
Sample records for rhodopseudomonas palustris coupling

  1. Photometabolism of Heterocyclic Aromatic Compounds by Rhodopseudomonas palustris OU 11 (United States)

    Sasikala, C.; Ramana, C. V.; Rao, P. Raghuveer


    Rhodopseudomonas palustris OU 11 (ATCC 51186; DSM 7375) isolated from a pond of chemical industry effluent could anaerobically photometabolize heterocyclic aromatic compounds belonging to the pyridine and pyrazine groups only after a period of adaptation on pyrazinoic acid of 5 to 6 weeks. Growth on heterocyclic compounds was light dependent. The effects of various concentrations of heterocyclic compounds on growth suggest that higher concentrations of these compounds inhibit growth and are toxic. PMID:16349307

  2. Acclimation strategy of Rhodopseudomonas palustris to high light irradiance. (United States)

    Muzziotti, Dayana; Adessi, Alessandra; Faraloni, Cecilia; Torzillo, Giuseppe; De Philippis, Roberto


    The ability of Rhodopseudomonas palustris cells to rapidly acclimate to high light irradiance is an essential issue when cells are grown under sunlight. The aim of this study was to investigate the photo-acclimation process in Rhodopseudomonas palustris 42OL under different culturing conditions: (i) anaerobic (AnG), (ii) aerobic (AG), and (iii) under H 2 -producing (HP) conditions both at low (LL) and high light (HL) irradiances. The results obtained clearly showed that the photosynthetic unit was significantly affected by the light irradiance at which Rp. palustris 42OL was grown. The synthesis of carotenoids was affected by both illumination and culturing conditions. At LL, lycopene was the main carotenoid synthetized under all conditions tested, while at HL under HP conditions, it resulted the predominant carotenoid. Oppositely, under AnG and AG at HL, rhodovibrin was the major carotenoid detected. The increase in light intensity produced a deeper variation in light-harvesting complexes (LHC) ratio. These findings are important for understanding the ecological distribution of PNSB in natural environments, mostly characterized by high light intensities, and for its growth outdoors. Copyright © 2017 Elsevier GmbH. All rights reserved.

  3. Final report: 'Rhodopseudomonas palustris' genome workshop to be held in Spring of 2001; FINAL

    International Nuclear Information System (INIS)

    Harwood, Caroline S.


    The 'Rhodopseudomonas palustris' genome workshop took place in Iowa City on April 6-8, 2001. The purpose of the meeting was to instruct members of the annotation working group in approaches to accomplishing the 'human' phase of the 'R. palustris' genome annotation. A partial draft of a paper describing the 'Rhodopseudomonas palustris' genome has been written and a full version of the paper should be ready for submission by the end of the summer 2002

  4. The anaerobic phototrophic metabolism of 3-chlorobenzoate by Rhodopseudomonas palustris

    Energy Technology Data Exchange (ETDEWEB)

    Kamal, V S


    The degradation of chlorinated aromatic compounds by anaerobic bacteria is now known to be an important mechanism of bioremediation. In an experimental study, a mixed phototrophic culture was found to metabolize 3-chlorobenzoate in the presence of benzoate following adaptation on a benzoate and 3-chlorobenzoate medium for 7 weeks. The dominant bacterial isolate was identified as Rhodopseudomonas palustris. Radioisotopic studies showed [sup 14]C-3-chlorobenzoate was converted by the isolate to [sup 14]CO[sub 2] and cell biomass in the absence of oxygen and in the presence of a cosubstrate red light. Cyclohexane carboxylate was able to replace the cosubstrate, benzoate. The isolate also metabolized 3-chlorobenzoate in the presence of pimelic acid, sodium acetate, and sodium succinate; however, the metabolic rate was reduced. Gas chromatography mass spectrometry and high pressure liquid chromatography indicated the intracellular presence of 3-chlorobenzoate and benzoyl-CoA. Cell-free extracts produced benzoate and benzoyl-CoA. A probable route of 3-chlorobenzoate metabolism via dehalogenation followed by steps similar to the benzoate reductive ring fission pathway is suggested. Comparison of kinetic coefficients showed a higher affinity of the isolate for benzoate. Isolates from representative samples of various freshwater and wastewater ecosystems indicated widespread ecological distribution of R. palustris and the common occurrence of the 3-chlorobenzoate metabolic phenotype. R. palustris was found to grow in mixed anaerobic cultures and retained its 3-chlorobenzoate degradation property. 91 refs., 25 figs., 14 tabs.

  5. Acquisition of the ability for Rhodopseudomonas palustris to degrade chlorinated benzoic acids as the sole carbon source

    NARCIS (Netherlands)

    Oda, Y; de Vries, YP; Forney, LJ; Gottschal, JC


    Three strains of Rhodopseudomonas palustris were isolated from phototrophic enrichment cultures containing 3-chlorobenzoate (3-CBA) and benzoate (BA). These new strains as well as several previously described strains of R. palustris were tested in this study and shown to degrade 3-CBA if grown in

  6. Revealing the functions of the transketolase enzyme isoforms in Rhodopseudomonas palustris using a systems biology approach.

    Directory of Open Access Journals (Sweden)

    Chia-Wei Hu

    Full Text Available BACKGROUND: Rhodopseudomonas palustris (R. palustris is a purple non-sulfur anoxygenic phototrophic bacterium that belongs to the class of proteobacteria. It is capable of absorbing atmospheric carbon dioxide and converting it to biomass via the process of photosynthesis and the Calvin-Benson-Bassham (CBB cycle. Transketolase is a key enzyme involved in the CBB cycle. Here, we reveal the functions of transketolase isoforms I and II in R. palustris using a systems biology approach. METHODOLOGY/PRINCIPAL FINDINGS: By measuring growth ability, we found that transketolase could enhance the autotrophic growth and biomass production of R. palustris. Microarray and real-time quantitative PCR revealed that transketolase isoforms I and II were involved in different carbon metabolic pathways. In addition, immunogold staining demonstrated that the two transketolase isoforms had different spatial localizations: transketolase I was primarily associated with the intracytoplasmic membrane (ICM but transketolase II was mostly distributed in the cytoplasm. Comparative proteomic analysis and network construction of transketolase over-expression and negative control (NC strains revealed that protein folding, transcriptional regulation, amino acid transport and CBB cycle-associated carbon metabolism were enriched in the transketolase I over-expressed strain. In contrast, ATP synthesis, carbohydrate transport, glycolysis-associated carbon metabolism and CBB cycle-associated carbon metabolism were enriched in the transketolase II over-expressed strain. Furthermore, ATP synthesis assays showed a significant increase in ATP synthesis in the transketolase II over-expressed strain. A PEPCK activity assay showed that PEPCK activity was higher in transketolase over-expressed strains than in the negative control strain. CONCLUSIONS/SIGNIFICANCE: Taken together, our results indicate that the two isoforms of transketolase in R. palustris could affect photoautotrophic growth

  7. Effects of metal ions on biomass and 5-aminolevulinic acid production in Rhodopseudomonas palustris wastewater treatment. (United States)

    Liu, Shuli; Zhang, Guangming; Li, Jianzheng; Li, Xiangkun; Zhang, Jie


    This work investigated the effects of eight metal ions on Rhodopseudomonas palustris growth and 5-aminolevulinic acid (ALA) yield in wastewater treatment. Results show that metal ions (Mg(2+) of 15 mmol/L, Fe(2+) of 400 μmol/L, Co(2+) of 4 μmol/L, Ni(2+) of 8 μmol/L and Zn(2+) of 4 μmol/L) could effectively improve the chemical oxygen demand (COD) removal, Rp. palustris biomass and ALA yield. The highest ALA yield of 13.1 mg/g-biomass was achieved with Fe(2+) of 400 μmol/L. ALA yields were differentially increased under different metal ions in the following order: Fe(2+) group > Mg(2+) group > Co(2+) group = Ni(2+) group > Zn(2+) group = Mo(2+) group > control. Cu(2+) and Mn(2+) inhibited Rp. palustris growth and ALA production. Mechanism analysis revealed that metal ions changed ALA yields by influencing the activities of ALA synthetase and ALA dehydratase.

  8. Uranium interaction with two multi-resistant environmental bacteria: Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris. (United States)

    Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie


    Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations.

  9. Uranium Interaction with Two Multi-Resistant Environmental Bacteria: Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris (United States)

    Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie


    Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations. PMID:23251623

  10. How Posttranslational Modification of Nitrogenase Is Circumvented in Rhodopseudomonas palustris Strains That Produce Hydrogen Gas Constitutively (United States)

    Heiniger, Erin K.; Oda, Yasuhiro; Samanta, Sudip K.


    Nitrogenase catalyzes the conversion of dinitrogen gas (N2) and protons to ammonia and hydrogen gas (H2). This is a catalytically difficult reaction that requires large amounts of ATP and reducing power. Thus, nitrogenase is not normally expressed or active in bacteria grown with a readily utilized nitrogen source like ammonium. nifA* mutants of the purple nonsulfur phototrophic bacterium Rhodopseudomonas palustris have been described that express nitrogenase genes constitutively and produce H2 when grown with ammonium as a nitrogen source. This raised the regulatory paradox of why these mutants are apparently resistant to a known posttranslational modification system that should switch off the activity of nitrogenase. Microarray, mutation analysis, and gene expression studies showed that posttranslational regulation of nitrogenase activity in R. palustris depends on two proteins: DraT2, an ADP-ribosyltransferase, and GlnK2, an NtrC-regulated PII protein. GlnK2 was not well expressed in ammonium-grown NifA* cells and thus not available to activate the DraT2 nitrogenase modification enzyme. In addition, the NifA* strain had elevated nitrogenase activity due to overexpression of the nif genes, and this increased amount of expression overwhelmed a basal level of activity of DraT2 in ammonium-grown cells. Thus, insufficient levels of both GlnK2 and DraT2 allow H2 production by an nifA* mutant grown with ammonium. Inactivation of the nitrogenase posttranslational modification system by mutation of draT2 resulted in increased H2 production by ammonium-grown NifA* cells. PMID:22179236

  11. Two Distinct Aerobic Methionine Salvage Pathways Generate Volatile Methanethiol in Rhodopseudomonas palustris (United States)

    Miller, Anthony R.; North, Justin A.; Wildenthal, John A.


    ABSTRACT 5′-Methyl-thioadenosine (MTA) is a dead-end, sulfur-containing metabolite and cellular inhibitor that arises from S-adenosyl-l-methionine-dependent reactions. Recent studies have indicated that there are diverse bacterial methionine salvage pathways (MSPs) for MTA detoxification and sulfur salvage. Here, via a combination of gene deletions and directed metabolite detection studies, we report that under aerobic conditions the facultatively anaerobic bacterium Rhodopseudomonas palustris employs both an MTA-isoprenoid shunt identical to that previously described in Rhodospirillum rubrum and a second novel MSP, both of which generate a methanethiol intermediate. The additional R. palustris aerobic MSP, a dihydroxyacetone phosphate (DHAP)-methanethiol shunt, initially converts MTA to 2-(methylthio)ethanol and DHAP. This is identical to the initial steps of the recently reported anaerobic ethylene-forming MSP, the DHAP-ethylene shunt. The aerobic DHAP-methanethiol shunt then further metabolizes 2-(methylthio)ethanol to methanethiol, which can be directly utilized by O-acetyl-l-homoserine sulfhydrylase to regenerate methionine. This is in contrast to the anaerobic DHAP-ethylene shunt, which metabolizes 2-(methylthio)ethanol to ethylene and an unknown organo-sulfur intermediate, revealing functional diversity in MSPs utilizing a 2-(methylthio)ethanol intermediate. When MTA was fed to aerobically growing cells, the rate of volatile methanethiol release was constant irrespective of the presence of sulfate, suggesting a general housekeeping function for these MSPs up through the methanethiol production step. Methanethiol and dimethyl sulfide (DMS), two of the most important compounds of the global sulfur cycle, appear to arise not only from marine ecosystems but from terrestrial ones as well. These results reveal a possible route by which methanethiol might be biologically produced in soil and freshwater environments. PMID:29636438

  12. Hydrogen production under salt stress conditions by a freshwater Rhodopseudomonas palustris strain. (United States)

    Adessi, Alessandra; Concato, Margherita; Sanchini, Andrea; Rossi, Federico; De Philippis, Roberto


    Hydrogen represents a possible alternative energy carrier to face the growing request for energy and the shortage of fossil fuels. Photofermentation for the production of H2 constitutes a promising way for integrating the production of energy with waste treatments. Many wastes are characterized by high salinity, and polluted seawater can as well be considered as a substrate. Moreover, the application of seawater for bacterial culturing is considered cost-effective. The aims of this study were to assess the capability of the metabolically versatile freshwater Rhodopseudomonas palustris 42OL of producing hydrogen on salt-containing substrates and to investigate its salt stress response strategy, never described before. R. palustris 42OL was able to produce hydrogen in media containing up to 3 % added salt concentration and to grow in media containing up to 4.5 % salinity without the addition of exogenous osmoprotectants. While the hydrogen production performances in absence of sea salts were higher than in their presence, there was no significant difference in performances between 1 and 2 % of added sea salts. Nitrogenase expression levels indicated that the enzyme was not directly inhibited during salt stress, but a regulation of its expression may have occurred in response to salt concentration increase. During cell growth and hydrogen production in the presence of salts, trehalose was accumulated as a compatible solute; it protected the enzymatic functionality against salt stress, thus allowing hydrogen production. The possibility of producing hydrogen on salt-containing substrates widens the range of wastes that can be efficiently used in production processes.

  13. Sequence Analysis of the Cryptic Plasmid pMG101 from Rhodopseudomonas palustris and Construction of Stable Cloning Vectors (United States)

    Inui, Masayuki; Roh, Jung Hyeob; Zahn, Kenneth; Yukawa, Hideaki


    A 15-kb cryptic plasmid was obtained from a natural isolate of Rhodopseudomonas palustris. The plasmid, designated pMG101, was able to replicate in R. palustris and in closely related strains of Bradyrhizobium japonicum and phototrophic Bradyrhizobium species. However, it was unable to replicate in the purple nonsulfur bacterium Rhodobacter sphaeroides and in Rhizobium species. The replication region of pMG101 was localized to a 3.0-kb SalI-XhoI fragment, and this fragment was stably maintained in R. palustris for over 100 generations in the absence of selection. The complete nucleotide sequence of this fragment revealed two open reading frames (ORFs), ORF1 and ORF2. The deduced amino acid sequence of ORF1 is similar to sequences of Par proteins, which mediate plasmid stability from certain plasmids, while ORF2 was identified as a putative rep gene, coding for an initiator of plasmid replication, based on homology with the Rep proteins of several other plasmids. The function of these sequences was studied by deletion mapping and gene disruptions of ORF1 and ORF2. pMG101-based Escherichia coli-R. palustris shuttle cloning vectors pMG103 and pMG105 were constructed and were stably maintained in R. palustris growing under nonselective conditions. The ability of plasmid pMG101 to replicate in R. palustris and its close phylogenetic relatives should enable broad application of these vectors within this group of α-proteobacteria. PMID:10618203

  14. Hydrogen production using Rhodopseudomonas palustris WP 3-5 with hydrogen fermentation reactor effluent

    International Nuclear Information System (INIS)

    Chi-Mei Lee; Kuo-Tsang Hung


    The possibility of utilizing the dark hydrogen fermentation stage effluents for photo hydrogen production using purple non-sulfur bacteria should be elucidated. In the previous experiments, Rhodopseudomonas palustris WP3-5 was proven to efficiently produce hydrogen from the effluent of hydrogen fermentation reactors. The highest hydrogen production rate was obtained at a HRT value of 48 h when feeding a 5 fold effluent dilution from anaerobic hydrogen fermentation. Besides, hydrogen production occurred only when the NH 4 + concentration was below 17 mg-NH 4 + /l. Therefore, for successful fermentation effluent utilization, the most important things were to decrease the optimal HRT, increase the optimal substrate concentration and increase the tolerable ammonia concentration. In this study, a lab-scale serial photo-bioreactor was constructed. The reactor overall hydrogen production efficiency with synthetic wastewater exhibiting an organic acid profile identical to that of anaerobic hydrogen fermentation reactor effluent and with effluent from two anaerobic hydrogen fermentation reactors was evaluated. (authors)

  15. Optimization of phototrophic hydrogen production by Rhodopseudomonas palustris PBUM001 via statistical experimental design

    Energy Technology Data Exchange (ETDEWEB)

    Jamil, Zadariana [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia); Faculty of Civil Engineering, Technology University of MARA (Malaysia); Mohamad Annuar, Mohamad Suffian; Vikineswary, S. [Institute of Biological Sciences, University of Malaya (Malaysia); Ibrahim, Shaliza [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia)


    Phototrophic hydrogen production by indigenous purple non-sulfur bacteria, Rhodopseudomonas palustris PBUM001 from palm oil mill effluent (POME) was optimized using response surface methodology (RSM). The process parameters studied include inoculum sizes (% v/v), POME concentration (% v/v), light intensity (klux), agitation (rpm) and pH. The experimental data on cumulative hydrogen production and COD reduction were fitted into a quadratic polynomial model using response surface regression analysis. The path to optimal process conditions was determined by analyzing response surface three-dimensional surface plot and contour plot. Statistical analysis on experimental data collected following Box-Behnken design showed that 100% (v/v) POME concentration, 10% (v/v) inoculum size, light intensity at 4.0 klux, agitation rate at 250 rpm and pH of 6 were the best conditions. The maximum predicted cumulative hydrogen production and COD reduction obtained under these conditions was 1.05 ml H{sub 2}/ml POME and 31.71% respectively. Subsequent verification experiments at optimal process values gave the maximum yield of cumulative hydrogen at 0.66 {+-} 0.07 ml H{sub 2}/ml POME and COD reduction at 30.54 {+-} 9.85%. (author)

  16. Arsenic-Redox Transformation and Plant Growth Promotion by Purple Nonsulfur Bacteria Rhodopseudomonas palustris CS2 and Rhodopseudomonas faecalis SS5. (United States)

    Batool, Kanza; Tuz Zahra, Fatima; Rehman, Yasir


    Arsenic (As) is a well-known toxic metalloid found naturally and released by different industries, especially in developing countries. Purple nonsulfur bacteria (PNSB) are known for wastewater treatment and plant growth promoting abilities. As-resistant PNSB were isolated from a fish pond. Based on As-resistance and plant growth promoting attributes, 2 isolates CS2 and SS5 were selected and identified as Rhodopseudomonas palustris and Rhodopseudomonas faecalis , respectively, through 16S rRNA gene sequencing. Maximum As(V) resistance shown by R. faecalis SS5 and R. palustris CS2 was up to 150 and 100 mM, respectively. R . palustris CS2 showed highest As(V) reduction up to 62.9% (6.29 ± 0.24 mM), while R. faecalis SS5 showed maximum As(III) oxidation up to 96% (4.8 ± 0.32 mM), respectively. Highest auxin production was observed by R. palustris CS2 and R. faecalis SS, up to 77.18 ± 3.7 and 76.67 ± 2.8  μ g mL -1 , respectively. Effects of these PNSB were tested on the growth of Vigna mungo plants. A statistically significant increase in growth was observed in plants inoculated with isolates compared to uninoculated plants, both in presence and in absence of As. R. palustris CS2 treated plants showed 17% (28.1 ± 0.87 cm) increase in shoot length and 21.7% (7.07 ± 0.42 cm) increase in root length, whereas R. faecalis SS5 treated plants showed 12.8% (27.09 ± 0.81 cm) increase in shoot length and 18.8% (6.9 ± 0.34 cm) increase in root length as compared to the control plants. In presence of As, R. palustris CS2 increased shoot length up to 26.3% (21.0 ± 1.1 cm), while root length increased up to 31.3% (5.3 ± 0.4 cm), whereas R. faecalis SS5 inoculated plants showed 25% (20.7 ± 1.4 cm) increase in shoot length and 33.3% (5.4 ± 0.65 cm) increase in root length as compared to the control plants. Bacteria with such diverse abilities could be ideal for plant growth promotion in As-contaminated sites.

  17. A novel electrophototrophic bacterium Rhodopseudomonas palustris strain RP2, exhibits hydrocarbonoclastic potential in anaerobic environments

    Directory of Open Access Journals (Sweden)

    Krishnaveni Venkidusamy


    Full Text Available An electrophototrophic, hydrocarbonoclastic bacterium Rhodopseudomonas palustris stain RP2 was isolated from the anodic biofilms of hydrocarbon fed microbial electrochemical remediation systems (MERS. Salient properties of the strain RP2 were direct electrode respiration, dissimilatory metal oxide reduction, spore formation, anaerobic nitrate reduction, free living diazotrophy and the ability to degrade n-alkane components of petroleum hydrocarbons in anoxic, photic environments. In acetate fed microbial electrochemical cells, a maximum current density of 305±10 mA/m2 (1000Ω was generated (power density 131.65±10 mW/m2 by strain RP2 with a coulombic efficiency of 46.7 ± 1.3%. Cyclic voltammetry studies showed that anaerobically grown cells of strain RP2 is electrochemically active and likely to transfer electrons extracellularly to solid electron acceptors through membrane bound compounds, however, aerobically grown cells lacked the electrochemical activity. The ability of strain RP2 to produce current (maximum current density 21±3 mA/m2; power density 720±7 µW/m2, 1000Ω using petroleum hydrocarbon (PH as a sole energy source was also examined using an initial concentration of 800 mg l-1 of diesel range hydrocarbons (C9- C36 with a concomitant removal of 47.4 ± 2.7% hydrocarbons in MERS. Here, we also report the first study that shows an initial evidence for the existence of a hydrocarbonoclastic behavior in the strain RP2 when grown in different electron accepting and illuminated conditions (anaerobic and MERS degradation. Such observations reveal the importance of photoorganotrophic growth in the utilization of hydrocarbons from contaminated environments. Identification of such novel petrochemical hydrocarbon degrading electricigens, not only expands the knowledge on the range of bacteria known for the hydrocarbon bioremediation but also shows a biotechnological potential that goes well beyond its applications to MERS.

  18. High-throughput transcriptome sequencing analysis provides preliminary insights into the biotransformation mechanism of Rhodopseudomonas palustris treated with alpha-rhamnetin-3-rhamnoside. (United States)

    Bi, Lei; Guan, Chun-jie; Yang, Guan-e; Yang, Fei; Yan, Hong-yu; Li, Qing-shan


    The purple photosynthetic bacterium Rhodopseudomonas palustris has been widely applied to enhance the therapeutic effects of traditional Chinese medicine using novel biotransformation technology. However, comprehensive studies of the R. palustris biotransformation mechanism are rare. Therefore, investigation of the expression patterns of genes involved in metabolic pathways that are active during the biotransformation process is essential to elucidate this complicated mechanism. To promote further study of the biotransformation of R. palustris, we assembled all R. palustris transcripts using Trinity software and performed differential expression analysis of the resulting unigenes. A total of 9725, 7341 and 10,963 unigenes were obtained by assembling the alpha-rhamnetin-3-rhamnoside-treated R. palustris (RPB) reads, control R. palustris (RPS) reads and combined RPB&RPS reads, respectively. A total of 9971 unigenes assembled from the RPB&RPS reads were mapped to the nr, nt, Swiss-Prot, Gene Ontology (GO), Clusters of Orthologous Groups (COGs) and Kyoto Encyclopedia of Genes and Genomes (KEGG) (E-value biotransformation in R. palustris. Furthermore, we propose two putative ARR biotransformation mechanisms in R. palustris. These analytical results represent a useful genomic resource for in-depth research into the molecular basis of biotransformation and genetic modification in R. palustris. Copyright © 2016 Elsevier GmbH. All rights reserved.

  19. Phenotype fingerprinting suggests the involvement of single-genotype consortia in degradation of aromatic compounds by Rhodopseudomonas palustris.

    Directory of Open Access Journals (Sweden)

    Tatiana V Karpinets

    Full Text Available Anaerobic degradation of complex organic compounds by microorganisms is crucial for development of innovative biotechnologies for bioethanol production and for efficient degradation of environmental pollutants. In natural environments, the degradation is usually accomplished by syntrophic consortia comprised of different bacterial species. This strategy allows consortium organisms to reduce efforts required for maintenance of the redox homeostasis at each syntrophic level. Cellular mechanisms that maintain the redox homeostasis during the degradation of aromatic compounds by one organism are not fully understood. Here we present a hypothesis that the metabolically versatile phototrophic bacterium Rhodopseudomonas palustris forms its own syntrophic consortia, when it grows anaerobically on p-coumarate or benzoate as a sole carbon source. We have revealed the consortia from large-scale measurements of mRNA and protein expressions under p-coumarate, benzoate and succinate degrading conditions using a novel computational approach referred as phenotype fingerprinting. In this approach, marker genes for known R. palustris phenotypes are employed to determine the relative expression levels of genes and proteins in aromatics versus non-aromatics degrading condition. Subpopulations of the consortia are inferred from the expression of phenotypes and known metabolic modes of the R. palustris growth. We find that p-coumarate degrading conditions may lead to at least three R. palustris subpopulations utilizing p-coumarate, benzoate, and CO2 and H2. Benzoate degrading conditions may also produce at least three subpopulations utilizing benzoate, CO2 and H2, and N2 and formate. Communication among syntrophs and inter-syntrophic dynamics in each consortium are indicated by up-regulation of transporters and genes involved in the curli formation and chemotaxis. The N2-fixing subpopulation in the benzoate degrading consortium has preferential activation of the

  20. Promoting effects of a single Rhodopseudomonas palustris inoculant on plant growth by Brassica rapa chinensis under low fertilizer input. (United States)

    Wong, Wai-Tak; Tseng, Ching-Han; Hsu, Shu-Hua; Lur, Huu-Sheng; Mo, Chia-Wei; Huang, Chu-Ning; Hsu, Shu-Chiung; Lee, Kung-Ta; Liu, Chi-Te


    Several Rhodopseudomonas palustris strains have been isolated from rice paddy fields in Taiwan by combining the Winogradsky column method and molecular marker detection. These isolates were initially screened by employing seed germination and seedling vigor assays to evaluate their potential as inoculants. To fulfill the demand in the present farming system for reducing the application of chemical fertilizers, we assessed the plant growth-promoting effects of the R. palustris YSC3, YSC4, and PS3 inoculants on Brassica rapa chinensis (Chinese cabbage) cultivated under a half quantity of fertilizer. The results obtained showed that supplementation with approximately 4.0×10(6) CFU g(-1) soil of the PS3 inoculant at half the amount of fertilizer consistently produced the same plant growth potential as 100% fertility, and also increased the nitrogen use efficiency of the applied fertilizer nutrients. Furthermore, we noted that the plant growth-promotion rate elicited by PS3 was markedly higher with old seeds than with new seeds, suggesting it has the potential to boost the development of seedlings that were germinated from carry-over seeds of poor quality. These beneficial traits suggest that the PS3 isolate may serve as a potential PGPR inoculant for integrated nutrient management in agriculture.

