; Woodyatt, Cory R; de Vries, Brian
2015-01-01
Same-sex couples experience unique minority stressors. It is known that strong social networks facilitate access to psychosocial resources that help people reduce and manage stress. However, little is known about the social networks of same-sex couples, in particular their connections to other same-sex couples, which is important to understand given that the presence of similar others in social networks can ameliorate social stress for stigmatized populations. In this brief report, we present data from a diverse sample of 120 same-sex couples in Atlanta and San Francisco. The median number of other same-sex couples known was 12; couples where one partner was non-Hispanic White and the other a person of color knew relatively few other same-sex couples; and there was a high degree of homophily within the social networks of same-sex couples. These data establish a useful starting point for future investigations of couples' social networks, especially couples whose relationships are stigmatized or marginalized in some way. Better understandings of the size, composition, and functions of same-sex couples' social networks are critically needed.
-
Reduction of coupling parameters and duality
International Nuclear Information System (INIS)
Oehme, R.; Max-Planck-Institut fuer Physik, Muenchen
2000-01-01
The general method of the reduction in the number of coupling parameters is discussed. Using renormalization group invariance, theories with several independent couplings are related to a set of theories with a single coupling parameter. The reduced theories may have particular symmetries, or they may not be related to any known symmetry. The method is more general than the imposition of invariance properties. Usually, there are only a few reduced theories with an asymptotic power series expansion corresponding to a renormalizable Lagrangian. There also exist 'general' solutions containing non-integer powers and sometimes logarithmic factors. As an example for the use of the reduction method, the dual magnetic theories associated with certain supersymmetric gauge theories are discussed. They have a superpotential with a Yukawa coupling parameter. This parameter is expressed as a function of the gauge coupling. Given some standard conditions, a unique, isolated power series solution of the reduction equations is obtained. After reparameterization, the Yukawa coupling is proportional to the square of the gauge coupling parameter. The coefficient is given explicitly in terms of the numbers of colors and flavors. 'General' solutions with non-integer powers are also discussed. A brief list is given of other applications of the reduction method. (orig.)
-
Biologically inspired coupled antenna beampattern design
Energy Technology Data Exchange (ETDEWEB)
Akcakaya, Murat; Nehorai, Arye, E-mail: makcak2@ese.wustl.ed, E-mail: nehorai@ese.wustl.ed [Department of Electrical and Systems Engineering, Washington University in St Louis, St Louis, MO 63130 (United States)
2010-12-15
We propose to design a small-size transmission-coupled antenna array, and corresponding radiation pattern, having high performance inspired by the female Ormia ochracea's coupled ears. For reproduction purposes, the female Ormia is able to locate male crickets' call accurately despite the small distance between its ears compared with the incoming wavelength. This phenomenon has been explained by the mechanical coupling between the Ormia's ears, which has been modeled by a pair of differential equations. In this paper, we first solve these differential equations governing the Ormia ochracea's ear response, and convert the response to the pre-specified radio frequencies. We then apply the converted response of the biological coupling in the array factor of a uniform linear array composed of finite-length dipole antennas, and also include the undesired electromagnetic coupling due to the proximity of the elements. Moreover, we propose an algorithm to optimally choose the biologically inspired coupling for maximum array performance. In our numerical examples, we compute the radiation intensity of the designed system for binomial and uniform ordinary end-fire arrays, and demonstrate the improvement in the half-power beamwidth, sidelobe suppression and directivity of the radiation pattern due to the biologically inspired coupling.
-
Uzawa smoother in multigrid for the coupleD porous medium and stokes flow system
P. Luo (Peiyao); C. Rodrigo (Carmen); F.J. Gaspar Lorenz (Franscisco); C.W. Oosterlee (Kees)
2017-01-01
textabstractThe multigrid solution of coupled porous media and Stokes flow problems is considered. The Darcy equation as the saturated porous medium model is coupled to the Stokes equations by means of appropriate interface conditions. We focus on an efficient multigrid solution technique for the
-
A tightly coupled non-equilibrium model for inductively coupled radio-frequency plasmas
International Nuclear Information System (INIS)
Munafò, A.; Alfuhaid, S. A.; Panesi, M.; Cambier, J.-L.
2015-01-01
The objective of the present work is the development of a tightly coupled magneto-hydrodynamic model for inductively coupled radio-frequency plasmas. Non Local Thermodynamic Equilibrium (NLTE) effects are described based on a hybrid State-to-State approach. A multi-temperature formulation is used to account for thermal non-equilibrium between translation of heavy-particles and vibration of molecules. Excited electronic states of atoms are instead treated as separate pseudo-species, allowing for non-Boltzmann distributions of their populations. Free-electrons are assumed Maxwellian at their own temperature. The governing equations for the electro-magnetic field and the gas properties (e.g., chemical composition and temperatures) are written as a coupled system of time-dependent conservation laws. Steady-state solutions are obtained by means of an implicit Finite Volume method. The results obtained in both LTE and NLTE conditions over a broad spectrum of operating conditions demonstrate the robustness of the proposed coupled numerical method. The analysis of chemical composition and temperature distributions along the torch radius shows that: (i) the use of the LTE assumption may lead to an inaccurate prediction of the thermo-chemical state of the gas, and (ii) non-equilibrium phenomena play a significant role close the walls, due to the combined effects of Ohmic heating and macroscopic gradients
-
International Nuclear Information System (INIS)
Deadrick, F.J.; Cabayan, H.S.; Kunz, K.F.; Bevensee, R.M.; Martin, L.C.; Egbert, R.W.
1980-01-01
Scale-model tests were conducted to establish the adequacy and limitations of model measurements as tools for predicting electromagnetic pulse (EMP) coupling voltages and currents to the critical antennas, cables, and metallic structures on ships. The scale-model predictions are compared with the results of the full-scale EMP simulation test of the Canadian ASW ship, HMCS Huron. (The EMP coupling predictions in this report were made without prior knowledge of the results of the data from the HMCS Huron tests.) This report establishes that the scale-model tests in conjunction with the data base from EMP coupling modules provides the necessary information for source model development and permits effective, low-cost study of particular system configurations. 184 figures, 9 tables
-
Coupled ears in lizards and crocodilians
DEFF Research Database (Denmark)
Carr, Catherine E; Christensen-Dalsgaard, Jakob; Bierman, Hilary
2016-01-01
Lizard ears are coupled across the pharynx, and are very directional. In consequence all auditory responses should be directional, without a requirement for computation of sound source location. Crocodilian ears are connected through sinuses, and thus less tightly coupled. Coupling may improve th...... range is reviewed in the light of current theories of sound localization....
-
Measuring Relative Coupling Strength in Circadian Systems.
Schmal, Christoph; Herzog, Erik D; Herzel, Hanspeter
2018-02-01
Modern imaging techniques allow the monitoring of circadian rhythms of single cells. Coupling between these single cellular circadian oscillators can generate coherent periodic signals on the tissue level that subsequently orchestrate physiological outputs. The strength of coupling in such systems of oscillators is often unclear. In particular, effects on coupling strength by varying cell densities, by knockouts, and by inhibitor applications are debated. In this study, we suggest to quantify the relative coupling strength via analyzing period, phase, and amplitude distributions in ensembles of individual circadian oscillators. Simulations of different oscillator networks show that period and phase distributions become narrower with increasing coupling strength. Moreover, amplitudes can increase due to resonance effects. Variances of periods and phases decay monotonically with coupling strength, and can serve therefore as measures of relative coupling strength. Our theoretical predictions are confirmed by studying recently published experimental data from PERIOD2 expression in slices of the suprachiasmatic nucleus during and after the application of tetrodotoxin (TTX). On analyzing the corresponding period, phase, and amplitude distributions, we can show that treatment with TTX can be associated with a reduced coupling strength in the system of coupled oscillators. Analysis of an oscillator network derived directly from the data confirms our conclusions. We suggest that our approach is also applicable to quantify coupling in fibroblast cultures and hepatocyte networks, and for social synchronization of circadian rhythmicity in rodents, flies, and bees.
-
Computation of expectation values from vibrational coupled-cluster at the two-mode coupling level
DEFF Research Database (Denmark)
Zoccante, Alberto; Seidler, Peter; Christiansen, Ove
2011-01-01
In this work we show how the vibrational coupled-cluster method at the two-mode coupling level can be used to calculate zero-point vibrational averages of properties. A technique is presented, where any expectation value can be calculated using a single set of Lagrangian multipliers computed...
-
Resonant coupling applied to superconducting accelerator structures
International Nuclear Information System (INIS)
Potter, James M.; Krawczyk, Frank L.
2013-01-01
The concept of resonant coupling and the benefits that accrue from its application is well known in the world of room temperature coupled cavity linacs. Design studies show that it can be applied successfully between sections of conventional elliptical superconducting coupled cavity accelerator structures and internally to structures with spoked cavity resonators. The coupling mechanisms can be designed without creating problems with high field regions or multipactoring. The application of resonant coupling to superconducting accelerators eliminates the need for complex cryogenic mechanical tuners and reduces the time needed to bring a superconducting accelerator into operation.
-
Dynamics of coupled phantom and tachyon fields
Energy Technology Data Exchange (ETDEWEB)
Shahalam, M. [Zhejiang University of Technology, Institute for Advanced Physics and Mathematics, Hangzhou (China); Pathak, S.D.; Li, Shiyuan [Shandong University, School of Physics, Jinan (China); Myrzakulov, R. [Eurasian National University, Department of General and Theoretical Physics, Eurasian International Center for Theoretical Physics, Astana (Kazakhstan); Wang, Anzhong [Zhejiang University of Technology, Institute for Advanced Physics and Mathematics, Hangzhou (China); Baylor University, Department of Physics, GCAP-CASPER, Waco, TX (United States)
2017-10-15
In this paper, we apply the dynamical analysis to a coupled phantom field with scaling potential taking particular forms of the coupling (linear and combination of linear), and present phase space analysis. We investigate if there exists a late time accelerated scaling attractor that has the ratio of dark energy and dark matter densities of the order one. We observe that the scrutinized couplings cannot alleviate the coincidence problem, however, they acquire stable late time accelerated solutions. We also discuss a coupled tachyon field with inverse square potential assuming linear coupling. (orig.)
-
Dynamics of coupled phantom and tachyon fields
International Nuclear Information System (INIS)
Shahalam, M.; Pathak, S.D.; Li, Shiyuan; Myrzakulov, R.; Wang, Anzhong
2017-01-01
In this paper, we apply the dynamical analysis to a coupled phantom field with scaling potential taking particular forms of the coupling (linear and combination of linear), and present phase space analysis. We investigate if there exists a late time accelerated scaling attractor that has the ratio of dark energy and dark matter densities of the order one. We observe that the scrutinized couplings cannot alleviate the coincidence problem, however, they acquire stable late time accelerated solutions. We also discuss a coupled tachyon field with inverse square potential assuming linear coupling. (orig.)
-
Matter couplings in supergravity theories
International Nuclear Information System (INIS)
Bagger, J.A.
1983-01-01
The N = 1 supersymmetric nonlinear sigma model is coupled to supergravity. The results are expressed in the language of Kahler geometry. Topological considerations constrain the scalar fields to lie on a Kahler manifold of restricted type, or a Hodge manifold. For topologically nontrivial manifolds, this leads to the quantization of Newton's constant in terms of the scalar self-coupling. The isometries of the N = 1 model are gauged. This gives a geometrical picture of what might be called the gauge invariant supersymmetric nonlinear sigma model. It also provides a new interpretation of the Fayet-Iliopoulos D-term. The gauge invariant supersymmetric nonlinear sigma model is coupled to N = 1 supergravity. This leads to a deeper understanding of the connections between supergravity, R-invariance and the Fayet-Iliopoulos D-term. It also provides a foundation for phenomenological studies of supergravity theories. Finally, the N = 2 supersymmetric nonlinear sigma model is coupled to supergravity. The scalar fields are found to lie on a negatively curved quaternionic manifold. This implies that matter self-couplings that are allowed in N = 2 supersymmetry are forbidden in N = 2 supergravity, and vice versa
-
Spatiotemporal complexity in coupled map lattices
International Nuclear Information System (INIS)
Kaneko, Kunihiko
1986-01-01
Some spatiotemporal patterns of couple map lattices are presented. The chaotic kink-like motions are shown for the phase motion of the coupled circle lattices. An extension of the couple map lattice approach to Hamiltonian dynamics is briefly reported. An attempt to characterize the high-dimensional attractor by the extension of the correlation dimension is discussed. (author)
-
Luft, Peter A [El Cerrito, CA
2009-05-12
A coupling for mechanically connecting modular tubular struts of a positioning apparatus or space frame, comprising a pair of toothed rings (10, 12) attached to separate strut members (16), the teeth (18, 20) of the primary rings (10, 12) mechanically interlocking in both an axial and circumferential manner, and a third part comprising a sliding, toothed collar (14) the teeth (22) of which interlock the teeth (18, 20) of the primary rings (10, 12), preventing them from disengaging, and completely locking the assembly together. A secondary mechanism provides a nesting force for the collar, and/or retains it. The coupling is self-contained and requires no external tools for installation, and can be assembled with gloved hands in demanding environments. No gauging or measured torque is required for assembly. The assembly can easily be visually inspected to determine a "go" or "no-go" status. The coupling is compact and relatively light-weight. Because of it's triply interlocking teeth, the connection is rigid. The connection does not primarily rely on clamps, springs or friction based fasteners, and is therefore reliable in fail-safe applications.
-
International Nuclear Information System (INIS)
Fayolle, D.
2002-01-01
In its second phase, LEP has allowed to study four fermion processes never observed before. Results are presented on the charged triple gauge boson couplings (TGC) from the W-pair, Single W and Single γ production. The anomalous quartic gauge couplings (QGC) are constrained using production of WWγ, νν-barγγ and Z γγ final states. Finally, limits on the neutral anomalous gauge couplings (NGC) using the Z γ and ZZ production processes are also reported. All results are consistent with the Standard Model expectations. (authors)
-
Chimera states: Effects of different coupling topologies
Bera, Bidesh K.; Majhi, Soumen; Ghosh, Dibakar; Perc, Matjaž
2017-04-01
Collective behavior among coupled dynamical units can emerge in various forms as a result of different coupling topologies as well as different types of coupling functions. Chimera states have recently received ample attention as a fascinating manifestation of collective behavior, in particular describing a symmetry breaking spatiotemporal pattern where synchronized and desynchronized states coexist in a network of coupled oscillators. In this perspective, we review the emergence of different chimera states, focusing on the effects of different coupling topologies that describe the interaction network connecting the oscillators. We cover chimera states that emerge in local, nonlocal and global coupling topologies, as well as in modular, temporal and multilayer networks. We also provide an outline of challenges and directions for future research.
-
Dijkstra, H.A.; Neelin, J.D.
1998-01-01
Coupled processes between the equatorial ocean and atmosphere control the spatial structure of the annual mean state in the Pacific region,in particular the warm-pool/cold- tongue structure.At the same time,coupled processes are known to be responsible for the variability about this mean state,in
-
Strong Coupling Corrections in Quantum Thermodynamics
Perarnau-Llobet, M.; Wilming, H.; Riera, A.; Gallego, R.; Eisert, J.
2018-03-01
Quantum systems strongly coupled to many-body systems equilibrate to the reduced state of a global thermal state, deviating from the local thermal state of the system as it occurs in the weak-coupling limit. Taking this insight as a starting point, we study the thermodynamics of systems strongly coupled to thermal baths. First, we provide strong-coupling corrections to the second law applicable to general systems in three of its different readings: As a statement of maximal extractable work, on heat dissipation, and bound to the Carnot efficiency. These corrections become relevant for small quantum systems and vanish in first order in the interaction strength. We then move to the question of power of heat engines, obtaining a bound on the power enhancement due to strong coupling. Our results are exemplified on the paradigmatic non-Markovian quantum Brownian motion.
-
Coupling between minimum scattering antennas
DEFF Research Database (Denmark)
Andersen, J.; Lessow, H; Schjær-Jacobsen, Hans
1974-01-01
Coupling between minimum scattering antennas (MSA's) is investigated by the coupling theory developed by Wasylkiwskyj and Kahn. Only rotationally symmetric power patterns are considered, and graphs of relative mutual impedance are presented as a function of distance and pattern parameters. Crossed...
-
Linear analysis of coupled lattices
Directory of Open Access Journals (Sweden)
D. Sagan
1999-07-01
Full Text Available A formalism for describing the coupled two-dimensional motion of high energy particle beams in a storage ring is developed and extended to circumstances where the coupling is very strong, such as for the Möbius twist accelerator.
-
Trilateral market coupling. Algorithm appendix
International Nuclear Information System (INIS)
2006-03-01
Market Coupling is both a mechanism for matching orders on the exchange and an implicit cross-border capacity allocation mechanism. Market Coupling improves the economic surplus of the coupled markets: the highest purchase orders and the lowest sale orders of the coupled power exchanges are matched, regardless of the area where they have been submitted; matching results depend however on the Available Transfer Capacity (ATC) between the coupled hubs. Market prices and schedules of the day-ahead power exchanges of the several connected markets are simultaneously determined with the use of the Available Transfer Capacity defined by the relevant Transmission System Operators. The transmission capacity is thereby implicitly auctioned and the implicit cost of the transmission capacity from one market to the other is the price difference between the two markets. In particular, if the transmission capacity between two markets is not fully used, there is no price difference between the markets and the implicit cost of the transmission capacity is null. Market coupling relies on the principle that the market with the lowest price exports electricity to the market with the highest price. Two situations may appear: either the Available Transfer Capacity (ATC) is large enough and the prices of both markets are equalized (price convergence), or the ATC is too small and the prices cannot be equalized. The Market Coupling algorithm takes as an input: 1 - The Available Transfer Capacity (ATC) between each area for each flow direction and each Settlement Period of the following day (i.e. for each hour of following day); 2 - The (Block Free) Net Export Curves (NEC) of each market for each hour of the following day, i.e., the difference between the total quantity of Divisible Hourly Bids and the total quantity of Divisible Hourly Offers for each price level. The NEC reflects a market's import or export volume sensitivity to price. 3 - The Block Orders submitted by the participants in
-
Trilateral market coupling. Algorithm appendix
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-03-15
Market Coupling is both a mechanism for matching orders on the exchange and an implicit cross-border capacity allocation mechanism. Market Coupling improves the economic surplus of the coupled markets: the highest purchase orders and the lowest sale orders of the coupled power exchanges are matched, regardless of the area where they have been submitted; matching results depend however on the Available Transfer Capacity (ATC) between the coupled hubs. Market prices and schedules of the day-ahead power exchanges of the several connected markets are simultaneously determined with the use of the Available Transfer Capacity defined by the relevant Transmission System Operators. The transmission capacity is thereby implicitly auctioned and the implicit cost of the transmission capacity from one market to the other is the price difference between the two markets. In particular, if the transmission capacity between two markets is not fully used, there is no price difference between the markets and the implicit cost of the transmission capacity is null. Market coupling relies on the principle that the market with the lowest price exports electricity to the market with the highest price. Two situations may appear: either the Available Transfer Capacity (ATC) is large enough and the prices of both markets are equalized (price convergence), or the ATC is too small and the prices cannot be equalized. The Market Coupling algorithm takes as an input: 1 - The Available Transfer Capacity (ATC) between each area for each flow direction and each Settlement Period of the following day (i.e. for each hour of following day); 2 - The (Block Free) Net Export Curves (NEC) of each market for each hour of the following day, i.e., the difference between the total quantity of Divisible Hourly Bids and the total quantity of Divisible Hourly Offers for each price level. The NEC reflects a market's import or export volume sensitivity to price. 3 - The Block Orders submitted by the
-
Dynamics of unidirectionally coupled bistable Henon maps
International Nuclear Information System (INIS)
Sausedo-Solorio, J.M.; Pisarchik, A.N.
2011-01-01
We study dynamics of two bistable Henon maps coupled in a master-slave configuration. In the case of coexistence of two periodic orbits, the slave map evolves into the master map state after transients, which duration determines synchronization time and obeys a -1/2 power law with respect to the coupling strength. This scaling law is almost independent of the map parameter. In the case of coexistence of chaotic and periodic attractors, very complex dynamics is observed, including the emergence of new attractors as the coupling strength is increased. The attractor of the master map always exists in the slave map independently of the coupling strength. For a high coupling strength, complete synchronization can be achieved only for the attractor similar to that of the master map. -- Highlights: → We study dynamics of two bistable Henon maps coupled in a master-slave configuration. → Synchronization time for periodic orbits obeys a -1/2 power law with respect to coupling. → For a high coupling strength, the slave map remains bistable. → Complete synchronization can be achieved only when both maps stay at the same attractor.
-
APROS couplings from core to containment
International Nuclear Information System (INIS)
Puska, E.K.; Ylijoki, J.
2005-01-01
APROS simulation environment is able to describe the 1-D and 3-D neutronics of the reactor core. It is also able to describe the thermal hydraulics of the core and circuits either with 5- equation or 6-equation thermal hydraulics. It can also describe the plant automation and electrical systems, as well as the behaviour of the containment. The peculiar feature of APROS in comparison to other coupled systems is that all parts in the coupled system are described with the same code instead of coupling two or three separate codes together with information exchange between the separate codes. The most recent possibility is the coupled calculation of the process and the containment. The more traditional coupling, the coupling of the process containing both the process description and the automation description with more or less detailed description of the 3-D core either for safety analysis or real-time simulation purposes has been discussed in previous work. The paper presents and discusses the capabilities of the code in coupling the plant process and automation description with the plant containment description with two example transient cases. An improved boron concentration solution with second order upwind discretization has been recently included in APROS. An example on the increased accuracy acquired in the 3-D core model has been included. (authors)
-
Cluster synchronization in community network with hybrid coupling
International Nuclear Information System (INIS)
Yang, Lixin; Jiang, Jun; Liu, Xiaojun
2016-01-01
Highlights: • A community network model with hybrid coupling is proposed. • Control scheme is designed via combining adaptive external coupling strength and feedback control. • The influence of topology structure on synchronization of community network is discussed. - Abstract: A general model of community network with hybrid coupling is proposed in this paper. In the community network model with hybrid coupling, the inner connections are in the same type of coupling within the same community and in different types of coupling in different communities. The connections between different pair of communities are also nonidentical. Cluster synchronization of community network with hybrid coupling is investigated via adaptive couplings control scheme. Effective controllers are designed for constructing an effective control scheme and adjusting automatically the adaptive external coupling strength by taking external coupling strength as adaptive variables on a small fraction of network edges. Moreover, the impact of the topology on the synchronizability of community network is investigated. The numerical results reveal that the number of links between communities and the degree of the connector nodes have significant effects on the synchronization performance.
-
Coupling Integrable Couplings of an Equation Hierarchy
International Nuclear Information System (INIS)
Wang Hui; Xia Tie-Cheng
2013-01-01
Based on a kind of Lie algebra G proposed by Zhang, one isospectral problem is designed. Under the framework of zero curvature equation, a new kind of integrable coupling of an equation hierarchy is generated using the methods proposed by Ma and Gao. With the help of variational identity, we get the Hamiltonian structure of the hierarchy. (general)
-
Directory of Open Access Journals (Sweden)
Xinwei Wang
2017-01-01
Full Text Available Topology detection for output-coupling weighted complex dynamical networks with two types of time delays is investigated in this paper. Different from existing literatures, coupling delay and transmission delay are simultaneously taken into account in the output-coupling network. Based on the idea of the state observer, we build the drive-response system and apply LaSalle’s invariance principle to the error dynamical system of the drive-response system. Several convergent criteria are deduced in the form of algebraic inequalities. Some numerical simulations for the complex dynamical network, with node dynamics being chaotic, are given to verify the effectiveness of the proposed scheme.
-
Quantum field theories coupled to supergravity. AdS/CFT and local couplings
International Nuclear Information System (INIS)
Grosse, J.
2006-01-01
This dissertation is devoted to the investigation of the interplay of supersymmetric Yang-Mills theories (SYM) and supergravity (SUGRA). The topic is studied from two points of view: Firstly from the point of view of AdS/CFT correspondence, which realises the coupling of four dimensional superconformal N=4 SYM theory and ten dimensional type IIB SUGRA in a holographic way. In order to arrive at theories that resemble quantum chromodynamics (QCD) more closely, fundamental fields are introduced using probe D7-branes and nontrivial background configuration are considered. In particular supergravity solutions that are only asymptotically anti-de Sitter and break supersymmetry are used. This allows the description of spontaneous chiral symmetry breaking. The meson spectrum is calculated and the existence of an associated Goldstone mode is demonstrated. Moreover it is shown that highly radially excited mesons are not degenerate. Additionally instanton configurations on the D7-branes are investigated, which lead to a holographic description of the dual field theory's Higgs branch. Finally a holographic description of heavy-light mesons is developed, which are mesons consisting of quarks with a large mass difference, such that a treatment of B mesons can be achieved. The second approach to the topic of this thesis is the technique of socalled space-time dependent couplings (also known as ''local couplings''), where coupling constants are promoted to external sources. This allows to explore the conformal anomaly of quantum field theories coupled to a classical gravity background. The technique is extended to the superfield description of N=1 supergravity, a complete basis for the anomaly is given and the consistency conditions that arise from a cohomological treatment are calculated. Possible implications for an extension of Zamolodchikov's c-theorem to four dimensional supersymmetric quantum field theories are discussed. (orig.)
-
Quantum field theories coupled to supergravity. AdS/CFT and local couplings
Energy Technology Data Exchange (ETDEWEB)
Grosse, J.
2006-08-03
This dissertation is devoted to the investigation of the interplay of supersymmetric Yang-Mills theories (SYM) and supergravity (SUGRA). The topic is studied from two points of view: Firstly from the point of view of AdS/CFT correspondence, which realises the coupling of four dimensional superconformal N=4 SYM theory and ten dimensional type IIB SUGRA in a holographic way. In order to arrive at theories that resemble quantum chromodynamics (QCD) more closely, fundamental fields are introduced using probe D7-branes and nontrivial background configuration are considered. In particular supergravity solutions that are only asymptotically anti-de Sitter and break supersymmetry are used. This allows the description of spontaneous chiral symmetry breaking. The meson spectrum is calculated and the existence of an associated Goldstone mode is demonstrated. Moreover it is shown that highly radially excited mesons are not degenerate. Additionally instanton configurations on the D7-branes are investigated, which lead to a holographic description of the dual field theory's Higgs branch. Finally a holographic description of heavy-light mesons is developed, which are mesons consisting of quarks with a large mass difference, such that a treatment of B mesons can be achieved. The second approach to the topic of this thesis is the technique of socalled space-time dependent couplings (also known as ''local couplings''), where coupling constants are promoted to external sources. This allows to explore the conformal anomaly of quantum field theories coupled to a classical gravity background. The technique is extended to the superfield description of N=1 supergravity, a complete basis for the anomaly is given and the consistency conditions that arise from a cohomological treatment are calculated. Possible implications for an extension of Zamolodchikov's c-theorem to four dimensional supersymmetric quantum field theories are discussed. (orig.)
-
Magnetosphere - Ionosphere - Thermosphere (MIT) Coupling at Jupiter
Yates, J. N.; Ray, L. C.; Achilleos, N.
2017-12-01
Jupiter's upper atmospheric temperature is considerably higher than that predicted by Solar Extreme Ultraviolet (EUV) heating alone. Simulations incorporating magnetosphere-ionosphere coupling effects into general circulation models have, to date, struggled to reproduce the observed atmospheric temperatures under simplifying assumptions such as azimuthal symmetry and a spin-aligned dipole magnetic field. Here we present the development of a full three-dimensional thermosphere model coupled in both hemispheres to an axisymmetric magnetosphere model. This new coupled model is based on the two-dimensional MIT model presented in Yates et al., 2014. This coupled model is a critical step towards to the development of a fully coupled 3D MIT model. We discuss and compare the resulting thermospheric flows, energy balance and MI coupling currents to those presented in previous 2D MIT models.
-
Surrogate versus couple therapy in vaginismus.
Ben-Zion, Itzhak; Rothschild, Shelly; Chudakov, Bella; Aloni, Ronit
2007-05-01
Women who do not have a cooperative partner cannot complete the usual therapeutic process in the treatment of vaginismus, because they cannot progress to the stage of practicing the insertion of the man partner's fingers and the insertion of a penis. To compare traditional couple therapy with therapy utilizing a surrogate partner. The study was controlled and retrospective. Data were obtained from the treatment charts of patients who had come to the clinic for treatment of vaginismus. Sixteen vaginismus patients who were treated with a man surrogate partner were compared with 16 vaginismus patients who were treated with their own partners. Successful pain-free intercourse upon completion of therapy. One hundred percent of the surrogate patients succeeded in penile-vaginal intercourse compared with 75% in the couples group (P = 0.1). All surrogate patients ended the therapy because it was fully successful, compared with 69% in the couples group. Twelve percent of the couples group ended the therapy because it failed, and 19% because the couples decided to separate. Treating vaginismus with a man surrogate partner was at least as effective as couple therapy. Surrogate therapy may be considered for vaginismus patients who have no cooperative partner.
-
Linearized holographic isotropization at finite coupling
Energy Technology Data Exchange (ETDEWEB)
Atashi, Mahdi; Fadafan, Kazem Bitaghsir [Shahrood University of Technology, Physics Department (Iran, Islamic Republic of); Jafari, Ghadir [Institute for Research in Fundamental Sciences (IPM), School of Physics, Tehran (Iran, Islamic Republic of)
2017-06-15
We study holographic isotropization of an anisotropic homogeneous non-Abelian strongly coupled plasma in the presence of Gauss-Bonnet corrections. It was verified before that one can linearize Einstein's equations around the final black hole background and simplify the complicated setup. Using this approach, we study the expectation value of the boundary stress tensor. Although we consider small values of the Gauss-Bonnet coupling constant, it is found that finite coupling leads to significant increasing of the thermalization time. By including higher order corrections in linearization, we extend the results to study the effect of the Gauss-Bonnet coupling on the entropy production on the event horizon. (orig.)
-
International Nuclear Information System (INIS)
Singh, S.P.; Asthana, R.K.; Singh, A.P.
2006-01-01
Semi-solid state fermentation route of hydrogen production from agro-waste sugar cane bagasse was tried using the photosynthetic bacterium Rhodopseudomonas (BHU strain-1) and the non-photosynthetic Enterobacter aerogenes MTCC2822. The process seems an alternative to submerged fermentation that requires high volumes of nutrient broth. Bagasse (10 g) pre-hydrolyzed with NaOH (2%, w/v) was coated with Ca-alginate (1.5%, v/v) containing Rhodopseudomonas and E. aerogenes in the co-immobilized state (300 μg bacterial biomass ml -1 ). The fermenting medium was just 150 ml to sustain the moistened bagasse in a 0.5 L fermenter kept in light. A parallel set of free bacterial cells served as control. Hydrogen production by the immobilized sets reached 30 L within 60 h with the average rate of 0.177 L H 2 h -1 . For free cells, the values for hydrogen output (20 L) or the rate 0.1125 L H 2 h -1 were approximately 1.5-fold low. It is proposed that semi-solid fermentation route of hydrogen production from bagasse will be a cost-effective technology in countries generating this agro-waste. (authors)
-
Energy Technology Data Exchange (ETDEWEB)
Singh, S.P.; Asthana, R.K.; Singh, A.P. [Centre of Advanced Study in Botany, Banaras Hindu University, Varanasi-221005, (India)
2006-07-01
Semi-solid state fermentation route of hydrogen production from agro-waste sugar cane bagasse was tried using the photosynthetic bacterium Rhodopseudomonas (BHU strain-1) and the non-photosynthetic Enterobacter aerogenes MTCC2822. The process seems an alternative to submerged fermentation that requires high volumes of nutrient broth. Bagasse (10 g) pre-hydrolyzed with NaOH (2%, w/v) was coated with Ca-alginate (1.5%, v/v) containing Rhodopseudomonas and E. aerogenes in the co-immobilized state (300 {mu}g bacterial biomass ml{sup -1}). The fermenting medium was just 150 ml to sustain the moistened bagasse in a 0.5 L fermenter kept in light. A parallel set of free bacterial cells served as control. Hydrogen production by the immobilized sets reached 30 L within 60 h with the average rate of 0.177 L H{sub 2} h{sup -1}. For free cells, the values for hydrogen output (20 L) or the rate 0.1125 L H{sub 2} h{sup -1} were approximately 1.5-fold low. It is proposed that semi-solid fermentation route of hydrogen production from bagasse will be a cost-effective technology in countries generating this agro-waste. (authors)
-
Older Couple Relationships and Loneliness
de Jong Gierveld, J.; Broese van Groenou, M.; Bookwala, Jamila
2016-01-01
The couple relationship is a major factor in alleviating loneliness. Midlife and older adults without a couple relationship, especially after widowhood or divorce, are at serious risk of loneliness. Outcomes of empirical research, both dating back to the former century (Lopata, 1980, 1996), as well
-
On couplings to matter in massive (bi-)gravity
International Nuclear Information System (INIS)
Rham, Claudia de; Ribeiro, Raquel H; Heisenberg, Lavinia
2015-01-01
We investigate the coupling to matter in ghost-free massive (bi-)gravity. When species in the matter sector couple covariantly to only one metric, we show that at one-loop these couplings do not spoil the special structure of the graviton potential. When the same species couples directly to both metrics we show that a ghost is present at the classical level and that loops destroy the special structure of the potential at an unacceptably low scale. We then propose a new ‘composite’ effective metric built out of both metrics. When matter fields couple covariantly to this effective metric, the would be Boulware–Deser (BD) ghost is absent in different representative limits. At one-loop such couplings do not detune the special structure of the potential. We conjecture that matter can couple covariantly to that effective metric in all generality without introducing any BD ghost below a cut-off scale parametrically larger than the strong coupling scale. We also discuss alternative couplings to matter where the kinetic and potential terms of the matter field couple to different metrics. In both cases we discuss preliminary implications for cosmology. (paper)
-
Systemic couple therapy for dysthymia.
Montesano, Adrián; Feixas, Guillem; Muñoz, Dámaris; Compañ, Victoria
2014-03-01
We examined the effect of Systemic Couple Therapy on a patient diagnosed with dysthymic disorder and her partner. Marge and Peter, a middle-aged married couple, showed significant and meaningful changes in their pattern of interaction over the course of the therapy and, by the end of it, Marge no longer met the diagnostic criteria for dysthymic disorder. Her scores on the Structured Clinical Interview for DSM-IV Axis I Disorders (SCID-I) and Beck Depression Inventory, Second Edition (BDI-II) were in the clinical range before treatment and in the nonclinical one at the end of therapy. Although scores on Dyadic Adjustment Scale showed different patterns, both members reported significant improvement. The analysis of change in the alliance-related behaviors throughout the process concurred with change in couple's pattern of interaction. Treatment effects were maintained at 12-month follow-up. Highlights in the therapy process showed the importance of relational mechanisms of change, such as broadening the therapeutic focus into the couple's pattern of interaction, reducing expressed emotion and resentment, as well as increasing positive exchanges. The results of this evidence-based case study should prompt further investigation of couple therapy for dysthymia disorder. Randomized clinical trial design is needed to reach an evidence-based treatment status. (c) 2014 APA, all rights reserved.
-
Communication and Contraceptive Practices in Adolescent Couples.
Polit-O'Hara, Denise; Kahn, Janet R.
1985-01-01
Presents a descriptive analysis of couple communication among stable, sexually active adolescent couples (N=83) and the effect of communication on actual contraceptive practices. Results showed couples with good communication were more likely to practice effective contraception. (BH)
-
Couple-level Minority Stress: An Examination of Same-sex Couples' Unique Experiences.
Frost, David M; LeBlanc, Allen J; de Vries, Brian; Alston-Stepnitz, Eli; Stephenson, Rob; Woodyatt, Cory
2017-12-01
Social stress resulting from stigma, prejudice, and discrimination-"minority stress"-negatively impacts sexual minority individuals' health and relational well-being. The present study examined how being in a same-sex couple can result in exposure to unique minority stressors not accounted for at the individual level. Relationship timeline interviews were conducted with 120 same-sex couples equally distributed across two study sites (Atlanta and San Francisco), gender (male and female), and relationship duration (at least six months but less than three years, at least three years but less than seven years, and seven or more years). Directed content analyses identified 17 unique couple-level minority stressors experienced within nine distinct social contexts. Analyses also revealed experiences of dyadic minority stress processes (stress discrepancies and stress contagion). These findings can be useful in future efforts to better understand and address the cumulative impact of minority stress on relational well-being and individual health.
-
Spatial coupling in heterogeneous catalysis
Yamamoto, S. Y.; Surko, C. M.; Maple, M. B.
1995-11-01
Spatial coupling mechanisms are studied in the heterogeneous catalytic oxidation of carbon monoxide over platinum at atmospheric pressure under oscillatory conditions. Experiments are conducted in a continuous flow reactor, and the reaction rate is monitored using both infrared imaging and thermocouples. The catalysts are in the form of platinum annular thin films on washer-shaped quartz substrates, and they provide highly repeatable oscillatory behavior. Oscillations are typically spatially synchronized with the entire catalyst ``flashing'' on and off uniformly. Spatial coupling is investigated by introducing various barriers which split the annular ring in half. Infrared images show that coupling through the gas phase dominates coupling via the diffusion of CO on the surface or heat diffusion through the substrate. The introduction of a localized heat perturbation to the catalyst surface does not induce a transition in the reaction rate. Thus, it is likely that the primary mode of communication is through the gas-phase diffusion of reactants.
-
The two-qubit quantum Rabi model: inhomogeneous coupling
International Nuclear Information System (INIS)
Mao, Lijun; Huai, Sainan; Zhang, Yunbo
2015-01-01
We revisit the analytic solution of the two-qubit quantum Rabi model with inhomogeneous coupling and transition frequencies using a displaced oscillator basis. This approach enables us to apply the same truncation rules and techniques adopted in the Rabi model to the two qubits system. The derived analytical spectra match perfectly with the numerical solutions in the parameter regime where the qubits’ transition frequencies are far off-resonance with the field frequency and the interaction strengths reach the ultrastrong coupling regime. We further explore the dynamical behavior of the two qubits as well as the evolution of entanglement. The analytical methods provide unexpectedly accurate results in describing the dynamics of the two qubits in the present experimentally accessible coupling regime. The time evolutions of the probability for the qubits show that the collapse-revival phenomena emerge, survive and finally disappear when one coupling strength increases from weak to strong coupling regimes and the other coupling strength is well into the ultrastrong coupling regime. The inhomogeneous coupling system exhibits new dynamics, which are different from the homogeneous coupling case. (paper)
-
Couples with dementia: Positioning the 'we'.
Hydén, Lars-Christer; Nilsson, Elin
2015-11-01
The aim of this article is to investigate how spouses in couples with dementia position themselves in relation to each other by analysing their use of pronouns, especially the we. The study uses joint interviews with 11 couples. Based on a quantitative analysis of pronoun use, it is argued that the pronoun we is used by all the spouses; however, it is used less frequently by the spouses with dementia in comparison with healthy spouses. A qualitative analysis of the use of the pronoun we shows that the spouses position, experience and consider themselves as a couple and that they position and experience themselves as individuals in relation to the couple. One of the challenges for couples with dementia is to be able to retain a we in face of the progression of the dementia disease. By positioning themselves in various ways, the spouses establish and negotiate quite a complex and emotionally charged web of relationships. © The Author(s) 2013.
-
Updated Global Analysis of Higgs Couplings
Ellis, John
2013-01-01
There are many indirect and direct experimental indications that the new particle H discovered by the ATLAS and CMS Collaborations has spin zero and (mostly) positive parity, and that its couplings to other particles are correlated with their masses. Beyond any reasonable doubt, it is a Higgs boson, and here we examine the extent to which its couplings resemble those of the single Higgs boson of the Standard Model. Our global analysis of its couplings to fermions and massive bosons determines that they have the same relative sign as in the Standard Model. We also show directly that these couplings are highly consistent with a dependence on particle masses that is linear to within a few %, and scaled by the conventional electroweak symmetry-breaking scale to within 10%. We also give constraints on loop-induced couplings, on the total Higgs decay width, and on possible invisible decays of the Higgs boson under various assumptions.
-
Qubit absorption refrigerator at strong coupling
Mu, Anqi; Agarwalla, Bijay Kumar; Schaller, Gernot; Segal, Dvira
2017-12-01
We demonstrate that a quantum absorption refrigerator (QAR) can be realized from the smallest quantum system, a qubit, by coupling it in a non-additive (strong) manner to three heat baths. This function is un-attainable for the qubit model under the weak system-bath coupling limit, when the dissipation is additive. In an optimal design, the reservoirs are engineered and characterized by a single frequency component. We then obtain closed expressions for the cooling window and refrigeration efficiency, as well as bounds for the maximal cooling efficiency and the efficiency at maximal power. Our results agree with macroscopic designs and with three-level models for QARs, which are based on the weak system-bath coupling assumption. Beyond the optimal limit, we show with analytical calculations and numerical simulations that the cooling efficiency varies in a non-universal manner with model parameters. Our work demonstrates that strongly-coupled quantum machines can exhibit function that is un-attainable under the weak system-bath coupling assumption.
-
International Nuclear Information System (INIS)
Ravenal, E.C.
1988-01-01
This paper reports on the prospects of coupling and decoupling for extended deterrence. Thirty-eight years after the foundation of NATO, the defence of Western Europe still rests on the proposition that an American president will invite the destruction of US cities and the incineration of 100 million of its citizens to repel a Soviet incursion or resist a Soviet ultimatum in Western Europe. On its face, America's war plan---never denied by any president from Truman to Reagan, or by any Secretary of State from George Marshall to George Shultz---is the first use of nuclear weapons, if necessary, to defend Europe. Thus America threatens to turn local defeat into global holocaust. But under the surface, America's nuclear commitment to Europe is not so sure. The word that encapsulates this problem is coupling. Not the title of an Updike novel or an anthropological treatise by Margaret Mead, coupling is a term of art used by strategic analysts to connote the integrity of the chain of escalation, from conventional war in Europe, to theatre nuclear weapons, to the final use of America's ultimate strategic weapon
-
Axial forces in centrifugal compressor couplings
Ivanov, A. N.; Ivanov, N. M.; Yun, V. K.
2017-08-01
The article presents the results of the theoretical and experimental investigation of axial forces arising in the toothed and plate couplings of centrifugal compressor shaft lines. Additional loads on the thrust bearing are considered that can develop in the toothed couplings as a result of coupled rotors misalignment. Design relationships to evaluate the level of axial forces and recommendations for their reduction in the operating conditions are given.
-
International Nuclear Information System (INIS)
Topin, S.; Baglan, N.; Aupiais, J.
2009-01-01
Full text: Aiming to investigate plutonium speciation at trace levels, we coupled capillary electrophoresis, a high resolution separation technique with inductively coupled plasma mass spectrometry, a detector with high sensitivity for plutonium. The research work performed to optimize the coupling is discussed based on the following criteria: the migration time, the resolution and the detection limit. The capabilities of the analytical tool are demonstrated by determining thermodynamic constants for pentavalent plutonium, and neptunium as a reference, in the presence of inorganic ligands. (author)
-
Plasmonic solutions for coupling and modulation
DEFF Research Database (Denmark)
Andryieuski, Andrei; Babicheva, Viktoriia; Malureanu, Radu
We present our design results for efficient coupling and modulation in plasmonic structures. Fiber coupling to a plasmonic slot waveguide is significantly increased by a metallic nanoantenna with additional reflectors or by the configuration of several connected antennas. We also show that the pl......We present our design results for efficient coupling and modulation in plasmonic structures. Fiber coupling to a plasmonic slot waveguide is significantly increased by a metallic nanoantenna with additional reflectors or by the configuration of several connected antennas. We also show...... that the plasmonic four-layer waveguide with patterned ITO layer can modulate light with higher transmission and the same modulation depth as a waveguide with a uniform ITO layer....