  1. Transfer of the high-GC cyclohexane carboxylate degradation pathway from Rhodopseudomonas palustris to Escherichia coli for production of biotin. (United States)

    Bernstein, Jeffrey R; Bulter, Thomas; Liao, James C


    This work demonstrates the transfer of the five-gene cyclohexane carboxylate (CHC) degradation pathway from the high-GC alphaproteobacterium Rhodopseudomonas palustris to Escherichia coli, a gammaproteobacterium. The degradation product of this pathway is pimeloyl-CoA, a key metabolite in E. coli's biotin biosynthetic pathway. This pathway is useful for biotin overproduction in E. coli; however, the expression of GC-rich genes is troublesome in this host. When the native R. palustris CHC degradation pathway is transferred to a DeltabioH pimeloyl-CoA auxotroph of E. coli, it is unable to complement growth in the presence of CHC. To overcome this expression problem we redesigned the operon with decreased GC content and removed stretches of high-GC intergenic DNA which comprise the 5' untranslated region of each gene, replacing these features with shorter low-GC sequences. We show this synthetic construct enables growth of the DeltabioH strain in the presence of CHC. When the synthetic degradation pathway is overexpressed in conjunction with the downstream genes for biotin biosynthesis, we measured significant accumulation of biotin in the growth medium, showing that the pathway transfer is successfully integrated with the host metabolism.

  2. Identification of protein W, the elusive sixth subunit of the Rhodopseudomonas palustris reaction center-light harvesting 1 core complex. (United States)

    Jackson, Philip J; Hitchcock, Andrew; Swainsbury, David J K; Qian, Pu; Martin, Elizabeth C; Farmer, David A; Dickman, Mark J; Canniffe, Daniel P; Hunter, C Neil


    The X-ray crystal structure of the Rhodopseudomonas (Rps.) palustris reaction center-light harvesting 1 (RC-LH1) core complex revealed the presence of a sixth protein component, variably referred to in the literature as helix W, subunit W or protein W. The position of this protein prevents closure of the LH1 ring, possibly to allow diffusion of ubiquinone/ubiquinol between the RC and the cytochrome bc 1 complex in analogous fashion to the well-studied PufX protein from Rhodobacter sphaeroides. The identity and function of helix W have remained unknown for over 13years; here we use a combination of biochemistry, mass spectrometry, molecular genetics and electron microscopy to identify this protein as RPA4402 in Rps. palustris CGA009. Protein W shares key conserved sequence features with PufX homologs, and although a deletion mutant was able to grow under photosynthetic conditions with no discernible phenotype, we show that a tagged version of protein W pulls down the RC-LH1 complex. Protein W is not encoded in the photosynthesis gene cluster and our data indicate that only approximately 10% of wild-type Rps. palustris core complexes contain this non-essential subunit; functional and evolutionary consequences of this observation are discussed. The ability to purify uniform RC-LH1 and RC-LH1-protein W preparations will also be beneficial for future structural studies of these bacterial core complexes. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  3. A two-step fermentation of distillers' grains using Trichoderma viride and Rhodopseudomonas palustris for fish feed. (United States)

    Zhang, Jian; Zhang, Wen-Xue; Li, Shun-Zhou; You, Ling; Zhang, Chao; Sun, Chuan-Ze; Liu, Xiao-Bin


    It is important to provide added value or to make full use of the co-product of grains from ethanol production. In order to convert distillers' grains into a high-quality feed, the Trichoderma viride and Rhodopseudomonas palustris fermentation were combined and investigated in this study. The T. viride fermentation was carried out in an aerobic fermentation installation in favoring of the growth of the fungi and the degradation of the cellulose, and then the fermentation of R. palustris was performed to increase the content of protein with an anaerobic installation. After the two step fermentations, the true protein content of dried distiller' grains increased from 11.4 to 33.6 % (w/w) (the content of crude protein from 14.5 to 39.7 %), the crude fiber content decreased from 21.3 to 7.6 % (w/w), the crude fat content increased from 5.5 to 7.9 % (w/w), the crude ash decreased from 14.6 to 10.2 % (w/w), the total phosphorus content increased from 0.4 to 1.2 % (w/w), and the water content was 11.8 % (w/w). The dried and fermented grains contain the R. palustris viable count of 5.3 × 10¹¹ CFU/g dry matter. The results may support a new application of an active photosynthetic bacteria fish feed in fisheries industry and offer a reference for the further study of lignocellulosic materials as raw materials converting into high-quality feed.

  4. Single-molecule spectroscopy reveals that individual low-light LH2 complexes from Rhodopseudomonas palustris 2.1.6. have a heterogeneous polypeptide composition. (United States)

    Brotosudarmo, Tatas H P; Kunz, Ralf; Böhm, Paul; Gardiner, Alastair T; Moulisová, Vladimíra; Cogdell, Richard J; Köhler, Jürgen


    Rhodopseudomonas palustris belongs to the group of purple bacteria that have the ability to produce LH2 complexes with unusual absorption spectra when they are grown at low-light intensity. This ability is often related to the presence of multiple genes encoding the antenna apoproteins. Here we report, for the first time to our knowledge, direct evidence that individual low-light LH2 complexes have a heterogeneous alphabeta-apoprotein composition that modulates the site energies of Bchl a molecules, producing absorption bands at 800, 820, and 850 nm. The arrangement of the Bchl a molecules in the "tightly coupled ring" can be modeled by nine alphabeta-Bchls dimers, such that the Bchls bound to six alphabeta-pairs have B820-like site energies and the remaining Bchl a molecules have B850-like site energies. Furthermore, the experimental data can only be satisfactorily modeled when these six alphabeta-pairs with B820 Bchl a molecules are distributed such that the symmetry of the assembly is reduced to C(3). It is also clear from the measured single-molecule spectra that the energies of the electronically excited states in the mixed B820/850 ring are mainly influenced by diagonal disorder.

  5. Cloning and characterization of a pyrethroid pesticide decomposing esterase gene, Est3385, from Rhodopseudomonas palustris PSB-S. (United States)

    Luo, Xiangwen; Zhang, Deyong; Zhou, Xuguo; Du, Jiao; Zhang, Songbai; Liu, Yong


    Full length open reading frame of pyrethroid detoxification gene, Est3385, contains 963 nucleotides. This gene was identified and cloned based on the genome sequence of Rhodopseudomonas palustris PSB-S available at the GneBank. The predicted amino acid sequence of Est3385 shared moderate identities (30-46%) with the known homologous esterases. Phylogenetic analysis revealed that Est3385 was a member in the esterase family I. Recombinant Est3385 was heterologous expressed in E. coli, purified and characterized for its substrate specificity, kinetics and stability under various conditions. The optimal temperature and pH for Est3385 were 35 °C and 6.0, respectively. This enzyme could detoxify various pyrethroid pesticides and degrade the optimal substrate fenpropathrin with a Km and Vmax value of 0.734 ± 0.013 mmol·l -1 and 0.918 ± 0.025 U·µg -1 , respectively. No cofactor was found to affect Est3385 activity but substantial reduction of enzymatic activity was observed when metal ions were applied. Taken together, a new pyrethroid degradation esterase was identified and characterized. Modification of Est3385 with protein engineering toolsets should enhance its potential for field application to reduce the pesticide residue from agroecosystems.

  6. Different Metabolomic Responses to Carbon Starvation between Light and Dark Conditions in the Purple Photosynthetic Bacterium, Rhodopseudomonas palustris. (United States)

    Kanno, Nanako; Matsuura, Katsumi; Haruta, Shin


    Purple photosynthetic bacteria utilize light energy for growth. We previously demonstrated that light energy contributed to prolonging the survival of multiple purple bacteria under carbon-starved conditions. In order to clarify the effects of illumination on metabolic states under carbon-starved, non-growing conditions, we herein compared the metabolic profiles of starved cells in the light and dark using the purple bacterium, Rhodopseudomonas palustris. The metabolic profiles of starved cells in the light were markedly different from those in the dark. After starvation for 5 d in the light, cells showed increases in the amount of ATP and the NAD + /NADH ratio. Decreases in the amounts of most metabolites related to glycolysis and the TCA cycle in energy-rich starved cells suggest the active utilization of these metabolites for the modification of cellular components. Starvation in the dark induced the consumption of cellular compounds such as amino acids, indicating that the degradation of these cellular components produced ATP in order to maintain viability under energy-poor conditions. The present results suggest that intracellular energy levels alter survival strategies under carbon-starved conditions through metabolism.

  7. Preservation of H2 production activity in nanoporous latex coatings of Rhodopseudomonas palustris CGA009 during dry storage at ambient temperatures: Preservation of R. palustris latex coatings

    Energy Technology Data Exchange (ETDEWEB)

    Piskorska, M. [Univ. of South Carolina, Aiken, SC (United States); Soule, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Gosse, J. L. [North Carolina State Univ., Raleigh, NC (United States); Milliken, C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Flickinger, M. C. [North Carolina State Univ., Raleigh, NC (United States); Smith, G. W. [Univ. of South Carolina, Aiken, SC (United States); Yeager, C. M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)


    To assess the applicability of latex cell coatings as an ‘off-the-shelf’ biocatalyst, the effect of osmoprotectants, temperature, humidity and O2 on preservation of H2 production in Rhodopseudomonas palustris coatings was evaluated. Immediately following latex coating coalescence (24 h) and for up to 2 weeks of dry storage, rehydrated coatings containing different osmoprotectants displayed similar rates of H2 production. Beyond 2 weeks of storage, sorbitol-treated coatings lost all H2 production activity, whereas considerable H2 production was still detected in sucrose- and trehalose-stabilized coatings. The relative humidity level at which the coatings were stored had a significant impact on the recovery and subsequent rates of H2 production. After 4 weeks storage under air at 60% humidity, coatings produced only trace amounts of H2 (0–0.1% headspace accumulation), whereas those stored at < 5% humidity retained 27–53% of their H2 production activity after 8 weeks of storage. In conWhen stored in argon at < 5% humidity and room temperature, R. palustris coatings retained full H2 production activity for 3 months, implicating oxidative damage as a key factor limiting coating storage. Overall, the results demonstrate that biocatalytic latex coatings are an attractive cell immobilization platform for preservation of bioactivity in the dry state.

  8. Anaerobic p-coumarate degradation by Rhodopseudomonas palustris and identification of CouR, a MarR repressor protein that binds p-coumaroyl coenzyme A. (United States)

    Hirakawa, Hidetada; Schaefer, Amy L; Greenberg, E Peter; Harwood, Caroline S


    The phenylpropanoid p-coumarate and structurally related aromatic compounds are produced in large amounts by green plants and are excellent carbon sources for many soil bacteria. Aerobic bacteria remove the acyl side chain from phenylpropanoids to leave an aromatic aldehyde, which then enters one of several possible central pathways of benzene ring degradation. We investigated the pathway for the anaerobic degradation of p-coumarate by the phototrophic bacterium Rhodopseudomonas palustris and found that it also follows this metabolic logic. We characterized enzymes for the conversion of p-coumarate to p-hydroxybenzaldehyde and acetyl coenzyme A (acetyl-CoA) encoded by the couAB operon. We also identified a MarR family transcriptional regulator that we named CouR. A couR mutant had elevated couAB expression. In addition, His-tagged CouR bound with high affinity to a DNA fragment encompassing the couAB promoter region, and binding was abrogated by the addition of nanomolar quantities of p-coumaroyl-CoA but not by p-coumarate. Footprinting demonstrated binding of CouR to an inverted repeat sequence that overlaps the -10 region of the couAB promoter. Our results provide evidence for binding of a CoA-modified aromatic compound by a MarR family member. Although the MarR family is widely distributed in bacteria and archaea and includes over 12,000 members, ligands have been identified for relatively few family members. Here we provide biochemical evidence for a new category of MarR ligand.

  9. Hydrogen photo-evolution by Rhodopseudomonas palustris 6A using pre-treated olive mill wastewater and a synthetic medium containing sugars

    International Nuclear Information System (INIS)

    Pintucci, Cristina; Padovani, Giulia; Giovannelli, Alessio; Traversi, Maria Laura; Ena, Alba; Pushparaj, Benjamin; Carlozzi, Pietro


    Highlights: • Adsorbent matrices to convert fresh olive mill wastewater (OMW F ) in feedstock. • Dry-Azolla and granular active carbon for adsorbing polyphenols from OMW F . • Photofermentative processes for biohydrogen production. • Culture mixing by means of an impeller or a magnetic stir bar. • A 30% of dephenolised OMW containing medium suits the photofermentative process. - Abstract: Increasing costs of petroleum, associated with the escalating problems of global climate change, require always greater efforts in order to produce an energy carrier as bioH 2 . In this study, bioH 2 production using photofermentative process was investigated. Two culture broths were used: (a) a synthetic medium rich in sugars (glucose and fructose) and (b) a pre-treated fresh olive-mill wastewater (OMW F ) diluted with water (30%, v:v). The pre-treatment was carried out using two different vegetable matrices (dry-Azolla and granular active carbon) to decrease both the content of polyphenols and the dark colour of wastewater. Rhodopseudomonas palustris 6A isolated from soil spread with OMW was utilized for batch growth experiments, carried out indoors under continuous light (200 μE/m 2 /s). When synthetic medium was used, the culture mixing was performed using either (i) a magnetic stir bar, and (ii) an impeller equipped with five turbines. The latter system made it possible to increase the bioH 2 photo-evolution by 1.4 times. The specific hydrogen photo-evolution rate was 13.5 mL/g(dw)/h in the broth containing diluted OMW F and 11.8 mL/g(dw)/h in the synthetic medium containing sugars (glucose and fructose)

  10. Effect of dilution and L-malic acid addition on bio-hydrogen production with Rhodopseudomonas palustris from effluent of an acidogenic anaerobic reactor

    International Nuclear Information System (INIS)

    Azbar, N.; Tuba, F.; Dokgoz, C.


    In this study, H 2 was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31 o C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121 o C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H 2 / g COD fed ). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H 2 / g COD fed ). It was found that, undiluted raw cheese whey wastewater effluent from dark hydrogen

  11. Effect of dilution and L-malic acid addition on bio-hydrogen production with Rhodopseudomonas palustris from effluent of an acidogenic anaerobic reactor

    Energy Technology Data Exchange (ETDEWEB)

    Azbar, N.; Tuba, F.; Dokgoz, C. [Bioengineering Dept., Faculty of Engineering, Ege Univ., Izmir (Turkey)], E-mail:


    In this study, H{sub 2} was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31{sup o}C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121{sup o}C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H{sub 2}/ g COD{sub fed}). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H{sub 2} / g COD{sub fed}). It was found that, undiluted raw cheese whey wastewater

  12. Phosphoenolpyruvate-dependent fructose phosphotransferase system in Rhodopseudomonas sphaeroides : The coupling between transport and phosphorylation in inside-out vesicles

    NARCIS (Netherlands)

    Lolkema, Juke S.; Robillard, George T.

    The bacterial phosphotransferase systems are believed to catalyze the concomitant transport and phosphorylation of hexoses and hexitols. The transport is from the outside to the inside of the cell. An absolute coupling between transport and phosphorylation has however been questioned in the

  13. Ecosystem carbon stocks in Pinus palustris forests (United States)

    Lisa Samuelson; Tom Stokes; John R. Butnor; Kurt H. Johnsen; Carlos A. Gonzalez-Benecke; Pete Anderson; Jason Jackson; Lorenzo Ferrari; Tim A. Martin; Wendell P. Cropper


    Longleaf pine (Pinus palustris Mill.) restoration in the southeastern United States offers opportunities for carbon (C) sequestration. Ecosystem C stocks are not well understood in longleaf pine forests, which are typically of low density and maintained by prescribed fire. The objectives of this research were to develop allometric equations for...

  14. Moessbauer spectroscopy on the reaction center of Rhodopseudomonas viridis

    International Nuclear Information System (INIS)

    Frolov, E.; Goldanskii, V.I.; Birk, A.; Parak, F.; Fritzsch, G.; Sinning, I.; Michel, H.


    Proteins called 'reaction centers' (RC) can be isolated from many photosynthetic bacteria. They have one non-heme iron in a quinone acceptor region. The RC of Rhodopseudomonas viridis contains an additional tightly bound tetra-heme cytochrome c subunit. The electronic configuration of both cytochrome and the non-heme iron has been studied in the crystallized protein by Moessbauer spectroscopy at different redox potentials, pH-values, and with an addition of o-phenanthroline. At high potentials (E h =+500 mV) all heme irons are in the low spin Fe 3+ -state, and at low potential (E h = 1 50 mV) they are low spin Fe 2+ with the same Moessbauer parameters for all hemes independent of pH. Redox titrations change the relative area of the reduced and oxidized states in agreement with other methods. The non-heme iron shows a high spin Fe 2+ configuration independent of E h and pH with parameters comparable to those of Rhodopseudomonas sphaeroides. Surprisingly, there is strong evidence for another non-heme iron species in part of the molecules with a Fe 2+ low spin configuration. Incubation with o-phenanthroline decreases the relative Fe 2+ hs-area and increases the contribution of Fe 2+ ls-area. Above 210 K the mean square displacement, 2 >, of the RC-crystals increases more than linearly with temperature. This may be correlated with the increase of the electron transfer rate and indicates that intramolecular mobility influences the functional activity of a protein. (orig.)

  15. Molar extinction coefficients and other properties of an improved reaction center preparation from Rhodopseudomonas viridis

    Energy Technology Data Exchange (ETDEWEB)

    Clayton, R.K.; Clayton, B.J.


    Reaction centers have been purified from chromatophores of Rhodopseudomonas viridis by treatment with lauryl dimethyl amine oxide followed by hydroxyapatite chromatography and precipitation with ammonium sulfate. The absorption spectrum at low temperature shows bands at 531 and 543 nm, assigned to two molecules of bacteriopheophytin b. The 600 nm band of bacteriochlorophyll b is resolved at low temperature into components at 601 and 606.5 nm. At room temperature the light-induced difference spectrum shows a negative band centered at 615 nm, where the absorption spectrum shows only a week shoulder adjacent to the 600 nm band. The fluorescence spectrum shows a band at 1000 nm and no fluorescence corresponding to the 830 nm absorption band. Two molecules of cytochrome 558 and three of cytochrome 552 accompany each reaction center. The differential extinction coefficient (reduced minus oxidized) of cytochrome 558 nm was estimated as 20 +- 2 mM/sup -1/.cm/sup -1/ through a coupled reaction with equine cytochrome c. The extinction coefficient of reaction centers at 960 nm was determined to be 123 +- 25 mM/sup -1/.cm/sup -1/ by measuring the light-induced bleaching of P-960 and the coupled oxidation of cytochrome 558. The corresponding extinction coefficient at 830 nm is 300 +- 65 mM/sup -1/.cm/sup -1/. The absorbance ratio ..cap alpha../sub 280nm/..cap alpha../sub 830nm/ in our preparations was 2.1, and there was 190 kg protein per mol of reaction centers. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis showed three major components of apparent molecular weights 31,000, 37,000, and 41,000.

  16. Variability of Caltha palustris L. populations in garden culture

    Directory of Open Access Journals (Sweden)

    Krystyna Falińska


    Full Text Available On the basis of studies performed in the experimental garden the character of the variability of Caltha palustris L. populations is described. Individuals were bred under uniform conditions from diaspores of meadow, springwood, flood-plain forest and alder forest populations. The results obtained allow to evaluate the hypothesis concerning the ecological preference of cytotypes (S m i t 1967, 1968 and the somewhat different ecological requirements of two subspecies: C. palustris ssp. palustris and C. palustris ssp. cornuta. It was found that each population includes individuals with different cytotypes. The situation is similar as far as subspecies are concerned, distinguished on the basis of fruit morphology (Fig. 1. It should be stressed, however, that, investigations of many years duration raised serious doubts as to the diagnostic value of fruit morphology (Figs. 2, 3. On the basis of the preserved differences between the populations in shoot habitus, reproduction and phenology in garden culture, a springwood and an alder forest ecotype were distinguished. Meadow and flood-plain populations exhibited a transitional character with certain similarities both to the alder forest and to the springwood populations.

  17. Aberrante Epigynenbildungen bei der Wolfspinne Pardosa palustris (Araneae, Lycosidae

    Directory of Open Access Journals (Sweden)

    Martin, Dieter


    Full Text Available Two cases of aberrant epigyne shape in Pardosa palustris (Linnaeus, 1758 are described. Characteristic is the absence of the posterior lateral parts of the septum. Possible causes, such as `genital damage` during mating or the effects of parasite infestation, are discussed.

  18. Fluorescence spectral fluctuations of single LH2 complexes from Rhodopseudomonas acidophila strain 10050

    NARCIS (Netherlands)

    Rutkauskas, D.; Novoderezkhin, V.; Cogdell, R.J.; van Grondelle, R.


    We have investigated the energy landscape of the bacterial photosynthetic peripheral light-harvesting complex LH2 of purple bacterium Rhodopseudomonas acidophila by monitoring sequences of fluorescence spectra of single LH2 assemblies, at room temperature, with different excitation intensities as

  19. ?-Oryzanols of North American Wild Rice (Zizania palustris)


    Aladedunye, Felix; Przybylski, Roman; Rudzinska, Magdalena; Klensporf-Pawlik, Dorota


    ?-Oryzanol, a natural mixture of ferulic acid esters of triterpene alcohols and sterols, are an important bioactive components present in rice bran oil. In light of the recent increase in the popularity of wild rice among consumers, and the possibility of a direct relationship between ?-oryzanol composition and its bioactivity, the oryzanol profile of major wild rice (Zizania palustris) grown in North America was studied and compared to regular brown rice (Oryza sativa L.). A total of twenty-...

  20. A new marsh plant community of Eleocharito palustris-Alismatetum lanceolati (Eleocharito palustris-Sagittarion sagittifoliae alliance in Slovakia

    Directory of Open Access Journals (Sweden)

    Richard Hrivnák


    Full Text Available Open and species-poor stands with a dominance of Alisma lanceolatum were recorded in periodically flooded habitats of the southern part of central Slovakia (Ipeľ River catchment area during the summer of 2013. Phytosociological relevés correspond to the association Eleocharito palustris-Alismatetum lanceolati (alliance Eleocharito palustris-Sagittarion sagittifoliae, which is reported and documented here for the first time from the territory of Slovakia. It inhabits predominantly temporarily flooded depressions on agricultural land – wet arable fields and extensively used pastures. Detrended correspondence analysis showed that the variability in species composition was most significantly influenced by water depth, the presence of arable fields in the contact area and water conductivity. Special attention was paid to a detailed description of the floristic composition, habitat requirements, distribution patterns and nomenclature of the community.

  1. Louisiana’s Palustris Experimental Forest: 75 years of research that transformed the South (United States)

    James P. Barnett; James D. Haywood; Henry A. Pearson


    The Palustris Experimental Forest, located on Kisatchie National Forest, has been in existence for 75 years. Research at Palustris has focused on southern pine reforestation technology, including seed production, bareroot nursery production, direct seeding, and planting container seedlings. After establishing pine plantations, researchers developed stand management...

  2. Isoprenoid hydrocarbons produced by thermal alteration of Nostoc muscorum and Rhodopseudomonas spheroides (United States)

    Philp, R. P.; Brown, S.; Calvin, M.


    The potential of algae and photosynthetic bacteria to serve as precursors of kerogen was studied to determine what factors affect the relative rates of formation of precursor hydrocarbons. Cells of Nostoc muscorum and Rhodopseudomonas spheroides were subjected to thermal alteration (by heating samples in glass tubes sealed under nitrogen) for two, four, and twelve weeks. Both unextracted and extracted cells in the absence and presence of montmorillonite were investigated, and the isoprenoid hydrocarbons produced in these experiments were determined. Phytane and five isomeric phytenes were the main hydrocarbons observed; their relative rates of formation in the different experimental conditions are described. No phytadienes, pristane, or pristenes were detected.

  3. Mortalidade em florestas de Pinus palustris causada por tempestade de raios (United States)

    Kenneth W. Outcalt; Jorge Paladino Corrêa de Lima; Jose Américo de Mello Filho


    The importance of lightning as an ignition source for the fire driven Pinus palustris ecosystem is widely recognized. Lightning also impacts this system on a smaller scale by causing individual tree mortality. The objective of this study was to determine the level of mortality due to lightning activity at the Department of Energy's Savannah...

  4. Population Genetic Structure of Cochliobolus miyabeanus on Cultivated Wild Rice (Zizania palustris L.) in Minnesota (United States)

    Cochliobolus miyabeanus (Bipolaris oryzae) is the causal agent of fungal brown spot (FBS) in wild rice (Zizania palustris L.), an aquatic grass, endemic in Minnesota, Wisconsin, and parts of Canada. Grain yield losses can reach up to 74% when the disease starts at the boot stage and continues until ...

  5. Forest floor depth mediates understory vigor in xeric Pinus palustris ecosystems (United States)

    J. Kevin Hiers; Joseph J. O' Brien; Rodney E. Will; Robert J. Mitchell


    Longleaf pine (Pinus palustris) woodlands and savannas are among the most frequently burned ecosystems in the world with fire return intervals of 1–10 years. This fire regime has maintained high levels of biodiversity in terms of both species richness and endemism. Land use changes have reduced the area of this ecosystem by .95%, and inadequate fire...

  6. Assessing longleaf pine (Pinus palustris) restoration after southern pine beetle kill using a compact experimental design (United States)

    J.-P. Berrill; C.M. Dagley


    A compact experimental design and analysis is presented of longleaf pine (Pinus palustris) survival and growth in a restoration project in the Piedmont region of Georgia, USA. Longleaf pine seedlings were planted after salvage logging and broadcast burning in areas of catastrophic southern pine beetle (Dendroctonus frontalis) attacks on even-aged mixed pine-hardwood...

  7. Nursery response of container Pinus palustris seedlings to nitrogen supply and subsequent effects on outplanting performance (United States)

    D. Paul Jackson; R. Kasten Dumroese; James P. Barnett


    Container longleaf pine (Pinus palustris) seedlings often survive and grow better after outplanting than bareroot seedlings. Because of this, most longleaf pine are now produced in containers. Little is known about nursery fertilization effects on the quality of container longleaf pine seedlings and how that influences outplanting performance. We compared various...

  8. Assembly and structural organization of pigment-protein complexes in membranes of Rhodopseudomonas sphaeroides

    International Nuclear Information System (INIS)

    Hunter, C.N.; Pennoyer, J.D.; Niederman, R.A.


    The B875 and B800-850 light-harvesting pigment-protein complexes of Rhodopseudomonas sphaeroides are characterized further by lithium dodecyl sulfate/polyacrylamide gel electrophoresis at 4 degrees C. Bacteriochlorophyll a was shown in reconstruction studies to remain complexed with its respective binding proteins during this procedure. From distributions in these gels, a quantitative description for the arrangement of the complexes is proposed. Assembly of the complexes was examined in delta-aminolevulinate-requiring mutant H-5 after a shift from high- to low-light intensity. After 10 h of delta-[ 3 H]aminolevulinate labeling, the specific radioactivity of bacteriochlorophyll in a fraction containing putative membrane invaginations reached the maximal level, while that of the mature photosynthetic membrane was at only one-third this level. This suggests that membrane invaginations are sites of preferential bacteriochlorophyll synthesis in which completed pigment-proteins exist transiently. Analysis of the 3 H distribution after electrophoretic separation further suggests that photosynthetic membranes grow mainly by addition of B800-850 to preformed membrane consisting largely of B875 and photochemical reaction centers. These results corroborate the above model for the structural organization of the light-harvesting system and indicate that the structurally and functionally discrete B800-850 pool is not completely assembled until all B875 sites for B800-850 interactions are occupied

  9. Ferrochelatase from Rhodopseudomonas sphaeroides: substrate specificity and role of sulfhydryl and arginyl residues

    International Nuclear Information System (INIS)

    Dailey, H.A.; Fleming, J.E.; Harbin, B.M.


    Purified ferrochelatase from the bacterium Rhodopseudomonas sphaeroides was examined to determine the roles of cationic and sulfhydryl residues in substrate binding. Reaction of the enzyme sulfhydryl residues with N-ethylmaleimide or monobromobimane resulted in a rapid loss of enzyme activity. Ferrous iron, but not porphyrin substrate, had a protective effect against inactivation by these two reagents. Quantitation with 3 H-labeled N-ethylmaleimide revealed that inactivation required one to two sulfhydryl groups to be modified. Modification of arginyl residues with either 2,3-butanedione or camphorquinone 10-sulfonate resulted in a loss of ferrochelatase activity. A kinetic analysis of the modified enzyme showed that the K/sub m/ for ferrous iron was not altered but that the K/sub m/ for the prophyrin substrate was increased. These data suggested that arginyl residues may be involved in porphyrin binding, possibly via charge pair interactions between the arginyl residue and the anionic porphyrin propionate side chain. Modification of lysyl residues had no effect on enzyme activity. The authors also examined the ability of bacterial ferrochelatase to use various 2,4-disubstituted porphyrins as substrates. The authors found that 2,4-bis-acetal- and 2,4-disulfonate deuteroporphyrins were effective substrates for the purified bacterial enzyme and that N-methylprotoporphyrin was an effective inhibitor of the enzyme. Data for the ferrochelatase of R. sphaeroides are compared with previously published data for the eucaryotic enzyme

  10. Cholinesterase inhibitory activity and chemical constituents of Stenochlaena palustris fronds at two different stages of maturity

    Directory of Open Access Journals (Sweden)

    Nelson Jeng-Yeou Chear


    Full Text Available Stenochlaena palustris fronds are popular as a vegetable in Southeast Asia. The objectives of this study were to evaluate the anticholinesterase properties and phytochemical profiles of the young and mature fronds of this plant. Both types of fronds were found to have selective inhibitory effect against butyrylcholinesterase compared with acetylcholinesterase. However, different sets of compounds were responsible for their activity. In young fronds, an antibutyrylcholinesterase effect was observed in the hexane extract, which was comprised of a variety of aliphatic hydrocarbons, fatty acids, and phytosterols. In the mature fronds, inhibitory activity was observed in the methanol extract, which contained a series of kaempferol glycosides. Our results provided novel information concerning the ability of S. palustris to inhibit cholinesterase and its phytochemical profile. Further research to investigate the potential use of this plant against Alzheimer's disease is warranted, however, young and mature fronds should be distinguished due to their phytochemical differences.

  11. The usage of sulfide and thiosulfate ions by purple non-sulfur bacteria Rhodopseudomonas yavorovii

    Directory of Open Access Journals (Sweden)

    O. V. Tarabas


    Full Text Available This article covers the patterns of oxidation of sulfide and thiosulfate ions by bacteria Rhodopseudomonas yavorovii Ya-2016 under different cultivation conditions. In the environments with 1.4–5.6 мМ Na2S2O3, R. yavorovii Ya-2016 bacteria accumulated biomass of 1.4–1.6 g/l, which was higher than biomass (1.2-0.6 g/l accumulated by the bacteria with the same concentrations of Na2S × 9H2O. The efficiency of oxidation of 1.4, 2.8, 5.6 мМ sulfide- and thiosulfate-ions as donors of electrons by the bacteria equaled 97.4, 42.6, 18.7 and 68.8, 28.0, 3.7%, respectively. As a result of bacterial oxidation of 1.4 мМ hydrogen sulfide and sodium thiosulphate in the environment accumulation of 0.13–1.30 мМ sulfate-ions occurs, and the element sulfur becomes an intermediate metabolite in the environment with Na2S×9H2O. R. yavorovii Ya-2016 bacteria are capable of using sulfate-ions as a single source of sulfate at increase in photptrophs. In the environment with 2.5 мМ sulfate-ions concentration the bacteria biomass was 1.4 g/l, the bacteria assimilated 17.7% of sulfates. Because purple non-sulfur bacteria R. yavorovii Ya-2016 are capable of using sulfide-ions as donors of electrons of anoxygenic photosynthesis and using sulfate-ions as a single source of sulfate, they could be successfully used in the technologies of remediating the environment from compounds of sulfur.

  12. The role of oxalic acid in tolerance to N’N-napthaloylhydroxylamine in Tyromyces palustris (United States)

    R.A. Arango; C.A. Clausen; Frederick Green


    Certain wood decay fungi exhibit tolerance to one or more wood preservatives. Copper tolerance of brown-rot fungi has been studied in our laboratory for the past six years. We have observed some degree of tolerance to N’N-naphthaloylhydroxamine (NHA), a recently patented termite bait, by the brown-rot fungus Tyromyces palustris TYP-6137. In an effort to try and confirm...

  13. Couplings (United States)

    Stošić, Dušan; Auroux, Aline

    Basic principles of calorimetry coupled with other techniques are introduced. These methods are used in heterogeneous catalysis for characterization of acidic, basic and red-ox properties of solid catalysts. Estimation of these features is achieved by monitoring the interaction of various probe molecules with the surface of such materials. Overview of gas phase, as well as liquid phase techniques is given. Special attention is devoted to coupled calorimetry-volumetry method. Furthermore, the influence of different experimental parameters on the results of these techniques is discussed, since it is known that they can significantly influence the evaluation of catalytic properties of investigated materials.

  14. Spectral diffusion and electron-phonon coupling of the B800 BChl a molecules in LH2 complexes from three different species of purple bacteria. (United States)

    Baier, J; Gabrielsen, M; Oellerich, S; Michel, H; van Heel, M; Cogdell, R J; Köhler, J


    We have investigated the spectral diffusion and the electron-phonon coupling of B800 bacteriochlorophyll a molecules in the peripheral light-harvesting complex LH2 for three different species of purple bacteria, Rhodobacter sphaeroides, Rhodospirillum molischianum, and Rhodopseudomonas acidophila. We come to the conclusion that B800 binding pockets for Rhodobacter sphaeroides and Rhodopseudomonas acidophila are rather similar with respect to the polarity of the protein environment but that the packaging of the alphabeta-polypeptides seems to be less tight in Rb. sphaeroides with respect to the other two species.

  15. Development of antioxidative effect in ice cream with Kalakai (Stenochlaena palustris) water extract (United States)

    Hadhiwaluyo, Kristania; Rahmawati, Della; Gunawan Puteri, Maria D. P. T.


    Kalakai (Stenochlaena. palustris) extract was used to develop the ice cream. The antioxidant activity of the extracts and its stability over process and storage were evaluated through various antioxidant assay including DPPH assay, Folin-Ciocalteau assay and aluminum chloride colorimetric method. In general, the leaves of S. palustris had a significantly higher antioxidant activity (p ice cream without affecting the sensory properties of the ice cream. In addition, the high phenolic and flavonoid content also suggest the more compounds that were capable to act as an antioxidant. The result of the stability test also suggested the ability low temperature storage and processing in maintaining the stability of the antioxidant activity of the extract (p > 0.05) over processing and storage. Thus, this strengthen the feasibility of S. palustris to be used as a potential functional food ingredient that is low cost and easily accessible with an antioxidant activity and safe iron content that is beneficial to increase the quality of food produced including in ice cream.

  16. Evidence for a Very Early Intermediate in Bacterial Photosynthesis. A Photon-Echo and Hole-Burning Study of the Primary Donor Band in Rhodopseudomonas Sphaeroides

    NARCIS (Netherlands)

    Meech, S.R.; Hoff, A.J.


    Two coherent spectroscopic methods, accumulated photon echo and population bottleneck hole-burning, have been employed in a study of the decay rate of the primary donor (P) of Rhodopseudomonas sphaeroides at 1.5 K. The decay rate is instrument-limited in the photon-echo experiment, implying a

  17. Phosphoenolpyruvate-Dependent Fructose Phosphotransferase System of Rhodopseudomonas sphaeroides : Purification and Physicochemical and Immunochemical Characterization of a Membrane-Associated Enzyme I

    NARCIS (Netherlands)

    Brouwer, Marius; Elferink, Marieke G.L.; Robillard, George T.


    The phosphotransferase system (PTS) of the phototrophic bacterium Rhodopseudomonas sphaeroides consists of a component located in the cytoplasmic membrane and a membrane-associated enzyme called “soluble factor” (SF). SF has been partially purified by a combination of hydrophobic interaction and

  18. Muscle senescence in short-lived wild mammals, the soricine shrews Blarina brevicauda and Sorex palustris. (United States)

    Hindle, Allyson G; Lawler, John M; Campbell, Kevin L; Horning, Markus


    Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H(0): shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n=17) and second-year (n=17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: approximately 50%; B. brevicauda: approximately 60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris ( approximately 50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. (c) 2009 Wiley-Liss, Inc.

  19. Muscle Senescence in Short-Lived Wild Mammals, the Soricine Shrews Blarina brevicauda and Sorex palustris (United States)



    Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H0: shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n = 17) and second-year (n = 17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: ~50%; B. brevicauda: ~60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris (~50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. PMID:19296507

  20. Endemic Marsh Mongoose Herpestes palustris (Carnivora: Herpestidae of East Kolkata Wetlands, India: a status report

    Directory of Open Access Journals (Sweden)

    J.K. Mallick


    Full Text Available Marsh Mongoose Herpestes palustris is the only extant endemic mammal of the East Kolkata wetlands, which has been declared a RAMSAR site in 2002. Since its first description by the scientists of the Zoological Survey of India, the population of this species has dwindled to an alarming state due to reclamation of the Salt Lake City and Rajarhat expansion, as well as from other anthropogenic causes. Recently, during a field survey only a small population of this endangered mongoose was found in a single location. Immediate conservation measures are required to be taken by the concerned authorities to stop its probable extinction in the near future.

  1. The potential of Thelypteris palustris and Asparagus sprengeri in phytoremediation of arsenic contamination. (United States)

    Anderson, LaShunda L; Walsh, Maud; Roy, Amitava; Bianchetti, Christopher M; Merchan, Gregory


    The potential of two plants, Thelypteris palustris (marsh fern) and Asparagus sprengeri (asparagus fern), for phytoremediation of arsenic contamination was evaluated. The plants were chosen for this study because of the discovery of the arsenic hyperaccumulating fern, Pteris vittata (Ma et al., 2001) and previous research indicating asparagus fern's ability to tolerate > 1200 ppm soil arsenic. Objectives were (1) to assess if selected plants are arsenic hyperaccumulators; and (2) to assess changes in the species of arsenic upon accumulation in selected plants. Greenhouse hydroponic experiments arsenic treatment levels were established by adding potassium arsenate to solution. All plants were placed into the hydroponic experiments while still potted in their growth media. Marsh fern and Asparagus fern can both accumulate arsenic. Marsh fern bioaccumulation factors (> 10) are in the range of known hyperaccumulator, Pteris vittata Therefore, Thelypteris palustris is may be a good candidate for remediation of arsenic soil contamination levels of arsenic. Total oxidation of As (III) to As (V) does not occur in asparagus fern. The asparagus fern is arsenic tolerant (bioaccumulation factors phytoremediation candidate.

  2. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)


  3. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Rhodopseudomonas palustris CGA009] ... Length = 102 ... Query: 14 ... ...MRDGEFLVSKTTAKGVITYINEPFIRMSGFTEQELVGQAHNIIRHPDMPPEAFADFWNTL 73 ... + DG ++VSKT ... KG +TY NE F++ SGF+EQ

  4. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)


  5. Ethylene regulates fast apoplastic acidification and expansin A transcription during submergence-induced petiole elongation in Rumex palustris

    NARCIS (Netherlands)

    Vreeburg, RAM; Benschop, JJ; Peeters, AJM; Colmer, TD; Ammerlaan, AHM; Staal, M; Elzenga, TM; Staals, RHJ; Darley, CP; McQueen-Mason, SJ; Voesenek, LACJ

    The semi-aquatic dicot Rumex palustris responds to complete submergence by enhanced elongation of young petioles. This elongation of petiole cells brings leaf blades above the water surface, thus reinstating gas exchange with the atmosphere and increasing survival in flood-prone environments. We

  6. Modeling silviculture after natural disturbance to sustain biodiversity in the longleaf pine (Pinus palustris) ecosystem : balancing complexity and implementation (United States)

    Brian J. Palik; Robert J. Mitchell; J. Kevin Hiers


    Modeling silviculture after natural disturbance to maintain biodiversity is a popular concept, yet its application remains elusive. We discuss difficulties inherent to this idea, and suggest approaches to facilitate implementation, using longleaf pine (Pinus palustris) as an example. Natural disturbance regimes are spatially and temporally variable. Variability...

  7. Influence of residual basal area on longleaf pine (Pinus palustris Mill.) first year germination and establishment under selection silviculture (United States)

    Ferhat Kara; Edward F. Loewenstein


    Even-aged silvicultural methods have been successfully used to manage longleaf pine (Pinus palustris Mill.) forests for wood production; however, successful use of uneven-aged methods to manage this ecosystem is less well documented. In this study, the effects of varying levels of residual basal area (RBA) (9.2, 13.8, and 18.4 m2...

  8. Phytodesalinization potential of Typha angustifolia, Juncus maritimus, and Eleocharis palustris for removal of de-icing salts from runoff water. (United States)

    Guesdon, Gaëlle; de Santiago-Martín, Ana; Galvez-Cloutier, Rosa


    Typha angustifolia, Juncus maritimus, and Eleocharis palustris were evaluated for de-icing salt removal from runoff water. Plants were exposed to a range of de-icing salt levels (0.2, 0.7, 4, 8, and 13 dS m(-1)) in laboratory-scale subsurface constructed wetlands (CWs) for 2 months under greenhouse conditions. Effluent characteristics, plant height, biomass, and Cl and Na removal rates and uptake were monitored. More water volume was retained in CWs of T. angustifolia (∼60 %) than of J. maritimus and E. palustris (∼37.5 %), which accounted for the electrical conductivity increase in effluents (1.3-1.9-fold). Based on the NaCl removal rate, T. angustifolia showed the greatest phytodesalinization ability (31-60 %) with the highest removal at the lowest salt levels (0.2-0.7 dS m(-1)), followed by J. maritimus (22-36 %) without differences in removal among levels, and E. palustris (3-26 %) presenting a removal rate highly decreased with increasing salt levels. Plant height and biomass were stimulated at low de-icing salt levels, but, at higher levels, T. angustifolia and E. palustris growth was inhibited (tolerance index ∼67 and 10 %, respectively, in the worst cases). Salt amounts in aboveground biomass in g m(-2) differed among levels and ranged as follows: 13.6-29.1 (Cl), 4.2-9.3 (Na; T. angustifolia); 7.0-12.0 (Cl), 2.7-6.4 (Na; J. maritimus); and 0.9-7.6 (Cl), 0.3-1.6 (Na; E. palustris). Chloride and Na translocation decreased with de-icing salt increase in T. angustifolia, while no significant differences were found in J. maritimus, which is interesting for harvesting purposes.

  9. Experiments on accumulation of phosphorus in the plants Myosotis palustris, Glyceria maxima and Nasturtium officinale

    Directory of Open Access Journals (Sweden)

    O. Prokopchuk


    Full Text Available The problem of availability of quality water is highly relevant today, so the technologies of prediction and prevention of water pollution and purification are very important. Biological methods of cleaning, in paticular cleaning water by the so-called method of biosorption, have been increasingly used in the last decade. This method means the removal of dangerous substances and improvement of water condition by using aquatic organisms, in particular plants. Therefore, in view of the rich experience of research conducted in the biosorption sphere, we decided to predict the effectiveness of this method by using the cumulative ability of higher water plants to absorb phosphorus compounds. For this purpose, we selected water and plant samples (Glyceria maxima (C. Hartm. Holmb., Nasturtium officinale R. Br., Myosotis palustris (L. L. from the river Seret (Ternopil, Ukraine. The plants were placed into sterilized glass jars filled with 3 liters of water from the river Seret (control samples and still tap water with addition of sodium phosphate with phosphorus concentration of 3.5 mg/dm³ (research sample, which were cultured in laboratory conditions for four months. We determined the content of phosphates, permanganate and dichromate oxidation in the water and the total content of phosphorus in the plants. We traced the dynamic of organic substances and the content of phosphates in the water, the accumulation of phosphorus in plants and the rate of accumulation of phosphorus in the plants and in the water. We calculated correlation coefficients to detect the dependence between phosphorus indicators in the aquatic plants and the concentration of phosphate ions in the water. We found that M. palustris had the greatest capacity to accumulate phosphorus and the highest rate of phosphorus accumulation from water, which allows us to consider it the most effective aquatic plant for absorption of elements and decreasing water pollution. We also established

  10. Current status of Marsh Crocodiles Crocodylus palustris (Reptilia: Crocodylidae in Vishwamitri River, Vadodara City, Gujarat, India

    Directory of Open Access Journals (Sweden)

    R. Vyas


    Full Text Available Data presented here is based on a three year study (2008-2010 on a population of Mugger Crocodylus palustris inhabiting Vishwamitri River near Vadodara City, Gujarat State, India. In total, 155 Muggers were counted in the 25km river stretch during 2010. In all, 40 burrows were observed along the river bank, and the same were clumped in certain sections of the river. Muggers fed eight species of birds, and domestic livestock in addition to scavenging. Eight instances of human-crocodile conflicts were observed including four human causalities. A total 90 Muggers were rescued from the urban areas and the same were relocated elsewhere in the river system. Various types of threats to Mugger were also noticed including habitat loss, alteration and soil erosion and mortality due to rail traffic. The present study suggests further research to propose strategies to conserve this population.

  11. Differences in mycorrhizal communities between Epipactis palustris, E. helleborine and its presumed sister species E. neerlandica. (United States)

    Jacquemyn, Hans; Waud, Michael; Lievens, Bart; Brys, Rein


    In orchid species that have populations occurring in strongly contrasting habitats, mycorrhizal divergence and other habitat-specific adaptations may lead to the formation of reproductively isolated taxa and ultimately to species formation. However, little is known about the mycorrhizal communities associated with recently diverged sister taxa that occupy different habitats. In this study, 454 amplicon pyrosequencing was used to investigate mycorrhizal communities associating with Epipactis helleborine in its typical forest habitat and with its presumed sister species E. neerlandica that almost exclusively occurs in coastal dune habitats. Samples of the phylogenetically more distant E. palustris, which co-occurred with E. neerlandica, were also included to investigate the role of habitat-specific conditions on mycorrhizal communities. A total of 105 operational taxonomic units (OTUs) of putative orchid mycorrhizal fungi were observed in the three studied species. The majority of these fungi were endophytic fungi of Helotiales and ectomycorrhizal fungi belonging to Thelephoraceae, Sebacinaceae and Inocybaceae. In addition, a large number of other ectomycorrhizal taxa were detected, including Cortinarius, Cenococcum, Tuber, Geopora, Wilcoxina, Meliniomyces, Hebeloma, Tricholoma, Russula and Peziza Mycorrhizal communities differed significantly between the three species, but differences were most pronounced between the forest species (E. helleborine) and the two dune slack species (E. neerlandica and E. palustris). The results clearly showed that recently diverged orchid species that occupy different habitats were characterized by significantly different mycorrhizal communities and call for more detailed experiments that aim at elucidating the contribution of habitat-specific adaptations in general and mycorrhizal divergence in particular to the process of speciation in orchids. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany

  12. R-prime site-directed transposon Tn7 mutagenesis of the photosynthetic apparatus in Rhodopseudomonas capsulata

    Energy Technology Data Exchange (ETDEWEB)

    Youvan, D C [Univ. of California, Berkeley; Elder, J T; Sandlin, D E; Zsebo, K; Alder, D P; Panopoulos, N J; Marrs, B L; Hearst, J E


    Site-directed mutagenesis of the photosynthetic apparatus (PSA) genes in Rhodopseudomonas capsulata is presented utilizing a transposon Tn7 mutagenized R-prime. The R-prime, pRPS404, bears most of the genes necessary for the differentiation of the photosynthetic apparatus. Mutagenesis of the R-prime with Tn7 in Escherichia coli, conjugation into R. capsulata, and homologous recombination with the wild-type alleles efficiently generates photosynthetic apparatus lesions. Wild-type alleles are lost spontaneously and the Tn7-induced lesions are revealed by subsequent intramolecular recombination between IS21 insertion elements that bracket the prime sequences in direct repeat. The molecular nature of the intermediates involved in the transposition, recombination and deletion have been investigated by Southern hybridization analysis. The spontaneous loss of wild-type alleles after homologous recombination with the chromosome may be of general use to other prokaryotic site-directed transposon mutagenesis schemes. The IS21-mediated deletion of the prime DNA is dependent on the RecA protein in E. coli, generating the parental R-factor bearing one IS21 element. A genetic-physical map exists for a portion of the prime photosynthetic apparatus DNA. When Tn7 is inserted into a bacteriochlorophyll gene in the R-prime and then crossed into R. capsulata, mutants are produced that accumulate a bacteriochlorophyll precursor, which is in excellent agreement with the existing genetic-physical map. This corroborates the mutagenesis scheme.

  13. Traffic-emitted metal status and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in roadside turfy swamp in the Changbai Mountain area, China. (United States)

    Wang, Hong; Nie, Lei; Xu, Yan; Li, Miao; Lv, Yan


    Six traffic-emitted metals (Cr, Zn, Cu, Cd, Pb, and Ni) were determined in soil and plants for below- and aboveground parts along different distances from highway to evaluate their behavior and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in turfy swamps. The results indicated that the different plant tissues showed significantly different levels of metal content. Nonlinear regression analysis indicated that metal contents leveled off at constant values before they decreased as the distance from the roadside increased. The high R 2 values of the regression model indicated good fit of the exponential function applied to depict the distribution pattern of the metal elements. It was deduced that Cr, Cu, and Cd in Thelypteris palustris var. pubescens Fernald were mainly derived from the soil; Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald absorbed Pb mainly through the stomata from atmospheric depositions; Cr, Cu, and Cd in Carex meyeriana Kunth and Zn in Thelypteris palustris var. pubescens Fernald were mainly affected by soil and atmospheric depositions. After excluding the effects of traffic, only the bioaccumulation factor of Cd (1.34) in Carex meyeriana Kunth and the translocation factor of Zn (1.13) in Thelypteris palustris var. pubescens Fernald were greater than 1, suggesting that Carex meyeriana Kunth could be a good candidate for assimilating Cd from soils and Thelypteris palustris var. pubescens Fernald could be suitable for the phytoextraction of Zn.

  14. Correlation between oxalic acid production and tolerance of Tyromyces palustris strain TYP-6137 to N',N-naphthaloylhydroxamine (United States)

    Rachel A. Arango; Patricia K. Lebow; Frederick III Green


    Eleven strains of T. palustris were evaluated for mass loss and production of phosphate buffer soluble oxalic acid on pine wood blocks treated with 0.5% N’,N-naphthaloylhydroxamine (NHA) in a soil-block test. After 12 weeks higher percentage mass loss was observed in control groups for 10 strains, while TYP-6137 was shown to be tolerant with no difference between the...

  15. Toxicity of sulfide to early life stages of wild rice (Zizania palustris). (United States)

    Fort, Douglas J; Todhunter, Kevin; Fort, Troy D; Mathis, Michael B; Walker, Rachel; Hansel, Mike; Hall, Scott; Richards, Robin; Anderson, Kurt


    The sensitivity of wild rice (Zizania palustris) to sulfide is not well understood. Because sulfate in surface waters is reduced to sulfide by anaerobic bacteria in sediments and historical information indicated that 10 mg/L sulfate in Minnesota (USA) surface water reduced Z. palustris abundance, the Minnesota Pollution Control Agency established 10 mg/L sulfate as a water quality criterion in 1973. A 21-d daily-renewal hydroponic study was conducted to evaluate sulfide toxicity to wild rice and the potential mitigation of sulfide toxicity by iron (Fe). The hydroponic design used hypoxic test media for seed and root exposure and aerobic headspace for the vegetative portion of the plant. Test concentrations were 0.3, 1.6, 3.1, 7.8, and 12.5 mg/L sulfide in test media with 0.8, 2.8, and 10.8 mg/L total Fe used to evaluate the impact of iron on sulfide toxicity. Visual assessments (i.e., no plants harvested) of seed activation, mesocotyl emergence, seedling survival, and phytoxicity were conducted 10 d after dark-phase exposure. Each treatment was also evaluated for time to 30% emergence (ET30), total plant biomass, root and shoot lengths, and signs of phytotoxicity at study conclusion (21 d). The results indicate that exposure of developing wild rice to sulfide at ≥3.1 mg sulfide/L in the presence of 0.8 mg/L Fe reduced mesocotyl emergence. Sulfide toxicity was mitigated by the addition of Fe at 2.8 mg/L and 10.8 mg/L relative to the control value of 0.8 mg Fe/L, demonstrating the importance of iron in mitigating sulfide toxicity to wild rice. Ultimately, determination of site-specific sulfate criteria taking into account factors that alter toxicity, including sediment Fe and organic carbon, are necessary. Environ Toxicol Chem 2017;36:2217-2226. © 2017 SETAC. © 2017 SETAC.

  16. Hydrogen gas production by fermentation from various organic wastewater using Clostridium butyricum NCIB 9576 and Rhodopseudomonas sphaeroides E15-1

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Young Sue; Kim, Hyun Kyung; Rye, Hye Yeon; Lee, In Gu; Kim, Mi Sun [Biomass Research Team, Korea Institute of Energy Research, Taejeon (Korea)


    Anaerobic fermentation using Clostidium butyricum NCIB 9576, and phto-fermentation using Rhodopseudomonas sphaeroides E15-1 were studied for the production of hydrogen from Makkoli, fruits (orange and apple, watermelon and melon) and Tofu wastewaters. From the Makkoli wastewater, which contained 0.94 g/liter sugars and 2.74 g/liter solubel starch, approximately 49 mM H{sub 2}/liter wastewater was produced during the initial 18h of the anaerobic fermentation with pH control between 6.5-7.0. Several organic acids such as butyric acid, acetic acid, propionic acid, lactic acid and ethanol were also produced. From watermelon and melon wastewater, which contained 43 g/liter sugars, generated about approximately 71 mM H{sub 2}/liter wastewater was produced during the initial 24h of the anaerobic fermentation. Tofu wastewater, pH 6.5, containing 12.6 g/liter soluble starch and 0.74 g/liter sugars, generated about 30mM H{sub 2}/liter wastewater, along with some organic acids, during the initial 24 h of anaerobic fermentation. Makkoli and Tofu wastewaters as substrates for the photo-fermentation by Rhodopseudomonas sphaeroides E15-1 produced approximately 37.9 and 22.2 {mu}M H{sub 2}/ml wastewaters, respectively for 9 days of incubation under the average of 9,000010,000 lux illumination at the surface of reactor using tungsten halogen lamps. Orange and apple wastewater, which contained 93.4 g/l produced approximately 13.1 {mu}M H{sub 2}/ml wastewater only for 2 days of photo-fermentation and the growth of Rhodopseudomonas spnaeroides E15-1 and hydrogen production were stopped. 22 refs, 4 figs., 2 tabs.