-
Metabolite coupling in genome-scale metabolic networks
Directory of Open Access Journals (Sweden)
Palsson Bernhard Ø
2006-03-01
Full Text Available Abstract Background Biochemically detailed stoichiometric matrices have now been reconstructed for various bacteria, yeast, and for the human cardiac mitochondrion based on genomic and proteomic data. These networks have been manually curated based on legacy data and elementally and charge balanced. Comparative analysis of these well curated networks is now possible. Pairs of metabolites often appear together in several network reactions, linking them topologically. This co-occurrence of pairs of metabolites in metabolic reactions is termed herein "metabolite coupling." These metabolite pairs can be directly computed from the stoichiometric matrix, S. Metabolite coupling is derived from the matrix ŜŜT, whose off-diagonal elements indicate the number of reactions in which any two metabolites participate together, where Ŝ is the binary form of S. Results Metabolite coupling in the studied networks was found to be dominated by a relatively small group of highly interacting pairs of metabolites. As would be expected, metabolites with high individual metabolite connectivity also tended to be those with the highest metabolite coupling, as the most connected metabolites couple more often. For metabolite pairs that are not highly coupled, we show that the number of reactions a pair of metabolites shares across a metabolic network closely approximates a line on a log-log scale. We also show that the preferential coupling of two metabolites with each other is spread across the spectrum of metabolites and is not unique to the most connected metabolites. We provide a measure for determining which metabolite pairs couple more often than would be expected based on their individual connectivity in the network and show that these metabolites often derive their principal biological functions from existing in pairs. Thus, analysis of metabolite coupling provides information beyond that which is found from studying the individual connectivity of individual
-
Modeling of supermodes in coupled unstable resonators
International Nuclear Information System (INIS)
Townsend, S.S.
1986-01-01
A general formalism describing the supermodes of an array of N identical, circulantly coupled resonators is presented. The symmetry of the problem results in a reduction of the N coupled integral equations to N decoupled integral equations. Each independent integral equation defines a set of single-resonator modes derived for a hypothetical resonator whose geometry resembles a member of the real array with the exception that all coupling beams are replaced by feedback beams, each with a prescribed constant phase. A given array supermode consists of a single equivalent resonator mode appearing repetitively in each resonator with a prescribed relative phase between individual resonators. The specific array design chosen for example is that of N adjoint coupled confocal unstable resonators. The impact of coupling on the computer modeling of this system is discussed and computer results for the cases of two- and four-laser coupling are presented
-
Directory of Open Access Journals (Sweden)
Qian Wang
2017-01-01
Full Text Available Different configurations of coupling strategies influence greatly the accuracy and convergence of the simulation results in the hybrid atomistic-continuum method. This study aims to quantitatively investigate this effect and offer the guidance on how to choose the proper configuration of coupling strategies in the hybrid atomistic-continuum method. We first propose a hybrid molecular dynamics- (MD- continuum solver in LAMMPS and OpenFOAM that exchanges state variables between the atomistic region and the continuum region and evaluate different configurations of coupling strategies using the sudden start Couette flow, aiming to find the preferable configuration that delivers better accuracy and efficiency. The major findings are as follows: (1 the C→A region plays the most important role in the overlap region and the “4-layer-1” combination achieves the best precision with a fixed width of the overlap region; (2 the data exchanging operation only needs a few sampling points closer to the occasions of interactions and decreasing the coupling exchange operations can reduce the computational load with acceptable errors; (3 the nonperiodic boundary force model with a smoothing parameter of 0.1 and a finer parameter of 20 can not only achieve the minimum disturbance near the MD-continuum interface but also keep the simulation precision.
-
Holomorphic Yukawa couplings in heterotic string theory
Energy Technology Data Exchange (ETDEWEB)
Blesneag, Stefan [Rudolf Peierls Centre for Theoretical Physics, Oxford University,1 Keble Road, Oxford, OX1 3NP (United Kingdom); Buchbinder, Evgeny I. [The University of Western Australia,35 Stirling Highway, Crawley WA 6009 (Australia); Candelas, Philip [Mathematical Institute, University of Oxford,Andrew Wiles Building, Radcliffe Observatory Quarter, Woodstock Road, Oxford, OX2 6GG (United Kingdom); Lukas, Andre [Rudolf Peierls Centre for Theoretical Physics, Oxford University,1 Keble Road, Oxford, OX1 3NP (United Kingdom)
2016-01-26
We develop techniques, based on differential geometry, to compute holomorphic Yukawa couplings for heterotic line bundle models on Calabi-Yau manifolds defined as complete intersections in projective spaces. It is shown explicitly how these techniques relate to algebraic methods for computing holomorphic Yukawa couplings. We apply our methods to various examples and evaluate the holomorphic Yukawa couplings explicitly as functions of the complex structure moduli. It is shown that the rank of the Yukawa matrix can decrease at specific loci in complex structure moduli space. In particular, we compute the up Yukawa coupling and the singlet-Higgs-lepton trilinear coupling in the heterotic standard model described in ref. http://dx.doi.org/10.1007/JHEP06(2014)100.
-
Analytical solutions of coupled-mode equations for microring ...
Indian Academy of Sciences (India)
equivalent to waveguide and single microring coupled system. The 3 × 3 coupled system is equivalent to waveguide and double microring coupled system. In this paper, we adopt a novel approach for obtaining coupled-mode equations for linearly distributed and circularly distributed multiwaveguide systems with different ...
-
8.3 Microbiology and Biodegradation: A New Bacterial Communication System
2014-04-09
Approved for Public Release; Distribution Unlimited 8.3 Microbiology and Biodegradation: A new bacterial communication system The views, opinions and...JB.01479-10 Federico E. Rey, Caroline S. Harwood. FixK, a global regulator of microaerobic growth, controls photosynthesis in Rhodopseudomonas...Quorum sensing is a term used to describe bacterial cell-to-cell communication that allows cell-density-dependent gene expression. There are many
-
The couple's odyssey: Hollywood's take on love relationships.
Alexander, Matthew
2009-06-01
Psychiatrists need to be aware of how their individual clients are impacted by issues they may be having in their intimate relationships and how couples issues, in turn, impact and are impacted by emotional and mental disorders. In addition, psychiatrists need to be able to offer sound advice to individuals in troubled relationships, know how to make referrals to trained marriage therapists and know how medications they prescribe may impact couples. Over the past twenty years, there have been significant advances in couple research to assist health professionals in offering insight to couples struggling with communication, conflict resolution, affairs, addictions and many other aspects of the couple's odyssey. Movie clips offer an effective way of teaching psychiatrists about common issues in coupling and couple therapy. The use of movies for teaching health professionals is well documented in previous articles and books on cinemeducation. This paper highlights movies and movie clips which are useful for educating psychiatrists about common clinical issues in couple therapy.
-
Gestural coupling and social cognition
DEFF Research Database (Denmark)
Michael, John; Krueger, Joel William
2012-01-01
Social cognition researchers have become increasingly interested in the ways that behavioral, physiological, and neural coupling facilitate social interaction and interpersonal understanding. We distinguish two ways of conceptualizing the role of such coupling processes in social cognition: strong...... an essential enabling feature for social interaction and interpersonal understanding more generally and thus ought to exhibit severe deficits in these areas. We challenge SI's prediction and show how MS cases offer compelling reasons for instead adopting MI's pluralistic model of social interaction...... and interpersonal understanding. We conclude that investigations of coupling processes within social interaction should inform rather than marginalize or eliminate investigation of higher-level individual cognition...
-
Overprotection in couples with aphasia.
Croteau, C; Le Dorze, G
1999-09-01
The study aimed to measure the perception of overprotection in 21 couples living with aphasia, relative to controls. The 'Questionnaire on Resources and Stress' assessed the spouses' perception and the 'Overprotection Scale for Adults' measured the perception of persons with aphasia. Husbands of women with aphasia did not differ from husbands of women without aphasia. Wives of men with aphasia reported more overprotection than wives of men without aphasia, even when functional impairment was controlled. The men with aphasia did not report feeling overprotected. No significant relationship was uncovered between the report of overprotection and feeling overprotected in couples with aphasia. Overprotection is present in some couples coping with aphasia.
-
Bubbling in delay-coupled lasers.
Flunkert, V; D'Huys, O; Danckaert, J; Fischer, I; Schöll, E
2009-06-01
We theoretically study chaos synchronization of two lasers which are delay coupled via an active or a passive relay. While the lasers are synchronized, their dynamics is identical to a single laser with delayed feedback for a passive relay and identical to two delay-coupled lasers for an active relay. Depending on the coupling parameters the system exhibits bubbling, i.e., noise-induced desynchronization, or on-off intermittency. We associate the desynchronization dynamics in the coherence collapse and low-frequency fluctuation regimes with the transverse instability of some of the compound cavity's antimodes. Finally, we demonstrate how, by using an active relay, bubbling can be suppressed.
-
Hydromechanical coupling in geologic processes
Neuzil, C.E.
2003-01-01
Earth's porous crust and the fluids within it are intimately linked through their mechanical effects on each other. This paper presents an overview of such "hydromechanical" coupling and examines current understanding of its role in geologic processes. An outline of the theory of hydromechanics and rheological models for geologic deformation is included to place various analytical approaches in proper context and to provide an introduction to this broad topic for nonspecialists. Effects of hydromechanical coupling are ubiquitous in geology, and can be local and short-lived or regional and very long-lived. Phenomena such as deposition and erosion, tectonism, seismicity, earth tides, and barometric loading produce strains that tend to alter fluid pressure. Resulting pressure perturbations can be dramatic, and many so-called "anomalous" pressures appear to have been created in this manner. The effects of fluid pressure on crustal mechanics are also profound. Geologic media deform and fail largely in response to effective stress, or total stress minus fluid pressure. As a result, fluid pressures control compaction, decompaction, and other types of deformation, as well as jointing, shear failure, and shear slippage, including events that generate earthquakes. By controlling deformation and failure, fluid pressures also regulate states of stress in the upper crust. Advances in the last 80 years, including theories of consolidation, transient groundwater flow, and poroelasticity, have been synthesized into a reasonably complete conceptual framework for understanding and describing hydromechanical coupling. Full coupling in two or three dimensions is described using force balance equations for deformation coupled with a mass conservation equation for fluid flow. Fully coupled analyses allow hypothesis testing and conceptual model development. However, rigorous application of full coupling is often difficult because (1) the rheological behavior of geologic media is complex
-
Soriano, Diogo C.; Santos, Odair V. dos; Suyama, Ricardo; Fazanaro, Filipe I.; Attux, Romis
2018-03-01
This work has a twofold aim: (a) to analyze an alternative approach for computing the conditional Lyapunov exponent (λcmax) aiming to evaluate the synchronization stability between nonlinear oscillators without solving the classical variational equations for the synchronization error dynamical system. In this first framework, an analytic reference value for λcmax is also provided in the context of Duffing master-slave scenario and precisely evaluated by the proposed numerical approach; (b) to apply this technique to the study of synchronization stability in chaotic Hindmarsh-Rose (HR) neuronal models under uni- and bi-directional resistive coupling and different excitation bias, which also considered the root mean square synchronization error, information theoretic measures and asymmetric transfer entropy in order to offer a better insight of the synchronization phenomenon. In particular, statistical and information theoretical measures were able to capture similarity increase between the neuronal oscillators just after a critical coupling value in accordance to the largest conditional Lyapunov exponent behavior. On the other hand, transfer entropy was able to detect neuronal emitter influence even in a weak coupling condition, i.e. under the increase of conditional Lyapunov exponent and apparently desynchronization tendency. In the performed set of numerical simulations, the synchronization measures were also evaluated for a two-dimensional parameter space defined by the neuronal coupling (emitter to a receiver neuron) and the (receiver) excitation current. Such analysis is repeated for different feedback couplings as well for different (emitter) excitation currents, revealing interesting characteristics of the attained synchronization region and conditions that facilitate the emergence of the synchronous behavior. These results provide a more detailed numerical insight of the underlying behavior of a HR in the excitation and coupling space, being in accordance
-
Hadronic couplings of open beauty states
International Nuclear Information System (INIS)
Ram, S.N.; Singh, C.P.
1982-08-01
Strong interaction coupling parameters of particles with beauty quantum number are obtained using dispersion sum rules in various forms, e.g. current algebra sum rules, superconvergence sum rules and finite energy sum rules etc. These sum rules lead to a set of algebraic relations among masses and coupling constants. We compare the hadronic couplings of beautiful particles as obtained from various techniques and discuss their implications on the hadronic production of these states. (author)
-
Shi, Shuangxia; Su, Zhu; Jin, Guoyong; Liu, Zhigang
2018-01-01
This paper is concerned with the modeling and solution method of a three-dimensional (3D) coupled acoustic system comprising a partially opened cavity coupled with a flexible plate and an exterior field of semi-infinite size, which is ubiquitously encountered in architectural acoustics and is a reasonable representation of many engineering occasions. A general solution method is presented to predict the dynamic behaviors of the three-dimensional (3D) acoustic coupled system, in which the displacement of the plate and the sound pressure in the cavity are respectively constructed in the form of the two-dimensional and three-dimensional modified Fourier series with several auxiliary functions introduced to ensure the uniform convergence of the solution over the entire solution domain. The effect of the opening is taken into account via the work done by the sound pressure acting at the coupling aperture that is contributed from the vibration of particles on the acoustic coupling interface and on the structural-acoustic coupling interface. Both the acoustic coupling between finite cavity and exterior field and the structural-acoustic coupling between flexible plate and interior acoustic field are considered in the vibro-acoustic modeling of the three-dimensional acoustic coupled acoustic system. The dynamic responses of the coupled structural-acoustic system are obtained using the Rayleigh-Ritz procedure based on the energy expressions for the coupled system. The accuracy and effectiveness of the proposed method are validated through numerical examples and comparison with results obtained by the boundary element analysis. Furthermore, the influence of the opening and the cavity volume on the acoustic behaviors of opened cavity system is studied.
-
Coupled Acoustic-Mechanical Bandgaps
DEFF Research Database (Denmark)
Jensen, Jakob Søndergaard; Kook, Junghwan
2016-01-01
medium and the presence of acoustic resonances. It is demonstrated that corrugation of the plate structure can introduce bending wave bandgaps and bandgaps in the acoustic domain in overlapping and audible frequency ranges. This effect is preserved also when taking the physical coupling between the two...... domains into account. Additionally, the coupling is shown to introduce extra gaps in the band structure due to modal interaction and the appearance of a cut-on frequency for the fundamental acoustic mode....
-
International Nuclear Information System (INIS)
Wu, Xu; Kozlowski, Tomasz
2015-01-01
Highlights: • Coupling of Monte Carlo code Serpent and thermal–hydraulics code RELAP5. • A convergence criterion is developed based on the statistical uncertainty of power. • Correlation between MC statistical uncertainty and coupled error is quantified. • Both UO 2 and MOX single assembly models are used in the coupled simulation. • Validation of coupling results with a multi-group transport code DeCART. - Abstract: Coupled multi-physics approach plays an important role in improving computational accuracy. Compared with deterministic neutronics codes, Monte Carlo codes have the advantage of a higher resolution level. In the present paper, a three-dimensional continuous-energy Monte Carlo reactor physics burnup calculation code, Serpent, is coupled with a thermal–hydraulics safety analysis code, RELAP5. The coupled Serpent/RELAP5 code capability is demonstrated by the improved axial power distribution of UO 2 and MOX single assembly models, based on the OECD-NEA/NRC PWR MOX/UO 2 Core Transient Benchmark. Comparisons of calculation results using the coupled code with those from the deterministic methods, specifically heterogeneous multi-group transport code DeCART, show that the coupling produces more precise results. A new convergence criterion for the coupled simulation is developed based on the statistical uncertainty in power distribution in the Monte Carlo code, rather than ad-hoc criteria used in previous research. The new convergence criterion is shown to be more rigorous, equally convenient to use but requiring a few more coupling steps to converge. Finally, the influence of Monte Carlo statistical uncertainty on the coupled error of power and thermal–hydraulics parameters is quantified. The results are presented such that they can be used to find the statistical uncertainty to use in Monte Carlo in order to achieve a desired precision in coupled simulation
-
Directory of Open Access Journals (Sweden)
Imran Talib
2015-12-01
Full Text Available In this article, study the existence of solutions for the second-order nonlinear coupled system of ordinary differential equations $$\\displaylines{ u''(t=f(t,v(t,\\quad t\\in [0,1],\\cr v''(t=g(t,u(t,\\quad t\\in [0,1], }$$ with nonlinear coupled boundary conditions $$\\displaylines{ \\phi(u(0,v(0,u(1,v(1,u'(0,v'(0=(0,0, \\cr \\psi(u(0,v(0,u(1,v(1,u'(1,v'(1=(0,0, }$$ where $f,g:[0,1]\\times \\mathbb{R}\\to \\mathbb{R}$ and $\\phi,\\psi:\\mathbb{R}^6\\to \\mathbb{R}^2$ are continuous functions. Our main tools are coupled lower and upper solutions, Arzela-Ascoli theorem, and Schauder's fixed point theorem.
-
COSMOLOGY OF CHAMELEONS WITH POWER-LAW COUPLINGS
International Nuclear Information System (INIS)
Mota, David F.; Winther, Hans A.
2011-01-01
In chameleon field theories, a scalar field can couple to matter with gravitational strength and still evade local gravity constraints due to a combination of self-interactions and the couplings to matter. Originally, these theories were proposed with a constant coupling to matter; however, the chameleon mechanism also extends to the case where the coupling becomes field dependent. We study the cosmology of chameleon models with power-law couplings and power-law potentials. It is found that these generalized chameleons, when viable, have a background expansion very close to ΛCDM, but can in some special cases enhance the growth of the linear perturbations at low redshifts. For the models we consider, it is found that this region of the parameter space is ruled out by local gravity constraints. Imposing a coupling to dark matter only, the local constraints are avoided, and it is possible to have observable signatures on the linear matter perturbations.
-
Modeling bidirectionally coupled single-mode semiconductor lasers
International Nuclear Information System (INIS)
Mulet, Josep; Masoller, Cristina; Mirasso, Claudio R.
2002-01-01
We develop a dynamical model suitable for the description of two mutually coupled semiconductor lasers in a face-to-face configuration. Our study considers the propagation of the electric field along the compound system as well as the evolution of the carrier densities within each semiconductor laser. Mutual injection, passive optical feedback, and multiple reflections are accounted for in this framework, although under weak to moderate coupling conditions. We systematically describe the effect of the coupling strength on the spectrum of monochromatic solutions and on the respective dynamical behavior. By assuming single-longitudinal-mode operation, weak mutual coupling and slowly varying approximation, the dynamical model can be reduced to rate equations describing the mutual injection from one laser to its counterpart and vice versa. A good agreement between the complete and simplified models is found for small coupling. For larger coupling, higher-order terms lead to a smaller threshold reduction, reflected itself in the spectrum of the monochromatic solutions and in the dynamics of the optical power
-
Energy Technology Data Exchange (ETDEWEB)
Ramos, Daniel, E-mail: daniel.ramos@csic.es; Frank, Ian W.; Deotare, Parag B.; Bulu, Irfan; Lončar, Marko [School of Engineering and Applied Sciences, Harvard University, Cambridge, Massachusetts 02138 (United States)
2014-11-03
We investigate the coupling between mechanical and optical modes supported by coupled, freestanding, photonic crystal nanobeam cavities. We show that localized cavity modes for a given gap between the nanobeams provide weak optomechanical coupling with out-of-plane mechanical modes. However, we show that the coupling can be significantly increased, more than an order of magnitude for the symmetric mechanical mode, due to optical resonances that arise from the interaction of the localized cavity modes with standing waves formed by the reflection from thesubstrate. Finally, amplification of motion for the symmetric mode has been observed and attributed to the strong optomechanical interaction of our hybrid system. The amplitude of these self-sustained oscillations is large enough to put the system into a non-linear oscillation regime where a mixing between the mechanical modes is experimentally observed and theoretically explained.
-
Ultrastrong exciton-photon coupling in single and coupled organic microcavities
Liu, Bin; Bramante, Rosemary; Valle, Brent; Singer, Kenneth; Khattab, Tawfik; Williams, Jarrod; Twieg, Robert
2015-03-01
We have demonstrated ultrastrong light-matter coupling in organic planar microcavities composed of a neat glassy organic dye film between two metallic (aluminum) mirrors in a half-cavity configuration. Such cavities are characterized by Q factors around 10. Tuning the thickness of the organic layer enables the observation of the ultrastrong coupling regime. Via reflectivity measurements, we observe a very large Rabi splitting around 1.227 eV between upper and lower polariton branches at room temperature, and we detect polariton emission from the lower polariton branch via photoluminescence measurements. The large splitting is due to the large oscillator strength of the neat dye glass, and to the match of the low-Q cavity spectral width to the broad absorption width of the dye film material. We also study the interaction between excitonic states of neat glassy organic dye and cavity modes within coupled microcavity structures. The high-reflectivity mirrors are formed from distributed Bragg reflectors (DBR), which are multilayer films fabricated using the coextrusion process, containing alternating layers of high (SAN25, n =1.57) and low (Dyneon THV 220G, n =1.37) refractive index dielectric polymers. Nonlinear optical measurements will be discussed. This research was supported by the National Science Foundation Center for Layered Polymer Systems (CLiPS) under Grant Number DMR-0423914.
-
Automatic design of permanent magnet coupling
International Nuclear Information System (INIS)
Yonnet, J.-P.; Pandele, P.; Coutel, C.; Wurtz, F.
1998-01-01
Up to now, two main methods have been used to design permanent magnet couplings : finite element calculation, and analytical expressions of the forces between the magnets. The two methods use the same starting point, the permanent magnet coupling dimensions. The calculated parameters are the forces and the torques. The optimization of the couplings shape is generally done by using different curves describing torque variations as a function of the different geometrical parameters. We have developed a very new approach solving the reverse problem. Choosing the value of the torque, the airgap and an optimization criterium, the new method automatically calculates the size of the magnets and the ideal number of poles. It is based on a software, PASCOSMA, using an analytical model of the coupling which can be eventually corrected by a finite element method like FLUX2D. The coupling optimization is automatically made, keeping the parameters between predefined values. For a given application, it is very easy to obtain the best design, for example with the minimum magnet volume. (orig.)