  17. Synchrotron small-angle x-ray scattering investigation on integral membrane protein light-harvesting complex LH2 from photosynthetic bacterium rhodopseudomonas acidophila

    International Nuclear Information System (INIS)

    Du Luchao; Weng Yuxiang; Hong Xinguo; Xian Dingchang; Kobayashi Katsumi


    Structures of membrane protein in solution are different from that in crystal phase. We present the primary results of small angle x-ray scattering (SAXS) resolved topological structures of a light harvesting antenna membrane protein complex LH2 from photosynthetic bacteria Rhodopseudomonas acidophila in detergent solution for the first time. Our results show that the elliptical shape of the LH2 complex in solution clearly deviates from its circular structure in crystal phase determined by x-ray diffraction. This result provides an insight into the structure and function interplay in LH2. (authors)

  18. Aptitude of Lymnaea palustris and L. stagnalis to Fasciola hepatica larval development through the infection of several successive generations of 4-mm-high snails. (United States)

    Vignoles, P; Rondelaud, D; Dreyfuss, G


    Bimiracidial infections of Lymnaea palustris and Lymnaea stagnalis (shell height at exposure, 4 mm) with Fasciola hepatica were carried out during six successive snail generations to determine if prevalence and intensity of snail infection increased over time through descendants issuing from eggs laid by parents already exposed to this digenean. Controls were constituted by a French population of Galba truncatula (a single generation) infected according to the same protocol. In a first experiment performed with the F1 to F5 generations of L. palustris, the prevalence and intensity of F. hepatica infection in snails progressively increased. Immature rediae and a few cercariae-containing rediae of the digenean were observed in L. stagnalis from the F3 generation, but no free cercaria was noted in the bodies of this lymnaeid from the F4 to F6 generations. In another experiment carried out with the F6 generation of L. palustris, the prevalence of F. hepatica infection and the number of shed cercariae were significantly lower in L. palustris than in G. truncatula. This mode of snail infection suggests an explanation for cases of human fasciolosis occurring in central France after the collection of wild watercress from beds where L. palustris was the sole lymnaeid.

  19. Linear-dichroism measurements on the LH2 antenna complex of Rhodopseudomonas Acidophila strain 10050 show that the transition dipole moment of the Carotenoid Rhodopin Glucoside us nit collinair with the long molecular axis

    NARCIS (Netherlands)

    Georgakopoulou, S.; Gogdell, R.J.; Grondelle, van R.; Amerongen, van H.


    We have applied linear-dichroism experiments to determine the orientation of the transition dipole moment, corresponding to the main absorption band of the carotenoid, rhodopin glucoside, in the light-harvesting complex LH2 from Rhodopseudomonas acidophila strain 10050. The crystal structure of this

  20. Gnotobiotic cultures of rice plants up to ear stage in the absence of combined nitrogen source but in the presence of free living nitrogen fixing bacteria Azotobacter vinelandii and Rhodopseudomonas capsulata

    International Nuclear Information System (INIS)

    Maudinas, B.; Chemardin, M.; Yovanovitch, E.; Gadal, P.


    An all glass tight growth chamber, entirely sterilizable, has been constructed to carry out axenic and gnotobiotic cultures of rice plants (Oryza sativa L.). When grown in liquid medium and in the absence of combined nitrogen but in the presence of the diazotrophs Azotobacter vinelandii and Rhodopseudomonas capsulata, rice plants exhibited a complete biological cycle from germination up to ear stage, during a period of time similiar to the one encountered in French paddy soil of Camargue. In one experiment, mannitol was given to rice culture medium together with Azotobacter vinelandii and Rhodopseudomonas capsulata. In another experiment, mannitol was not given together with Rhodopseudomonas, and still positive nitrogen gain was obtained, although it was less than culture with mannitol. When 15 N labeled cells of Rhodopseudomonas were added in rice culture medium, 15 N was partly transferred to rice plant. Among the nitrogen substances excreted from the bacteria in the rhizosphere medium, large organic molecules were shown to be the most abundant in our experimental conditions. Moreover, the concentration of free ammonia or aminoacids present in the rice rhizosphere were always compatible with a bacterial nitrogenase activity. (orig.)

  1. Hydraulic architecture and tracheid allometry in mature Pinus palustris and Pinus elliottii trees. (United States)

    Gonzalez-Benecke, C A; Martin, T A; Peter, G F


    Pinus palustris Mill. (longleaf pine, LL) and Pinus elliottii Engelm. var. elliottii (slash pine, SL) frequently co-occur in lower coastal plain flatwoods of the USA, with LL typically inhabiting slightly higher and better-drained microsites than SL. The hydraulic architecture and tracheid dimensions of roots, trunk and branches of mature LL and SL trees were compared to understand their role in species microsite occupation. Root xylem had higher sapwood-specific hydraulic conductivity (k(s)) and was less resistant to cavitation compared with branches and trunk sapwood. Root k(s) of LL was significantly higher than SL, whereas branch and trunk k(s) did not differ between species. No differences in vulnerability to cavitation were observed in any of the organs between species. Across all organs, there was a significant but weak trade-off between water conduction efficiency and safety. Tracheid hydraulic diameter (D(h)) was strongly correlated with k(s) across all organs, explaining >73% of the variation in k(s). In contrast, tracheid length (L(t)) explained only 2.4% of the variability. Nevertheless, for trunk xylem, k(s) was 39.5% higher at 20 m compared with 1.8 m; this increase in k(s) was uncorrelated with D(h) and cell-wall thickness but was strongly correlated with the difference in L(t). Tracheid allometry markedly changed between sapwood of roots, trunks and branches, possibly reflecting different mechanical constraints. Even though vulnerability to cavitation was not different for sapwood of roots, branches or the trunks of LL and SL, higher sapwood to leaf area ratio and higher maximum sapwood-specific hydraulic conductivity in roots of LL are functional traits that may provide LL with a competitive advantage on drier soil microsites.

  2. Ecosystem engineering potential of the gastropod Terebralia palustris (Linnaeus, 1767) in mangrove wastewater wetlands - A controlled mesocosm experiment

    Energy Technology Data Exchange (ETDEWEB)

    Penha-Lopes, Gil, E-mail: [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal); Department of Analytical and Environmental Chemistry, Vrije Universiteit Brussels, Brussels (Belgium); Bartolini, Fabrizio [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Limbu, Samwel [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Cannicci, Stefano [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Mgaya, Yunus [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Kristensen, Erik [Institute of Biology, University of Southern Denmark, DK-5230 Odense M (Denmark); Paula, Jose [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal)


    The effect of different sewage concentrations (0, 20, 60 and 100%), vegetation (Bare, Avicennia marina or Rhizophora mucronata) and immersion periods (immersion/emersion period of 12/12 h or 3/3 days just for 100%) conditions were studied for 6 months on survival and growth rates of Terebralia palustris (Linnaeus, 1767). Gastropods' activity and ecosystem engineering preformed at bare and A. marina planted cells and 3 sewage conditions (0, 20 and 60%) were determined. Survival rates were higher than 70% in all treatments. Growth rate decreased significantly with increasing sewage concentrations (mainly at unplanted conditions) and longer immersion periods. A complete shift (from immersion to emersion periods) and a significant decrease in mobility and consequently its engineer potential, due to sewage contamination, lead to a 3-4 fold decrease in the amount of sediment disturbed. Sewage contamination, primary producers' abundance and environmental conditions may have influenced the gastropods survival, growth and its ecosystem engineering potential. - Terebralia palustris high ecosystem engineering potential in constructed mangrove wetlands.

  3. Differential responses of the freshwater wetland species Juncus effusus L. and Caltha palustris L. to iron supply in sulfidic environments

    International Nuclear Information System (INIS)

    Welle, Marlies E.W. van der; Niggebrugge, Karla; Lamers, Leon P.M.; Roelofs, Jan G.M.


    Sulfur pollution can lead to serious problems in freshwater wetlands, including phosphorus eutrophication and sulfide toxicity. We tested the effects of anaerobic iron-rich groundwater discharge in fens, simulated by iron injection, on two characteristic species (Juncus effusus and Caltha palustris) in a sulfidic environment. Biomass production of C. palustris roots showed an optimum response to the combined addition of iron and sulfide, with highest values at intermediate concentrations of both substances. Iron deficiency apparently occurred at low iron concentrations, while at high iron concentrations, growth was decreased. For J. effusus, in contrast, no toxic effects were found of both iron and sulfide. This could be explained by larger radial oxygen loss (ROL) of J. effusus and could not be explained by differences in phosphorous concentrations. The results of our experiments confirm that iron-rich groundwater discharge has the potential to affect vegetation composition through toxicity modification in sulfidic environments. - Toxicity of iron and sulfide are interacting with each other and have the potential to affect vegetation composition

  4. Fluorescence-excitation and emission spectra from LH2 antenna complexes of Rhodopseudomonas acidophila as a function of the sample preparation conditions. (United States)

    Kunz, Ralf; Timpmann, Kõu; Southall, June; Cogdell, Richard J; Köhler, Jürgen; Freiberg, Arvi


    The high sensitivity of optical spectra of pigment-protein complexes to temperature and pressure is well known. In the present study, we have demonstrated the significant influence of the environments commonly used in bulk and single-molecule spectroscopic studies at low temperatures on the LH2 photosynthetic antenna complex from Rhodopseudomonas acidophila. A transfer of this LH2 complex from a bulk-buffer solution into a spin-coated polymer film results in a 189 cm(-1) blue shift of the B850 excitonic absorption band at 5 K. Within the molecular exciton model, the origin of this shift could be disentangled into three parts, namely to an increase of the local site energies, a contraction of the exciton band, and a decrease of the displacement energy.

  5. Correlation of paramagnetic states and molecular structure in bacterial photosynthetic reaction centers: The symmetry of the primary electron donor in Rhodopseudomonas viridis and Rhodobacter sphaeroides R-26

    International Nuclear Information System (INIS)

    Norris, J.R.; Budil, D.E.; Gast, P.; Chang, C.H.; El-Kabbani, O.; Schiffer, M.


    The orientation of the principal axes of the primary electron donor triplet state measured in single crystals of photosynthetic reaction centers is compared to the x-ray structures of the bacteria Rhodobacter (Rb.) sphaeroides R-26 and Rhodopseudomonas (Rps.) viridis. The primary donor of Rps. viridis is significantly different from that of Rb. sphaeroides. The measured directions of the axes indicate that triplet excitation is almost completely localized on the L-subunit half of the dimer in Rps. viridis but is more symmetrically distributed on the dimeric donor in Rb. sphaeroides R-26. The large reduction of the zero field splitting parameters relative to monomeric bacteriochlorophyll triplet in vitro suggests significant participation of asymmetrical charge transfer electronic configurations in the special pair triplet state of both organisms

  6. Genome assembly of the fungus Cochliobolus miyabeanus, and transcriptome analysis during early stages of infection on American wild rice (Zizania palustris L.) (United States)

    Cochliobolus miyabeanus causes a severe, yield-reducing leaf spot disease on rice (Oryza sativa) and two North American specialty crops, American wildrice (Zizania palustris) and switchgrass (Panicum virgatum). Despite the importance of the pathogen in wildrice, little is known about mechanisms of p...

  7. Long-term effects of fire and fire-return interval on population structure and growth of longleaf pine (Pinus palustris) (United States)

    Chelcy R. Ford; Emily S. Minor; Gordon A. Fox


    We investigated the effect of fire and fire frequency on stand structure and longleaf pine (Pinus palustris P. Mill.) growth and population demography in an experimental research area in a southwest Florida sandhill community. Data were collected from replicated plots that had prescribed fire-return intervals of 1, 2, 5, or 7 years or were left...

  8. Effects of site preparation treatments on early growth and survival of planted longleaf pine (Pinus palustris Mill.) seedlings in North Carolina (United States)

    Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker; Susan Cohen


    We tested the effects of eight site preparation treatments on early growth and survival of container-grown longleaf pine (Pinus palustris Mill.) seedlings. Treatments included an untreated check, six combinations of two initial vegetation control treatments (chopping or herbicide) with three planting site conditions (flat [no additional treatment],...

  9. High-resolution bioactivity profiling combined with HPLC-HRMS-SPE-NMR: α-glucosidase inhibitors and acetylated ellagic acid rhamnosides from Myrcia palustris DC. (Myrtaceae)

    DEFF Research Database (Denmark)

    Wubshet, Sileshi Gizachew; Moresco, Henrique H.; Tahtah, Yousof


    , and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC–HRMS–SPE–NMR. This led to identification...

  10. Purification, molecular cloning, and enzymatic properties of a family 12 endoglucanase (EG-II) from fomitopsis palustris: role of EG-II in larch holocellulose hydrolysis. (United States)

    Shimokawa, Tomoko; Shibuya, Hajime; Nojiri, Masanobu; Yoshida, Shigeki; Ishihara, Mitsuro


    A family 12 endoglucanase with a molecular mass of 23,926 Da (EG-II) from the brown-rot basidiomycete Fomitopsis palustris was purified and characterized. One of the roles of EG-II in wood degradation is thought to be to loosen the polysaccharide network in cell walls by disentangling hemicelluloses that are associated with cellulose.

  11. Comparison of red-cockaded woodpecker (Picoides borealis) nestling diet in old-growth and old-field longleaf pine (Pinus palustris) habitats (United States)

    James L. Hanula; R. Todd Engstrom


    Automatic cameras were used to record adult red-cockaded woodpecker (Picoides borealis) nest visits with food for nestlings. Diet of nestlings on or near an old-growth longleaf pine (Pinus palustris) remnant in southern Georgia was compared to that in longleaf pine stands established on old farm fields in western South Carolina....

  12. Size-dependent distribution and feeding habits of Terebralia palustris in mangrove habitats of Gazi Bay, Kenya (United States)

    Pape, Ellen; Muthumbi, Agnes; Kamanu, Chomba Peter; Vanreusel, Ann


    The gastropod Terebralia palustris often dominates the surface of muddy to sandy substrates of intertidal mudflats and mangrove forests, where they clearly destabilize the sediment. In the present study, it was investigated whether and to what extent the behaviour of juvenile and adult snails differs among habitats (mudflat vs. mangrove stand) in a Sonneratia alba mangal at Gazi Bay, Kenya. For this purpose we: (1) examined their distribution along three land-sea transects; and (2) applied stable isotope analysis to determine the feeding patterns of different-sized snails from the mangrove and mudflat habitats. Additionally, we investigated if these gastropods exert an impact on microphytobenthic (diatom) biomass, and whether this is size-dependent. The latter objective was met by either enclosing or excluding different-sized snails from experimental cages on the intertidal mudflat and the subsequent assessment of a change in pigment concentration of the sediment surface. In agreement with several previous studies conducted in other mangroves and geographical locations, a spatial segregation was demonstrated between juveniles (more common on the mudflat) and adults (more common in the mangrove forest). On the intertidal mudflat juveniles avoided sediment patches characterized by highly saline water in intertidal pools and a high mud content, while adults tended to dwell on substrates covered by a high amount of leaf litter. Stable carbon isotope analysis of the foot tissue of snails sampled from the S. alba stand and the mudflat indicated a transition in food source when a shell length of 51 mm is reached. Considering the δ13C value of juveniles, it seems they might be selecting for microphytobenthos, which might explain their preference for the mudflat. The diet of size classes found in both habitats did not differ significantly, although juveniles inhabiting the mangrove forest were slightly more depleted in 13C compared to those residing on the mudflat

  13. Differentiation of epipactis palustris (l.) crantz (orchidaceae) in habitats altered by man based on species populations within poznan city (poland)

    International Nuclear Information System (INIS)

    Wieloch, M.K.; Raszewska, M.W.; Drapikowska, M.


    The aim of the study was to compare two populations of Epipactis palustris (Orchidaceae) growing in the valley of Junikowski Stream, in the south-western part of the Poznan city (square of ATPOL BD08) and to compare current results to data on the species described in the literature. Group characteristics of both populations, such as population size, average density and congestion factor, as well as the average coefficient of dispersion, were defined. Specimen variability was determined by measuring 250 generative ramets in each population. The following plant traits were included: stem length, inflorescence length, number of flowers per inflorescence, number of leaves per stem and length and width of the largest leaf. Obtained data were subjected to statistical analyses. Descriptive statistics were calculated (arithmetic average, standard deviation, minimum and maximum). The variation coefficient (V) was established to determine the variation degree of each trait. In order to determine statistical significance of average values of traits of the samples in question, the factor variance ANOVA F-statistics was used. The significance degree was examined with Scheffe's test. Principal component analysis (PCA) enabled the examination of mutual relations between the samples in the system of two first principal components. This work confirmed previous information about low variability of marsh helleborine. Individual traits in both populations were very similar. The differences concerned the group characteristics. The plants were in good condition irrespective of occupied habitat. (author)

  14. An evaluation of memory accuracy in food hoarding marsh tits Poecile palustris--how accurate are they compared to humans? (United States)

    Brodin, Anders; Urhan, A Utku


    Laboratory studies of scatter hoarding birds have become a model system for spatial memory studies. Considering that such birds are known to have a good spatial memory, recovery success in lab studies seems low. In parids (titmice and chickadees) typically ranging between 25 and 60% if five seeds are cached in 50-128 available caching sites. Since these birds store many thousands of food items in nature in one autumn one might expect that they should easily retrieve five seeds in a laboratory where they know the environment with its caching sites in detail. We designed a laboratory set up to be as similar as possible with previous studies and trained wild caught marsh tits Poecile palustris to store and retrieve in this set up. Our results agree closely with earlier studies, of the first ten looks around 40% were correct when the birds had stored five seeds in 100 available sites both 5 and 24h after storing. The cumulative success curve suggests high success during the first 15 looks where after it declines. Humans performed much better, in the first five looks most subjects were 100% correct. We discuss possible reasons for why the birds were not doing better. Copyright © 2013 Elsevier B.V. All rights reserved.

  15. Eficiencia de pseudomonas sp, rhodopseudomonas sp, micrococcus sp y bacillus sp empleados como cultivos individuales y en consorcio, en la degradación de petróleo diesel ii


    Otiniano García, Nélida Milly Esther


    In order to evaluate the efficiency of Pseudomonas sp, Rhodopseudomonas sp, Micrococcus sp, Bacillus sp, and the consortium formed by these four microorganisms in the diesel II petroleum degradation, it was worked in 5 bioreactors of aerated and shaken tank of 1.5 litters of capacity, with speed agitation of 120 rpm, and air flow of 0.5 vvm; in which were placed; 940 mL of Minimum Broth of Davies pH 7.0; 50 mL of diesel II petroleum as source of carbon and 10 mL of a suspension of approx...

  16. The electronically excited states of LH2 complexes from Rhodopseudomonas acidophila strain 10050 studied by time-resolved spectroscopy and dynamic Monte Carlo simulations. II. Homo-arrays of LH2 complexes reconstituted into phospholipid model membranes. (United States)

    Pflock, Tobias J; Oellerich, Silke; Krapf, Lisa; Southall, June; Cogdell, Richard J; Ullmann, G Matthias; Köhler, Jürgen


    We performed time-resolved spectroscopy on homoarrays of LH2 complexes from the photosynthetic purple bacterium Rhodopseudomonas acidophila. Variations of the fluorescence transients were monitored as a function of the excitation fluence and the repetition rate of the excitation. These parameters are directly related to the excitation density within the array and to the number of LH2 complexes that still carry a triplet state prior to the next excitation. Comparison of the experimental observations with results from dynamic Monte Carlo simulations for a model cluster of LH2 complexes yields qualitative agreement without the need for any free parameter and reveals the mutual relationship between energy transfer and annihilation processes.

  17. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)


  18. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

  19. Magnitude and direction of the change in dipole moment associated with excitation of the primary electron donor in Rhodopseudomonas sphaeroides reaction centers

    Energy Technology Data Exchange (ETDEWEB)

    Lockhart, D.J.; Boxer, S.G.


    The magnitude and direction of the change in dipole moment, mu.., associated with the Q/sub y/ transition of the dimeric primary electron donor (special pair or P870) in Rhodopseudomonas sphaeroides reaction centers have been measured by Stark spectroscopy at 20 /sup 0/C. The magnitude of mu.. is found to be f/sup -1/ (10.3 +/- 0.7) D, where f is a correction factor for the local dielectric properties of the protein matrix. With the spherical cavity approximation and an effective local dielectric constant of 2, f = 1.2, and absolute value of mu.. is 8.6 +/- 0.6 D. Absolute value of mu.. for the Q/sub y/ transition of the special pair is approximately a factor of 3.4 and 2 greater than for the monomeric bacteriochlorophylls and bacteriopheophytins, respectively, in the reaction center. The angle between mu.. and the transition dipole moment for excitation of the first singlet electron state of the special pair was found to be 24 +/- 2/sup 0/. The measured values are combined to suggest a physical model in which the lowest excited singlet state of the special pair has substantial charge-transfer character and where charge is separated between the two monomers comprising the dimeric special pair. This leads to the hypothesis that the first charge-separated state in bacterial photosynthesis is formed directly upon photoexcitation. These data provide stringent values for comparison with theoretical calculations of the electronic structure of the chromophores in the reaction center.

  20. Conformational heterogeneity of the bacteriopheophytin electron acceptor HA in reaction centers from Rhodopseudomonas viridis revealed by Fourier transform infrared spectroscopy and site-directed mutagenesis. (United States)

    Breton, J; Bibikova, M; Oesterhelt, D; Nabedryk, E


    The light-induced Fourier transform infrared (FTIR) difference spectra corresponding to the photoreduction of either the HA bacteriopheophytin electron acceptor (HA-/HA spectrum) or the QA primary quinone (QA-/QA spectrum) in photosynthetic reaction centers (RCs) of Rhodopseudomonas viridis are reported. These spectra have been compared for wild-type (WT) RCs and for two site-directed mutants in which the proposed interactions between the carbonyls on ring V of HA and the RC protein have been altered. In the mutant EQ(L104), the putative hydrogen bond between the protein and the 9-keto C=O of HA should be affected by changing Glu L104 to a Gln. In the mutant WF(M250), the van der Waals interactions between Trp M250 and the 10a-ester C=O of HA should be modified. The characteristic effects of both mutations on the FTIR spectra support the proposed interactions and allow the IR modes of the 9-keto and 10a-ester C=O of HA and HA- to be assigned. Comparison of the HA-/HA and QA-/QA spectra leads us to conclude that the QA-/QA IR signals in the spectral range above 1700 cm-1 are largely dominated by contributions from the electrostatic response of the 10a-ester C=O mode of HA upon QA photoreduction. A heterogeneity in the conformation of the 10a-ester C=O mode of HA in WT RCs, leading to three distinct populations of HA, appears to be related to differences in the hydrogen-bonding interactions between the carbonyls of ring V of HA and the RC protein. The possibility that this structural heterogeneity is related to the observed multiexponential kinetics of electron transfer and the implications for primary processes are discussed. The effect of 1H/2H exchange on the QA-/QA spectra of the WT and mutant RCs shows that neither Glu L104 nor any other exchangeable carboxylic residue changes appreciably its protonation state upon QA reduction.

  1. A Tribal Story Written in Silica: Using Phytoliths to Research the Effects of Mining on Past Wild Rice (Zizania palustris) Abundance in Sandy Lake, Minnesota (United States)

    Clarke, I. R.; Jones, M. A.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.


    Wild rice (Zizania palustris, manoomin) is an emergent aquatic plant that grows annually in the northern Great Lakes region of North America. This region is also rich in iron ore deposits and correspondingly has an extensive history of mining activities. Wild rice no longer grows in some areas where it was previously abundant. Sandy Lake, located in St. Louis County on federally protected lands that are ceded territory of the Fond du Lac Band of Lake Superior Chippewa in Minnesota and downstream of the nearby U.S. Steel Minntac mine, was selected as a test site. This lake has a history of ricing activities by the Ojibwe (Chippewa) People, for whom manoomin has cultural importance. Lake cores were taken on June 17, 2014 by LacCore and FDLRM staff and samples were obtained. This project used phytolith analysis to answer the question of past wild rice presence and abundance in Sandy Lake. Phytoliths are microscopic opal silica deposits produced in some plants. Zizania palustris produces phytolith morphotypes that are unequivocally diagnostic of this species in this region. Microscopic slides were prepared and analyzed for wild rice phytoliths. Concentration values ranged from 25 to 4379 phytoliths per cm3/year, and wild rice accumulation figures ranged from 7 to 789 phytoliths/cm2/year, the maximum values of which occurred in the 1920s and generally declined to the current lowest levels observed. Mining has likely impacted wild rice populations by causing increased sulfate levels and possibly contributing to higher lake levels.

  2. Allodaposuchus palustris sp. nov. from the upper cretaceous of Fumanya (South-Eastern Pyrenees, Iberian Peninsula: systematics, palaeoecology and palaeobiogeography of the enigmatic allodaposuchian crocodylians.

    Directory of Open Access Journals (Sweden)

    Alejandro Blanco

    Full Text Available The controversial European genus Allodaposuchus is currently composed of two species (A. precedens, A. subjuniperus and it has been traditionally considered a basal eusuchian clade of crocodylomorphs. In the present work, the new species A. palustris is erected on the base of cranial and postcranial remains from the lower Maastrichtian of the southern Pyrenees. Phylogenetic analyses here including both cranial and postcranial data support the hypothesis that Allodaposuchus is included within Crocodylia. The studied specimen suggests little change in postcranial skeleton along the evolutionary history of crocodylians, except for some bone elements such as the axis, the first caudal vertebra and the ilium. The specimen was found in an organic mudstone corresponding to a coastal wetland environment. Thus, A. palustris from Fumanya is the first Allodaposuchus reported in lacustrine-palustrine settings that expand the ecological range for this genus. The S-DIVA palaeobiogeographic reconstruction of ancestral area suggests that early members of Crocodylia rapidly widespread for the Northern Hemisphere landmasses no later than the Campanian, leading the apparition of endemic groups. In that way "Allodaposuchia" represents an endemic European clade probably originated in the Ibero-Armorican domain in the late Campanian and dispersed by the Southern European archipelago prior to the early Maastrichtian.

  3. Action of sulfurous acid on pollen. [Hepatica triloba; Helleborus orientalis; Vinca minor; Viola tricolor; Primula officinalis; Lilium candidum; Petunia; Pisum; Helleborus viridus; Galanthus nivealis; Vinca major; Convallaria maialis; Narcissus poeticus; Caltha palustris; Cystisus laburnum; Orchis maculata; Bilbergia; Eranthus; Crocus

    Energy Technology Data Exchange (ETDEWEB)

    Sabachnikoff, V


    The following ornamental plants: Hepatica triloba, Helleborus orientalis, Vinca minor, Viola tricolor, Primula officinalis, Lilium candidum, Petunia, Pisum, Helleborus viridus, Galanthus nivealis, Vinca major, Convallaria maialis, Narcissus poeticus, Caltha palustris, Cystisus laburnum, Orchis maculata, Bilbergia, Eranthus, and Crocus were tested for seed production. Exposure to sulfuric acid ranged from three to forty-eight hours. Responses were noted for varying concentrations.

  4. Scheuchzeria palustris L

    Czech Academy of Sciences Publication Activity Database

    Šída, O.; Štěpánková, Jitka


    Roč. 50, č. 1 (2015), s. 100-101 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : floristics * distribution * endangered species Subject RIV: EF - Botanics

  5. The electronically excited states of LH2 complexes from Rhodopseudomonas acidophila strain 10050 studied by time-resolved spectroscopy and dynamic Monte Carlo simulations. I. Isolated, non-interacting LH2 complexes. (United States)

    Pflock, Tobias J; Oellerich, Silke; Southall, June; Cogdell, Richard J; Ullmann, G Matthias; Köhler, Jürgen


    We have employed time-resolved spectroscopy on the picosecond time scale in combination with dynamic Monte Carlo simulations to investigate the photophysical properties of light-harvesting 2 (LH2) complexes from the purple photosynthetic bacterium Rhodopseudomonas acidophila. The variations of the fluorescence transients were studied as a function of the excitation fluence, the repetition rate of the excitation and the sample preparation conditions. Here we present the results obtained on detergent solubilized LH2 complexes, i.e., avoiding intercomplex interactions, and show that a simple four-state model is sufficient to grasp the experimental observations quantitatively without the need for any free parameters. This approach allows us to obtain a quantitative measure for the singlet-triplet annihilation rate in isolated, noninteracting LH2 complexes.

  6. Detection and enumeration of methanotrophs in acidic Sphagnum peat by 16S rRNA fluorescence in situ hybridization, including the use of newly developed oligonucleotide probes for Methylocella palustris. (United States)

    Dedysh, S N; Derakshani, M; Liesack, W


    Two 16S rRNA-targeted oligonucleotide probes, Mcell-1026 and Mcell-181, were developed for specific detection of the acidophilic methanotroph Methylocella palustris using fluorescence in situ hybridization (FISH). The fluorescence signal of probe Mcell-181 was enhanced by its combined application with the oligonucleotide helper probe H158. Mcell-1026 and Mcell-181, as well as 16S rRNA oligonucleotide probes with reported group specificity for either type I methanotrophs (probes M-84 and M-705) or the Methylosinus/Methylocystis group of type II methanotrophs (probes MA-221 and M-450), were used in FISH to determine the abundance of distinct methanotroph groups in a Sphagnum peat sample of pH 4.2. M. palustris was enumerated at greater than 10(6) cells per g of peat (wet weight), while the detectable population size of type I methanotrophs was three orders of magnitude below the population level of M. palustris. The cell counts with probe MA-221 suggested that only 10(4) type II methanotrophs per g of peat (wet weight) were present, while the use of probe M-450 revealed more than 10(6) type II methanotroph cells per g of the same samples. This discrepancy was due to the fact that probe M-450 targets almost all currently known strains of Methylosinus and Methylocystis, whereas probe MA-221, originally described as group specific, does not detect a large proportion of Methylocystis strains. The total number of methanotrophic bacteria detected by FISH was 3.0 (+/-0.2) x 10(6) cells per g (wet weight) of peat. This was about 0.8% of the total bacterial cell number. Thus, our study clearly suggests that M. palustris and a defined population of Methylocystis spp. were the predominant methanotrophs detectable by FISH in an acidic Sphagnum peat bog.

  7. Methylocella palustris gen. nov., sp. nov., a new methane-oxidizing acidophilic bacterium from peat bogs, representing a novel subtype of serine-pathway methanotrophs. (United States)

    Dedysh, S N; Liesack, W; Khmelenina, V N; Suzina, N E; Trotsenko, Y A; Semrau, J D; Bares, A M; Panikov, N S; Tiedje, J M


    A new genus, Methylocella, and a new species, Methylocella palustris, are proposed for three strains of methane-oxidizing bacteria isolated from acidic Sphagnum peat bogs. These bacteria are aerobic, Gram-negative, colourless, non-motile, straight and curved rods that utilize the serine pathway for carbon assimilation, multiply by normal cell division and contain intracellular poly-beta-hydroxybutyrate granules (one at each pole). These strains use methane and methanol as sole sources of carbon and energy and are moderately acidophilic organisms with growth between pH 4.5 and pH 7.0, the optimum being at pH 5.0-5.5. The temperature range for growth is 10-28 degrees C with the optimum at 15-20 degrees C. The intracytoplasmic membrane system is different from those of type I and II methanotrophs. Cells contain an extensive periplasmic space and a vesicular membrane system connected to the cytoplasmic membrane. The strains grew only on media with a low salt content (0.2-0.5 g l(-1)). All three strains were found to possess soluble methane monooxygenase and are able to fix atmospheric nitrogen via an oxygen-sensitive nitrogenase. No products were observed in a PCR with particulate methane monooxygenase-targeted primers; hybridization with a pmoA probe was also negative. The major phospholipid fatty acids are 18:1 acids. The G+C content of the DNA is 61.2 mol%. The three strains share identical 16S rRNA gene sequences and represent a novel lineage of methane-oxidizing bacteria within the alpha-subclass of the class Proteobacteria and are only moderately related to type II methanotrophs of the Methylocystis-Methylosinus group. The three strains are most closely related to the acidophilic heterotrophic bacterium Beijerinckia indica subsp. indica (96.5% 16S rDNA sequence similarity). Collectively, these strains comprise a new species and genus Methylocella palustris gen. nov., sp. nov.; strain KT (= ATCC 700799T) is the type strain.

  8. Sulfide Generated by Sulfate Reduction is a Primary Controller of the Occurrence of Wild Rice (Zizania palustris) in Shallow Aquatic Ecosystems (United States)

    Myrbo, A.; Swain, E. B.; Engstrom, D. R.; Coleman Wasik, J.; Brenner, J.; Dykhuizen Shore, M.; Peters, E. B.; Blaha, G.


    Field observations suggest that surface water sulfate concentrations control the distribution of wild rice, an aquatic grass (Zizania palustris). However, hydroponic studies show that sulfate is not toxic to wild rice at even unrealistically high concentrations. To determine how sulfate might directly or indirectly affect wild rice, potential wild rice habitat was characterized for 64 chemical and physical variables in over 100 sites spanning a relatively steep climatic and geological gradient in Minnesota. Habitat suitability was assessed by comparing the occurrence of wild rice with the field variables, through binary logistic regression. This analysis demonstrated that sulfide in sediment pore water, generated by the microbial reduction of sulfate that diffuses or advects into the sediment, is the primary control of wild rice occurrence. Water temperature and water transparency independently control the suitability of habitat for wild rice. In addition to generating phytotoxic sulfide, sulfate reduction also supports anaerobic decomposition of organic matter, releasing nutrients that can compound the harm of direct sulfide toxicity. These results are important because they show that increases in sulfate loading to surface water can have multiple negative consequences for ecosystems, even though sulfate itself is relatively benign.

  9. Kocuria palustris sp. nov. and Kocuria rhizophila sp. nov., isolated from the rhizoplane of the narrow-leaved cattail (Typha angustifolia). (United States)

    Kovács, G; Burghardt, J; Pradella, S; Schumann, P; Stackebrandt, E; Màrialigeti, K


    Two Gram-positive, aerobic spherical actinobacteria were isolated from the rhizoplane of narrow-leaved cattail (Typha angustifolia) collected from a floating mat in the Soroksár tributary of the Danube river, Hungary. Sequence comparisons of the 16S rDNA indicated these isolates to be phylogenetic neighbours of members of the genus Kocuria, family Micrococcaceae, in which they represent two novel lineages. The phylogenetic distinctness of the two organisms TA68T and TAGA27T was supported by DNA-DNA similarity values of less than 55% between each other and with the type strains of Kocuria rosea, Kocuria kristinae and Kocuria varians. Chemotaxonomic properties supported the placement of the two isolates in the genus Kocuria. The diagnostic diamino acid of the cell-wall peptidoglycan is lysine, the interpeptide bridge is composed of three alanine residues. Predominant menaquinone was MK-7(H2). The fatty acid pattern represents the straight-chain saturated iso-anteiso type. Main fatty acid was anteiso-C15:0. The phospholipids are diphosphatidylglycerol, phosphatidylglycerol and an unknown component. The DNA base composition of strains TA68T and TAGA27T is 69.4 and 69.6 mol% G+C, respectively. Genotypic, morphological and physiological characteristics are used to describe two new species of Kocuria, for which we propose the names Kocuria palustris, type strain DSM 11925T and Kocuria rhizophila, type strain DSM 11926T.

  10. High-resolution bioactivity profiling combined with HPLC-HRMS-SPE-NMR: α-Glucosidase inhibitors and acetylated ellagic acid rhamnosides from Myrcia palustris DC. (Myrtaceae). (United States)

    Wubshet, Sileshi G; Moresco, Henrique H; Tahtah, Yousof; Brighente, Inês M C; Staerk, Dan


    Type 2 diabetes (T2D) is an endocrine metabolic disease with a worldwide prevalence of more than 8%, and an expected increase close to 50% in the next 15-20years. T2D is associated with severe and life-threatening complications like retinopathy, neuropathy, nephropathy, and cardiovascular diseases, and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC-HRMS-SPE-NMR. This led to identification of casuarinin, myricetin 3-O-β-d-(6″-galloyl)galactopyranoside, kaempferol 3-O-β-d-galactopyranoside, myricetin, and quercetin as α-glucosidase inhibitors. In addition, four acetylated ellagic acid rhamnosides, i.e., 4-O-(2″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(2″,3″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(3″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, and 4-O-(2″,3″,4″-O-triacetyl-α-l-rhamnopyranosyl)ellagic acid were identified. Copyright © 2015 Elsevier Ltd. All rights reserved.

  11. Genome Assembly of the Fungus Cochliobolus miyabeanus, and Transcriptome Analysis during Early Stages of Infection on American Wildrice (Zizania palustris L..

    Directory of Open Access Journals (Sweden)

    Claudia V Castell-Miller

    Full Text Available The fungus Cochliobolus miyabeanus causes severe leaf spot disease on rice (Oryza sativa and two North American specialty crops, American wildrice (Zizania palustris and switchgrass (Panicum virgatum. Despite the importance of C. miyabeanus as a disease-causing agent in wildrice, little is known about either the mechanisms of pathogenicity or host defense responses. To start bridging these gaps, the genome of C. miyabeanus strain TG12bL2 was shotgun sequenced using Illumina technology. The genome assembly consists of 31.79 Mbp in 2,378 scaffolds with an N50 = 74,921. It contains 11,000 predicted genes of which 94.5% were annotated. Approximately 10% of total gene number is expected to be secreted. The C. miyabeanus genome is rich in carbohydrate active enzymes, and harbors 187 small secreted peptides (SSPs and some fungal effector homologs. Detoxification systems were represented by a variety of enzymes that could offer protection against plant defense compounds. The non-ribosomal peptide synthetases and polyketide synthases (PKS present were common to other Cochliobolus species. Additionally, the fungal transcriptome was analyzed at 48 hours after inoculation in planta. A total of 10,674 genes were found to be expressed, some of which are known to be involved in pathogenicity or response to host defenses including hydrophobins, cutinase, cell wall degrading enzymes, enzymes related to reactive oxygen species scavenging, PKS, detoxification systems, SSPs, and a known fungal effector. This work will facilitate future research on C. miyabeanus pathogen-associated molecular patterns and effectors, and in the identification of their corresponding wildrice defense mechanisms.

  12. Entrepreneurial Couples

    DEFF Research Database (Denmark)

    Dahl, Michael S.; Van Praag, Mirjam; Thompson, Peter


    We study possible motivations for co-entreprenurial couples to start up a joint firm, using a sample of 1,069 Danish couples that established a joint enterprise between 2001 and 2010. We compare their pre-entry characteristics, firm performance and post-dissolution private and financial outcomes...

  13. Entrepreneurial Couples

    DEFF Research Database (Denmark)

    Dahl, Michael S.; Van Praag, Mirjam; Thompson, Peter

    with a selected set of comparable firms and couples. We find evidence that couples often establish a business together because one spouse – most commonly the female – has limited outside opportunities in the labor market. However, the financial benefits for each of the spouses, and especially the female......We study possible motivations for co-entrepenurial couples to start up a joint firm, using a sample of 1,069 Danish couples that established a joint enterprise between 2001 and 2010. We compare their pre-entry characteristics, firm performance and postdissolution private and financial outcomes......, are larger in co-entrepreneurial firms, both during the life of the business and post-dissolution. The start-up of co-entrepreneurial firms seems therefore a sound investment in the human capital of both spouses as well as in the reduction of income inequality in the household. We find no evidence of non...

  14. Entrepreneurial Couples

    DEFF Research Database (Denmark)

    Dahl, Michael S.; Van Praag, Mirjam; Thompson, Peter

    with a selected set of comparable firms and couples. We find evidence that couples often establish a business together because one spouse - most commonly the female - has limited outside opportunities in the labor market. However, the financial benefits for each of the spouses, and especially the female......We study possible motivations for co-entrepenurial couples to start up a joint firm, us-ing a sample of 1,069 Danish couples that established a joint enterprise between 2001 and 2010. We compare their pre-entry characteristics, firm performance and post-dissolution private and financial outcomes......, are larger in co-entrepreneurial firms, both during the life of the business and post-dissolution. The start-up of co-entrepreneurial firms seems therefore a sound in-vestment in the human capital of both spouses as well as in the reduction of income inequality in the household. We find no evidence of non...

  15. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  16. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  17. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  18. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  19. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  20. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  1. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

  2. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

  3. Dark coupling

    International Nuclear Information System (INIS)

    Gavela, M.B.; Hernández, D.; Honorez, L. Lopez; Mena, O.; Rigolin, S.


    The two dark sectors of the universe—dark matter and dark energy—may interact with each other. Background and linear density perturbation evolution equations are developed for a generic coupling. We then establish the general conditions necessary to obtain models free from non-adiabatic instabilities. As an application, we consider a viable universe in which the interaction strength is proportional to the dark energy density. The scenario does not exhibit ''phantom crossing'' and is free from instabilities, including early ones. A sizeable interaction strength is compatible with combined WMAP, HST, SN, LSS and H(z) data. Neutrino mass and/or cosmic curvature are allowed to be larger than in non-interacting models. Our analysis sheds light as well on unstable scenarios previously proposed

  4. In Situ Dark Adaptation Enhances the Efficiency of DNA Extraction from Mature Pin Oak (Quercus palustris Leaves, Facilitating the Identification of Partial Sequences of the 18S rRNA and Isoprene Synthase (IspS Genes

    Directory of Open Access Journals (Sweden)

    Csengele E. Barta


    Full Text Available Mature oak (Quercus spp. leaves, although abundantly available during the plants’ developmental cycle, are rarely exploited as viable sources of genomic DNA. These leaves are rich in metabolites difficult to remove during standard DNA purification, interfering with downstream molecular genetics applications. The current work assessed whether in situ dark adaptation, to deplete sugar reserves and inhibit secondary metabolite synthesis could compensate for the difficulties encountered when isolating DNA from mature leaves rich in secondary metabolites. We optimized a rapid, commercial kit based method to extract genomic DNA from dark- and light-adapted leaves. We demonstrated that in situ dark adaptation increases the yield and quality of genomic DNA obtained from mature oak leaves, yielding templates of sufficiently high quality for direct downstream applications, such as PCR amplification and gene identification. The quality of templates isolated from dark-adapted pin oak leaves particularly improved the amplification of larger fragments in our experiments. From DNA extracts prepared with our optimized method, we identified for the first time partial segments of the genes encoding 18S rRNA and isoprene synthase (IspS from pin oak (Quercus palustris, whose full genome has not yet been sequenced.

  5. A 400-year phytolith-based reconstruction of wild rice (Zizania palustris) abundance from Mud Lake core sediments, Fond du Lac Band of Lake Superior Chippewa Reservation, Minnesota, USA. (United States)

    Munoz, R.; Caylor, E.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.


    Wild rice (Zizania palustris L.) is an aquatic grass with spiritual and subsistence significance to Native people of the Great Lakes region of North America. Mud Lake (Mashkiigwaagamaag), located on the Fond du Lac Band of Lake Superior Chippewa Reservation in Carlton County, Minnesota, USA, once supported an extensive population of wild rice (manoomin). However, early 20th century attempts to ditch and drain surrounding wetlands for landuse intensification severely altered the natural hydrological system that supports wild rice. Fond du Lac Resource Management (FDLRM) technicians are currently working to increase the wild rice population in Mud Lake. As part of these efforts, this phytolith study was undertaken to better understand how wild rice abundance has fluctuated over the past 400 years, with particular emphasis on the 19th and 20th centuries. Phytoliths are microscopic opal silica plant remains that are incorporated into soils and lake sediments after the plant-parts that contain them decay. Wild rice produces phytolith morphotypes that are unequivocally diagnostic. Mud Lake core MNMN-MUD11-1C-1P-1 (46°43'38.39"N, 92°42'2.45"W) was piston cored by LacCore (National Lacustrine Core Facility) and FDLRM technicians on 24 May 2011. Initial core descriptions, multi-sensor core logging, phytolith sampling and phytolith extractions were completed during the summer of 2014 at LacCore. Wild rice phytolith identification and quantification was conducted on twelve samples using brightfield microscopy at 400x magnification. Wild rice phytolith concentration values ranged from 68 to 2,300 phytoliths/cm3. Wild rice accumulation rates ranged from 9 to 383 phytoliths/ cm2/yr, peaking in 1952 AD. Wild rice abundance in Mud Lake appears to be influenced by a complex set of variables that include anthropogenic disturbance, climatic events and aquatic plant community succession.

  6. Development of a Novel Escherichia coli–Kocuria Shuttle Vector Using the Cryptic pKPAL3 Plasmid from K. palustris IPUFS-1 and Its Utilization in Producing Enantiopure (S-Styrene Oxide

    Directory of Open Access Journals (Sweden)

    Hiroshi Toda


    Full Text Available The novel cryptic pKPAL3 plasmid was isolated from the Gram-positive microorganism Kocuria palustris IPUFS-1 and characterized in detail. pKPAL3 is a circular plasmid that is 4,443 bp in length. Open reading frame (ORF and homology search analyses indicated that pKPAL3 possesses four ORFs; however, there were no replication protein coding genes predicted in the plasmid. Instead, there were two nucleotide sequence regions that showed significant identities with untranslated regions of K. rhizophila DC2201 (NBRC 103217 genomic sequences, and these sequences were essential for autonomous replication of pKPAL3 in Kocuria cells. Based on these findings, we constructed the novel Escherichia coli–Kocuria shuttle vectors pKITE301 (kanamycin resistant and pKITE303 (thiostrepton resistant from pKPAL3. The copy numbers of the constructed shuttle vectors were estimated to be 20 per cell, and they exhibited low segregation stability in Kocuria transformant cells in the absence of antibiotics. Moreover, constructed vectors showed compatibility with the other K. rhizophila shuttle vector pKITE103. We successfully expressed multiple heterologous genes, including the styrene monooxygenase gene from Rhodococcus sp. ST-10 (rhsmo and alcohol dehydrogenase gene from Leifsonia sp. S749 (lsadh, in K. rhizophila DC2201 using the pKITE301P and pKITE103P vectors under the control of the glyceraldehyde 3-phosphate dehydrogenase (gapdh promotor. The RhSMO–LSADH co-expressing K. rhizophila was used as a biocatalyst in an organic solvent–water biphasic reaction system to efficiently convert styrene into (S-styrene oxide with 99% ee in the presence of 2-propanol as a hydrogen donor. The product concentration of the reaction in the organic solvent reached 235 mM after 30 h under optimum conditions. Thus, we demonstrated that this novel shuttle vector is useful for developing biocatalysts based on organic solvent-tolerant Kocuria cells.

  7. Path coupling and aggregate path coupling

    CERN Document Server

    Kovchegov, Yevgeniy


    This book describes and characterizes an extension to the classical path coupling method applied to statistical mechanical models, referred to as aggregate path coupling. In conjunction with large deviations estimates, the aggregate path coupling method is used to prove rapid mixing of Glauber dynamics for a large class of statistical mechanical models, including models that exhibit discontinuous phase transitions which have traditionally been more difficult to analyze rigorously. The book shows how the parameter regions for rapid mixing for several classes of statistical mechanical models are derived using the aggregate path coupling method.

  8. Electromagnetic clutches and couplings

    CERN Document Server

    Vorob'Yeva, T M; Fry, D W; Higinbotham, W


    Electromagnetic Clutches and Couplings contains a detailed description of U.S.S.R. electromagnetic friction clutches, magnetic couplings, and magnetic particle couplings. This book is divided into four chapters. The first chapter discusses the design and construction of magnetic (solenoid-operated) couplings, which are very quick-acting devices and used in low power high-speed servo-systems. Chapter 2 describes the possible fields of application, design, construction, and utilization of magnetic particle couplings. The aspects of construction, design, and utilization of induction clutches (sli

  9. Molecular Regulation of Photosynthetic Carbon Dioxide Fixation in Nonsulfur Purple Bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Tabita, Fred Robert [The Ohio State Univ., Columbus, OH (United States)


    The overall objective of this project is to determine the mechanism by which a transcriptional activator protein affects CO2 fixation (cbb) gene expression in nonsulfur purple photosynthetic bacteria, with special emphasis to Rhodobacter sphaeroides and with comparison to Rhodopseudomonas palustris. These studies culminated in several publications which indicated that additional regulators interact with the master regulator CbbR in both R. sphaeroides and R. palustris. In addition, the interactive control of the carbon and nitrogen assimilatory pathways was studied and unique regulatory signals were discovered.

  10. Conversation, coupling and complexity

    DEFF Research Database (Denmark)

    Fusaroli, Riccardo; Abney, Drew; Bahrami, Bahador

    We investigate the linguistic co-construction of interpersonal synergies. By applying a measure of coupling between complex systems to an experimentally elicited corpus of joint decision dialogues, we show that interlocutors’ linguistic behavior displays increasing signature of multi-scale coupling......, known as complexity matching, over the course of interaction. Furthermore, we show that stronger coupling corresponds with more effective interaction, as measured by collective task performance....

  11. Coupling Integrable Couplings of an Equation Hierarchy

    International Nuclear Information System (INIS)

    Wang Hui; Xia Tie-Cheng


    Based on a kind of Lie algebra G proposed by Zhang, one isospectral problem is designed. Under the framework of zero curvature equation, a new kind of integrable coupling of an equation hierarchy is generated using the methods proposed by Ma and Gao. With the help of variational identity, we get the Hamiltonian structure of the hierarchy. (general)

  12. Integrating large-scale functional genomics data to dissect metabolic networks for hydrogen production

    Energy Technology Data Exchange (ETDEWEB)

    Harwood, Caroline S


    The goal of this project is to identify gene networks that are critical for efficient biohydrogen production by leveraging variation in gene content and gene expression in independently isolated Rhodopseudomonas palustris strains. Coexpression methods were applied to large data sets that we have collected to define probabilistic causal gene networks. To our knowledge this a first systems level approach that takes advantage of strain-to strain variability to computationally define networks critical for a particular bacterial phenotypic trait.

  13. Translation-coupling systems (United States)

    Pfleger, Brian; Mendez-Perez, Daniel


    Disclosed are systems and methods for coupling translation of a target gene to a detectable response gene. A version of the invention includes a translation-coupling cassette. The translation-coupling cassette includes a target gene, a response gene, a response-gene translation control element, and a secondary structure-forming sequence that reversibly forms a secondary structure masking the response-gene translation control element. Masking of the response-gene translation control element inhibits translation of the response gene. Full translation of the target gene results in unfolding of the secondary structure and consequent translation of the response gene. Translation of the target gene is determined by detecting presence of the response-gene protein product. The invention further includes RNA transcripts of the translation-coupling cassettes, vectors comprising the translation-coupling cassettes, hosts comprising the translation-coupling cassettes, methods of using the translation-coupling cassettes, and gene products produced with the translation-coupling cassettes.

  14. Plastics pipe couplings

    International Nuclear Information System (INIS)

    Glover, J.B.


    A method is described of making a pipe coupling of the type comprising a plastics socket and a resilient annular sealing member secured in the mouth thereof, in which the material of at least one component of the coupling is subjected to irradiation with high energy radiation whereby the material is caused to undergo cross-linking. As examples, the coupling may comprise a polyethylene or plasticised PVC socket the material of which is subjected to irradiation, and the sealing member may be moulded from a thermoplastic elastomer which is subjected to irradiation. (U.K.)

  15. Coupling in the Tevatron

    International Nuclear Information System (INIS)

    Gelfand, N.M.


    The performance of the Fermilab Tevatron Collider at the commencement of run Ib was far below expectations. After a frustrating period of several months, a low-β quad downstream of the interaction point at B0 was found to be rolled. This rolled quadrupole coupled the horizontal and vertical motion of the Tevatron beams. It also made matching the beam from the Main Ring to the Tevatron impossible, resulting in emittance blow up on injection. The net result of the roll was a significant reduction in the Tevatron luminosity. When the roll in the quadrupole was corrected the performance of the Tevatron improved dramatically. This note will discuss the experimental data indicating the presence of coupling and subsequent calculations which show how coupling an affect the luminosity. It is not intended to exhaust a discussion of coupling, which hopefully will be understood well enough to be discussed in a subsequent note

  16. Coupled transverse motion

    International Nuclear Information System (INIS)

    Teng, L.C.


    The magnetic field in an accelerator or a storage ring is usually so designed that the horizontal (x) and the vertical (y) motions of an ion are uncoupled. However, because of imperfections in construction and alignment, some small coupling is unavoidable. In this lecture, we discuss in a general way what is known about the behaviors of coupled motions in two degrees-of-freedom. 11 refs., 6 figs

  17. Arsenic biotransformation and volatilization in transgenic rice (United States)

    Meng, Xiang-Yan; Qin, Jie; Wang, Li-Hong; Duan, Gui-Lan; Sun, Guo-Xin; Wu, Hui-Lan; Chu, Cheng-Cai; Ling, Hong-Qing; Rosen, Barry P.; Zhu, Yong-Guan


    Summary Biotransformation of arsenic includes oxidation, reduction, methylation and conversion to more complex organic arsenicals. Members of the class of arsenite [As(III)] S-adenosylmethyltransferase enzymes catalyze As(III) methylation to a variety of mono-, di- and trimethylated species, some of which are less toxic than As(III) itself. However, no methyltransferase gene has been identified in plants. Here, an arsM gene from the soil bacterium Rhodopseudomonas palustris was expressed in Japonica rice (Oryza sativa L.) cultivar Nipponbare, and the transgenic rice produced methylated arsenic species, which were measured by inductively coupled plasma mass spectrometry (ICP-MS) and high performance liquid chromatography-inductively coupled plasma-mass spectrometry (HPLC-ICP-MS). Both monomethylarsenate [MAs(V)] and dimethylarsenate [DMAs(V)] were detected in the root and shoot of transgenic rice. After 12-d exposure to As(III), the transgenic rice gave off 10-fold more volatile arsenicals. The present study demonstrates that expression of an arsM gene in rice induces arsenic methylation and volatilization, providing a potential stratagem for phytoremediation theoretically. PMID:21517874

  18. Projected coupled cluster theory. (United States)

    Qiu, Yiheng; Henderson, Thomas M; Zhao, Jinmo; Scuseria, Gustavo E


    Coupled cluster theory is the method of choice for weakly correlated systems. But in the strongly correlated regime, it faces a symmetry dilemma, where it either completely fails to describe the system or has to artificially break certain symmetries. On the other hand, projected Hartree-Fock theory captures the essential physics of many kinds of strong correlations via symmetry breaking and restoration. In this work, we combine and try to retain the merits of these two methods by applying symmetry projection to broken symmetry coupled cluster wave functions. The non-orthogonal nature of states resulting from the application of symmetry projection operators furnishes particle-hole excitations to all orders, thus creating an obstacle for the exact evaluation of overlaps. Here we provide a solution via a disentanglement framework theory that can be approximated rigorously and systematically. Results of projected coupled cluster theory are presented for molecules and the Hubbard model, showing that spin projection significantly improves unrestricted coupled cluster theory while restoring good quantum numbers. The energy of projected coupled cluster theory reduces to the unprojected one in the thermodynamic limit, albeit at a much slower rate than projected Hartree-Fock.