-
Isocurvature constraints on portal couplings
Energy Technology Data Exchange (ETDEWEB)
Kainulainen, Kimmo; Nurmi, Sami; Vaskonen, Ville [Department of Physics, University of Jyväskylä, P.O.Box 35 (YFL), FI-40014 University of Jyväskylä (Finland); Tenkanen, Tommi; Tuominen, Kimmo, E-mail: kimmo.kainulainen@jyu.fi, E-mail: sami.t.nurmi@jyu.fi, E-mail: tommi.tenkanen@helsinki.fi, E-mail: kimmo.i.tuominen@helsinki.fi, E-mail: ville.vaskonen@jyu.fi [Department of Physics, University of Helsinki P.O. Box 64, FI-00014, Helsinki (Finland)
2016-06-01
We consider portal models which are ultraweakly coupled with the Standard Model, and confront them with observational constraints on dark matter abundance and isocurvature perturbations. We assume the hidden sector to contain a real singlet scalar s and a sterile neutrino ψ coupled to s via a pseudoscalar Yukawa term. During inflation, a primordial condensate consisting of the singlet scalar s is generated, and its contribution to the isocurvature perturbations is imprinted onto the dark matter abundance. We compute the total dark matter abundance including the contributions from condensate decay and nonthermal production from the Standard Model sector. We then use the Planck limit on isocurvature perturbations to derive a novel constraint connecting dark matter mass and the singlet self coupling with the scale of inflation: m {sub DM}/GeV ∼< 0.2λ{sub s}{sup 3/8} ( H {sub *}/10{sup 11} GeV){sup −3/2}. This constraint is relevant in most portal models ultraweakly coupled with the Standard Model and containing light singlet scalar fields.
-
Rapid roll inflation with conformal coupling
International Nuclear Information System (INIS)
Kofman, Lev; Mukohyama, Shinji
2008-01-01
Usual inflation is realized with a slow rolling scalar field minimally coupled to gravity. In contrast, we consider dynamics of a scalar with a flat effective potential, conformally coupled to gravity. Surprisingly, it contains an attractor inflationary solution with the rapidly rolling inflaton field. We discuss models with the conformal inflaton with a flat potential (including hybrid inflation). There is no generation of cosmological fluctuations from the conformally coupled inflaton. We consider realizations of modulated (inhomogeneous reheating) or curvaton cosmological fluctuations in these models. We also implement these unusual features for the popular string-theoretic warped inflationary scenario, based on the interacting D3-D3 branes. The original warped brane inflation suffers a large inflaton mass due to conformal coupling to 4-dimensional gravity. Instead of considering this as a problem and trying to cure it with extra engineering, we show that warped inflation with the conformally coupled, rapidly rolling inflaton is yet possible with N=37 efoldings, which requires low-energy scales 1-100 TeV of inflation. Coincidentally, the same warping numerology can be responsible for the hierarchy. It is shown that the scalars associated with angular isometries of the warped geometry of compact manifold (e.g. S 3 of Klebanov-Strassler (KS) geometry) have solutions identical to conformally coupled modes and also cannot be responsible for cosmological fluctuations. We discuss other possibilities
-
Rapid roll inflation with conformal coupling
Kofman, Lev; Mukohyama, Shinji
2008-02-01
Usual inflation is realized with a slow rolling scalar field minimally coupled to gravity. In contrast, we consider dynamics of a scalar with a flat effective potential, conformally coupled to gravity. Surprisingly, it contains an attractor inflationary solution with the rapidly rolling inflaton field. We discuss models with the conformal inflaton with a flat potential (including hybrid inflation). There is no generation of cosmological fluctuations from the conformally coupled inflaton. We consider realizations of modulated (inhomogeneous reheating) or curvaton cosmological fluctuations in these models. We also implement these unusual features for the popular string-theoretic warped inflationary scenario, based on the interacting D3-D¯3 branes. The original warped brane inflation suffers a large inflaton mass due to conformal coupling to 4-dimensional gravity. Instead of considering this as a problem and trying to cure it with extra engineering, we show that warped inflation with the conformally coupled, rapidly rolling inflaton is yet possible with N=37 efoldings, which requires low-energy scales 1 100 TeV of inflation. Coincidentally, the same warping numerology can be responsible for the hierarchy. It is shown that the scalars associated with angular isometries of the warped geometry of compact manifold (e.g. S3 of Klebanov-Strassler (KS) geometry) have solutions identical to conformally coupled modes and also cannot be responsible for cosmological fluctuations. We discuss other possibilities.
-
International Nuclear Information System (INIS)
Aoki, Ken-ichi
1988-01-01
Existence of a strong coupling phase in QED has been suggested in solutions of the Schwinger-Dyson equation and in Monte Carlo simulation of lattice QED. In this article we recapitulate the previous arguments, and formulate the problem in the modern framework of the renormalization theory, Wilsonian renormalization. This scheme of renormalization gives the best understanding of the basic structure of a field theory especially when it has a multi-phase structure. We resolve some misleading arguments in the previous literature. Then we set up a strategy to attack the strong phase, if any. We describe a trial; a coupled Schwinger-Dyson equation. Possible picture of the strong coupling phase QED is presented. (author)
-
GMD Coupling to Power Systems and Disturbance Mitigation
Energy Technology Data Exchange (ETDEWEB)
Rivera, Michael Kelly [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Bent, Russell Whitford [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2018-01-24
Presentation includes slides on Geomagnetic Disturbance: Ground Fields; Geomagnetic Disturbance: Coupling to Bulk Electric System; Geomagnetic Disturbance: Transformers; GMD Assessment Workflow (TPL-007-1); FERC order 830; Goals; SuperMag (1 min data) Nov. 20-21, 2003 Storm (DST = -422); Spherical Harmonics; Spherical Harmonics Nov. 20-21, 2003 Storm (DST = -422); DST vs HN0,0; Fluctuations vs. DST; Fluctuations; Conclusions and Next Steps; GMD Assessment Workflow (TPL-007-1); EMP E3 Coupling to Texas 2000 Bus Model; E3 Coupling Comparison (total GIC) Varying Ground Zero; E3 Coupling Comparison (total MVAR) Varying Ground Zero; E3 Coupling Comparison (GIC) at Peak Ground Zero; E3 Coupling Comparison (GIC) at Peak Ground Zero; and Conclusion.
-
Gauge Coupling Unification with Partly Composite Matter
International Nuclear Information System (INIS)
Gherghetta, Tony
2005-01-01
It is shown how gauge coupling unification can occur in models with partly composite matter. The particle states which are composite only contribute small logarithmns to the running of gauge couplings, while the elementary states contribute the usual large logarithmns. This introduces a new differential running contribution to the gauge couplings from partly composite SU(5) matter multiplets. In particular, for partly supersymmetric models, the incomplete SU(5) elementary matter multiplets restore gauge coupling unification even though the usual elementary gaugino and Higgsino contributions need not be present
-
Linearly and nonlinearly bidirectionally coupled synchronization of hyperchaotic systems
International Nuclear Information System (INIS)
Zhou Jin; Lu Junan; Wu Xiaoqun
2007-01-01
To date, there have been many results about unidirectionally coupled synchronization of chaotic systems. However, much less work is reported on bidirectionally-coupled synchronization. In this paper, we investigate the synchronization of two bidirectionally coupled Chen hyperchaotic systems, which are coupled linearly and nonlinearly respectively. Firstly, linearly coupled synchronization of two hyperchaotic Chen systems is investigated, and a theorem on how to choose the coupling coefficients are developed to guarantee the global asymptotical synchronization of two coupled hyperchaotic systems. Analysis shows that the choice of the coupling coefficients relies on the bound of the chaotic system. Secondly, the nonlinearly coupled synchronization is studied; a sufficient condition for the locally asymptotical synchronization is derived, which is independent of the bound of the hyperchaotic system. Finally, numerical simulations are included to verify the effectiveness and feasibility of the developed theorems
-
Dynamic nonlinear thermal optical effects in coupled ring resonators
Directory of Open Access Journals (Sweden)
Chenguang Huang
2012-09-01
Full Text Available We investigate the dynamic nonlinear thermal optical effects in a photonic system of two coupled ring resonators. A bus waveguide is used to couple light in and out of one of the coupled resonators. Based on the coupling from the bus to the resonator, the coupling between the resonators and the intrinsic loss of each individual resonator, the system transmission spectrum can be classified by three different categories: coupled-resonator-induced absorption, coupled-resonator-induced transparency and over coupled resonance splitting. Dynamic thermal optical effects due to linear absorption have been analyzed for each category as a function of the input power. The heat power in each resonator determines the thermal dynamics in this coupled resonator system. Multiple “shark fins” and power competition between resonators can be foreseen. Also, the nonlinear absorption induced thermal effects have been discussed.
-
Chaotic Motion of Nonlinearly Coupled Quintic Oscillators | Adeloye ...
African Journals Online (AJOL)
With a fixed energy, we investigate the motion of two nonlinearly coupled quintic oscillators for various values of the coupling strength with the aid of the Poincare surface of section. It is observed that chaotic motion sets in for coupling strength as low as 0.001. The degree of chaoticity generally increases as the coupling ...
-
New insights on the matter-gravity coupling paradigm.
Delsate, Térence; Steinhoff, Jan
2012-07-13
The coupling between matter and gravity in general relativity is given by a proportionality relation between the stress tensor and the geometry. This is an oriented assumption driven by the fact that both the stress tensor and the Einstein tensor are divergenceless. However, general relativity is in essence a nonlinear theory, so there is no obvious reason why the coupling to matter should be linear. On another hand, modified theories of gravity usually affect the vacuum dynamics, yet keep the coupling to matter linear. In this Letter, we address the implications of consistent nonlinear gravity-matter coupling. The Eddington-inspired Born-Infeld theory recently introduced by Bañados and Ferreira provides an enlightening realization of such coupling modifications. We find that this theory coupled to a perfect fluid reduces to general relativity coupled to a nonlinearly modified perfect fluid, leading to an ambiguity between modified coupling and modified equation of state. We discuss observational consequences of this degeneracy and argue that such a completion of general relativity is viable from both an experimental and theoretical point of view through energy conditions, consistency, and singularity-avoidance perspectives. We use these results to discuss the impact of changing the coupling paradigm.
-
Energy Technology Data Exchange (ETDEWEB)
Kozioł-Rachwał, A. [AGH University of Science and Technology, Faculty of Physics and Applied Computer Science, al. Mickiewicza 30, 30-059 Kraków (Poland); National Institute of Advanced Industrial Science and Technology, Spintronics Research Center, Tsukuba, Ibaraki 305-8568 (Japan); Skowroński, W.; Frankowski, M. [AGH University of Science and Technology, Department of Electronics, al. Mickiewicza 30, 30-059 Kraków (Poland); Chęciński, J. [AGH University of Science and Technology, Faculty of Physics and Applied Computer Science, al. Mickiewicza 30, 30-059 Kraków (Poland); AGH University of Science and Technology, Department of Electronics, al. Mickiewicza 30, 30-059 Kraków (Poland); Ziętek, S.; Rzeszut, P. [AGH University of Science and Technology, Department of Electronics, al. Mickiewicza 30, 30-059 Kraków (Poland); Ślęzak, M.; Matlak, K.; Ślęzak, T. [AGH University of Science and Technology, Faculty of Physics and Applied Computer Science, al. Mickiewicza 30, 30-059 Kraków (Poland); Stobiecki, T. [AGH University of Science and Technology, Department of Electronics, al. Mickiewicza 30, 30-059 Kraków (Poland); Korecki, J. [AGH University of Science and Technology, Faculty of Physics and Applied Computer Science, al. Mickiewicza 30, 30-059 Kraków (Poland); Jerzy Haber Institute of Catalysis and Surface Chemistry, Polish Academy of Sciences, ul. Niezapominajek 8, 30-239 Kraków (Poland)
2017-02-15
Fe/MgO/Fe trilayers with a subnanometer MgO tunnel barrier were grown by molecular beam epitaxy. Longitudinal magnetooptic Kerr effect measurements confirmed the existence of the antiferromagnetic interlayer exchange coupling (IEC) between the Fe layers for 2 Å
-
Iqbal, Muhammad; Rehan, Muhammad; Khaliq, Abdul; Saeed-ur-Rehman; Hong, Keum-Shik
2014-01-01
This paper investigates the chaotic behavior and synchronization of two different coupled chaotic FitzHugh-Nagumo (FHN) neurons with unknown parameters under external electrical stimulation (EES). The coupled FHN neurons of different parameters admit unidirectional and bidirectional gap junctions in the medium between them. Dynamical properties, such as the increase in synchronization error as a consequence of the deviation of neuronal parameters for unlike neurons, the effect of difference in coupling strengths caused by the unidirectional gap junctions, and the impact of large time-delay due to separation of neurons, are studied in exploring the behavior of the coupled system. A novel integral-based nonlinear adaptive control scheme, to cope with the infeasibility of the recovery variable, for synchronization of two coupled delayed chaotic FHN neurons of different and unknown parameters under uncertain EES is derived. Further, to guarantee robust synchronization of different neurons against disturbances, the proposed control methodology is modified to achieve the uniformly ultimately bounded synchronization. The parametric estimation errors can be reduced by selecting suitable control parameters. The effectiveness of the proposed control scheme is illustrated via numerical simulations.
-
Information filtering on coupled social networks.
Nie, Da-Cheng; Zhang, Zi-Ke; Zhou, Jun-Lin; Fu, Yan; Zhang, Kui
2014-01-01
In this paper, based on the coupled social networks (CSN), we propose a hybrid algorithm to nonlinearly integrate both social and behavior information of online users. Filtering algorithm, based on the coupled social networks, considers the effects of both social similarity and personalized preference. Experimental results based on two real datasets, Epinions and Friendfeed, show that the hybrid pattern can not only provide more accurate recommendations, but also enlarge the recommendation coverage while adopting global metric. Further empirical analyses demonstrate that the mutual reinforcement and rich-club phenomenon can also be found in coupled social networks where the identical individuals occupy the core position of the online system. This work may shed some light on the in-depth understanding of the structure and function of coupled social networks.
-
Strong Coupling between Plasmons and Organic Semiconductors
Directory of Open Access Journals (Sweden)
Joel Bellessa
2014-05-01
Full Text Available In this paper we describe the properties of organic material in strong coupling with plasmon, mainly based on our work in this field of research. The strong coupling modifies the optical transitions of the structure, and occurs when the interaction between molecules and plasmon prevails on the damping of the system. We describe the dispersion relation of different plasmonic systems, delocalized and localized plasmon, coupled to aggregated dyes and the typical properties of these systems in strong coupling. The modification of the dye emission is also studied. In the second part, the effect of the microscopic structure of the organics, which can be seen as a disordered film, is described. As the different molecules couple to the same plasmon mode, an extended coherent state on several microns is observed.
-
Gildersleeve, Sara; Singer, Jefferson A; Skerrett, Karen; Wein, Shelter
2017-05-01
"We-ness," a couple's mutual investment in their relationship and in each other, has been found to be a potent dimension of couple resilience. This study examined the development of a method to capture We-ness in psychotherapy through the coding of relationship narratives co-constructed by couples ("We-Stories"). It used a coding system to identify the core thematic elements that make up these narratives. Couples that self-identified as "happy" (N = 53) generated We-Stories and completed measures of relationship satisfaction and mutuality. These stories were then coded using the We-Stories coding manual. Findings indicated that security, an element that involves aspects of safety, support, and commitment, was most common, appearing in 58.5% of all narratives. This element was followed by the elements of pleasure (49.1%) and shared meaning/vision (37.7%). The number of "We-ness" elements was also correlated with and predictive of discrepancy scores on measures of relationship mutuality, indicating the validity of the We-Stories coding manual. Limitations and future directions are discussed.
-
Deflecting modes of the side-coupled cavity structure
Energy Technology Data Exchange (ETDEWEB)
Inagaki, Shigemi.
1990-11-01
The deflecting modes of the 805 MHz side-coupled cavity structure with the relativistic factor 0.566 are studied. Our main concern is the dispersion properties among different configurations of side-coupling cells and their interpretations. It is shown that the ninety degree side-coupling cell configuration, so to speak, the Mickey Mouse configuration has a merit in reducing the HEM{sub 1} passband. Another concern is the magnitude of the transverse coupling impedance around the synchronization condition. It is shown that the existence of the coupling cell introduces the nonuniformity of the deflecting mode and gives different impedance relative to the beam axis and that the coupling impedance at {pi}/10 exceeds 50 M{Omega}/m if the quality value of the mode is around 12000.
-
Deflecting modes of the side-coupled cavity structure
International Nuclear Information System (INIS)
Inagaki, Shigemi.
1990-11-01
The deflecting modes of the 805 MHz side-coupled cavity structure with the relativistic factor 0.566 are studied. Our main concern is the dispersion properties among different configurations of side-coupling cells and their interpretations. It is shown that the ninety degree side-coupling cell configuration, so to speak, the Mickey Mouse configuration has a merit in reducing the HEM 1 passband. Another concern is the magnitude of the transverse coupling impedance around the synchronization condition. It is shown that the existence of the coupling cell introduces the nonuniformity of the deflecting mode and gives different impedance relative to the beam axis and that the coupling impedance at π/10 exceeds 50 MΩ/m if the quality value of the mode is around 12000
-
Cascade-robustness optimization of coupling preference in interconnected networks
International Nuclear Information System (INIS)
Zhang, Xue-Jun; Xu, Guo-Qiang; Zhu, Yan-Bo; Xia, Yong-Xiang
2016-01-01
Highlights: • A specific memetic algorithm was proposed to optimize coupling links. • A small toy model was investigated to examine the underlying mechanism. • The MA optimized strategy exhibits a moderate assortative pattern. • A novel coupling coefficient index was proposed to quantify coupling preference. - Abstract: Recently, the robustness of interconnected networks has attracted extensive attentions, one of which is to investigate the influence of coupling preference. In this paper, the memetic algorithm (MA) is employed to optimize the coupling links of interconnected networks. Afterwards, a comparison is made between MA optimized coupling strategy and traditional assortative, disassortative and random coupling preferences. It is found that the MA optimized coupling strategy with a moderate assortative value shows an outstanding performance against cascading failures on both synthetic scale-free interconnected networks and real-world networks. We then provide an explanation for this phenomenon from a micro-scope point of view and propose a coupling coefficient index to quantify the coupling preference. Our work is helpful for the design of robust interconnected networks.
-
Analysing home-ownership of couples: the effect of selecting couples at the time of the survey.
Mulder, C H
1996-09-01
"The analysis of events encountered by couple and family households may suffer from sample selection bias when data are restricted to couples existing at the moment of interview. The paper discusses the effect of sample selection bias on event history analyses of buying a home [in the Netherlands] by comparing analyses performed on a sample of existing couples with analyses of a more complete sample including past as well as current partner relationships. The results show that, although home-buying in relationships that have ended differs clearly from behaviour in existing relationships, sample selection bias is not alarmingly large." (SUMMARY IN FRE) excerpt
-
Anomalous coupling of scalars to gauge fields
International Nuclear Information System (INIS)
Brax, Philippe; Davis, Anne-Christine; Seery, David; Weltman, Amanda
2010-10-01
We study the transformation properties of a scalar-tensor theory, coupled to fermions, under the Weyl rescaling associated with a transition from the Jordan to the Einstein frame. We give a simple derivation of the corresponding modification to the gauge couplings. After changing frames, this gives rise to a direct coupling between the scalar and the gauge fields. (orig.)
-
Anomalous coupling of scalars to gauge fields
Energy Technology Data Exchange (ETDEWEB)
Brax, Philippe [CEA, IPhT, CNRS, URA 2306, Gif-sur-Yvette (France). Inst. de Physique Theorique; Burrage, Clare [Geneve Univ. (Switzerland). Dept. de Physique Theorique; Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Davis, Anne-Christine [Centre for Mathematical Sciences, Cambridge (United Kingdom). Dept. of Applied Mathematics and Theoretical Physics; Seery, David [Sussex Univ., Brighton (United Kingdom). Dept. of Physics and Astronomy; Weltman, Amanda [Cape Town Univ., Rondebosch (South Africa). Astronomy, Cosmology and Gravity Centre
2010-10-15
We study the transformation properties of a scalar-tensor theory, coupled to fermions, under the Weyl rescaling associated with a transition from the Jordan to the Einstein frame. We give a simple derivation of the corresponding modification to the gauge couplings. After changing frames, this gives rise to a direct coupling between the scalar and the gauge fields. (orig.)
-
Unsteady interfacial coupling of two-phase flow models
International Nuclear Information System (INIS)
Hurisse, O.
2006-01-01
The primary coolant circuit in a nuclear power plant contains several distinct components (vessel, core, pipes,...). For all components, specific codes based on the discretization of partial differential equations have already been developed. In order to obtain simulations for the whole circuit, the interfacial coupling of these codes is required. The approach examined within this work consists in coupling codes by providing unsteady information through the coupling interface. The numerical technique relies on the use of an interface model, which is combined with the basic strategy that was introduced by Greenberg and Leroux in order to compute approximations of steady solutions of non-homogeneous hyperbolic systems. Three different coupling cases have been examined: (i) the coupling of a one-dimensional Euler system with a two-dimensional Euler system; (ii) the coupling of two distinct homogeneous two-phase flow models; (iii) the coupling of a four-equation homogeneous model with the standard two-fluid model. (author)
-
Coupled uncertainty provided by a multifractal random walker
International Nuclear Information System (INIS)
Koohi Lai, Z.; Vasheghani Farahani, S.; Movahed, S.M.S.; Jafari, G.R.
2015-01-01
The aim here is to study the concept of pairing multifractality between time series possessing non-Gaussian distributions. The increasing number of rare events creates “criticality”. We show how the pairing between two series is affected by rare events, which we call “coupled criticality”. A method is proposed for studying the coupled criticality born out of the interaction between two series, using the bivariate multifractal random walk (BiMRW). This method allows studying dependence of the coupled criticality on the criticality of each individual system. This approach is applied to data sets of gold and oil markets, and inflation and unemployment. - Highlights: • The coupled criticality between two systems is modeled by the bivariate multifractal random walk. • This coupled criticality is generally directed. • This coupled criticality is inversely proportional to the criticality of either of the systems. • The coupled criticality can emerge when at least one of the systems posses a Gaussian distribution
-
Warthog: Coupling Status Update
Energy Technology Data Exchange (ETDEWEB)
Hart, Shane W. D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Reardon, Bradley T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-06-30
The Warthog code was developed to couple codes that are developed in both the Multi-Physics Object-Oriented Simulation Environment (MOOSE) from Idaho National Laboratory (INL) and SHARP from Argonne National Laboratory (ANL). The initial phase of this work, focused on coupling the neutronics code PROTEUS with the fuel performance code BISON. The main technical challenge involves mapping the power density solution determined by PROTEUS to the fuel in BISON. This presents a challenge since PROTEUS uses the MOAB mesh format, but BISON, like all other MOOSE codes, uses the libMesh format. When coupling the different codes, one must consider that Warthog is a light-weight MOOSE-based program that uses the Data Transfer Kit (DTK) to transfer data between the various mesh types. Users set up inputs for the codes they want to run, and then Warthog transfers the data between them. Currently Warthog supports XSProc from SCALE or the Sub-Group Application Programming Interface (SGAPI) in PROTEUS for generating cross sections. It supports arbitrary geometries using PROTEUS and BISON. DTK will transfer power densities and temperatures between the codes where the domains overlap. In the past fiscal year (FY), much work has gone into demonstrating two-way coupling for simple pin cells of various materials. XSProc was used to calculate the cross sections, which were then passed to PROTEUS in an external file. PROTEUS calculates the fission/power density, and Warthog uses DTK to pass this information to BISON, where it is used as the heat source. BISON then calculates the temperature profile of the pin cell and sends it back to XSProc to obtain the temperature corrected cross sections. This process is repeated until the convergence criteria (tolerance on BISON solve, or number of time steps) is reached. Models have been constructed and run for both uranium oxide and uranium silicide fuels. These models demonstrate a clear difference in power shape that is not accounted for in a
-
Coupling functions: Universal insights into dynamical interaction mechanisms
Stankovski, Tomislav; Pereira, Tiago; McClintock, Peter V. E.; Stefanovska, Aneta
2017-10-01
The dynamical systems found in nature are rarely isolated. Instead they interact and influence each other. The coupling functions that connect them contain detailed information about the functional mechanisms underlying the interactions and prescribe the physical rule specifying how an interaction occurs. A coherent and comprehensive review is presented encompassing the rapid progress made recently in the analysis, understanding, and applications of coupling functions. The basic concepts and characteristics of coupling functions are presented through demonstrative examples of different domains, revealing the mechanisms and emphasizing their multivariate nature. The theory of coupling functions is discussed through gradually increasing complexity from strong and weak interactions to globally coupled systems and networks. A variety of methods that have been developed for the detection and reconstruction of coupling functions from measured data is described. These methods are based on different statistical techniques for dynamical inference. Stemming from physics, such methods are being applied in diverse areas of science and technology, including chemistry, biology, physiology, neuroscience, social sciences, mechanics, and secure communications. This breadth of application illustrates the universality of coupling functions for studying the interaction mechanisms of coupled dynamical systems.
-
B-L violating supersymmetric couplings
International Nuclear Information System (INIS)
Ramond, P.
1983-01-01
We consider two problems: one is the possible effect of the breaking of Peccei-Quinn symmetry on the inflationary universe scenario; the other is the remark that even the minimal supersymmetric SU 5 theory contains B-L violating couplings which give rise to neutrino masses and family-diagonal proton decay. However the strength of these couplings is limited by the gauge hierarchy
-
Complex Dynamics of Delay-Coupled Neural Networks
Mao, Xiaochen
2016-09-01
This paper reveals the complicated dynamics of a delay-coupled system that consists of a pair of sub-networks and multiple bidirectional couplings. Time delays are introduced into the internal connections and network-couplings, respectively. The stability and instability of the coupled network are discussed. The sufficient conditions for the existence of oscillations are given. Case studies of numerical simulations are given to validate the analytical results. Interesting and complicated neuronal activities are observed numerically, such as rest states, periodic oscillations, multiple switches of rest states and oscillations, and the coexistence of different types of oscillations.
-
The SU(∞) twisted gradient flow running coupling
Energy Technology Data Exchange (ETDEWEB)
Pérez, Margarita García [Instituto de Física Teórica UAM-CSIC,Nicolás Cabrera 13-15, E-28049-Madrid (Spain); González-Arroyo, Antonio [Instituto de Física Teórica UAM-CSIC,Nicolás Cabrera 13-15, E-28049-Madrid (Spain); Departamento de Física Teórica, C-15, Universidad Autónoma de Madrid,E-28049-Madrid (Spain); Keegan, Liam [PH-TH, CERN,CH-1211 Geneva 23 (Switzerland); Okawa, Masanori [Graduate School of Science, Hiroshima University,Higashi-Hiroshima, Hiroshima 739-8526 (Japan)
2015-01-09
We measure the running of the SU(∞) ’t Hooft coupling by performing a step scaling analysis of the Twisted Eguchi-Kawai (TEK) model, the SU(N) gauge theory on a single site lattice with twisted boundary conditions. The computation relies on the conjecture that finite volume effects for SU(N) gauge theories defined on a 4-dimensional twisted torus are controlled by an effective size parameter l-tilde=l√N, with l the torus period. We set the scale for the running coupling in terms of l-tilde and use the gradient flow to define a renormalized ’t Hooft coupling λ(l-tilde). In the TEK model, this idea allows the determination of the running of the coupling through a step scaling procedure that uses the rank of the group as a size parameter. The continuum renormalized coupling constant is extracted in the zero lattice spacing limit, which in the TEK model corresponds to the large N limit taken at fixed value of λ(l-tilde). The coupling constant is thus expected to coincide with that of the ordinary pure gauge theory at N=∞. The idea is shown to work and permits us to follow the evolution of the coupling over a wide range of scales. At weak coupling we find a remarkable agreement with the perturbative two-loop formula for the running coupling.
-
The Economic Foundations of Cohabiting Couples' Union Transitions.
Ishizuka, Patrick
2018-04-01
In recent decades, cohabitation has become an increasingly important relationship context for U.S. adults and their children, a union status characterized by high levels of instability. To understand why some cohabiting couples marry but others separate, researchers have drawn on theories emphasizing the benefits of specialization, the persistence of the male breadwinner norm, low income as a source of stress and conflict, and rising economic standards associated with marriage (the marriage bar). Because of conflicting evidence and data constraints, however, important theoretical questions remain. This study uses survival analysis with prospective monthly data from nationally representative panels of the Survey of Income and Program Participation from 1996-2013 to test alternative theories of how money and work affect whether cohabiting couples marry or separate. Analyses indicate that the economic foundations of cohabiting couples' union transitions do not lie in economic specialization or only men's ability to be good providers. Instead, results for marriage support marriage bar theory: adjusting for couples' absolute earnings, increases in wealth and couples' earnings relative to a standard associated with marriage strongly predict marriage. For dissolution, couples with higher and more equal earnings are significantly less likely to separate. Findings demonstrate that within-couple earnings equality promotes stability, and between-couple inequalities in economic resources are critical in producing inequalities in couples' relationship outcomes.
-
Magnetically coupled impedance-source inverters
DEFF Research Database (Denmark)
Loh, Poh Chiang; Blaabjerg, Frede
2012-01-01
input-to-output gain, and the presence of an impedance network. The former means a high dc-link voltage, which can stress the semiconductor switches unnecessarily. The latter leads to increases in cost and size, which similarly are undesirable. To lessen these concerns, an interesting approach is to use...... magnetically coupled transformers or inductors to raise the gain and modulation ratio simultaneously, while reducing the number of passive components needed. A study of the approach is now presented to show how various existing magnetically coupled inverters can be derived by applying a generic methodology....... The same methodology is then applied to develop more magnetically coupled Z-source inverters with advantages that have not been identified in the literature. These findings have already been proven in experiments....
-
Neuron-glia metabolic coupling and plasticity.
Magistretti, Pierre J
2006-06-01
The coupling between synaptic activity and glucose utilization (neurometabolic coupling) is a central physiological principle of brain function that has provided the basis for 2-deoxyglucose-based functional imaging with positron emission tomography (PET). Astrocytes play a central role in neurometabolic coupling, and the basic mechanism involves glutamate-stimulated aerobic glycolysis; the sodium-coupled reuptake of glutamate by astrocytes and the ensuing activation of the Na-K-ATPase triggers glucose uptake and processing via glycolysis, resulting in the release of lactate from astrocytes. Lactate can then contribute to the activity-dependent fuelling of the neuronal energy demands associated with synaptic transmission. An operational model, the 'astrocyte-neuron lactate shuttle', is supported experimentally by a large body of evidence, which provides a molecular and cellular basis for interpreting data obtained from functional brain imaging studies. In addition, this neuron-glia metabolic coupling undergoes plastic adaptations in parallel with adaptive mechanisms that characterize synaptic plasticity. Thus, distinct subregions of the hippocampus are metabolically active at different time points during spatial learning tasks, suggesting that a type of metabolic plasticity, involving by definition neuron-glia coupling, occurs during learning. In addition, marked variations in the expression of genes involved in glial glycogen metabolism are observed during the sleep-wake cycle, with in particular a marked induction of expression of the gene encoding for protein targeting to glycogen (PTG) following sleep deprivation. These data suggest that glial metabolic plasticity is likely to be concomitant with synaptic plasticity.
-
Two Superconducting Charge Qubits Coupled by a Josephson Inductance
Watanabe, Michio; Yamamoto, Tsuyoshi; Pashkin, Yuri A.; Astafiev, Oleg; Nakamura, Yasunobu; Tsai, Jaw-Shen
2007-03-01
When the quantum oscillations [Pashkin et al., Nature 421, 823 (2003)] and the conditional gate operation [Yamamoto et al., Nature 425, 941 (2003)] were demonstrated using superconducting charge qubits, the charge qubits were coupled capacitively, where the coupling was always on and the coupling strength was not tunable. This fixed coupling, however, is not ideal because for example, it makes unconditional gate operations difficult. In this work, we aimed to tunably couple two charge qubits. We fabricated circuits based on the theoretical proposal by You, Tsai, and Nori [PRB 68, 024510 (2003)], where the inductance of a Josephson junction, which has a much larger junction area than the qubit junctions, couples the qubits and the coupling strength is controlled by the external magnetic flux. We confirmed by spectroscopy that the large Josephson junction was indeed coupled to the qubits and that the coupling was turned on and off by the external magnetic flux. In the talk, we will also discuss the quantum oscillations in the circuits.
-
Directory of Open Access Journals (Sweden)
Allison Ruark
Full Text Available Available data suggest that individual and family well-being are linked to the quality of women's and men's couple relationships, but few tools exist to assess couple relationship functioning in low- and middle-income countries. In response to this gap, Catholic Relief Services has developed a Couple Functionality Assessment Tool (CFAT to capture valid and reliable data on various domains of relationship quality. This tool is designed to be used by interventions which aim to improve couple and family well-being as a means of measuring the effectiveness of these interventions, particularly related to couple relationship quality. We carried out a validation study of the CFAT among 401 married and cohabiting adults (203 women and 198 men in rural Chikhwawa District, Malawi. Using psychometric scales, the CFAT addressed six domains of couple relationship quality (intimacy, partner support, sexual satisfaction, gender roles, decision-making, and communication and conflict management, and included questions on intimate partner violence. We used exploratory factor analysis to assess scale performance of each domain and produce a shortened Relationship Quality Index (RQI composed of items from five relationship quality domains. This article reports the performance of the RQI. Internal reliability and validity of the RQI were found to be good. Regression analyses examined the relationship of the RQI to outcomes important to health and development: intra-household cooperation, positive health behaviors, intimate partner violence, and gender-equitable norms. We found many significant correlations between RQI scores and these couple- and family-level development issues. There is a need to further validate the tool with use in other populations as well as to continue to explore whether the observed linkages between couple functionality and development outcomes are causal relationships.
-
Mode coupling in spin torque oscillators
International Nuclear Information System (INIS)
Zhang, Steven S.-L.; Zhou, Yan; Li, Dong; Heinonen, Olle
2016-01-01
A number of recent experimental works have shown that the dynamics of a single spin torque oscillator can exhibit complex behavior that stems from interactions between two or more modes of the oscillator, such as observed mode-hopping or mode coexistence. There has been some initial work indicating how the theory for a single-mode (macro-spin) spin torque oscillator should be generalized to include several modes and the interactions between them. In the present work, we rigorously derive such a theory starting with the Landau–Lifshitz–Gilbert equation for magnetization dynamics by expanding up to third-order terms in deviation from equilibrium. Our results show how a linear mode coupling, which is necessary for observed mode-hopping to occur, arises through coupling to a magnon bath. The acquired temperature dependence of this coupling implies that the manifold of orbits and fixed points may shift with temperature. - Highlights: • Deriving equations for coupled modes in spin torque oscillators. • Including Hamiltonian formalism and elimination of three–magnon processes. • Thermal bath of magnons central to mode coupling. • Numerical examples of circular and elliptical devices.
-
Mode coupling in spin torque oscillators
Energy Technology Data Exchange (ETDEWEB)
Zhang, Steven S.-L., E-mail: ZhangShule@missouri.edu [Department of Physics and Astronomy, University of Missouri, Columbia, MO 65211 (United States); Zhou, Yan, E-mail: yanzhou@hku.hk [Department of Physics, The University of Hong Kong, Hong Kong (China); Center of Theoretical and Computational Physics, University of Hong Kong, Hong Kong (China); Li, Dong, E-mail: geodesic.ld@gmail.com [Department of Physics, Centre for Nonlinear Studies, and Beijing-Hong Kong-Singapore Joint Centre for Nonlinear and Complex Systems, Hong Kong Baptist University, Kowloon Tong, Hong Kong (China); Heinonen, Olle, E-mail: heinonen@anl.gov [Material Science Division, Argonne National Laboratory, Lemont, IL 60439 (United States); Northwestern-Argonne Institute of Science and Technology, 2145 Sheridan Road, Evanston, IL 60208 (United States); Computation Institute, The Unversity of Chicago, 5735 S Ellis Avenue, Chicago, IL 60637 (United States)
2016-09-15
A number of recent experimental works have shown that the dynamics of a single spin torque oscillator can exhibit complex behavior that stems from interactions between two or more modes of the oscillator, such as observed mode-hopping or mode coexistence. There has been some initial work indicating how the theory for a single-mode (macro-spin) spin torque oscillator should be generalized to include several modes and the interactions between them. In the present work, we rigorously derive such a theory starting with the Landau–Lifshitz–Gilbert equation for magnetization dynamics by expanding up to third-order terms in deviation from equilibrium. Our results show how a linear mode coupling, which is necessary for observed mode-hopping to occur, arises through coupling to a magnon bath. The acquired temperature dependence of this coupling implies that the manifold of orbits and fixed points may shift with temperature. - Highlights: • Deriving equations for coupled modes in spin torque oscillators. • Including Hamiltonian formalism and elimination of three–magnon processes. • Thermal bath of magnons central to mode coupling. • Numerical examples of circular and elliptical devices.
-
Cation-Coupled Bicarbonate Transporters
Aalkjaer, Christian; Boedtkjer, Ebbe; Choi, Inyeong; Lee, Soojung
2014-01-01
Cation-coupled HCO3− transport was initially identified in the mid-1970s when pioneering studies showed that acid extrusion from cells is stimulated by CO2/HCO3− and associated with Na+ and Cl− movement. The first Na+-coupled bicarbonate transporter (NCBT) was expression-cloned in the late 1990s. There are currently five mammalian NCBTs in the SLC4-family: the electrogenic Na,HCO3-cotransporters NBCe1 and NBCe2 (SLC4A4 and SLC4A5 gene products); the electroneutral Na,HCO3-cotransporter NBCn1 ...
-
Grating-Coupled Waveguide Cloaking
International Nuclear Information System (INIS)
Wang Jia-Fu; Qu Shao-Bo; Ma Hua; Wang Cong-Min; Wang Xin-Hua; Zhou Hang; Xu Zhuo; Xia Song
2012-01-01
Based on the concept of a grating-coupled waveguide (GCW), a new strategy for realizing EM cloaking is presented. Using metallic grating, incident waves are firstly coupled into the effective waveguide and then decoupled into free space behind, enabling EM waves to pass around the obstacle. Phase compensation in the waveguide keeps the wave-front shape behind the obstacle unchanged. Circular, rectangular and triangular cloaks are presented to verify the robustness of the GCW cloaking. Electric field animations and radar cross section (RCS) comparisons convincingly demonstrate the cloaking effect
-
Apodized coupled resonator waveguides.
Capmany, J; Muñoz, P; Domenech, J D; Muriel, M A
2007-08-06
In this paper we propose analyse the apodisation or windowing of the coupling coefficients in the unit cells of coupled resonator waveguide devices (CROWs) as a means to reduce the level of secondary sidelobes in the bandpass characteristic of their transfer functions. This technique is regularly employed in the design of digital filters and has been applied as well in the design of other photonic devices such as corrugated waveguide filters and fiber Bragg gratings. The apodisation of both Type-I and Type-II structures is discussed for several windowing functions.
-
Directory of Open Access Journals (Sweden)
M Sodani
2017-07-01
Full Text Available Abstract Background and Aim: Intimacy is a key characteristic of marital relationships and is one of the most prominent characteristics of a successful marriage. Communication patterns can also determine marital satisfaction. The aim of this study was to determine the effectiveness of coupled collaborative therapy on communication patterns and intimacy of couples referring to Behbahan counseling centers. Methods: In this research, a single-trial experimental design, which was also called a single-trial trial, was used as a clinical trial. This design has different types. In the present study, several asynchronous base lines were used. Contrary to large-scale group comparison schemes, this design focuses on individual levels, not on average differences in pre-test and post-test. Another point of this plan is that fewer subjects are needed and couples completed the intimate questionnaire and communication patterns on the baseline, treatment and follow-up. Purposeful sampling was voluntary. The population of the study consisted of all disturbed couples referring to Behbahan psychological clinics. From these couples, 3 couples were selected based on entry and exit criteria. For analyzing the data, visual analysis (chart drawing, clinical significance (the changeover index and normative comparison, as well as the percentage of recovery, have been used. Results: The results indicated that couples experience improvement in intimacy (30.95% and interactive constructive communication model (47.05%, and in the communication model, the expected return (29.55% and communication pattern Interactive avoidance (33.64% showed a decrease. Likewise, data analysis using normative comparison showed that the couples after the treatment did not differ from the couples to the norm. Conclusion: Participatory couples’s therapy may increase the intimacy and constructive communication patterns and decrease the communication patterns of waiting and withdrawal
-
Exploring AdS waves via nonminimal coupling
International Nuclear Information System (INIS)
Ayon-Beato, Eloy; Hassaiene, Mokhtar
2006-01-01
We consider nonminimally coupled scalar fields to explore the Siklos spacetimes in three dimensions. Their interpretation as exact gravitational waves propagating on AdS space restrict the source to behave as a pure radiation field. We show that the related pure radiation constraints single out a unique self-interaction potential depending on one coupling constant. For a vanishing coupling constant, this potential reduces to a mass term with a mass fixed in terms of the nonminimal-coupling parameter. This mass dependence allows the existence of several free cases including massless and tachyonic sources. There even exists a particular value of the nonminimal-coupling parameter for which the corresponding mass exactly compensates the contribution generated by the negative scalar curvature, producing a genuinely massless field in this curved background. The self-interacting case is studied in detail for the conformal coupling. The resulting gravitational wave is formed by the superposition of the free and the self-interaction contributions, except for a critical value of the coupling constant where a nonperturbative effect relating the strong and weak regimes of the source appears. We establish a correspondence between the scalar source supporting an AdS wave and a pp wave by showing that their respective pure radiation constraints are conformally related, while their involved backgrounds are not. Finally, we consider the AdS waves for topologically massive gravity and its limit to conformal gravity
-
Shear viscosities of photons in strongly coupled plasmas
Directory of Open Access Journals (Sweden)
Di-Lun Yang
2016-09-01
Full Text Available We investigate the shear viscosity of thermalized photons in the quark gluon plasma (QGP at weak coupling and N=4 super Yang–Mills plasma (SYMP at both strong and weak couplings. We find that the shear viscosity due to the photon–parton scattering up to the leading order of electromagnetic coupling is suppressed when the coupling of the QGP/SYMP is increased, which stems from the blue-shift of the thermal-photon spectrum at strong coupling. In addition, the shear viscosity rapidly increases near the deconfinement transition in a phenomenological model analogous to the QGP.
-
Spin Pumping in Electrodynamically Coupled Magnon-Photon Systems.
Bai, Lihui; Harder, M; Chen, Y P; Fan, X; Xiao, J Q; Hu, C-M
2015-06-05
We use electrical detection, in combination with microwave transmission, to investigate both resonant and nonresonant magnon-photon coupling at room temperature. Spin pumping in a dynamically coupled magnon-photon system is found to be distinctly different from previous experiments. Characteristic coupling features such as modes anticrossing, linewidth evolution, peculiar line shape, and resonance broadening are systematically measured and consistently analyzed by a theoretical model set on the foundation of classical electrodynamic coupling. Our experimental and theoretical approach paves the way for pursuing microwave coherent manipulation of pure spin current via the combination of spin pumping and magnon-photon coupling.
-
Coupling correction using closed orbit measurements
International Nuclear Information System (INIS)
Safranek, J.; Krinsky, S.
1994-01-01
The authors describe a coupling correction scheme they have developed and used to successfully reduce the vertical emittance of the NSLS X-Ray ring by a factor of 6 to below 2 A. This gives a vertical to horizontal emittance ratio of less than 0.2%. They find the strengths of 17 skew quadrupoles to simultaneously minimize the vertical dispersion and the coupling. As a measure of coupling they utilize the shift in vertical closed orbit resulting from a change in strength of a horizontal steering magnet. Experimental measurements confirm the reduced emittance
-
Coupled seismic and electromagnetic wave propagation
Schakel, M.D.
2011-01-01
Coupled seismic and electromagnetic wave propagation is studied theoretically and experimentally. This coupling arises because of the electrochemical double layer, which exists along the solid-grain/fluid-electrolyte boundaries of porous media. Within the double layer, charge is redistributed,
-
Congruence Couple Therapy for Pathological Gambling
Lee, Bonnie K.