  19. Tube coupling device (United States)

    Myers, William N. (Inventor); Hein, Leopold A. (Inventor)


    A first annular ring of a tube coupling device has a keyed opening sized to fit around the nut region of a male coupling, and a second annular ring has a keyed opening sized to fit around the nut of a female coupling. Each ring has mating ratchet teeth and these rings are biased together, thereby engaging these teeth and preventing rotation of these rings. This in turn prevents the rotation of the male nut region with respect to the female nut. For tube-to-bulkhead locking, one facet of one ring is notched, and a pin is pressed into an opening in the bulkhead. This pin is sized to fit within one of the notches in the ring, thereby preventing rotation of this ring with respect to the bulkhead.

  20. EMP coupling to ships

    International Nuclear Information System (INIS)

    Deadrick, F.J.; Cabayan, H.S.; Kunz, K.F.; Bevensee, R.M.; Martin, L.C.; Egbert, R.W.


    Scale-model tests were conducted to establish the adequacy and limitations of model measurements as tools for predicting electromagnetic pulse (EMP) coupling voltages and currents to the critical antennas, cables, and metallic structures on ships. The scale-model predictions are compared with the results of the full-scale EMP simulation test of the Canadian ASW ship, HMCS Huron. (The EMP coupling predictions in this report were made without prior knowledge of the results of the data from the HMCS Huron tests.) This report establishes that the scale-model tests in conjunction with the data base from EMP coupling modules provides the necessary information for source model development and permits effective, low-cost study of particular system configurations. 184 figures, 9 tables

  1. Strong-coupling approximations

    International Nuclear Information System (INIS)

    Abbott, R.B.


    Standard path-integral techniques such as instanton calculations give good answers for weak-coupling problems, but become unreliable for strong-coupling. Here we consider a method of replacing the original potential by a suitably chosen harmonic oscillator potential. Physically this is motivated by the fact that potential barriers below the level of the ground-state energy of a quantum-mechanical system have little effect. Numerically, results are good, both for quantum-mechanical problems and for massive phi 4 field theory in 1 + 1 dimensions. 9 references, 6 figures

  2. Coupled moderator neutronics

    International Nuclear Information System (INIS)

    Russell, G.J.; Pitcher, E.J.; Ferguson, P.D.


    Optimizing the neutronic performance of a coupled-moderator system for a Long-Pulse Spallation Source is a new and challenging area for the spallation target-system designer. For optimal performance of a neutron source, it is essential to have good communication with instrument scientists to obtain proper design criteria and continued interaction with mechanical, thermal-hydraulic, and materials engineers to attain a practical design. A good comprehension of the basics of coupled-moderator neutronics will aid in the proper design of a target system for a Long-Pulse Spallation Source

  3. Coupled nonlinear oscillators

    Energy Technology Data Exchange (ETDEWEB)

    Chandra, J; Scott, A C


    Topics discussed include transitions in weakly coupled nonlinear oscillators, singularly perturbed delay-differential equations, and chaos in simple laser systems. Papers are presented on truncated Navier-Stokes equations in a two-dimensional torus, on frequency locking in Josephson point contacts, and on soliton excitations in Josephson tunnel junctions. Attention is also given to the nonlinear coupling of radiation pulses to absorbing anharmonic molecular media, to aspects of interrupted coarse-graining in stimulated excitation, and to a statistical analysis of long-term dynamic irregularity in an exactly soluble quantum mechanical model.

  4. Apodized coupled resonator waveguides. (United States)

    Capmany, J; Muñoz, P; Domenech, J D; Muriel, M A


    In this paper we propose analyse the apodisation or windowing of the coupling coefficients in the unit cells of coupled resonator waveguide devices (CROWs) as a means to reduce the level of secondary sidelobes in the bandpass characteristic of their transfer functions. This technique is regularly employed in the design of digital filters and has been applied as well in the design of other photonic devices such as corrugated waveguide filters and fiber Bragg gratings. The apodisation of both Type-I and Type-II structures is discussed for several windowing functions.

  5. Coupling in reflector arrays

    DEFF Research Database (Denmark)

    Appel-Hansen, Jørgen


    In order to reduce the space occupied by a reflector array, it is desirable to arrange the array antennas as close to each other as possible; however, in this case coupling between the array antennas will reduce the reflecting properties of the reflector array. The purpose of the present communic......In order to reduce the space occupied by a reflector array, it is desirable to arrange the array antennas as close to each other as possible; however, in this case coupling between the array antennas will reduce the reflecting properties of the reflector array. The purpose of the present...

  6. ElectroWeak Bosons Couplings

    CERN Document Server

    Ouraou, Ahmimed; The ATLAS collaboration


    Latest results on the measurement of gauge boson couplings, from ATLAS and CMS at the LHC, are presented. This review starts with an introduction to boson couplings, then the measurements of Triple and Quartic Couplings are described. And finally, limits on anomalous couplings are summarized.

  7. Anomalous top magnetic couplings

    Indian Academy of Sciences (India)


    Nov 9, 2012 ... Corresponding author. E-mail: Abstract. The real and imaginary parts of the one-loop electroweak contributions to the left and right tensorial anomalous couplings of the tbW vertex in the Standard Model (SM) are computed. Keywords. Top; anomalous. PACS Nos 14.65.Ha; 12.15 ...

  8. HIV-discordant couples

    African Journals Online (AJOL)



    Jun 2, 2006 ... These may broadly be divided into factors that affect the transmissibility of HIV between couples per sex act and factors influencing the number of sex acts during which exposure may occur. Examples of the former include use of condoms or other barrier methods and certain sexual behaviours, such as sex.

  9. Gravitationally coupled electroweak monopole

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Y.M., E-mail: [Administration Building 310-4, Konkuk University, Seoul 143-701 (Korea, Republic of); School of Physics and Astronomy, Seoul National University, Seoul 151-742 (Korea, Republic of); Kimm, Kyoungtae [Faculty of Liberal Education, Seoul National University, Seoul 151-747 (Korea, Republic of); Yoon, J.H. [Department of Physics, College of Natural Sciences, Konkuk University, Seoul 143-701 (Korea, Republic of)


    We present a family of gravitationally coupled electroweak monopole solutions in Einstein–Weinberg–Salam theory. Our result confirms the existence of globally regular gravitating electroweak monopole which changes to the magnetically charged black hole as the Higgs vacuum value approaches to the Planck scale. Moreover, our solutions could provide a more accurate description of the monopole stars and magnetically charged black holes.

  10. International Migration of Couples

    DEFF Research Database (Denmark)

    Junge, Martin; Munk, Martin D.; Nikolka, Till


    Migrant self-selection is important to labor markets and public finances in both origin and destination countries. We develop a theoretical model regarding the migration of dual-earner couples and test it using population-wide administrative data from Denmark. Our model predicts that the probabil...

  11. Warthog: Coupling Status Update

    Energy Technology Data Exchange (ETDEWEB)

    Hart, Shane W. D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Reardon, Bradley T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)


    The Warthog code was developed to couple codes that are developed in both the Multi-Physics Object-Oriented Simulation Environment (MOOSE) from Idaho National Laboratory (INL) and SHARP from Argonne National Laboratory (ANL). The initial phase of this work, focused on coupling the neutronics code PROTEUS with the fuel performance code BISON. The main technical challenge involves mapping the power density solution determined by PROTEUS to the fuel in BISON. This presents a challenge since PROTEUS uses the MOAB mesh format, but BISON, like all other MOOSE codes, uses the libMesh format. When coupling the different codes, one must consider that Warthog is a light-weight MOOSE-based program that uses the Data Transfer Kit (DTK) to transfer data between the various mesh types. Users set up inputs for the codes they want to run, and then Warthog transfers the data between them. Currently Warthog supports XSProc from SCALE or the Sub-Group Application Programming Interface (SGAPI) in PROTEUS for generating cross sections. It supports arbitrary geometries using PROTEUS and BISON. DTK will transfer power densities and temperatures between the codes where the domains overlap. In the past fiscal year (FY), much work has gone into demonstrating two-way coupling for simple pin cells of various materials. XSProc was used to calculate the cross sections, which were then passed to PROTEUS in an external file. PROTEUS calculates the fission/power density, and Warthog uses DTK to pass this information to BISON, where it is used as the heat source. BISON then calculates the temperature profile of the pin cell and sends it back to XSProc to obtain the temperature corrected cross sections. This process is repeated until the convergence criteria (tolerance on BISON solve, or number of time steps) is reached. Models have been constructed and run for both uranium oxide and uranium silicide fuels. These models demonstrate a clear difference in power shape that is not accounted for in a

  12. Optically coupled semiconductor device

    Energy Technology Data Exchange (ETDEWEB)

    Kumagaya, Naoki


    This invention concerns an optically coupled semiconductor device using the light as input signal and a MOS transistor for the output side in order to control on-off of the output side by the input signal which is insulated from the output. Concerning this sort of element, when a MOS transistor and a load resistance are planned to be accumulated on the same chip, a resistor and control of impurity concentration of the channel, etc. become necessary despite that the only formation of a simple P-N junction is enough, for a solar cell, hence cost reduction thereof cannot be done. In order to remove this defect, this invention offers an optically coupled semiconductor device featuring that two solar cells are connected in reverse parallel between the gate sources of the output MOS transistors and an operational light emitting element is individually set facing a respective solar cell. 4 figs.

  13. Magnetic coupling device (United States)

    Nance, Thomas A [Aiken, SC


    A quick connect/disconnect coupling apparatus is provided in which a base member is engaged by a locking housing through a series of interengagement pins. The pins maintain the shaft in a locked position. Upon exposure to an appropriately positioned magnetic field, pins are removed a sufficient distance such that the shaft may be withdrawn from the locking housing. The ability to lock and unlock the connector assembly requires no additional tools or parts apart from a magnetic key.

  14. Coupling of Hidden Sector


    Królikowski, Wojciech


    A hypothetic Hidden Sector of the Universe, consisting of sterile fer\\-mions (``sterinos'') and sterile mediating bosons (``sterons'') of mass dimension 1 (not 2!) --- the last described by an antisymmetric tensor field --- requires to exist also a scalar isovector and scalar isoscalar in order to be able to construct electroweak invariant coupling (before spontaneously breaking its symmetry). The introduced scalar isoscalar might be a resonant source for the diphoton excess of 750 GeV, sugge...

  15. Quick torque coupling (United States)

    Luft, Peter A [El Cerrito, CA


    A coupling for mechanically connecting modular tubular struts of a positioning apparatus or space frame, comprising a pair of toothed rings (10, 12) attached to separate strut members (16), the teeth (18, 20) of the primary rings (10, 12) mechanically interlocking in both an axial and circumferential manner, and a third part comprising a sliding, toothed collar (14) the teeth (22) of which interlock the teeth (18, 20) of the primary rings (10, 12), preventing them from disengaging, and completely locking the assembly together. A secondary mechanism provides a nesting force for the collar, and/or retains it. The coupling is self-contained and requires no external tools for installation, and can be assembled with gloved hands in demanding environments. No gauging or measured torque is required for assembly. The assembly can easily be visually inspected to determine a "go" or "no-go" status. The coupling is compact and relatively light-weight. Because of it's triply interlocking teeth, the connection is rigid. The connection does not primarily rely on clamps, springs or friction based fasteners, and is therefore reliable in fail-safe applications.

  16. Coupling and decoupling

    International Nuclear Information System (INIS)

    Ravenal, E.C.


    This paper reports on the prospects of coupling and decoupling for extended deterrence. Thirty-eight years after the foundation of NATO, the defence of Western Europe still rests on the proposition that an American president will invite the destruction of US cities and the incineration of 100 million of its citizens to repel a Soviet incursion or resist a Soviet ultimatum in Western Europe. On its face, America's war plan---never denied by any president from Truman to Reagan, or by any Secretary of State from George Marshall to George Shultz---is the first use of nuclear weapons, if necessary, to defend Europe. Thus America threatens to turn local defeat into global holocaust. But under the surface, America's nuclear commitment to Europe is not so sure. The word that encapsulates this problem is coupling. Not the title of an Updike novel or an anthropological treatise by Margaret Mead, coupling is a term of art used by strategic analysts to connote the integrity of the chain of escalation, from conventional war in Europe, to theatre nuclear weapons, to the final use of America's ultimate strategic weapon

  17. Coupled-resonator optical waveguides

    DEFF Research Database (Denmark)

    Raza, Søren; Grgic, Jure; Pedersen, Jesper Goor


    Coupled-resonator optical waveguides hold potential for slow-light propagation of optical pulses. The dispersion properties may adequately be analyzed within the framework of coupled-mode theory. We extend the standard coupled-mode theory for such structures to also include complex-valued paramet......Coupled-resonator optical waveguides hold potential for slow-light propagation of optical pulses. The dispersion properties may adequately be analyzed within the framework of coupled-mode theory. We extend the standard coupled-mode theory for such structures to also include complex...

  18. Effect of Group Cognitive Behavioral Couples Therapy on Couple Burnout and Divorce Tendency in Couples

    Directory of Open Access Journals (Sweden)

    M Mohammadi


    Full Text Available Background & aim: Couple burnout is one of the phenomena which involve many couples, it is among the main causes of emotional divorce, and without proper management and treatment, and it can lay the ground for formal divorce among couples. Cognitive behavioral couple therapy is one of the existing approaches in the couple therapy field, the efficiency of which has been established for resolving many marital problems. The present study was designed by the aim of investigating the effect of group cognitive behavioral couple therapy on couple burnout and divorce tendency in couples.   Methods: The present research was of applied research type. The research method was semi-empirical with a pretest-posttest with control group design. The research population included all the couples with marital conflict and problems who, after a recall announcement of the researcher, visited the counseling and psychological services center located in Gorgan city in 2014. By using the available sampling method, 20 couples were selected among the volunteer and qualified couples for the research, and they were assigned into experiment and control groups (10 couples per group by random assignment. In the present research, the Pines burnout questionnaire (1996 and divorce tendency scale of Rouswelt, Johnson, and Mouro (1986 were used for gathering the data. After taking the pretest, the group cognitive behavioral couple therapy based on the couple therapy model of Baucom  and colleagues (2008 was held in 10 2-hour weekly sessions for the experiment group couples, while the control group couples received no intervention. The data were analyzed through descriptive statistics method and multivariate covariance analysis (MANCOVA in SPSS v.20. Results: The multivariate covariance analysis results for couple burnout (F= 28.80 and divorce tendency (F= 51.25 suggested that there was a significant difference between the couples of experiment and control groups (P< 0

  19. Loosely coupled class families

    DEFF Research Database (Denmark)

    Ernst, Erik


    are expressed using virtual classes seem to be very tightly coupled internally. While clients have achieved the freedom to dynamically use one or the other family, it seems that any given family contains a xed set of classes and we will need to create an entire family of its own just in order to replace one...... of the members with another class. This paper shows how to express class families in such a manner that the classes in these families can be used in many dierent combinations, still enabling family polymorphism and ensuring type safety....

  20. LIA longitudinal coupling impedance

    International Nuclear Information System (INIS)

    Faltens, A.


    The beam generated fields enter into the problems of waveform generation and longitudinal stability. In the former, provision must be made for the longitudinally defocusing forces due to the space charge and the beam loading effects on the accelerating voltage due to the current of a presumably known bunch. In the latter, the concern is for the growth of unintentional perturbations to unacceptably large values through the interaction of the charge and current fluctuations with the rest of the beam and the surrounding structures. These beam generated electric fields may be related to the beam current through a coupling impedance

  1. Nonminimally coupled hybrid inflation

    International Nuclear Information System (INIS)

    Koh, Seoktae; Minamitsuji, Masato


    We discuss the hybrid inflation model where the inflaton field is nonminimally coupled to gravity. In the Jordan frame, the potential contains φ 4 term as well as terms in the original hybrid inflation model. In our model, inflation can be classified into the type (I) and the type (II). In the type (I), inflation is terminated by the tachyonic instability of the waterfall field, while in the type (II) by the violation of slow-roll conditions. In our model, the reheating takes place only at the true minimum and even in the case (II) finally the tachyonic instability occurs after the termination of inflation. For a negative nonminimal coupling, inflation takes place in the vacuum-dominated region, in the large field region, or near the local minimum/maximum. Inflation in the vacuum-dominated region becomes either the type (I) or (II), resulting in a blue or red spectrum of the curvature perturbations, respectively. Inflation around the local maximum can be either the type (I) or the type (II), which results in the red spectrum of the curvature perturbations, while around the local minimum it must be the type (I), which results in the blue spectrum. In the large field region, to terminate inflation, potential in the Einstein frame must be positively tilted, always resulting in the red spectrum. We then numerically solve the equations of motion to investigate the whole dynamics of inflaton and confirm that the spectrum of curvature perturbations changes from red to blue ones as scales become smaller.

  2. Strong Coupling Holography

    CERN Document Server

    Dvali, Gia


    We show that whenever a 4-dimensional theory with N particle species emerges as a consistent low energy description of a 3-brane embedded in an asymptotically-flat (4+d)-dimensional space, the holographic scale of high-dimensional gravity sets the strong coupling scale of the 4D theory. This connection persists in the limit in which gravity can be consistently decoupled. We demonstrate this effect for orbifold planes, as well as for the solitonic branes and string theoretic D-branes. In all cases the emergence of a 4D strong coupling scale from bulk holography is a persistent phenomenon. The effect turns out to be insensitive even to such extreme deformations of the brane action that seemingly shield 4D theory from the bulk gravity effects. A well understood example of such deformation is given by large 4D Einstein term in the 3-brane action, which is known to suppress the strength of 5D gravity at short distances and change the 5D Newton's law into the four-dimensional one. Nevertheless, we observe that the ...

  3. How couples choose vasectomy. (United States)

    Schehl, M


    A study conducted by AVSC International between 1992 and 1995 found that couples around the world go through a highly similar decision-making process when they choose vasectomy as their family planning methods. Study findings are based upon in-depth, qualitative interviews with couples using vasectomy in Bangladesh, Mexico, Kenya, and Rwanda, where the prevalence of vasectomy is relatively low, and Sri Lanka and the US, where it is relatively high. 218 separate interviews were conducted with male and female partners. Concerns about the woman's health were cited by respondents in each country as reasons to cease childbearing and to opt for vasectomy as the means to achieving that end. Also, almost all respondents mentioned varying degrees of financial hardship as contributing to their decision to end childbearing. These findings highlight the concept of partnership in relationships and family planning decision-making, and demonstrate the importance of going beyond traditional stereotypes about gender roles in decision-making. Social influences and the potential risks of using other forms of contraception also contributed to the choice of using vasectomy. The decision-making process and lessons learned are discussed.

  4. Magnetically Coupled Calorimeters (United States)

    Bandler, Simon


    Calorimeters that utilize the temperature sensitivity of magnetism have been under development for over 20 years. They have targeted a variety of different applications that require very high resolution spectroscopy. I will describe the properties of this sensor technology that distinguish it from other low temperature detectors and emphasize the types of application to which they appear best suited. I will review what has been learned so far about the best materials, geometries, and read-out amplifiers and our understanding of the measured performance and theoretical limits. I will introduce some of the applications where magnetic calorimeters are being used and also where they are in development for future experiments. So far, most magnetic calorimeter research has concentrated on the use of paramagnets to provide temperature sensitivity; recent studies have also focused on magnetically coupled calorimeters that utilize the diamagnetic response of superconductors. I will present some of the highlights of this research, and contrast the properties of the two magnetically coupled calorimeter types.

  5. Using the Model Coupling Toolkit to couple earth system models (United States)

    Warner, J.C.; Perlin, N.; Skyllingstad, E.D.


    Continued advances in computational resources are providing the opportunity to operate more sophisticated numerical models. Additionally, there is an increasing demand for multidisciplinary studies that include interactions between different physical processes. Therefore there is a strong desire to develop coupled modeling systems that utilize existing models and allow efficient data exchange and model control. The basic system would entail model "1" running on "M" processors and model "2" running on "N" processors, with efficient exchange of model fields at predetermined synchronization intervals. Here we demonstrate two coupled systems: the coupling of the ocean circulation model Regional Ocean Modeling System (ROMS) to the surface wave model Simulating WAves Nearshore (SWAN), and the coupling of ROMS to the atmospheric model Coupled Ocean Atmosphere Prediction System (COAMPS). Both coupled systems use the Model Coupling Toolkit (MCT) as a mechanism for operation control and inter-model distributed memory transfer of model variables. In this paper we describe requirements and other options for model coupling, explain the MCT library, ROMS, SWAN and COAMPS models, methods for grid decomposition and sparse matrix interpolation, and provide an example from each coupled system. Methods presented in this paper are clearly applicable for coupling of other types of models. ?? 2008 Elsevier Ltd. All rights reserved.

  6. Fluid structure coupling algorithm

    International Nuclear Information System (INIS)

    McMaster, W.H.; Gong, E.Y.; Landram, C.S.; Quinones, D.F.


    A fluid-structure-interaction algorithm has been developed and incorporated into the two-dimensional code PELE-IC. This code combines an Eulerian incompressible fluid algorithm with a Lagrangian finite element shell algorithm and incorporates the treatment of complex free surfaces. The fluid structure and coupling algorithms have been verified by the calculation of solved problems from the literature and from air and steam blowdown experiments. The code has been used to calculate loads and structural response from air blowdown and the oscillatory condensation of steam bubbles in water suppression pools typical of boiling water reactors. The techniques developed have been extended to three dimensions and implemented in the computer code PELE-3D


    KAUST Repository



    We consider a model system for the collective behavior of oxygen-driven swimming bacteria in an aquatic fluid. In certain parameter regimes, such suspensions of bacteria feature large-scale convection patterns as a result of the hydrodynamic interaction between bacteria. The presented model consist of a parabolicparabolic chemotaxis system for the oxygen concentration and the bacteria density coupled to an incompressible Stokes equation for the fluid driven by a gravitational force of the heavier bacteria. We show local existence of weak solutions in a bounded domain in d, d = 2, 3 with no-flux boundary condition and in 2 in the case of inhomogeneous Dirichlet conditions for the oxygen. © 2010 World Scientific Publishing Company.

  8. Coupled wave sensor technology

    International Nuclear Information System (INIS)

    Maki, M.C.


    Buried line guided radar sensors have been used successfully for a number of years to provide perimeter security for high value resources. This paper introduces a new complementary sensor advancement at Computing Devices termed 'coupled wave device technology' (CWD). It provides many of the inherent advantages of leakey cable sensors, such as terrain-following and the ability to discriminate between humans and small animals. It also is able to provide a high or wide detection zone, and allows the sensor to be mounted aerially and adjacent to a wall or fence. Several alternative sensors have been developed which include a single-line sensor, a dual-line hybrid sensor that combines the elements of ported coax and CWD technology, and a rapid-deployment portable sensor for temporary or mobile applications. A description of the technology, the sensors, and their characteristics is provided

  9. Structural Coupling and Translation

    DEFF Research Database (Denmark)

    Tække, Jesper

    formations. After presenting the two theories the article put forward Twitter as an example making it possible to compare the two theories. Hereby the article also provides two analysis of how Twitter changes the communication milieu of modern society. In systems theory media can be seen as the mechanisms...... and translations the social medium of Twitter opens for. The second, but most prioritized, aim of the paper is to present, compare and discuss the two theories: How do they understand what becomes visible in their different optics, which observations become possible in the one or the other – and is it possible...... creating networks consisting in both humans and non-humans. Then the two appearing frameworks are used to observe Twitter and discuss which structural couplings and translations are made possible by this medium. In the end of the paper the two theories are discussed and compared....

  10. Gay and lesbian couples in Italy: comparisons with heterosexual couples. (United States)

    Antonelli, Paolo; Dèttore, Davide; Lasagni, Irene; Snyder, Douglas K; Balderrama-Durbin, Christina


    Assessing couple relationships across diverse languages and cultures has important implications for both clinical intervention and prevention. This is especially true for nontraditional relationships potentially subject to various expressions of negative societal evaluation or bias. Few empirically validated measures of relationship functioning have been developed for cross-cultural applications, and none have been examined for their psychometric sufficiency for evaluating same-sex couples across different languages and cultures. The current study examined the psychometric properties of an Italian translation of the Marital Satisfaction Inventory - Revised (MSI-R), a 150-item 13-scale measure of couple relationship functioning, for its use in assessing the intimate relationships of gay and lesbian couples in Italy. Results for these couples were compared to data from heterosexual married and unmarried cohabiting couples from the same geographical region, as well as to previously published data for gay, lesbian, and unmarried heterosexual couples from the United States. Findings suggest that, despite unique societal pressures confronting Italian same-sex couples, these relationships appear resilient and fare well both overall and in specific domains of functioning compared to heterosexual couples both in Italy and the United States. © 2014 Family Process Institute.

  11. Synchronizability of coupled PWL maps

    International Nuclear Information System (INIS)

    Polynikis, A.; Di Bernardo, M.; Hogan, S.J.


    In this paper we discuss the phenomenon of synchronization of chaotic systems in the case of coupled piecewise linear (PWL) continuous and discontinuous one-dimensional maps. We present numerical results for two examples of coupled systems consisting of two PWL maps. We illustrate how the coupled system can achieve synchronization and discuss the nature of the bifurcation that occurs at a critical value of the coupling strength. We then determine this critical coupling using linear stability analysis. We discuss the effects of variation of the parameters of the PWL maps on the critical coupling and present different bifurcation scenarios obtained for different sets of values of these parameters. Finally, we discuss an extension of our work to the synchronizability of networks consisting of two or more PWL maps. We show how the synchronizability of a network of PWL maps can be improved by tuning the map parameters.