2009-01-01
Couple therapy models for pathological gambling are limited. Congruence Couple Therapy is an integrative, humanistic, systems model that addresses intrapsychic, interpersonal, intergenerational, and universal-spiritual disconnections of pathological gamblers and their spouses to shift towards congruence. Specifically, CCT's theoretical…
-
Principle of Global Decoupling with Coupling Angle Modulation
Luo, Yun; Pilat, Fulvia Caterina; Roser, Thomas; Trbojevic, Dejan
2005-01-01
The global betatron decoupling on the ramp is an important issue for the operation of the Relativistic Heavy Ion Collider (RHIC). A new scheme coupling phase modulation is found. It introduces a rotating extra coupling into the coupled machine to detect the residual coupling. The eigentune responses are measured with a high resolution phase lock loop (PLL) system. From the minimum and maximum tune splits, the correction strengths are given. The time period occupied by one coupling phase modulation is less than 10 seconds. So it is a very promising solution for the global decoupling on the ramp. In this article the principle of the coupling phase modulation is given. The simulation with the smooth accelerator model is also done. The practical issues concerning its applications are discussed.
-
Electromagnetic Pulse Coupling Analysis of Electronic Equipment
Hong Lei; Qingying LI
2017-01-01
High-intensity nuclear explosion caused by high-altitude nuclear electromagnetic pulse through the antenna, metal cables, holes and other channels, coupled with very high energy into the electronic device, and cause serious threats. In this paper, the mechanism, waveform, coupling path and damage effect of nuclear electromagnetic pulse is analyzed, and the coupling mechanism of nuclear electromagnetic pulse is studied.
-
Protein dynamics revealed in the excitonic spectra of single LH2 complexes
International Nuclear Information System (INIS)
Valkunas, Leonas; Janusonis, Julius; Rutkauskas, Danielis; Grondelle, Rienk van
2007-01-01
The fluorescence emission spectrum of single peripheral light-harvesting (LH2) complexes of the photosynthetic purple bacterium Rhodopseudomonas acidophila exhibits remarkable dynamics on a time scale of several minutes. Often the spectral properties are quasi-stable; sometimes large spectral jumps to the blue or to the red are observed. To explain the dynamics, every pigment is proposed to be in two conformational substates with different excitation energies, which originate from the conformational state of the protein as a result of pigment-protein interaction. Due to the excitonic coupling in the ring of 18 pigments, the two-state assumption generates a substantial amount of distinct spectroscopic states, which reflect part of the inhomogeneous distributed spectral properties of LH2. To describe the observed dynamics, spontaneous and light-induced transitions are introduced between the two states. For each 'realization of the disorder', the spectral properties are calculated using a disordered exciton model combined with the modified Redfield theory to obtain realistic spectral line shapes. The single-molecule fluorescence peak (FLP) distribution, the distribution dependence on the excitation intensity, and the FLP time traces are well described within the framework of this model
-
Feedback coupling in dynamical systems
Trimper, Steffen; Zabrocki, Knud
2003-05-01
Different evolution models are considered with feedback-couplings. In particular, we study the Lotka-Volterra system under the influence of a cumulative term, the Ginzburg-Landau model with a convolution memory term and chemical rate equations with time delay. The memory leads to a modified dynamical behavior. In case of a positive coupling the generalized Lotka-Volterra system exhibits a maximum gain achieved after a finite time, but the population will die out in the long time limit. In the opposite case, the time evolution is terminated in a crash. Due to the nonlinear feedback coupling the two branches of a bistable model are controlled by the the strength and the sign of the memory. For a negative coupling the system is able to switch over between both branches of the stationary solution. The dynamics of the system is further controlled by the initial condition. The diffusion-limited reaction is likewise studied in case the reacting entities are not available simultaneously. Whereas for an external feedback the dynamics is altered, but the stationary solution remain unchanged, a self-organized internal feedback leads to a time persistent solution.
-
Bioregional Planning in Central Georgia, USA
National Research Council Canada - National Science Library
Dale, Virginia; Aldridge, Matthew; Arthur, Taryn; Baskaran, Latha; Berry, Michael; Chang, Michael; Efroymson, Rebecca; Garten, Chuck; Stewart, Catherine; Washington-Allen, Robert
2005-01-01
...% of the native longleaf pine (Pinus palustris) forest remains intact. Besides the loss of species, habitats, and ecosystem services associated with longleaf pine forests, the environmental concerns of the region include air, water, and noise pollution...
-
Fractional dynamical model for neurovascular coupling
Belkhatir, Zehor; Laleg-Kirati, Taous-Meriem
2014-01-01
The neurovascular coupling is a key mechanism linking the neural activity to the hemodynamic behavior. Modeling of this coupling is very important to understand the brain function but it is at the same time very complex due to the complexity
-
Intimacy and sexual risk behaviour in serodiscordant male couples.
Remien, R H; Carballo-Diéguez, A; Wagner, G
1995-01-01
Several studies have demonstrated individual-level determinants of HIV sexual risk behaviour. Very little research has been conducted to identify couple-level factors associated with unsafe sexual behaviour. As part of a three-year study of more than 100 serodiscordant male couples, we conducted an in-depth qualitative study of 15 Latino and non-Latino male couples via focus groups and a follow-up telephone survey. We identified the sexual risk behaviour that occurs in these male couples, their perceptions of susceptibility for HIV transmission, and numerous couple-level and intrapsychic factors associated with their risk behaviour. We also describe the challenges confronted by these couples and barriers to emotional intimacy and couple satisfaction. Finally, we provide suggestions for ways of intervening to facilitate improved couple functioning, pleasure, satisfaction, and communication, and ways of reducing sexual risk behaviour without loss of emotional intimacy.
-
Synchronization of hyperchaotic oscillators via single unidirectional chaotic-coupling
International Nuclear Information System (INIS)
Zou Yanli; Zhu Jie; Chen Guanrong; Luo Xiaoshu
2005-01-01
In this paper, synchronization of two hyperchaotic oscillators via a single variable's unidirectional coupling is studied. First, the synchronizability of the coupled hyperchaotic oscillators is proved mathematically. Then, the convergence speed of this synchronization scheme is analyzed. In order to speed up the response with a relatively large coupling strength, two kinds of chaotic coupling synchronization schemes are proposed. In terms of numerical simulations and the numerical calculation of the largest conditional Lyapunov exponent, it is shown that in a given range of coupling strengths, chaotic-coupling synchronization is quicker than the typical continuous-coupling synchronization. Furthermore, A circuit realization based on the chaotic synchronization scheme is designed and Pspice circuit simulation validates the simulated hyperchaos synchronization mechanism
-
Intermarried Couples, gender positions and mental well being
DEFF Research Database (Denmark)
Singla, Rashmi
‘North’ (Denmark). Despite increase in numbers, intermarried couples are still almost invisible as a statistical category and in psychosocial services in the Danish context. The theoretical framework combines intersectionality approach, with life course perspective and the everyday life practices....... Implications for relevant mental health promotion and counselling for distressed couples are also included. Keywords: intermarried couples, visible ethnically different couples. intersectionality approach, gender positions, structural barriers, health promotion...
-
Membrane Curvature Induced by Aggregates of LH2s and Monomeric LH1s
Chandler, Danielle E.; Gumbart, James; Stack, John D.; Chipot, Christophe; Schulten, Klaus
2009-01-01
The photosynthetic apparatus of purple bacteria is contained within organelles called chromatophores, which form as extensions of the cytoplasmic membrane. The shape of these chromatophores can be spherical (as in Rhodobacter sphaeroides), lamellar (as in Rhodopseudomonas acidophila and Phaeospirillum molischianum), or tubular (as in certain Rb. sphaeroides mutants). Chromatophore shape is thought to be influenced by the integral membrane proteins Light Harvesting Complexes I and II (LH1 and ...
-
Münch, Ingo; Neff, Patrizio; Madeo, Angela; Ghiba, Ionel-Dumitrel
2015-01-01
We show that the reasoning in favor of a symmetric couple stress tensor in Yang et al.'s introduction of the modified couple stress theory contains a gap, but we present a reasonable physical hypothesis, implying that the couple stress tensor is traceless and may be symmetric anyway. To this aim, the origin of couple stress is discussed on the basis of certain properties of the total stress itself. In contrast to classical continuum mechanics, the balance of linear momentum and the balance of...
-
Directory of Open Access Journals (Sweden)
Muhammad Iqbal
2014-01-01
Full Text Available This paper investigates the chaotic behavior and synchronization of two different coupled chaotic FitzHugh-Nagumo (FHN neurons with unknown parameters under external electrical stimulation (EES. The coupled FHN neurons of different parameters admit unidirectional and bidirectional gap junctions in the medium between them. Dynamical properties, such as the increase in synchronization error as a consequence of the deviation of neuronal parameters for unlike neurons, the effect of difference in coupling strengths caused by the unidirectional gap junctions, and the impact of large time-delay due to separation of neurons, are studied in exploring the behavior of the coupled system. A novel integral-based nonlinear adaptive control scheme, to cope with the infeasibility of the recovery variable, for synchronization of two coupled delayed chaotic FHN neurons of different and unknown parameters under uncertain EES is derived. Further, to guarantee robust synchronization of different neurons against disturbances, the proposed control methodology is modified to achieve the uniformly ultimately bounded synchronization. The parametric estimation errors can be reduced by selecting suitable control parameters. The effectiveness of the proposed control scheme is illustrated via numerical simulations.
-
Sexual and Reproductive Health in HIV Serodiscordant Couples
African Journals Online (AJOL)
AJRH Managing Editor
Keywords: HIV, Serodiscordant couple, Conception, Contraception, infertility. Résumé. Les couples ... risk of sexual transmission of HIV from male-to- female as 0.1-0.3% per ... Antiretroviral Drugs in Serodiscordant Couples. The use of ARV ...
-
Weakly and strongly coupled Belousov-Zhabotinsky patterns
Weiss, Stephan; Deegan, Robert D.
2017-02-01
We investigate experimentally and numerically the synchronization of two-dimensional spiral wave patterns in the Belousov-Zhabotinsky reaction due to point-to-point coupling of two separate domains. Different synchronization modalities appear depending on the coupling strength and the initial patterns in each domain. The behavior as a function of the coupling strength falls into two qualitatively different regimes. The weakly coupled regime is characterized by inter-domain interactions that distorted but do not break wave fronts. Under weak coupling, spiral cores are pushed around by wave fronts in the other domain, resulting in an effective interaction between cores in opposite domains. In the case where each domain initially contains a single spiral, the cores form a bound pair and orbit each other at quantized distances. When the starting patterns consist of multiple randomly positioned spiral cores, the number of cores decreases with time until all that remains are a few cores that are synchronized with a partner in the other domain. The strongly coupled regime is characterized by interdomain interactions that break wave fronts. As a result, the wave patterns in both domains become identical.
-
Temporality of couple conflict and relationship perceptions.
Johnson, Matthew D; Horne, Rebecca M; Hardy, Nathan R; Anderson, Jared R
2018-05-03
Using 5 waves of longitudinal survey data gathered from 3,405 couples, the present study investigates the temporal associations between self-reported couple conflict (frequency and each partner's constructive and withdrawing behaviors) and relationship perceptions (satisfaction and perceived instability). Autoregressive cross-lagged model results revealed couple conflict consistently predicted future relationship perceptions: More frequent conflict and withdrawing behaviors and fewer constructive behaviors foretold reduced satisfaction and conflict frequency and withdrawal heightened perceived instability. Relationship perceptions also shaped future conflict, but in surprising ways: Perceptions of instability were linked with less frequent conflict, and male partner instability predicted fewer withdrawing behaviors for female partners. Higher satisfaction from male partners also predicted more frequent and less constructive conflict behavior in the future. These findings illustrate complex bidirectional linkages between relationship perceptions and couple conflict behaviors in the development of couple relations. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
-
Vinyldisiloxanes: their synthesis, cross coupling and applications.
Sore, Hannah F; Boehner, Christine M; Laraia, Luca; Logoteta, Patrizia; Prestinari, Cora; Scott, Matthew; Williams, Katharine; Galloway, Warren R J D; Spring, David R
2011-01-21
During the studies towards the development of pentafluorophenyldimethylsilanes as a novel organosilicon cross coupling reagent it was revealed that the active silanolate and the corresponding disiloxane formed rapidly under basic conditions. The discovery that disiloxanes are in equilibrium with the silanolate led to the use of disiloxanes as cross coupling partners under fluoride free conditions. Our previous report focused on the synthesis and base induced cross coupling of aryl substituted vinyldisiloxanes with aryl halides; good yields and selectivities were achieved. As a continuation of our research, studies into the factors which influence the successful outcome of the cross coupling reaction with both alkyl and aryl substituted vinyldisiloxanes were examined and a proposed mechanism discussed. Further investigation into expanding the breadth and diversity of substituted vinyldisiloxanes in cross coupling was explored and applied to the synthesis of unsymmetrical trans-stilbenes and cyclic structures containing the trans-alkene architecture.
-
Locomotive Crash Energy Management Coupling Tests
2018-04-18
This paper describes the results of the CEM equipped locomotive coupling tests. In this set of tests, a moving CEM locomotive was coupled to a standing cab car. The primary objective was to demonstrate the robustness of the PBC design and determine t...
-
Coupled Langmuir oscillations in 2-dimensional quantum plasmas
International Nuclear Information System (INIS)
Akbari-Moghanjoughi, M.
2014-01-01
In this work, we present a hydrodynamic model to study the coupled quantum electron plasma oscillations (QEPO) for two dimensional (2D) degenerate plasmas, which incorporates all the essential quantum ingredients such as the statistical degeneracy pressure, electron-exchange, and electron quantum diffraction effect. Effects of diverse physical aspects like the electronic band-dispersion effect, the electron exchange-correlations and the quantum Bohm-potential as well as other important plasma parameters such as the coupling parameter (plasma separation) and the plasma electron number-densities on the linear response of the coupled system are investigated. By studying three different 2D plasma coupling types, namely, graphene-graphene, graphene-metalfilm, and metalfilm-metalfilm coupling configurations, it is remarked that the collective quantum effects can influence the coupled modes quite differently, depending on the type of the plasma configuration. It is also found that the slow and fast QEPO frequency modes respond very differently to the change in plasma parameters. Current findings can help in understanding of the coupled density oscillations in multilayer graphene, graphene-based heterojunctions, or nanofabricated integrated circuits
-
Singlet-paired coupled cluster theory for open shells
Gomez, John A.; Henderson, Thomas M.; Scuseria, Gustavo E.
2016-06-01
Restricted single-reference coupled cluster theory truncated to single and double excitations accurately describes weakly correlated systems, but often breaks down in the presence of static or strong correlation. Good coupled cluster energies in the presence of degeneracies can be obtained by using a symmetry-broken reference, such as unrestricted Hartree-Fock, but at the cost of good quantum numbers. A large body of work has shown that modifying the coupled cluster ansatz allows for the treatment of strong correlation within a single-reference, symmetry-adapted framework. The recently introduced singlet-paired coupled cluster doubles (CCD0) method is one such model, which recovers correct behavior for strong correlation without requiring symmetry breaking in the reference. Here, we extend singlet-paired coupled cluster for application to open shells via restricted open-shell singlet-paired coupled cluster singles and doubles (ROCCSD0). The ROCCSD0 approach retains the benefits of standard coupled cluster theory and recovers correct behavior for strongly correlated, open-shell systems using a spin-preserving ROHF reference.
-
Singlet-paired coupled cluster theory for open shells
International Nuclear Information System (INIS)
Gomez, John A.; Henderson, Thomas M.; Scuseria, Gustavo E.
2016-01-01
Restricted single-reference coupled cluster theory truncated to single and double excitations accurately describes weakly correlated systems, but often breaks down in the presence of static or strong correlation. Good coupled cluster energies in the presence of degeneracies can be obtained by using a symmetry-broken reference, such as unrestricted Hartree-Fock, but at the cost of good quantum numbers. A large body of work has shown that modifying the coupled cluster ansatz allows for the treatment of strong correlation within a single-reference, symmetry-adapted framework. The recently introduced singlet-paired coupled cluster doubles (CCD0) method is one such model, which recovers correct behavior for strong correlation without requiring symmetry breaking in the reference. Here, we extend singlet-paired coupled cluster for application to open shells via restricted open-shell singlet-paired coupled cluster singles and doubles (ROCCSD0). The ROCCSD0 approach retains the benefits of standard coupled cluster theory and recovers correct behavior for strongly correlated, open-shell systems using a spin-preserving ROHF reference.
-
Conduction-coupled Tesla transformer.
Reed, J L
2015-03-01
A proof-of-principle Tesla transformer circuit is introduced. The new transformer exhibits the high voltage-high power output signal of shock-excited transformers. The circuit, with specification of proper circuit element values, is capable of obtaining extreme oscillatory voltages. The primary and secondary portions of the circuit communicate solely by conduction. The destructive arcing between the primary and secondary inductors in electromagnetically coupled transformers is ubiquitous. Flashover is eliminated in the new transformer as the high-voltage inductors do not interpenetrate and so do not possess an annular volume of electric field. The inductors are remote from one another. The high voltage secondary inductor is isolated in space, except for a base feed conductor, and obtains earth by its self-capacitance to the surroundings. Governing equations, for the ideal case of no damping, are developed from first principles. Experimental, theoretical, and circuit simulator data are presented for the new transformer. Commercial high-temperature superconductors are discussed as a means to eliminate the counter-intuitive damping due to small primary inductances in both the electromagnetic-coupled and new conduction-coupled transformers.
-
Integrating out resonances in strongly-coupled electroweak scenarios
Directory of Open Access Journals (Sweden)
Rosell Ignasi
2017-01-01
Full Text Available Accepting that there is a mass gap above the electroweak scale, the Electroweak Effective Theory (EWET is an appropriate tool to describe this situation. Since the EWET couplings contain information on the unknown high-energy dynamics, we consider a generic strongly-coupled scenario of electroweak symmetry breaking, where the known particle fields are coupled to heavier states. Then, and by integrating out these heavy fields, we study the tracks of the lightest resonances into the couplings. The determination of the low-energy couplings (LECs in terms of resonance parameters can be made more precise by considering a proper short-distance behaviour on the Lagrangian with heavy states, since the number of resonance couplings is then reduced. Notice that we adopt a generic non-linear realization of the electroweak symmetry breaking with a singlet Higgs.
-
Coupled skinny baker's maps and the Kaplan-Yorke conjecture
Gröger, Maik; Hunt, Brian R.
2013-09-01
The Kaplan-Yorke conjecture states that for ‘typical’ dynamical systems with a physical measure, the information dimension and the Lyapunov dimension coincide. We explore this conjecture in a neighborhood of a system for which the two dimensions do not coincide because the system consists of two uncoupled subsystems. We are interested in whether coupling ‘typically’ restores the equality of the dimensions. The particular subsystems we consider are skinny baker's maps, and we consider uni-directional coupling. For coupling in one of the possible directions, we prove that the dimensions coincide for a prevalent set of coupling functions, but for coupling in the other direction we show that the dimensions remain unequal for all coupling functions. We conjecture that the dimensions prevalently coincide for bi-directional coupling. On the other hand, we conjecture that the phenomenon we observe for a particular class of systems with uni-directional coupling, where the information and Lyapunov dimensions differ robustly, occurs more generally for many classes of uni-directionally coupled systems (also called skew-product systems) in higher dimensions.
-
Coupled skinny baker's maps and the Kaplan–Yorke conjecture
International Nuclear Information System (INIS)
Gröger, Maik; Hunt, Brian R
2013-01-01
The Kaplan–Yorke conjecture states that for ‘typical’ dynamical systems with a physical measure, the information dimension and the Lyapunov dimension coincide. We explore this conjecture in a neighborhood of a system for which the two dimensions do not coincide because the system consists of two uncoupled subsystems. We are interested in whether coupling ‘typically’ restores the equality of the dimensions. The particular subsystems we consider are skinny baker's maps, and we consider uni-directional coupling. For coupling in one of the possible directions, we prove that the dimensions coincide for a prevalent set of coupling functions, but for coupling in the other direction we show that the dimensions remain unequal for all coupling functions. We conjecture that the dimensions prevalently coincide for bi-directional coupling. On the other hand, we conjecture that the phenomenon we observe for a particular class of systems with uni-directional coupling, where the information and Lyapunov dimensions differ robustly, occurs more generally for many classes of uni-directionally coupled systems (also called skew-product systems) in higher dimensions. (paper)
-
Dissociative identity disorder and the process of couple therapy.
Macintosh, Heather B
2013-01-01
Couple therapy in the context of dissociative identity disorder (DID) has been neglected as an area of exploration and development in the couple therapy and trauma literature. What little discussion exists focuses primarily on couple therapy as an adjunct to individual therapy rather than as a primary treatment for couple distress and trauma. Couple therapy researchers have begun to develop adaptations to provide effective support to couples dealing with the impact of childhood trauma in their relationships, but little attention has been paid to the specific and complex needs of DID patients in couple therapy (H. B. MacIntosh & S. Johnson, 2008 ). This review and case presentation explores the case of "Lisa," a woman diagnosed with DID, and "Don," her partner, and illustrates the themes of learning to communicate, handling conflicting needs, responding to child alters, and addressing sexuality and education through their therapy process. It is the hope of the author that this discussion will renew interest in the field of couple therapy in the context of DID, with the eventual goal of developing an empirically testable model of treatment for couples.
-
A method for scientific code coupling in a distributed environment
International Nuclear Information System (INIS)
Caremoli, C.; Beaucourt, D.; Chen, O.; Nicolas, G.; Peniguel, C.; Rascle, P.; Richard, N.; Thai Van, D.; Yessayan, A.