  12. ESPC Coupled Global Prediction System (United States)


    through an improvement to the sea ice albedo . Fig. 3: 2-m Temperature bias (deg C) of 120-h forecasts for the month of May 2014 for the Arctic...forecast system (NAVGEM) and ocean- sea ice forecast system (HYCOM/CICE) have never been coupled at high resolution. The coupled processes will be...winds and currents across the interface. The sea - ice component of this project requires modification of CICE versions 4 and 5 to run in the coupled

  13. Cosmological tests of coupled Galileons

    International Nuclear Information System (INIS)

    Brax, Philippe; Burrage, Clare; Davis, Anne-Christine; Gubitosi, Giulia


    We investigate the cosmological properties of Galileon models which admit Minkowski space as a stable solution in vacuum. This is motivated by stable, positive tension brane world constructions that give rise to Galileons. We include both conformal and disformal couplings to matter and focus on constraints on the theory that arise because of these couplings. The disformal coupling to baryonic matter is extremely constrained by astrophysical and particle physics effects. The disformal coupling to photons induces a cosmological variation of the speed of light and therefore distorsions of the Cosmic Microwave Background spectrum which are known to be very small. The conformal coupling to baryons leads to a variation of particle masses since Big Bang Nucleosynthesis which is also tightly constrained. We consider the background cosmology of Galileon models coupled to Cold Dark Matter (CDM), photons and baryons and impose that the speed of light and particle masses respect the observational bounds on cosmological time scales. We find that requiring that the equation of state for the Galileon models must be close to -1 now restricts severely their parameter space and can only be achieved with a combination of the conformal and disformal couplings. This leads to large variations of particle masses and the speed of light which are not compatible with observations. As a result, we find that cosmological Galileon models are viable dark energy theories coupled to dark matter but their couplings, both disformal and conformal, to baryons and photons must be heavily suppressed making them only sensitive to CDM

  14. Instabilities in strongly coupled plasmas

    CERN Document Server

    Kalman, G J


    The conventional Vlasov treatment of beam-plasma instabilities is inappropriate when the plasma is strongly coupled. In the strongly coupled liquid state, the strong correlations between the dust grains fundamentally affect the conditions for instability. In the crystalline state, the inherent anisotropy couples the longitudinal and transverse polarizations, and results in unstable excitations in both polarizations. We summarize analyses of resonant and non-resonant, as well as resistive instabilities. We consider both ion-dust streaming and dust beam-plasma instabilities. Strong coupling, in general, leads to an enhancement of the growth rates. In the crystalline phase, a resonant transverse instability can be excited.

  15. Spin reorientation via antiferromagnetic coupling

    Energy Technology Data Exchange (ETDEWEB)

    Ranjbar, M., E-mail: [Data Storage Institute, A-STAR (Agency for Science, Technology and Research), 5, Engineering Drive 1, Singapore 117608 (Singapore); Department of Physics, University of Gothenburg, 412 96 Gothenburg (Sweden); Sbiaa, R. [Data Storage Institute, A-STAR (Agency for Science, Technology and Research), 5, Engineering Drive 1, Singapore 117608 (Singapore); Department of Physics, Sultan Qaboos University, P.O. Box 36, PC 123, Muscat (Oman); Dumas, R. K. [Department of Physics, University of Gothenburg, 412 96 Gothenburg (Sweden); Åkerman, J. [Department of Physics, University of Gothenburg, 412 96 Gothenburg (Sweden); Materials Physics, School of ICT, Royal Institute of Technology (KTH), 164 40 Kista (Sweden); Piramanayagam, S. N. [Data Storage Institute, A-STAR (Agency for Science, Technology and Research), 5, Engineering Drive 1, Singapore 117608 (Singapore)


    Spin reorientation in antiferromagnetically coupled (AFC) Co/Pd multilayers, wherein the thickness of the constituent Co layers was varied, was studied. AFC-Co/Pd multilayers were observed to have perpendicular magnetic anisotropy even for a Co sublayer thickness of 1 nm, much larger than what is usually observed in systems without antiferromagnetic coupling. When similar multilayer structures were prepared without antiferromagnetic coupling, this effect was not observed. The results indicate that the additional anisotropy energy contribution arising from the antiferromagnetic coupling, which is estimated to be around 6 × 10{sup 6} ergs/cm{sup 3}, induces the spin-reorientation.

  16. Performance assessment of coupled processes

    International Nuclear Information System (INIS)

    Pigford, T.H.


    The author considers all processes to be coupled. For example, a waste package heats the surrounding rock and its pore water, creating gradients in density and pressure that result in increased water flow. That process can be described as coupled, in that the flow is a consequence of heating. In a narrower sense, one speaks also of the more weakly coupled transport processes, expressed by the Onsager reciprocal relations, that state that a transport current, i.e., flux, of heat is accompanied by a small transport current of material, as evidenced in isotope separation by thermal diffusion, the Thompson effect in thermoelectricity, etc. This paper presents a performance assessment of coupled processes

  17. Stirring Strongly Coupled Plasma

    CERN Document Server

    Fadafan, Kazem Bitaghsir; Rajagopal, Krishna; Wiedemann, Urs Achim


    We determine the energy it takes to move a test quark along a circle of radius L with angular frequency w through the strongly coupled plasma of N=4 supersymmetric Yang-Mills (SYM) theory. We find that for most values of L and w the energy deposited by stirring the plasma in this way is governed either by the drag force acting on a test quark moving through the plasma in a straight line with speed v=Lw or by the energy radiated by a quark in circular motion in the absence of any plasma, whichever is larger. There is a continuous crossover from the drag-dominated regime to the radiation-dominated regime. In the crossover regime we find evidence for significant destructive interference between energy loss due to drag and that due to radiation as if in vacuum. The rotating quark thus serves as a model system in which the relative strength of, and interplay between, two different mechanisms of parton energy loss is accessible via a controlled classical gravity calculation. We close by speculating on the implicati...

  18. Coupling detrended fluctuation analysis for analyzing coupled nonstationary signals (United States)

    Hedayatifar, L.; Vahabi, M.; Jafari, G. R.


    When many variables are coupled to each other, a single case study could not give us thorough and precise information. When these time series are stationary, different methods of random matrix analysis and complex networks can be used. But, in nonstationary cases, the multifractal-detrended-cross-correlation-analysis (MF-DXA) method was introduced for just two coupled time series. In this article, we have extended the MF-DXA to the method of coupling detrended fluctuation analysis (CDFA) for the case when more than two series are correlated to each other. Here, we have calculated the multifractal properties of the coupled time series, and by comparing CDFA results of the original series with those of the shuffled and surrogate series, we can estimate the source of multifractality and the extent to which our series are coupled to each other. We illustrate the method by selected examples from air pollution and foreign exchange rates.

  19. Coupled assimilation for an intermediated coupled ENSO prediction model (United States)

    Zheng, Fei; Zhu, Jiang


    The value of coupled assimilation is discussed using an intermediate coupled model in which the wind stress is the only atmospheric state which is slavery to model sea surface temperature (SST). In the coupled assimilation analysis, based on the coupled wind-ocean state covariance calculated from the coupled state ensemble, the ocean state is adjusted by assimilating wind data using the ensemble Kalman filter. As revealed by a series of assimilation experiments using simulated observations, the coupled assimilation of wind observations yields better results than the assimilation of SST observations. Specifically, the coupled assimilation of wind observations can help to improve the accuracy of the surface and subsurface currents because the correlation between the wind and ocean currents is stronger than that between SST and ocean currents in the equatorial Pacific. Thus, the coupled assimilation of wind data can decrease the initial condition errors in the surface/subsurface currents that can significantly contribute to SST forecast errors. The value of the coupled assimilation of wind observations is further demonstrated by comparing the prediction skills of three 12-year (1997-2008) hindcast experiments initialized by the ocean-only assimilation scheme that assimilates SST observations, the coupled assimilation scheme that assimilates wind observations, and a nudging scheme that nudges the observed wind stress data, respectively. The prediction skills of two assimilation schemes are significantly better than those of the nudging scheme. The prediction skills of assimilating wind observations are better than assimilating SST observations. Assimilating wind observations for the 2007/2008 La Niña event triggers better predictions, while assimilating SST observations fails to provide an early warning for that event.

  20. Belpex and trilateral market coupling

    International Nuclear Information System (INIS)


    This document describes the operation of Belpex, the Belgian power transmission spot market, and its linking with the French (Powernext) and Dutch (APX) auction-style day-ahead spot markets. A last part deals with the extension of this trilateral market to other European countries. Content: Belpex day-ahead market (DAM) (Goals of the DAM: Provide consumers with a wider choice of electrical energy sources, Enable the ARP's to optimize their portfolio in terms of imbalance costs, Reduce trade and credit risks for market players compared with the risks involved in concluding bilateral contracts, Provide economic players with a transparent price benchmark, Stimulate the opening of the electricity market); Market model Product (description, Contracts, Collateral calculation, From 12 January to launch date Corporate and Legal Aspects, Next developments); Trilateral Market Coupling (What is market coupling and what are the benefits?, Implementation of trilateral market coupling ('TLC') in France/Belgium/Netherlands, From Trilateral to Multilateral, Implementation of Trilateral Market Coupling (TLC) in France/Belgium/Netherlands, Decentralized market coupling mechanism, influence of import and export on area prices); Decentralized market coupling (2 countries Situations: unconstrained/constrained, Decentralized market coupling: 3 countries, High Level Properties of Market Coupling, Maximize flow until prices across link converge (or ATC limit reached), Power flows from low price area to high price area, Implementing a decentralized technical approach, Market Coupling Daily Process, Impact on Existing Exchange Arrangements, Implementing a decentralized contractual approach, TLC Project Process); From Trilateral to Multilateral (Geographic extensions, Towards an Open and Multilateral Market Coupling, Management of Interconnection Capacities, Interconnection Capacities: current situation, TSO Roles and Responsibilities in the TLC, Other Import/Export products on the

  1. Coupling between minimum scattering antennas

    DEFF Research Database (Denmark)

    Andersen, J.; Lessow, H; Schjær-Jacobsen, Hans


    Coupling between minimum scattering antennas (MSA's) is investigated by the coupling theory developed by Wasylkiwskyj and Kahn. Only rotationally symmetric power patterns are considered, and graphs of relative mutual impedance are presented as a function of distance and pattern parameters. Crossed...

  2. Linear analysis of coupled lattices

    Directory of Open Access Journals (Sweden)

    D. Sagan


    Full Text Available A formalism for describing the coupled two-dimensional motion of high energy particle beams in a storage ring is developed and extended to circumstances where the coupling is very strong, such as for the Möbius twist accelerator.

  3. Development of Side Coupled Cavities

    International Nuclear Information System (INIS)

    Conto, J.M. de; Carretta, J.M.; Gomez-Martinez, Y.; Micoud, R.


    Side coupled Cavities are good candidates for proton accelerations in the 90-180 MeV range, as it has been first proposed for the CERN LINAC4 project. A side coupled Linac is made of a lump chain of resonant cavities, alternatively accelerating and coupling. A side coupled cavity has been designed in a CERN-LPSC collaboration to achieve LINAC4 requirements. After RF studies, a complete thermal study has been done, showing that 10-15% is the absolute maximum duty-cycle achievable by such a cavity. Error studies have been developed. They have shown that a tuning ring is mandatory and that a K equals 3% coupling factor is a good choice. A prototype has been built and each cell has been measured and tuned. A simple and accurate method has been used to get both the resonant frequency and the coupling factor, with a movable tuner and a linear fit. A similar method has been used to get the second order coupling factor. A large dispersion is observed on K. This is mainly due to the shape of the coupling apertures, which are very sensitive to mechanical errors. A future and realistic design must be very careful to guarantee a constant aperture (the important parameter is more the dispersion of k than its exact value). Finally, we analyse how to tune the cavity. This has to checked carefully and probably improved or corrected. Results are expected for mid-2008

  4. Older Couple Relationships and Loneliness

    NARCIS (Netherlands)

    de Jong Gierveld, J.; Broese van Groenou, M.; Bookwala, Jamila


    The couple relationship is a major factor in alleviating loneliness. Midlife and older adults without a couple relationship, especially after widowhood or divorce, are at serious risk of loneliness. Outcomes of empirical research, both dating back to the former century (Lopata, 1980, 1996), as well

  5. Slot-Coupled Barbel Antenna

    DEFF Research Database (Denmark)

    Jørgensen, Kasper Lüthje; Jakobsen, Kaj Bjarne


    A novel slot-coupled barbel antenna is designed and analyzed. A sensitivity analysis performed in order to improve the bandwidth, while the center frequency is kept constant.......A novel slot-coupled barbel antenna is designed and analyzed. A sensitivity analysis performed in order to improve the bandwidth, while the center frequency is kept constant....

  6. Anisotropic inflation with derivative couplings (United States)

    Holland, Jonathan; Kanno, Sugumi; Zavala, Ivonne


    We study anisotropic power-law inflationary solutions when the inflaton and its derivative couple to a vector field. This type of coupling is motivated by D-brane inflationary models, in which the inflaton, and a vector field living on the D-brane, couple disformally (derivatively). We start by studying a phenomenological model where we show the existence of anisotropic solutions and demonstrate their stability via a dynamical system analysis. Compared to the case without a derivative coupling, the anisotropy is reduced and thus can be made consistent with current limits, while the value of the slow-roll parameter remains almost unchanged. We also discuss solutions for more general cases, including D-brane-like couplings.

  7. Characteristics of purple nonsulfur bacteria grown under Stevia residue extractions. (United States)

    Xu, J; Feng, Y; Wang, Y; Lin, X


    As a consequence of the large-scale cultivation of Stevia plants, releases of plant residues, the byproduct after sweetener extraction, to the environment are inevitable. Stevia residue and its effluent after batching up contain large amounts of organic matters with small molecular weight, which therefore are a potential pollution source. Meanwhile, they are favourite substrates for micro-organism growths. This investigation was aimed to utilize the simulated effluent of Stevia residue to enrich the representative purple nonsulfur bacterium (PNSB), Rhodopseudomonas palustris (Rps. palustris), which has important economic values. The growth profile and quality of Rps. palustris were characterized by spectrophotometry, compared to those grown in common PNSB mineral synthetic medium. Our results revealed that the simulated effluent of Stevia residue not only stimulated Rps. palustris growth to a greater extent, but also increased its physiologically active cytochrome concentrations and excreted indole-3-acetic acid (IAA) content. This variation in phenotype of Rps. palustris could result from the shift in its genotype, further revealed by the repetitive sequence-based PCR (rep-PCR) fingerprinting analysis. Our results showed that the effluent of Stevia residue was a promising substrate for microbial growth. © 2013 The Society for Applied Microbiology.

  8. Within tree variation of lignin, extractives, and microfibril angle coupled with the theoretical and near infrared modeling of microfibril angle (United States)

    Brian K. Via; chi L. So; Leslie H. Groom; Todd F. Shupe; michael Stine; Jan. Wikaira


    A theoretical model was built predicting the relationship between microfibril angle and lignin content at the Angstrom (A) level. Both theoretical and statistical examination of experimental data supports a square root transformation of lignin to predict microfibril angle. The experimental material used came from 10 longleaf pine (Pinus palustris)...

  9. Couple Discord and Depression in Couples during Couple Therapy and in Depressed Individuals during Depression Treatment (United States)

    Atkins, David C.; Dimidjian, Sona; Bedics, Jamie D.; Christensen, Andrew


    The association between depression and relationship distress as well as the impact of treatment for the one on the other was examined across 2 treatment-seeking samples: individuals seeking treatment for depression (N = 120) and couples seeking marital therapy (N = 134 couples). Although there was a baseline association between depression and…

  10. Improved fluid-structure coupling

    International Nuclear Information System (INIS)

    McMaster, W.H.; Gong, E.Y.; Landram, C.S.


    In the computer code PELE-IC, an incompressible Eulerian hydrodynamic algorithm was coupled to a Lagrangian finite element shell algorithm for the analysis of pressure suppression in boiling water reactors. This effort also required the development of a free surface algorithm capable of handling expanding gas bubbles. These algorithms have been improved to strengthen the coupling and to add the capability for following the more complex free surfaces resulting from steam condensation. These improvements have also permitted more economical 2D calculations and have made it feasible to develop a 3D version. A compressible option using the acoustic approximation has also been added, furthering the usefulness of the code. The coupling improvements were made in three areas which are identified as (1) preferential coupling, (2) merged cell coupling, and (3) free surface-structure coupling, and are described. These algorithms have been additionally implemented in a three dimensional version of the code called PELE3D. This version has a free surface capability to follow expanding and contracting bubbles and is coupled to a curved rigid surface

  11. Gestural coupling and social cognition

    DEFF Research Database (Denmark)

    Michael, John; Krueger, Joel William


    Social cognition researchers have become increasingly interested in the ways that behavioral, physiological, and neural coupling facilitate social interaction and interpersonal understanding. We distinguish two ways of conceptualizing the role of such coupling processes in social cognition: strong...... an essential enabling feature for social interaction and interpersonal understanding more generally and thus ought to exhibit severe deficits in these areas. We challenge SI's prediction and show how MS cases offer compelling reasons for instead adopting MI's pluralistic model of social interaction...... and interpersonal understanding. We conclude that investigations of coupling processes within social interaction should inform rather than marginalize or eliminate investigation of higher-level individual cognition...

  12. Overprotection in couples with aphasia. (United States)

    Croteau, C; Le Dorze, G


    The study aimed to measure the perception of overprotection in 21 couples living with aphasia, relative to controls. The 'Questionnaire on Resources and Stress' assessed the spouses' perception and the 'Overprotection Scale for Adults' measured the perception of persons with aphasia. Husbands of women with aphasia did not differ from husbands of women without aphasia. Wives of men with aphasia reported more overprotection than wives of men without aphasia, even when functional impairment was controlled. The men with aphasia did not report feeling overprotected. No significant relationship was uncovered between the report of overprotection and feeling overprotected in couples with aphasia. Overprotection is present in some couples coping with aphasia.

  13. Anomalous couplings at LEP2

    International Nuclear Information System (INIS)

    Fayolle, D.


    In its second phase, LEP has allowed to study four fermion processes never observed before. Results are presented on the charged triple gauge boson couplings (TGC) from the W-pair, Single W and Single γ production. The anomalous quartic gauge couplings (QGC) are constrained using production of WWγ, νν-barγγ and Z γγ final states. Finally, limits on the neutral anomalous gauge couplings (NGC) using the Z γ and ZZ production processes are also reported. All results are consistent with the Standard Model expectations. (authors)

  14. Spatial coupling in heterogeneous catalysis (United States)

    Yamamoto, S. Y.; Surko, C. M.; Maple, M. B.


    Spatial coupling mechanisms are studied in the heterogeneous catalytic oxidation of carbon monoxide over platinum at atmospheric pressure under oscillatory conditions. Experiments are conducted in a continuous flow reactor, and the reaction rate is monitored using both infrared imaging and thermocouples. The catalysts are in the form of platinum annular thin films on washer-shaped quartz substrates, and they provide highly repeatable oscillatory behavior. Oscillations are typically spatially synchronized with the entire catalyst ``flashing'' on and off uniformly. Spatial coupling is investigated by introducing various barriers which split the annular ring in half. Infrared images show that coupling through the gas phase dominates coupling via the diffusion of CO on the surface or heat diffusion through the substrate. The introduction of a localized heat perturbation to the catalyst surface does not induce a transition in the reaction rate. Thus, it is likely that the primary mode of communication is through the gas-phase diffusion of reactants.

  15. Heterogeneous Dynamics of Coupled Vibrations

    NARCIS (Netherlands)

    Cringus, Dan; Jansen, Thomas I. C.; Pshenichnikov, Maxim S.; Schoenlein, RW; Corkum, P; DeSilvestri, S; Nelson, KA; Riedle, E


    Frequency-dependent dynamics of coupled stretch vibrations of a water molecule are revealed by 2D IR correlation spectroscopy. These are caused by non-Gaussian fluctuations of the environment around the individual OH stretch vibrations.

  16. Coupling spin qubits via superconductors

    DEFF Research Database (Denmark)

    Leijnse, Martin; Flensberg, Karsten


    We show how superconductors can be used to couple, initialize, and read out spatially separated spin qubits. When two single-electron quantum dots are tunnel coupled to the same superconductor, the singlet component of the two-electron state partially leaks into the superconductor via crossed...... Andreev reflection. This induces a gate-controlled singlet-triplet splitting which, with an appropriate superconductor geometry, remains large for dot separations within the superconducting coherence length. Furthermore, we show that when two double-dot singlet-triplet qubits are tunnel coupled...... to a superconductor with finite charging energy, crossed Andreev reflection enables a strong two-qubit coupling over distances much larger than the coherence length....

  17. Cognitive-behavioral couple therapy. (United States)

    Epstein, Norman B; Zheng, Le


    This article describes how cognitive-behavioral couple therapy (CBCT) provides a good fit for intervening with a range of stressors that couples experience from within and outside their relationship. It takes an ecological perspective in which a couple is influenced by multiple systemic levels. We provide an overview of assessment and intervention strategies used to modify negative behavioral interaction patterns, inappropriate or distorted cognitions, and problems with the experience and regulation of emotions. Next, we describe how CBCT can assist couples in coping with stressors involving (a) a partner's psychological disorder (e.g. depression), (b) physical health problems (e.g. cancer), (c) external stressors (e.g. financial strain), and (d) severe relational problems (e.g. partner aggression). Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Common mode and coupled failure

    International Nuclear Information System (INIS)

    Taylor, J.R.


    Based on examples and data from Abnormal Occurence Reports for nuclear reactors, a classification of common mode or coupled failures is given, and some simple statistical models are investigated. (author)

  19. Evaluation of Coupled Precipitator Two

    International Nuclear Information System (INIS)

    Stone, M.E.


    The offline testing of the Coupled Precipitator Two (CP-2) has been completed. The tests were conducted and are documented. The tests were conducted at an offline test rack near the Drain Tube Test Stand facility in 672-T

  20. Belpex and trilateral market coupling

    Energy Technology Data Exchange (ETDEWEB)



    This document describes the operation of Belpex, the Belgian power transmission spot market, and its linking with the French (Powernext) and Dutch (APX) auction-style day-ahead spot markets. A last part deals with the extension of this trilateral market to other European countries. Content: Belpex day-ahead market (DAM) (Goals of the DAM: Provide consumers with a wider choice of electrical energy sources, Enable the ARP's to optimize their portfolio in terms of imbalance costs, Reduce trade and credit risks for market players compared with the risks involved in concluding bilateral contracts, Provide economic players with a transparent price benchmark, Stimulate the opening of the electricity market); Market model Product (description, Contracts, Collateral calculation, From 12 January to launch date Corporate and Legal Aspects, Next developments); Trilateral Market Coupling (What is market coupling and what are the benefits?, Implementation of trilateral market coupling ('TLC') in France/Belgium/Netherlands, From Trilateral to Multilateral, Implementation of Trilateral Market Coupling (TLC) in France/Belgium/Netherlands, Decentralized market coupling mechanism, influence of import and export on area prices); Decentralized market coupling (2 countries Situations: unconstrained/constrained, Decentralized market coupling: 3 countries, High Level Properties of Market Coupling, Maximize flow until prices across link converge (or ATC limit reached), Power flows from low price area to high price area, Implementing a decentralized technical approach, Market Coupling Daily Process, Impact on Existing Exchange Arrangements, Implementing a decentralized contractual approach, TLC Project Process); From Trilateral to Multilateral (Geographic extensions, Towards an Open and Multilateral Market Coupling, Management of Interconnection Capacities, Interconnection Capacities: current situation, TSO Roles and Responsibilities in the TLC, Other Import/Export products

  1. Lens Coupled Quantum Cascade Laser (United States)

    Hu, Qing (Inventor); Lee, Alan Wei Min (Inventor)


    Terahertz quantum cascade (QC) devices are disclosed that can operate, e.g., in a range of about 1 THz to about 10 THz. In some embodiments, QC lasers are disclosed in which an optical element (e.g., a lens) is coupled to an output facet of the laser's active region to enhance coupling of the lasing radiation from the active region to an external environment. In other embodiments, terahertz amplifier and tunable terahertz QC lasers are disclosed.

  2. Marital Dissolution Among Interracial Couples


    Zhang, Yuanting; Van Hook, Jennifer


    Increases in interracial marriage have been interpreted as reflecting reduced social distance among racial and ethnic groups, but little is known about the stability of interracial marriages. Using six panels of Survey of Income and Program Participation (N = 23,139 married couples), we found that interracial marriages are less stable than endogamous marriages, but these findings did not hold up consistently. After controlling for couple characteristics, the risk of divorce or separation amon...

  3. Coupled Acoustic-Mechanical Bandgaps

    DEFF Research Database (Denmark)

    Jensen, Jakob Søndergaard; Kook, Junghwan


    medium and the presence of acoustic resonances. It is demonstrated that corrugation of the plate structure can introduce bending wave bandgaps and bandgaps in the acoustic domain in overlapping and audible frequency ranges. This effect is preserved also when taking the physical coupling between the two...... domains into account. Additionally, the coupling is shown to introduce extra gaps in the band structure due to modal interaction and the appearance of a cut-on frequency for the fundamental acoustic mode....

  4. Development of annular coupled structure

    International Nuclear Information System (INIS)

    Kageyama, T.; Morozumi, Y.; Yoshino, K.; Yamazaki, Y.


    A π/2-mode standing-wave linac of an Annular Coupled Structure (ACS) has been developed for the 1-GeV proton linac of the Japanese Hadron Project (JHP). This ACS has four coupling slots between accelerating and coupling cells in order to overcome difficulties in putting the ACS to practical use. Two prototypes of a four-slot ACS (f = 1296 MHz, β = v/c = 0.8) have been constructed and tested: one with a staggered slot-orientation from cell to cell; and the other with a uniform one. The staggered configuration gives a larger coupling constant and a larger shunt impedance than the uniform one with the same size of coupling slot. Both models have been conditioned up to the design input RF power. The four-slot ACS gives a distortion-free accelerating field around the beam axis, while a Side-Coupled Structure cavity gives an accelerating field mixed with a TE111-like mode. (Author) 7 figs., 2 tabs., 9 refs

  5. Communication and Contraceptive Practices in Adolescent Couples. (United States)

    Polit-O'Hara, Denise; Kahn, Janet R.


    Presents a descriptive analysis of couple communication among stable, sexually active adolescent couples (N=83) and the effect of communication on actual contraceptive practices. Results showed couples with good communication were more likely to practice effective contraception. (BH)

  6. Vibronic coupling density and related concepts

    International Nuclear Information System (INIS)

    Sato, Tohru; Uejima, Motoyuki; Iwahara, Naoya; Haruta, Naoki; Shizu, Katsuyuki; Tanaka, Kazuyoshi


    Vibronic coupling density is derived from a general point of view as a one-electron property density. Related concepts as well as their applications are presented. Linear and nonlinear vibronic coupling density and related concepts, orbital vibronic coupling density, reduced vibronic coupling density, atomic vibronic coupling constant, and effective vibronic coupling density, illustrate the origin of vibronic couplings and enable us to design novel functional molecules or to elucidate chemical reactions. Transition dipole moment density is defined as an example of the one-electron property density. Vibronic coupling density and transition dipole moment density open a way to design light-emitting molecules with high efficiency.

  7. Center vortices at strong couplings and all couplings

    International Nuclear Information System (INIS)

    Greensite, J.