1994-12-01
This guide book deals with coupling of big scientific codes. First, the context is introduced: big scientific codes devoted to a specific discipline coming to maturity, and more and more needs in terms of multi discipline studies. Then we describe different kinds of code coupling and an example of code coupling: 3D thermal-hydraulic code THYC and 3D neutronics code COCCINELLE. With this example we identify problems to be solved to realize a coupling. We present the different numerical methods usable for the resolution of coupling terms. This leads to define two kinds of coupling: with the leak coupling, we can use explicit methods, and with the strong coupling we need to use implicit methods. On both cases, we analyze the link with the way of parallelizing code. For translation of data from one code to another, we define the notion of Standard Coupling Interface based on a general structure for data. This general structure constitutes an intermediary between the codes, thus allowing a relative independence of the codes from a specific coupling. The proposed method for the implementation of a coupling leads to a simultaneous run of the different codes, while they exchange data. Two kinds of data communication with message exchange are proposed: direct communication between codes with the use of PVM product (Parallel Virtual Machine) and indirect communication with a coupling tool. This second way, with a general code coupling tool, is based on a coupling method, and we strongly recommended to use it. This method is based on the two following principles: re-usability, that means few modifications on existing codes, and definition of a code usable for coupling, that leads to separate the design of a code usable for coupling from the realization of a specific coupling. This coupling tool available from beginning of 1994 is described in general terms. (authors). figs., tabs
-
Pension plan participation among married couples.
Dushi, Irena; Iams, Howard M
2013-01-01
We present descriptive statistics on pension participation and types of pensions among married couples, using data from the 1996/2008 Panels of the Survey of Income and Program Participation and Social Security administrative records. Previous research has focused on pension coverage by marital status, but has not examined couples as a unit. Because couples usually share income, viewing them as a unit provides a better picture of potential access to income from retirement plans. Our analysis compares 1998 and 2009 data because substantial changes occurred in the pension landscape over this decade that could have influenced the prevalence of different pension plans, although we observe modest changes in participation rates and types of plans over the period. We find that in 20 percent of couples, neither spouse participated in a pension plan; in 10 percent, the wife was the only participant; and in 37 percent, the husband was the only participant.
-
Gauge coupling unification in six dimensions
Energy Technology Data Exchange (ETDEWEB)
Lee, H.M. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)]|[Carnegie-Mellon Univ., Pittsburgh, PA (United States). Dept. of Physics
2006-11-15
We compute the one-loop gauge couplings in six-dimensional non-Abelian gauge theories on the T{sup 2}/Z{sub 2} orbifold with general GUT breaking boundary conditions. For concreteness, we apply the obtained general formulae to the gauge coupling running in a 6D SO(10) orbifold GUT where the GUT group is broken down to the standard model gauge group up to an extra U(1). We find that the one-loop corrections depend on the parity matrices encoding the orbifold boundary conditions as well as the volume and shape moduli of extra dimensions. When the U(1) is broken by the VEV of bulk singlets, the accompanying extra color triplets also affect the unification of the gauge couplings. In this case, the B-L breaking scale is closely linked to the compactification scales for maintaining a success of the gauge coupling unification. (orig.)
-
Coupled DM Heating in SCDEW Cosmologies
Directory of Open Access Journals (Sweden)
Silvio Bonometto
2017-08-01
Full Text Available Strongly-Coupled Dark Energy plus Warm dark matter (SCDEW cosmologies admit the stationary presence of ∼1% of coupled-DM and DE, since inflationary reheating. Coupled-DM fluctuations therefore grow up to non-linearity even in the early radiative expansion. Such early non-linear stages are modelized here through the evolution of a top-hat density enhancement, reaching an early virial balance when the coupled-DM density contrast is just 25–26, and the DM density enhancement is ∼10 % of the total density. During the time needed to settle in virial equilibrium, the virial balance conditions, however, continue to modify, so that “virialized” lumps undergo a complete evaporation. Here, we outline that DM particles processed by overdensities preserve a fraction of their virial momentum. Although fully non-relativistic, the resulting velocities (moderately affect the fluctuation dynamics over greater scales, entering the horizon later on.
-
Running coupling corrections to high energy inclusive gluon production
International Nuclear Information System (INIS)
Horowitz, W.A.; Kovchegov, Yuri V.
2011-01-01
We calculate running coupling corrections for the lowest-order gluon production cross section in high energy hadronic and nuclear scattering using the BLM scale-setting prescription. In the final answer for the cross section the three powers of fixed coupling are replaced by seven factors of running coupling, five in the numerator and two in the denominator, forming a 'septumvirate' of running couplings, analogous to the 'triumvirate' of running couplings found earlier for the small-x BFKL/BK/JIMWLK evolution equations. It is interesting to note that the two running couplings in the denominator of the 'septumvirate' run with complex-valued momentum scales, which are complex conjugates of each other, such that the production cross section is indeed real. We use our lowest-order result to conjecture how running coupling corrections may enter the full fixed-coupling k T -factorization formula for gluon production which includes nonlinear small-x evolution.
-
Optical switching of nuclear spin-spin couplings in semiconductors.
Goto, Atsushi; Ohki, Shinobu; Hashi, Kenjiro; Shimizu, Tadashi
2011-07-05
Two-qubit operation is an essential part of quantum computation. However, solid-state nuclear magnetic resonance quantum computing has not been able to fully implement this functionality, because it requires a switchable inter-qubit coupling that controls the time evolutions of entanglements. Nuclear dipolar coupling is beneficial in that it is present whenever nuclear-spin qubits are close to each other, while it complicates two-qubit operation because the qubits must remain decoupled to prevent unwanted couplings. Here we introduce optically controllable internuclear coupling in semiconductors. The coupling strength can be adjusted externally through light power and even allows on/off switching. This feature provides a simple way of switching inter-qubit couplings in semiconductor-based quantum computers. In addition, its long reach compared with nuclear dipolar couplings allows a variety of options for arranging qubits, as they need not be next to each other to secure couplings.
-
Optical switching of nuclear spin–spin couplings in semiconductors
Goto, Atsushi; Ohki, Shinobu; Hashi, Kenjiro; Shimizu, Tadashi
2011-01-01
Two-qubit operation is an essential part of quantum computation. However, solid-state nuclear magnetic resonance quantum computing has not been able to fully implement this functionality, because it requires a switchable inter-qubit coupling that controls the time evolutions of entanglements. Nuclear dipolar coupling is beneficial in that it is present whenever nuclear–spin qubits are close to each other, while it complicates two-qubit operation because the qubits must remain decoupled to prevent unwanted couplings. Here we introduce optically controllable internuclear coupling in semiconductors. The coupling strength can be adjusted externally through light power and even allows on/off switching. This feature provides a simple way of switching inter-qubit couplings in semiconductor-based quantum computers. In addition, its long reach compared with nuclear dipolar couplings allows a variety of options for arranging qubits, as they need not be next to each other to secure couplings. PMID:21730962
-
A novel bridge coupler for SSC coupled cavity linac
International Nuclear Information System (INIS)
Yao, C.G.; Chang, C.R.; Funk, W.
1992-01-01
A novel magnetically coupled multi-cavity bridge coupler is proposed for SSC Coupled-Cavity-Linac (CCL). The bridge coupler is a five cell disc-loaded waveguide with a small central aperture used for measurement and two large curved coupling slots near the edge on each disc. The two coupling slots on the adjacent disc are rotated 90 degrees in orientation to reduce the direct coupling. This type of structure is capable of producing very large coupling (>10% in our longest bridge coupler). Also because of the small opening on the discs, the high-order-modes are very far (> 300 MHz) above the operating mode. Thus for long bridge couplers, the magnetic coupled structure should provide maximum coupling with minimum mode mixing problems. In this paper both physics and engineering issues of this new bridge coupler are presented. (Author) 5 refs., 2 tabs., 6 figs
-
Noether symmetry for non-minimally coupled fermion fields
International Nuclear Information System (INIS)
Souza, Rudinei C de; Kremer, Gilberto M
2008-01-01
A cosmological model where a fermion field is non-minimally coupled with the gravitational field is studied. By applying Noether symmetry the possible functions for the potential density of the fermion field and for the coupling are determined. Cosmological solutions are found showing that the non-minimally coupled fermion field behaves as an inflaton describing an inflationary scenario, whereas the minimally coupled fermion field describes a decelerated period, behaving as a standard matter field
-
Evaluation of Air Coupled Ultrasound for Composite Aerospace Structure
Tat, H.; Georgeson, G.; Bossi, R.
2009-03-01
Non-contact air coupled ultrasound suffers from the high acoustic impedance mismatch characteristics of air to solid interfaces. Advances in transducer technology, particularly MEMS, have improved the acoustic impedance match at the transmission stage and the signal to noise at the reception stage. Comparisons of through transmission (TTU) scanning of laminate and honeycomb test samples using conventional piezoelectric air coupled transducers, new MEMS air coupled transducers, and standard water coupled inspections have been performed to assess the capability. An additional issue for air coupled UT inspection is the need for a lean implementation for both manufacturing and in-service operations. Concepts and applications utilizing magnetic coupling of transducers have been developed that allows air coupled inspection operations in compact low cost configurations.
-
Formalized classification of European fen vegetation at the alliance level
DEFF Research Database (Denmark)
Peterka, Tomáš; Hájek, Michal; Jiroušek, Martin
2017-01-01
Aims Phytosociological classification of fen vegetation (Scheuchzerio palustris-Caricetea fuscae class) differs among European countries. Here we propose a unified vegetation classification of European fens at the alliance level, provide unequivocal assignment rules for individual vegetation plot...
-
A-coupled-expanding and distributional chaos
International Nuclear Information System (INIS)
Kim, Cholsan; Ju, Hyonhui; Chen, Minghao; Raith, Peter
2015-01-01
The concept of A-coupled-expanding maps is one of the more natural and useful ideas generalized from the horseshoe map which is commonly known as a criterion of chaos. It is well known that distributional chaos is one of the concepts which reflect strong chaotic behavior. In this paper, we focus on the relationship between A-coupled-expanding and distributional chaos. We prove two theorems which give sufficient conditions for a strictly A-coupled-expanding map to be distributionally chaotic in the senses of two kinds, where A is an m × m irreducible transition matrix
-
Optical Signatures of Coupled Quantum Dots
Stinaff, E. A.; Scheibner, M.; Bracker, A. S.; Ponomarev, I. V.; Korenev, V. L.; Ware, M. E.; Doty, M. F.; Reinecke, T. L.; Gammon, D.
2006-02-01
An asymmetric pair of coupled InAs quantum dots is tuned into resonance by applying an electric field so that a single hole forms a coherent molecular wave function. The optical spectrum shows a rich pattern of level anticrossings and crossings that can be understood as a superposition of charge and spin configurations of the two dots. Coulomb interactions shift the molecular resonance of the optically excited state (charged exciton) with respect to the ground state (single charge), enabling light-induced coupling of the quantum dots. This result demonstrates the possibility of optically coupling quantum dots for application in quantum information processing.
-
Nanocatalysts for Suzuki cross-coupling reactions
Fihri, Aziz
2011-01-01
This critical review deals with the applications of nanocatalysts in Suzuki coupling reactions, a field that has attracted immense interest in the chemical, materials and industrial communities. We intend to present a broad overview of nanocatalysts for Suzuki coupling reactions with an emphasis on their performance, stability and reusability. We begin the review with a discussion on the importance of Suzuki cross-coupling reactions, and we then discuss fundamental aspects of nanocatalysis, such as the effects of catalyst size and shape. Next, we turn to the core focus of this review: the synthesis, advantages and disadvantages of nanocatalysts for Suzuki coupling reactions. We begin with various nanocatalysts that are based on conventional supports, such as high surface silica, carbon nanotubes, polymers, metal oxides and double hydroxides. Thereafter, we reviewed nanocatalysts based on non-conventional supports, such as dendrimers, cyclodextrin and magnetic nanomaterials. Finally, we discuss nanocatalyst systems that are based on non-conventional media, i.e., fluorous media and ionic liquids, for use in Suzuki reactions. At the end of this review, we summarise the significance of nanocatalysts, their impacts on conventional catalysis and perspectives for further developments of Suzuki cross-coupling reactions (131 references). © 2011 The Royal Society of Chemistry.
-
Overtreatment in couples with unexplained infertility.
Kersten, F A M; Hermens, R P G M; Braat, D D M; Hoek, A; Mol, B W J; Goddijn, M; Nelen, W L D M
2015-01-01
What is the percentage of overtreatment, i.e. fertility treatment started too early, in couples with unexplained infertility who were eligible for tailored expectant management? Overtreatment occurred in 36% of couples with unexplained infertility who were eligible for an expectant management of at least 6 months. Prognostic models in reproductive medicine can help to identify infertile couples that would benefit from fertility treatment. In couples with unexplained infertility with a good chance of natural conception within 1 year, based on the Hunault prediction model, an expectant management of 6-12 months, as recommended in international fertility guidelines, prevents unnecessary treatment. A retrospective cohort study in 25 participating clinics, with follow-up of all couples who were seen for infertility in 2011-2012. In all, 9818 couples were seen for infertility in the participating clinics. Couples were eligible to participate if they were diagnosed with unexplained infertility and had a good prognosis of natural conception (>30%) within 1 year based on the Hunault prediction model. Data to assess overtreatment were collected from medical records. Multilevel regression analyses were performed to investigate associations of overtreatment with patient and clinic characteristics. Five hundred and forty-four couples eligible for expectant management were included in this study. Among these, overtreatment, i.e. starting medically assisted reproduction within 6 months, occurred in 36%. The underlying quality indicators showed that in 34% no prognosis was calculated and that in 42% expectant management was not recommended. Finally, 16% of the couples for whom a correct recommendation of expectant management for at least 6 months was made, started treatment within 6 months anyway. Overtreatment was associated with childlessness, higher female age and a longer duration of infertility. No associations between overtreatment and clinic characteristics were found. The
-
Disentangling Higgs-Top Couplings in Associated Production
Ellis, John; Sakurai, Kazuki; Takeuchi, Michihisa
2014-01-01
In the presence of CP violation, the Higgs-top coupling may have both scalar and pseudoscalar components, $\\kappa_t$ and ${\\tilde \\kappa_t}$, which are bounded indirectly but only weakly by the present experimental constraints on the Higgs-gluon-gluon and Higgs-$\\gamma$-$\\gamma$ couplings, whereas upper limits on electric dipole moments provide strong additional indirect constraints on ${\\tilde \\kappa_t}$, if the Higgs-electron coupling is similar to that in the Standard Model and there are no cancellations with other contributions. We discuss methods to measure directly the scalar and pseudoscalar Higgs-top couplings by measurements of Higgs production in association with ${\\bar t} t$, single $t$ and single ${\\bar t}$ at the LHC. Measurements of the total cross sections are very sensitive to variations in the Higgs-top couplings that are consistent with the present indirect constraints, as are invariant mass distributions in ${\\bar t} t H$, $tH$ and ${\\bar t} H$ final states. We also investigate the addition...
-
First-Principle Characterization for Singlet Fission Couplings.
Yang, Chou-Hsun; Hsu, Chao-Ping
2015-05-21
The electronic coupling for singlet fission, an important parameter for determining the rate, has been found to be too small unless charge-transfer (CT) components were introduced in the diabatic states, mostly through perturbation or a model Hamiltonian. In the present work, the fragment spin difference (FSD) scheme was generalized to calculate the singlet fission coupling. The largest coupling strength obtained was 14.8 meV for two pentacenes in a crystal structure, or 33.7 meV for a transition-state structure, which yielded a singlet fission lifetime of 239 or 37 fs, generally consistent with experimental results (80 fs). Test results with other polyacene molecules are similar. We found that the charge on one fragment in the S1 diabatic state correlates well with FSD coupling, indicating the importance of the CT component. The FSD approach is a useful first-principle method for singlet fission coupling, without the need to include the CT component explicitly.
-
Perturbative Critical Behavior from Spacetime Dependent Couplings
International Nuclear Information System (INIS)
Torroba, Gonzalo
2012-01-01
We find novel perturbative fixed points by introducing mildly spacetime-dependent couplings into otherwise marginal terms. In four-dimensional QFT, these are physical analogues of the small-ε Wilson-Fisher fixed point. Rather than considering 4-ε dimensions, we stay in four dimensions but introduce couplings whose leading spacetime dependence is of the form λx κ μ κ , with a small parameter κ playing a role analogous to ε. We show, in φ 4 theory and in QED and QCD with massless flavors, that this leads to a critical theory under perturbative control over an exponentially wide window of spacetime positions x. The exact fixed point coupling λ * (x) in our theory is identical to the running coupling of the translationally invariant theory, with the scale replaced by 1/x. Similar statements hold for three-dimensional φ 6 theories and two-dimensional sigma models with curved target spaces. We also describe strongly coupled examples using conformal perturbation theory.
-
Optical Control of Mechanical Mode-Coupling within a MoS2 Resonator in the Strong-Coupling Regime.
Liu, Chang-Hua; Kim, In Soo; Lauhon, Lincoln J
2015-10-14
Two-dimensional (2-D) materials including graphene and transition metal dichalcogenides (TMDs) are an exciting platform for ultrasensitive force and displacement detection in which the strong light-matter coupling is exploited in the optical control of nanomechanical motion. Here we report the optical excitation and displacement detection of a ∼ 3 nm thick MoS2 resonator in the strong-coupling regime, which has not previously been achieved in 2-D materials. Mechanical mode frequencies can be tuned by more than 12% by optical heating, and they exhibit avoided crossings indicative of strong intermode coupling. When the membrane is optically excited at the frequency difference between vibrational modes, normal mode splitting is observed, and the intermode energy exchange rate exceeds the mode decay rate by a factor of 15. Finite element and analytical modeling quantifies the extent of mode softening necessary to control intermode energy exchange in the strong coupling regime.
-
DEFF Research Database (Denmark)
Appel-Hansen, Jørgen
1968-01-01
In order to reduce the space occupied by a reflector array, it is desirable to arrange the array antennas as close to each other as possible; however, in this case coupling between the array antennas will reduce the reflecting properties of the reflector array. The purpose of the present communic......In order to reduce the space occupied by a reflector array, it is desirable to arrange the array antennas as close to each other as possible; however, in this case coupling between the array antennas will reduce the reflecting properties of the reflector array. The purpose of the present...
-
General coupled mode theory in non-Hermitian waveguides.
Xu, Jing; Chen, Yuntian
2015-08-24
In the presence of loss and gain, the coupled mode equation on describing the mode hybridization of various waveguides or cavities, or cavities coupled to waveguides becomes intrinsically non-Hermitian. In such non-Hermitian waveguides, the standard coupled mode theory fails. We generalize the coupled mode theory with a properly defined inner product based on reaction conservation. We apply our theory to the non-Hermitian parity-time symmetric waveguides, and obtain excellent agreement with results obtained by finite element fullwave simulations. The theory presented here is typically formulated in space to study coupling between waveguides, which can be transformed into time domain by proper reformulation to study coupling between non-Hermitian resonators. Our theory has the strength of studying non-Hermitian optical systems with inclusion of the full vector fields, thus is useful to study and design non-Hermitian devices that support asymmetric and even nonreciprocal light propagations.
-
Diverse coupling of neurons to populations in sensory cortex.
Okun, Michael; Steinmetz, Nicholas; Cossell, Lee; Iacaruso, M Florencia; Ko, Ho; Barthó, Péter; Moore, Tirin; Hofer, Sonja B; Mrsic-Flogel, Thomas D; Carandini, Matteo; Harris, Kenneth D
2015-05-28
A large population of neurons can, in principle, produce an astronomical number of distinct firing patterns. In cortex, however, these patterns lie in a space of lower dimension, as if individual neurons were "obedient members of a huge orchestra". Here we use recordings from the visual cortex of mouse (Mus musculus) and monkey (Macaca mulatta) to investigate the relationship between individual neurons and the population, and to establish the underlying circuit mechanisms. We show that neighbouring neurons can differ in their coupling to the overall firing of the population, ranging from strongly coupled 'choristers' to weakly coupled 'soloists'. Population coupling is largely independent of sensory preferences, and it is a fixed cellular attribute, invariant to stimulus conditions. Neurons with high population coupling are more strongly affected by non-sensory behavioural variables such as motor intention. Population coupling reflects a causal relationship, predicting the response of a neuron to optogenetically driven increases in local activity. Moreover, population coupling indicates synaptic connectivity; the population coupling of a neuron, measured in vivo, predicted subsequent in vitro estimates of the number of synapses received from its neighbours. Finally, population coupling provides a compact summary of population activity; knowledge of the population couplings of n neurons predicts a substantial portion of their n(2) pairwise correlations. Population coupling therefore represents a novel, simple measure that characterizes the relationship of each neuron to a larger population, explaining seemingly complex network firing patterns in terms of basic circuit variables.
-
Computational Aspects of Nuclear Coupled-Cluster Theory
International Nuclear Information System (INIS)
Dean, David Jarvis; Hagen, Gaute; Hjorth-Jensen, M.; Papenbrock, T.F.
2008-01-01
Coupled-cluster theory represents an important theoretical tool that we use to solve the quantum many-body problem. Coupled-cluster theory also lends itself to computation in a parallel computing environment. In this article, we present selected results from ab initio studies of stable and weakly bound nuclei utilizing computational techniques that we employ to solve coupled-cluster theory. We also outline several perspectives for future research directions in this area.
-
Therapy of a couple with a bipolar spouse.
Witusik, Andrzej; Pietras, Tadeusz
2017-10-23
Qualitative analysis of therapy of a couple with a partner who has bipolar disorder is an important research paradigm in contemporary psychotherapy of mental disorders.The qualitative method of the study is important both from the cognitive point of view and for the evaluation of the therapeutic efficacy in the individual, idiographical aspect. The aim of the study is a qualitative analysis of the therapeutic process of a couple in which one partner suffers from bipolar affective disorder. The study of the couple therapy process utilized the qualitative research methodology using variouspsychotherapeutic paradigms indicating the interrelationships that exist between relapses of the disease and functioning of the couple. The importance of triangulation processes, inheritance of transgenerational myths and dysfunctional cognitive patterns in the functional destabilization of a couple with one partner suffering from bipolar affective disorder was indicated. The study of the couple therapy process utilized the qualitative research methodology using variouspsychotherapeutic paradigms indicating the interrelationships that exist between relapses of the disease and functioning of the couple. The importance of triangulation processes, inheritance of transgenerational myths and dysfunctional cognitive patterns in the functional destabilization of a couple with one partner suffering from bipolar affective disorder was indicated. The dysfunctionality of the discussed couple is largely due to the effects of bipolar disorder and related disturbances on marital functioning. The spectrum of autism in the child is probably related both to the genetic strain of predisposition to psychiatric disorders and to the dysfunctionality of the parental dyad. The presence of bipolar affective disorder in the partner's family is also a genetic burden. The wife's aggression represents probably a syndrome of adaptation to disease in the family. Aggression plays a morphostatic role in the couple
-
Health behaviour change interventions for couples: A systematic review.
Arden-Close, Emily; McGrath, Nuala
2017-05-01
Partners are a significant influence on individuals' health, and concordance in health behaviours increases over time in couples. Several theories suggest that couple-focused interventions for health behaviour change may therefore be more effective than individual interventions. A systematic review of health behaviour change interventions for couples was conducted. Systematic search methods identified randomized controlled trials (RCTs) and non-randomized interventions of health behaviour change for couples with at least one member at risk of a chronic physical illness, published from 1990-2014. We identified 14 studies, targeting the following health behaviours: cancer prevention (6), obesity (1), diet (2), smoking in pregnancy (2), physical activity (1) and multiple health behaviours (2). In four out of seven trials couple-focused interventions were more effective than usual care. Of four RCTs comparing a couple-focused intervention to an individual intervention, two found that the couple-focused intervention was more effective. The studies were heterogeneous, and included participants at risk of a variety of illnesses. In many cases the intervention was compared to usual care for an individual or an individual-focused intervention, which meant the impact of the couplebased content could not be isolated. Three arm studies could determine whether any added benefits of couple-focused interventions are due to adding the partner or specific content of couple-focused interventions. Statement of contribution What is already known on this subject? Health behaviours and health behaviour change are more often concordant across couples than between individuals in the general population. Couple-focused interventions for chronic conditions are more effective than individual interventions or usual care (Martire, Schulz, Helgeson, Small, & Saghafi, ). What does this study add? Identified studies targeted a variety of health behaviours, with few studies in any one area. Further
-
Identical synchronization of coupled Rossler systems
DEFF Research Database (Denmark)
Yanchuk, S.; Maistrenko, Y.; Mosekilde, Erik
1999-01-01
Analyzing the transverse stability of low periodic orbits embedded in the synchronized chaotic state for a system of two coupled Rössler oscillators, we obtain the conditions for synchronization and determine the coupling parameters for which riddled basins of attraction may arise. It is shown how...
-
Phase locking of optically coupled lasers
International Nuclear Information System (INIS)
Glova, A F
2003-01-01
A review of studies of the properties of radiation from optically coupled lasers is presented. The methods for phase locking the fields in optically coupled lasers of different types are considered and the methods for supermode selection and correction of the radiation pattern are discussed. (review)
-
Subfecundity in overweight and obese couples
DEFF Research Database (Denmark)
Ramlau-Hansen, C H; Thulstrup, A M; Bonde, J P
2007-01-01
BACKGROUND: Recent studies indicate that not only women's but also men's obesity has adverse effects on fecundity and since fecundity is a couple concept, we examined fecundity in relation to overweight and obesity of the couple. We also examined the association between weight changes and fecundi...
-
Developmental Issues in Counseling With Couples.
Seligman, Linda; Deutsch, Marjorie B.
Marriages, just like the individuals in them, go through stages of development. Understanding these relatively predictable stages can be helpful to couples, by allaying apprehension, promoting preparation for change, and putting fluctuations into perspective. Research on marital stages and experiences in counseling couples suggest that marriages…
-
Dual-Career Couples: Keeping Them Together.
Wolf-Wendel, Lisa E.; Twombly, Susan; Rice, Suzanne
2000-01-01
Reports results of a survey of 360 chief academic officers at member institutions of the American Association of Colleges and Universities regarding their policies and practices for assisting dual-career couples. Examines the motivations, barriers, consequences, and policy implications of institutional responses to dual-career couples. (DB)
-
Synchronization in complex networks with adaptive coupling
International Nuclear Information System (INIS)
Zhang Rong; Hu Manfeng; Xu Zhenyuan
2007-01-01
Generally it is very difficult to realized synchronization for some complex networks. In order to synchronize, the coupling coefficient of networks has to be very large, especially when the number of coupled nodes is larger. In this Letter, we consider the problem of synchronization in complex networks with adaptive coupling. A new concept about asymptotic stability is presented, then we proved by using the well-known LaSalle invariance principle, that the state of such a complex network can synchronize an arbitrary assigned state of an isolated node of the network as long as the feedback gain is positive. Unified system is simulated as the nodes of adaptive coupling complex networks with different topologies
-
Electroweak effective couplings for future precision experiments
International Nuclear Information System (INIS)
Jegerlehner, F.
2011-01-01
The leading hadronic effects in electroweak theory derive from vacuum polarization which are non-perturbative hadronic contributions to the running of the gauge couplings, the electromagnetic α em (s)and the SU(2) L coupling α 2 (s). I will report on my recent package alphaQED, which besides the effective fine structure constant α em (s) also allows for a fairly precise calculation of the SU(2) L gauge coupling α 2 (s). I will briefly review the role, future requirements and possibilities. Applied together with the R had package by Harlander and Steinhauser, the package allows to calculate all SM running couplings as well as running sin 2 Θ versions with state-of-the-art accuracy.
-
Electroweak effective couplings for future precision experiments
International Nuclear Information System (INIS)
Jegerlehner, F.; Humboldt-Universitaet, Berlin
2011-07-01
The leading hadronic effects in electroweak theory derive from vacuum polarization which are non-perturbative hadronic contributions to the running of the gauge couplings, the electromagnetic α em (s) and the SU(2) L coupling α 2 (s). I report on my recent package alphaQED [1], which besides the effective fine structure constant α em (s) also allows for a fairly precise calculation of the SU(2) L gauge coupling α 2 (s). I will briefly review the role, future requirements and possibilities. Applied together with the Rhad package by Harlander and Steinhauser [2], the package allows to calculate all SM running couplings as well as running sin 2 Θ versions with state-of-the-art accuracy. (orig.)
-
Coupled qubits as a quantum heat switch
Karimi, B.; Pekola, J. P.; Campisi, M.; Fazio, R.
2017-12-01
We present a quantum heat switch based on coupled superconducting qubits, connected to two LC resonators that are terminated by resistors providing two heat baths. To describe the system, we use a standard second order master equation with respect to coupling to the baths. We find that this system can act as an efficient heat switch controlled by the applied magnetic flux. The flux influences the energy level separations of the system, and under some conditions, the finite coupling of the qubits enhances the transmitted power between the two baths, by an order of magnitude under realistic conditions. At the same time, the bandwidth at maximum power of the switch formed of the coupled qubits is narrowed.
-
Atomic precision tests and light scalar couplings
Energy Technology Data Exchange (ETDEWEB)
Brax, Philippe [CEA, IPhT, CNRS, URA 2306, Gif-sur-Yvette (France). Inst. de Physique Theorique; Burrage, Clare [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Geneve Univ. (Switzerland). Dept. de Physique Theorique
2010-10-15
We calculate the shift in the atomic energy levels induced by the presence of a scalar field which couples to matter and photons. We find that a combination of atomic measurements can be used to probe both these couplings independently. A new and stringent bound on the matter coupling springs from the precise measurement of the 1s to 2s energy level difference in the hydrogen atom, while the coupling to photons is essentially constrained by the Lamb shift. Combining these constraints with current particle physics bounds we find that the contribution of a scalar field to the recently claimed discrepancy in the proton radius measured using electronic and muonic atoms is negligible. (orig.)
-
Improving plasmonic waveguides coupling efficiency using nanoantennas
DEFF Research Database (Denmark)
Andryieuski, Andrei; Malureanu, Radu; Bouillard, Jean-Sebastien
2012-01-01
. The classical dipole antenna scheme can be improved by changing the nanoantenna geometry, adding constructive elements such as reflecting bars and mirrors and using arrays of antennas. The modelling designates that the coupling efficiency from a vertical fiber to a plasmonic waveguide can be improved more than......Plasmonic waveguides bear a lot of potential for photonic applications. However, one of the challenges for implementing them in devices is the low coupling efficiency to and from optical fibers. We report on our approach to facilitate the coupling efficiency with the use of metallic nanoantennas...... in 180 times in comparison with a direct fiber-waveguide coupling. Pros and cons of each configuration are discussed. Fabrication and characterisation results are reported....
-
How initial representations shape coupled learning processes
DEFF Research Database (Denmark)
Puranam, Phanish; Swamy, M.
2016-01-01
Coupled learning processes, in which specialists from different domains learn how to make interdependent choices among alternatives, are common in organizations. We explore the role played by initial representations held by the learners in coupled learning processes using a formal agent-based model....... We find that initial representations have important consequences for the success of the coupled learning process, particularly when communication is constrained and individual rates of learning are high. Under these conditions, initial representations that generate incorrect beliefs can outperform...... one that does not discriminate among alternatives, or even a mix of correct and incorrect representations among the learners. We draw implications for the design of coupled learning processes in organizations. © 2016 INFORMS....
-
Numerical design of an rf-coupling Iris
International Nuclear Information System (INIS)
Hanaki, H.
1991-07-01
For an rf coupler of an rf system in high-quality transmission an analytical method may be applied to treat the design problem, if a coupling hole between cavities or waveguides is small enough. However, in most cases of accelerator engineering the dimensions of the coupling slots are not so small compared with the size of a cavity and a waveguide. Numerical design of rf coupling slots for a few cases is tried basically according to Henke's method using an equivalent circuit to treat the matching of microwave components, but taking account of beam loading expressed by the coupling coefficient β. The MAFIA code has been applied for the design. (R.P.) 5 refs., 10 figs., 3 tabs
-
Nuclear physics from strong coupling QCD
Fromm, Michael
2009-01-01
The strong coupling limit (beta_gauge = 0) of QCD offers a number of remarkable research possibilities, of course at the price of large lattice artifacts. Here, we determine the complete phase diagram as a function of temperature T and baryon chemical potential mu_B, for one flavor of staggered fermions in the chiral limit, with emphasis on the determination of a tricritical point and on the T ~ 0 transition to nuclear matter. The latter is known to happen for mu_B substantially below the baryon mass, indicating strong nuclear interactions in QCD at infinite gauge coupling. This leads us to studying the properties of nuclear matter from first principles. We determine the nucleon-nucleon potential in the strong coupling limit, as well as masses m_A of nuclei as a function of their atomic number A. Finally, we clarify the origin of nuclear interactions at strong coupling, which turns out to be a steric effect.
-
Coupling effect on the Berry phase
Directory of Open Access Journals (Sweden)
Lijing Tian
2016-11-01
Full Text Available The Berry phase has universal applications in various fields. Here, we explore the coupling effect on the Berry phase of a two-level system adiabatically driven by a rotating classical field and interacting with a single quantized mode. Our simulations clearly reveal that the Berry phase change is quadratic proportional to the coupling constant if it is less than the level spacing between neighboring instantaneous eigenstates. Remarkably, if the nearest neighbouring level spacing is comparable with the coupling constant, this simple quadratic dependence is lost. Around this resonance, the Berry phase can be significantly tuned by slightly adjusting the parameters, such as the coupling constant, the frequency of the quantized mode, and the transition frequency. These numerical results, agreeing well with the perturbation theory calculations, provide an alternative approach to tune the Berry phase near the resonance, which is useful in quantum information science, i.e. designing quantum logic gates.
-
The LHC Transverse Coupled-Bunch Instability
Mounet, Nicolas; Métral, Elias
In this thesis, the problem of the transverse coupled-bunch instabilities created by the Large Hadron Collider (LHC) beam-coupling impedance, that can possibly limit the machine operation, is addressed thanks to several new theories and tools. A rather complete vision of the problem is proposed here, going from the calculation of the impedances and wake functions of individual machine elements, to the beam dynamics study. Firstly, new results are obtained in the theory of the beam-coupling impedance for an axisymmetric two-dimensional structure, generalizing Zotter's theories, and a new general theory is derived for the impedance of an infinite flat two-dimensional structure. Then, a new approach has been found to compute the wake functions from such analytically obtained beam-coupling impedances, over-coming limitations that could be met with standard discrete Fourier transform procedures. Those results are then used to obtain an impedance and wake function model of the LHC, based on the (resistive-) wall im...
-
Same-Sex and Different-Sex Cohabiting Couple Relationship Stability.
Manning, Wendy D; Brown, Susan L; Stykes, J Bart
2016-08-01
Relationship stability is a key indicator of well-being, but most U.S.-based research has been limited to different-sex couples. The 2008 panel of the Survey of Income and Program Participation (SIPP) provides an untapped data resource to analyze relationship stability of same-sex cohabiting, different-sex cohabiting, and different-sex married couples (n = 5,701). The advantages of the SIPP data include the recent, nationally representative, and longitudinal data collection; a large sample of same-sex cohabitors; respondent and partner socioeconomic characteristics; and identification of a state-level indicator of a policy stating that marriage is between one man and one woman (i.e., DOMA). We tested competing hypotheses about the stability of same-sex versus different-sex cohabiting couples that were guided by incomplete institutionalization, minority stress, relationship investments, and couple homogamy perspectives (predicting that same-sex couples would be less stable) as well as economic resources (predicting that same-sex couples would be more stable). In fact, neither expectation was supported: results indicated that same-sex cohabiting couples typically experience levels of stability that are similar to those of different-sex cohabiting couples. We also found evidence of contextual effects: living in a state with a constitutional ban against same-sex marriage was significantly associated with higher levels of instability for same- and different-sex cohabiting couples. The level of stability in both same-sex and different-sex cohabiting couples is not on par with that of different-sex married couples. The findings contribute to a growing literature on health and well-being of same-sex couples and provide a broader understanding of family life.
-
Comparison Of Cd2+ Biosorption And Bioaccumulation By Bacteria – A Radiometric Study
Directory of Open Access Journals (Sweden)
Machalová Linda
2015-12-01
Full Text Available In this work, bioaccumulation and biosorption characteristics of Cd2+ ions by both dead and living non-growing biomass of gram-positive bacteria Kocuria palustris and Micrococcus luteus isolated from spent nuclear fuel pools were compared. The radioindicator method with radionuclide 109Cd was used to obtain precise and reliable data characterizing Cd compartmentalization in bacterial cells. The following cellular distribution of Cd in living non-growing biomass after 4 h incubation in solutions containing different concentration of Cd2+ ions (100, 250, 500, 750 and 1000 µmol/L spiked with 109CdCl2 under aeration at 30 °C were obtained: in M. luteus almost 85 % of Cd was localized on the cell surface and 15 % in cytoplasm. Similarly, in K. palustris 83 % of Cd was localized on the cell surface and 17 % in cytoplasm. The data were obtained by gamma spectrometry of extracts and solids after sequential extraction of biomass with 5 mM Ca(NO32 and 20 mM EDTA. Biosorption of Cd by non-living bacterial biomass is a rapid process strongly affected by solution pH and as was confirmed by FTIR analysis beside carboxylate ions also other functional groups such as amino and phosphate contribute to Cd binding by bacterial cell surfaces. Maximum sorption capacities Qmax (μmol/g calculated from the Langmuir isotherm were 444 ± 15 μmol/g for M. luteus and 381 ± 1 μmol/g for K. palustris.
-
Alternative RF coupling configurations for H− ion sources
International Nuclear Information System (INIS)
Briefi, S.; Fantz, U.; Gutmann, P.
2015-01-01
RF heated sources for negative hydrogen ions both for fusion and accelerators require very high RF powers in order to achieve the required H − current what poses high demands on the RF generators and the RF circuit. Therefore it is highly desirable to improve the RF efficiency of the sources. This could be achieved by applying different RF coupling concepts than the currently used inductive coupling via a helical antenna, namely Helicon coupling or coupling via a planar ICP antenna enhanced with ferrites. In order to investigate the feasibility of these concepts, two small laboratory experiments have been set up. The PlanICE experiment, where the enhanced inductive coupling is going to be investigated, is currently under assembly. At the CHARLIE experiment systematic measurements concerning Helicon coupling in hydrogen and deuterium are carried out. The investigations show that a prominent feature of Helicon discharges occurs: the so-called low-field peak. This is a local improvement of the coupling efficiency at a magnetic field strength of a few mT which results in an increased electron density and dissociation degree. The full Helicon mode has not been achieved yet due to the limited available RF power and magnetic field strength but it might be sufficient for the application of the coupling concept to ion sources to operate the discharge in the low-field-peak region
-
James Hanula; Brian Sullivan; David Wakarchuk
2013-01-01
Redbay ambrosia beetle, Xyleborus glabratus Eichoff, is an exotic species to North America vectoring a deadly vascular wilt disease of redbay [Persea borbonia (L.) Spreng], swampbay [P. palustris (Raf.) Sarg.], avocado (P. americana Mill.), and sassafras [Sassafras albidum (...
-
Multi-disciplinary coupling for integrated design of propulsion systems
Chamis, C. C.; Singhal, S. N.
1993-01-01
Effective computational simulation procedures are described for modeling the inherent multi-disciplinary interactions for determining the true response of propulsion systems. Results are presented for propulsion system responses including multi-discipline coupling effects via (1) coupled multi-discipline tailoring, (2) an integrated system of multidisciplinary simulators, (3) coupled material-behavior/fabrication-process tailoring, (4) sensitivities using a probabilistic simulator, and (5) coupled materials/structures/fracture/probabilistic behavior simulator. The results show that the best designs can be determined if the analysis/tailoring methods account for the multi-disciplinary coupling effects. The coupling across disciplines can be used to develop an integrated interactive multi-discipline numerical propulsion system simulator.
-
Chameleons with Field Dependent Couplings
Brax, Philippe; Mota, David F; Nunes, Nelson J; Winther, Hans A
2010-01-01
Certain scalar-tensor theories exhibit the so-called chameleon mechanism, whereby observational signatures of scalar fields are hidden by a combination of self-interactions and interactions with ambient matter. Not all scalar-tensor theories exhibit such a chameleon mechanism, which has been originally found in models with inverse power run-away potentials and field independent couplings to matter. In this paper we investigate field-theories with field-dependent couplings and a power-law potential for the scalar field. We show that the theory indeed is a chameleon field theory. We find the thin-shell solution for a spherical body and investigate the consequences for E\\"ot-Wash experiments, fifth-force searches and Casimir force experiments. Requiring that the scalar-field evades gravitational tests, we find that the coupling is sensitive to a mass-scale which is of order of the Hubble scale today.
-
Chameleons with field-dependent couplings
International Nuclear Information System (INIS)
Brax, Philippe; Bruck, Carsten van de; Mota, David F.; Winther, Hans A.; Nunes, Nelson J.
2010-01-01
Certain scalar-tensor theories exhibit the so-called chameleon mechanism, whereby observational signatures of scalar fields are hidden by a combination of self-interactions and interactions with ambient matter. Not all scalar-tensor theories exhibit such a chameleon mechanism, which has been originally found in models with inverse power runaway potentials and field-independent couplings to matter. In this paper we investigate field theories with field-dependent couplings and a power-law potential for the scalar field. We show that the theory indeed is a chameleon field theory. We find the thin-shell solution for a spherical body and investigate the consequences for Eoet-Wash experiments, fifth-force searches and Casimir-force experiments. Requiring that the scalar field evades gravitational tests, we find that the coupling is sensitive to a mass scale which is of order of the Hubble scale today.
-
Coupled processes in repository sealing
International Nuclear Information System (INIS)
Case, J.B.; Kelsall, P.C.
1985-01-01
The significance of coupled processes in repository sealing is evaluated. In most repository designs, shaft seals will be located in areas of relatively low temperature perturbation, in which case the coupling of temperature with stress and permeability may be less significant than the coupling between stress and permeability that occurs during excavation. Constitutive relationships between stress and permeability are reviewed for crystalline rock and rocksalt. These provide a basis for predicting the development of disturbed zones near excavations. Field case histories of the degree of disturbance are presented for two contrasting rock types - Stripa granite and Southeastern New Mexico rocksalt. The results of field investigations in both rock types confirm that hydraulic conductivity or permeability is stress dependent, and that shaft seal performance may be related to the degree that stresses are perturbed and restored near the seal
-
Intimate Partner Violence in Interracial and Monoracial Couples
Martin, Brittny A.; Cui, Ming; Ueno, Koji; Fincham, Frank D.
2013-01-01
This study, using a nationally representative sample, investigated intimate partner violence (IPV) in interracial and monoracial relationships. Regression analyses indicated that interracial couples demonstrated a higher level of mutual IPV than monoracial White couples but a level similar to monoracial Black couples. There were significant gender…
-
Coupled mode theory of periodic waveguides arrays
DEFF Research Database (Denmark)
Lavrinenko, Andrei; Chigrin, Dmitry N.
We apply the scalar coupled mode theory to the case of waveguides array consisting om two periodic waveguides. One of the waveguides is arbitrary shifted along another. A longitudinal shift acts as a parameter in the coupled mode theory. The proposed theory explains peculiarities of modes dispers...... dispersion and transmission in coupled periodic waveguides systems. Analytical results are compared with the numerical ones obtained by the plane wave expansion and FDTD methods....
-
Improved formalism for precision Higgs coupling fits
Barklow, Tim; Fujii, Keisuke; Jung, Sunghoon; Karl, Robert; List, Jenny; Ogawa, Tomohisa; Peskin, Michael E.; Tian, Junping
2018-03-01
Future e+e- colliders give the promise of model-independent determinations of the couplings of the Higgs boson. In this paper, we present an improved formalism for extracting Higgs boson couplings from e+e- data, based on the effective field theory description of corrections to the Standard Model. We apply this formalism to give projections of Higgs coupling accuracies for stages of the International Linear Collider and for other proposed e+e- colliders.
-
Improved formalism for precision Higgs coupling fits
International Nuclear Information System (INIS)
Barklow, Tim; Peskin, Michael E.; Jung, Sunghoon; Tian, Junping
2017-08-01
Future e + e - colliders give the promise of model-independent determinations of the couplings of the Higgs boson. In this paper, we present an improved formalism for extracting Higgs boson couplings from e + e - data, based on the Effective Field Theory description of corrections to the Standard Model. We apply this formalism to give projections of Higgs coupling accuracies for stages of the International Linear Collider and for other proposed e + e - colliders.