    Motivations for the center vortex theory of confinement are discussed. In particular, it is noted that the abelian dual Meissner effect, which is the signature of dual superconductivity, cannot adequately describe the confining force at large distance scales. A long-range effective action is derived from strong-coupling lattice gauge theory in D=3 dimensions, and it is shown that center vortices emerge as the stable saddlepoints of this action. Thus, in the case of strong couplings, the vortex picture is arrived at analytically. I also respond briefly to a recent criticism regarding maximal center gauge. (author)

  8. Miscarriage experiences of lesbian couples. (United States)

    Wojnar, Danuta


    This was a descriptive phenomenological study of 10 self-identified lesbian couples who had experienced miscarriage in the context of a committed relationship. Analysis of individual and joint open-ended interviews revealed that the experience of miscarriage for lesbian couples must be viewed from the perspective of the difficulties surrounding conception as well as the actual pregnancy loss. The overarching theme, "We are not in control," captures the struggles lesbian couples faced in conceiving their pregnancies and the sense of loss that accompanied miscarrying. These experiences constituted two sub-themes: "We work so hard to get a baby" and "It hurts so bad: The sorrow of miscarriage." Our results indicate that the experience of miscarriage is compounded by the complexities of planning and achieving pregnancy. Practitioners need to be aware of the unique perspectives lesbian couples have on pregnancy and miscarriage and remain sensitive to their unique needs. Findings may serve as an intervention framework for nurse midwives and others caring for lesbian couples after miscarriage.

  9. Systemic couple therapy for dysthymia. (United States)

    Montesano, Adrián; Feixas, Guillem; Muñoz, Dámaris; Compañ, Victoria


    We examined the effect of Systemic Couple Therapy on a patient diagnosed with dysthymic disorder and her partner. Marge and Peter, a middle-aged married couple, showed significant and meaningful changes in their pattern of interaction over the course of the therapy and, by the end of it, Marge no longer met the diagnostic criteria for dysthymic disorder. Her scores on the Structured Clinical Interview for DSM-IV Axis I Disorders (SCID-I) and Beck Depression Inventory, Second Edition (BDI-II) were in the clinical range before treatment and in the nonclinical one at the end of therapy. Although scores on Dyadic Adjustment Scale showed different patterns, both members reported significant improvement. The analysis of change in the alliance-related behaviors throughout the process concurred with change in couple's pattern of interaction. Treatment effects were maintained at 12-month follow-up. Highlights in the therapy process showed the importance of relational mechanisms of change, such as broadening the therapeutic focus into the couple's pattern of interaction, reducing expressed emotion and resentment, as well as increasing positive exchanges. The results of this evidence-based case study should prompt further investigation of couple therapy for dysthymia disorder. Randomized clinical trial design is needed to reach an evidence-based treatment status. (c) 2014 APA, all rights reserved.

  10. Matter couplings in supergravity theories

    International Nuclear Information System (INIS)

    Bagger, J.A.


    The N = 1 supersymmetric nonlinear sigma model is coupled to supergravity. The results are expressed in the language of Kahler geometry. Topological considerations constrain the scalar fields to lie on a Kahler manifold of restricted type, or a Hodge manifold. For topologically nontrivial manifolds, this leads to the quantization of Newton's constant in terms of the scalar self-coupling. The isometries of the N = 1 model are gauged. This gives a geometrical picture of what might be called the gauge invariant supersymmetric nonlinear sigma model. It also provides a new interpretation of the Fayet-Iliopoulos D-term. The gauge invariant supersymmetric nonlinear sigma model is coupled to N = 1 supergravity. This leads to a deeper understanding of the connections between supergravity, R-invariance and the Fayet-Iliopoulos D-term. It also provides a foundation for phenomenological studies of supergravity theories. Finally, the N = 2 supersymmetric nonlinear sigma model is coupled to supergravity. The scalar fields are found to lie on a negatively curved quaternionic manifold. This implies that matter self-couplings that are allowed in N = 2 supersymmetry are forbidden in N = 2 supergravity, and vice versa

  11. String dynamics at strong coupling

    International Nuclear Information System (INIS)

    Hull, C.M.


    The dynamics of superstring, supergravity and M-theories and their compactifications are probed by studying the various perturbation theories that emerge in the strong and weak-coupling limits for various directions in coupling constant space. The results support the picture of an underlying non-perturbative theory that, when expanded perturbatively in different coupling constants, gives different perturbation theories, which can be perturbative superstring theories or superparticle theories. The p-brane spectrum is considered in detail and a criterion found to establish which p-branes govern the strong-coupling dynamics. In many cases there are competing conjectures in the literature, and this analysis decides between them. In other cases, new results are found. The chiral 6-dimensional theory resulting from compactifying the type IIB string on K 3 is studied in detail and it is found that certain strong-coupling limits appear to give new theories, some of which hint at the possibility of a 12-dimensional origin. (orig.)

  12. Trilateral market coupling. Algorithm appendix

    International Nuclear Information System (INIS)


    Market Coupling is both a mechanism for matching orders on the exchange and an implicit cross-border capacity allocation mechanism. Market Coupling improves the economic surplus of the coupled markets: the highest purchase orders and the lowest sale orders of the coupled power exchanges are matched, regardless of the area where they have been submitted; matching results depend however on the Available Transfer Capacity (ATC) between the coupled hubs. Market prices and schedules of the day-ahead power exchanges of the several connected markets are simultaneously determined with the use of the Available Transfer Capacity defined by the relevant Transmission System Operators. The transmission capacity is thereby implicitly auctioned and the implicit cost of the transmission capacity from one market to the other is the price difference between the two markets. In particular, if the transmission capacity between two markets is not fully used, there is no price difference between the markets and the implicit cost of the transmission capacity is null. Market coupling relies on the principle that the market with the lowest price exports electricity to the market with the highest price. Two situations may appear: either the Available Transfer Capacity (ATC) is large enough and the prices of both markets are equalized (price convergence), or the ATC is too small and the prices cannot be equalized. The Market Coupling algorithm takes as an input: 1 - The Available Transfer Capacity (ATC) between each area for each flow direction and each Settlement Period of the following day (i.e. for each hour of following day); 2 - The (Block Free) Net Export Curves (NEC) of each market for each hour of the following day, i.e., the difference between the total quantity of Divisible Hourly Bids and the total quantity of Divisible Hourly Offers for each price level. The NEC reflects a market's import or export volume sensitivity to price. 3 - The Block Orders submitted by the participants in

  13. Chameleons with Field Dependent Couplings

    CERN Document Server

    Brax, Philippe; Mota, David F; Nunes, Nelson J; Winther, Hans A


    Certain scalar-tensor theories exhibit the so-called chameleon mechanism, whereby observational signatures of scalar fields are hidden by a combination of self-interactions and interactions with ambient matter. Not all scalar-tensor theories exhibit such a chameleon mechanism, which has been originally found in models with inverse power run-away potentials and field independent couplings to matter. In this paper we investigate field-theories with field-dependent couplings and a power-law potential for the scalar field. We show that the theory indeed is a chameleon field theory. We find the thin-shell solution for a spherical body and investigate the consequences for E\\"ot-Wash experiments, fifth-force searches and Casimir force experiments. Requiring that the scalar-field evades gravitational tests, we find that the coupling is sensitive to a mass-scale which is of order of the Hubble scale today.

  14. Coupled processes in repository sealing

    International Nuclear Information System (INIS)

    Case, J.B.; Kelsall, P.C.


    The significance of coupled processes in repository sealing is evaluated. In most repository designs, shaft seals will be located in areas of relatively low temperature perturbation, in which case the coupling of temperature with stress and permeability may be less significant than the coupling between stress and permeability that occurs during excavation. Constitutive relationships between stress and permeability are reviewed for crystalline rock and rocksalt. These provide a basis for predicting the development of disturbed zones near excavations. Field case histories of the degree of disturbance are presented for two contrasting rock types - Stripa granite and Southeastern New Mexico rocksalt. The results of field investigations in both rock types confirm that hydraulic conductivity or permeability is stress dependent, and that shaft seal performance may be related to the degree that stresses are perturbed and restored near the seal

  15. Coupling Functions Enable Secure Communications (United States)

    Stankovski, Tomislav; McClintock, Peter V. E.; Stefanovska, Aneta


    Secure encryption is an essential feature of modern communications, but rapid progress in illicit decryption brings a continuing need for new schemes that are harder and harder to break. Inspired by the time-varying nature of the cardiorespiratory interaction, here we introduce a new class of secure communications that is highly resistant to conventional attacks. Unlike all earlier encryption procedures, this cipher makes use of the coupling functions between interacting dynamical systems. It results in an unbounded number of encryption key possibilities, allows the transmission or reception of more than one signal simultaneously, and is robust against external noise. Thus, the information signals are encrypted as the time variations of linearly independent coupling functions. Using predetermined forms of coupling function, we apply Bayesian inference on the receiver side to detect and separate the information signals while simultaneously eliminating the effect of external noise. The scheme is highly modular and is readily extendable to support different communications applications within the same general framework.

  16. Strong coupling phase in QED

    International Nuclear Information System (INIS)

    Aoki, Ken-ichi


    Existence of a strong coupling phase in QED has been suggested in solutions of the Schwinger-Dyson equation and in Monte Carlo simulation of lattice QED. In this article we recapitulate the previous arguments, and formulate the problem in the modern framework of the renormalization theory, Wilsonian renormalization. This scheme of renormalization gives the best understanding of the basic structure of a field theory especially when it has a multi-phase structure. We resolve some misleading arguments in the previous literature. Then we set up a strategy to attack the strong phase, if any. We describe a trial; a coupled Schwinger-Dyson equation. Possible picture of the strong coupling phase QED is presented. (author)

  17. Trilateral market coupling. Algorithm appendix

    Energy Technology Data Exchange (ETDEWEB)



    Market Coupling is both a mechanism for matching orders on the exchange and an implicit cross-border capacity allocation mechanism. Market Coupling improves the economic surplus of the coupled markets: the highest purchase orders and the lowest sale orders of the coupled power exchanges are matched, regardless of the area where they have been submitted; matching results depend however on the Available Transfer Capacity (ATC) between the coupled hubs. Market prices and schedules of the day-ahead power exchanges of the several connected markets are simultaneously determined with the use of the Available Transfer Capacity defined by the relevant Transmission System Operators. The transmission capacity is thereby implicitly auctioned and the implicit cost of the transmission capacity from one market to the other is the price difference between the two markets. In particular, if the transmission capacity between two markets is not fully used, there is no price difference between the markets and the implicit cost of the transmission capacity is null. Market coupling relies on the principle that the market with the lowest price exports electricity to the market with the highest price. Two situations may appear: either the Available Transfer Capacity (ATC) is large enough and the prices of both markets are equalized (price convergence), or the ATC is too small and the prices cannot be equalized. The Market Coupling algorithm takes as an input: 1 - The Available Transfer Capacity (ATC) between each area for each flow direction and each Settlement Period of the following day (i.e. for each hour of following day); 2 - The (Block Free) Net Export Curves (NEC) of each market for each hour of the following day, i.e., the difference between the total quantity of Divisible Hourly Bids and the total quantity of Divisible Hourly Offers for each price level. The NEC reflects a market's import or export volume sensitivity to price. 3 - The Block Orders submitted by the

  18. Identification and growth conditions of purple non-sulfur photosynthetic bacteria isolated from palm oil mill effluent

    International Nuclear Information System (INIS)

    Radziah Ariffin


    An indigenous strain of the purple non-sulphur photosynthetic bacterium, isolated from palm oil mill effluent was presumably identified as species of Rhodopseudomonas palustris. Cultivation in synthetic medium under different conditions indicated that it gave maximum carotenoid and bacteriophyll synthesis under anaerobic conditions in the light with values of 12.6 and 108.1 mg/g dry cell weight respectively. These values were significantly higher than the pigment content obtained from aerobic cultivation. The specific growth rates in anaerobic was twice those in aerobic conditions in the light. Growth was not occurred in anaerobic or aerobic conditions in the dark. (Author)

  19. Coupled-Beam and Coupled-Bunch Instabilities

    Energy Technology Data Exchange (ETDEWEB)

    Burov, Alexey [Fermilab


    A problem of coupled-beam instability is solved for two multibunch beams with slightly different revolution frequencies, as in the Fermilab Recycler Ring (RR). Sharing of the inter-bunch growth rates between the intra-bunch modes is described. The general analysis is applied to the RR; possibilities to stabilize the beams by means of chromaticity, feedback and Landau damping are considered.

  20. Cation-Coupled Bicarbonate Transporters


    Aalkjaer, Christian; Boedtkjer, Ebbe; Choi, Inyeong; Lee, Soojung


    Cation-coupled HCO3− transport was initially identified in the mid-1970s when pioneering studies showed that acid extrusion from cells is stimulated by CO2/HCO3− and associated with Na+ and Cl− movement. The first Na+-coupled bicarbonate transporter (NCBT) was expression-cloned in the late 1990s. There are currently five mammalian NCBTs in the SLC4-family: the electrogenic Na,HCO3-cotransporters NBCe1 and NBCe2 (SLC4A4 and SLC4A5 gene products); the electroneutral Na,HCO3-cotransporter NBCn1 ...

  1. Grating-Coupled Waveguide Cloaking

    International Nuclear Information System (INIS)

    Wang Jia-Fu; Qu Shao-Bo; Ma Hua; Wang Cong-Min; Wang Xin-Hua; Zhou Hang; Xu Zhuo; Xia Song


    Based on the concept of a grating-coupled waveguide (GCW), a new strategy for realizing EM cloaking is presented. Using metallic grating, incident waves are firstly coupled into the effective waveguide and then decoupled into free space behind, enabling EM waves to pass around the obstacle. Phase compensation in the waveguide keeps the wave-front shape behind the obstacle unchanged. Circular, rectangular and triangular cloaks are presented to verify the robustness of the GCW cloaking. Electric field animations and radar cross section (RCS) comparisons convincingly demonstrate the cloaking effect

  2. Tunable coupled surface acoustic cavities (United States)

    de Lima, M. M.; Santos, P. V.; Kosevich, Yu. A.; Cantarero, A.


    We demonstrate the electric tuning of the acoustic field in acoustic microcavities (MCs) defined by a periodic arrangement of metal stripes within a surface acoustic delay line on LiNbO3 substrate. Interferometric measurements show the enhancement of the acoustic field distribution within a single MC, the presence of a "bonding" and "anti-bonding" modes for two strongly coupled MCs, as well as the positive dispersion of the "mini-bands" formed by five coupled MCs. The frequency and amplitude of the resonances can be controlled by the potential applied to the metal stripes.

  3. Flashing coupled density wave oscillation

    International Nuclear Information System (INIS)

    Jiang Shengyao; Wu Xinxin; Zhang Youjie


    The experiment was performed on the test loop (HRTL-5), which simulates the geometry and system design of the 5 MW reactor. The phenomenon and mechanism of different kinds of two-phase flow instabilities, namely geyser instability, flashing instability and flashing coupled density wave instability are described. The especially interpreted flashing coupled density wave instability has never been studied well, it is analyzed by using a one-dimensional non-thermo equilibrium two-phase flow drift model computer code. Calculations are in good agreement with the experiment results. (5 refs.,5 figs., 1 tab.)

  4. Hydromechanical coupling in geologic processes (United States)

    Neuzil, C.E.


    Earth's porous crust and the fluids within it are intimately linked through their mechanical effects on each other. This paper presents an overview of such "hydromechanical" coupling and examines current understanding of its role in geologic processes. An outline of the theory of hydromechanics and rheological models for geologic deformation is included to place various analytical approaches in proper context and to provide an introduction to this broad topic for nonspecialists. Effects of hydromechanical coupling are ubiquitous in geology, and can be local and short-lived or regional and very long-lived. Phenomena such as deposition and erosion, tectonism, seismicity, earth tides, and barometric loading produce strains that tend to alter fluid pressure. Resulting pressure perturbations can be dramatic, and many so-called "anomalous" pressures appear to have been created in this manner. The effects of fluid pressure on crustal mechanics are also profound. Geologic media deform and fail largely in response to effective stress, or total stress minus fluid pressure. As a result, fluid pressures control compaction, decompaction, and other types of deformation, as well as jointing, shear failure, and shear slippage, including events that generate earthquakes. By controlling deformation and failure, fluid pressures also regulate states of stress in the upper crust. Advances in the last 80 years, including theories of consolidation, transient groundwater flow, and poroelasticity, have been synthesized into a reasonably complete conceptual framework for understanding and describing hydromechanical coupling. Full coupling in two or three dimensions is described using force balance equations for deformation coupled with a mass conservation equation for fluid flow. Fully coupled analyses allow hypothesis testing and conceptual model development. However, rigorous application of full coupling is often difficult because (1) the rheological behavior of geologic media is complex

  5. Fertility prognosis for infertile couples

    DEFF Research Database (Denmark)

    Bostofte, E; Bagger, P; Michael, A


    OBJECTIVE: To develop a fertility prognosis model for infertile couples. DESIGN: Prospective follow-up study. PARTICIPANTS: In the period November 30, 1977 to June 1, 1985, 321 consecutive couples were investigated for infertility at Hvidovre University Hospital. Investigation of the female...... MEASURE: The Cox regression model was used to predict the time required to conceive based on informations provided by fertility investigations. RESULTS: Three of 16 prognostic variables (the period of infertility, the female infertility factor, and the P-test) possess significant prognostic information...

  6. Coupling to photonic crystal fibers

    DEFF Research Database (Denmark)

    Hougaard, Kristian G.; Bjarklev, Anders Overgaard; Knudsen, Erik


    In this work we have analyzed the correspondence between the fundamental mode of PCFs and Gaussian modes as a function of frequency, pitch, and air hole size. Such analysis provides insight into design space regions of PCFs, where low-loss coupling to standard fibers may be obtained.......In this work we have analyzed the correspondence between the fundamental mode of PCFs and Gaussian modes as a function of frequency, pitch, and air hole size. Such analysis provides insight into design space regions of PCFs, where low-loss coupling to standard fibers may be obtained....

  7. Dark coupling and gauge invariance

    International Nuclear Information System (INIS)

    Gavela, M.B.; Honorez, L. Lopez; Mena, O.; Rigolin, S.


    We study a coupled dark energy-dark matter model in which the energy-momentum exchange is proportional to the Hubble expansion rate. The inclusion of its perturbation is required by gauge invariance. We derive the linear perturbation equations for the gauge invariant energy density contrast and velocity of the coupled fluids, and we determine the initial conditions. The latter turn out to be adiabatic for dark energy, when assuming adiabatic initial conditions for all the standard fluids. We perform a full Monte Carlo Markov Chain likelihood analysis of the model, using WMAP 7-year data

  8. Dark Coupling and Gauge Invariance

    CERN Document Server

    Gavela, M B; Mena, O; Rigolin, S


    We study a coupled dark energy-dark matter model in which the energy-momentum exchange is proportional to the Hubble expansion rate. The inclusion of its perturbation is required by gauge invariance. We derive the linear perturbation equations for the gauge invariant energy density contrast and velocity of the coupled fluids, and we determine the initial conditions. The latter turn out to be adiabatic for dark energy, when assuming adiabatic initial conditions for all the standard fluids. We perform a full Monte Carlo Markov Chain likelihood analysis of the model, using WMAP 7-year data.

  9. Analysis of some coplanar transmission lines: coplanar coupled lines, coplanar coupled striplines, and coplanar coupled lines with rectangular microshield (United States)

    Yuan, Naichang; He, Jianguo; Yao, Demiao; Dai, Qin; Lin, Weigan


    Two types of coplanar transmission lines, rectangular microshield coplanar coupled lines (RMCCL) and coplanar coupled rectangular microshield lines (CCRML), are proposed for MMIC applications. These are developed from coplanar coupled lines (CCL) and coplanar coupled strip lines (CCS). Analytic formulas are presented for calculating the quasistatic TEM parameters of these coupled lines by means of exact conformal mapping techniques. Numerical results are also presented to illustrate the properties of these coplanar transmission lines.

  10. Treating infidelity in same-sex couples. (United States)

    Martell, Christopher R; Prince, Stacey E


    Psychotherapy with same-sex couples does not differ markedly from standard couple therapies; this is also true for treating couples facing infidelity. However, same-sex couples often design their relationships differently, without tradition and formal marital contracts to prescribe behavior. Based on clinical experience and the empirical research, this article addresses the differing norms involved in affirmatively treating infidelity in gay and lesbian couples within the framework of integrative behavioral couple therapy (IBCT). Two cases illustrate the process and outcome of IBCT with same-sex couples.

  11. Solving Nonlinear Coupled Differential Equations (United States)

    Mitchell, L.; David, J.


    Harmonic balance method developed to obtain approximate steady-state solutions for nonlinear coupled ordinary differential equations. Method usable with transfer matrices commonly used to analyze shaft systems. Solution to nonlinear equation, with periodic forcing function represented as sum of series similar to Fourier series but with form of terms suggested by equation itself.

  12. Palladium-Catalysed Coupling Reactions

    NARCIS (Netherlands)

    de Vries, Johannes G.; Beller, M; Blaser, HU


    Palladium-catalysed coupling reactions have gained importance as a tool for the production of pharmaceutical intermediates and to a lesser extent also for the production of agrochemicals, flavours and fragrances, and monomers for polymers. In this review only these cases are discussed where it seems

  13. Couple specialization in multiple equilibria

    NARCIS (Netherlands)

    Esping-Andersen, G.; Boertien, D.; Bonke, J.; Gracia, P.


    We address the issue of men’s lagged adaptation to the ongoing revolution of women’s roles. This article proposes a multiple equilibrium approach and shows how modes of couple specialization cluster around qualitatively distinct logics. We identify a traditional, egalitarian, and ‘unstable’

  14. Couples Therapy: An Adlerian Perspective. (United States)

    Kern, Roy M.; And Others

    This book provides therapists with a theoretical base from which to view the dynamics of couples' relationships and the therapeutic process. The book's eight chapters are organized into three parts: "Adlerian Theory and Process"; "Therapeutic Interventions"; and "Special Issues in Marital Therapy." Chapter 1, Adlerian…

  15. Hyperchaos in coupled Colpitts oscillators

    DEFF Research Database (Denmark)

    Cenys, Antanas; Tamasevicius, Arunas; Baziliauskas, Antanas


    The paper suggests a simple solution of building a hyperchaotic oscillator. Two chaotic Colpitts oscillators, either identical or non-identical ones are coupled by means of two linear resistors R-k. The hyperchaotic output signal v(t) is a linear combination, specifically the mean of the individual...

  16. Latinos' Perceptions of Interethnic Couples (United States)

    Garcia, Amber L.; Riggio, Heidi R.; Palavinelu, Subha; Culpepper, Lane Locher


    Numerous survey findings indicate that the majority of White Americans are accepting of interracial romantic relationships. However, relatively few studies have looked at how different American ethnic minority groups view such relationships. The current research examined Latinos' evaluations of intraethnic and interethnic couples. Latino…

  17. Marital Dissolution among Interracial Couples (United States)

    Zhang, Yuanting; Van Hook, Jennifer


    Increases in interracial marriage have been interpreted as reflecting reduced social distance among racial and ethnic groups, but little is known about the stability of interracial marriages. Using six panels of Survey of Income and Program Participation (N = 23,139 married couples), we found that interracial marriages are less stable than…

  18. Feedback coupling in dynamical systems (United States)

    Trimper, Steffen; Zabrocki, Knud


    Different evolution models are considered with feedback-couplings. In particular, we study the Lotka-Volterra system under the influence of a cumulative term, the Ginzburg-Landau model with a convolution memory term and chemical rate equations with time delay. The memory leads to a modified dynamical behavior. In case of a positive coupling the generalized Lotka-Volterra system exhibits a maximum gain achieved after a finite time, but the population will die out in the long time limit. In the opposite case, the time evolution is terminated in a crash. Due to the nonlinear feedback coupling the two branches of a bistable model are controlled by the the strength and the sign of the memory. For a negative coupling the system is able to switch over between both branches of the stationary solution. The dynamics of the system is further controlled by the initial condition. The diffusion-limited reaction is likewise studied in case the reacting entities are not available simultaneously. Whereas for an external feedback the dynamics is altered, but the stationary solution remain unchanged, a self-organized internal feedback leads to a time persistent solution.

  19. Coupling Considerations in Assembly Language (United States)


    done in assembly languages—just write a command that modifies the opcode of another command. A module modifying (or referring to) local data in...178C.) 3. Martin Fowler. Last accessed 6 November 2017, Email is 4. “Thoughts on Coupling in Software

  20. Single and Coupled Nanobeam Cavities

    DEFF Research Database (Denmark)

    Ivinskaya, Aliaksandra; Lavrinenko, Andrei; Shyroki, Dzmitry M.


    for analysis and design of photonic crystal devices, such as 2D ring resonators for filters, single and coupled nanobeam cavities, birefringence in photonic crystal cavities, threshold analysis in photonic crystal lasers, gap solitons in photonic crystals, novel photonic atolls, dynamic characteristics...

  1. Coupled optical resonance laser locking

    CSIR Research Space (South Africa)

    Burd, CC


    Full Text Available We have demonstrated simultaneous laser frequency stabilization of a UV and IR laser, to coupled transitions of ions in the same spectroscopic sample, by detecting only the absorption of the UV laser. Separate signals for locking the different...

  2. Isocurvature constraints on portal couplings

    Energy Technology Data Exchange (ETDEWEB)

    Kainulainen, Kimmo; Nurmi, Sami; Vaskonen, Ville [Department of Physics, University of Jyväskylä, P.O.Box 35 (YFL), FI-40014 University of Jyväskylä (Finland); Tenkanen, Tommi; Tuominen, Kimmo, E-mail:, E-mail:, E-mail:, E-mail:, E-mail: [Department of Physics, University of Helsinki P.O. Box 64, FI-00014, Helsinki (Finland)


    We consider portal models which are ultraweakly coupled with the Standard Model, and confront them with observational constraints on dark matter abundance and isocurvature perturbations. We assume the hidden sector to contain a real singlet scalar s and a sterile neutrino ψ coupled to s via a pseudoscalar Yukawa term. During inflation, a primordial condensate consisting of the singlet scalar s is generated, and its contribution to the isocurvature perturbations is imprinted onto the dark matter abundance. We compute the total dark matter abundance including the contributions from condensate decay and nonthermal production from the Standard Model sector. We then use the Planck limit on isocurvature perturbations to derive a novel constraint connecting dark matter mass and the singlet self coupling with the scale of inflation: m {sub DM}/GeV ∼< 0.2λ{sub s}{sup 3/8} ( H {sub *}/10{sup 11} GeV){sup −3/2}. This constraint is relevant in most portal models ultraweakly coupled with the Standard Model and containing light singlet scalar fields.

  3. Perovskite catalysts for oxidative coupling (United States)

    Campbell, Kenneth D.


    Perovskites of the structure A.sub.2 B.sub.2 C.sub.3 O.sub.10 are useful as catalysts for the oxidative coupling of lower alkane to heavier hydrocarbons. A is alkali metal; B is lanthanide or lanthanum, cerium, neodymium, samarium, praseodymium, gadolinium or dysprosium; and C is titanium.

  4. Carbon Dynamics of Pinus palustris Ecosystems Following Drought

    Directory of Open Access Journals (Sweden)

    Gregory Starr


    Full Text Available Drought can affect forest structure and function at various spatial and temporal scales. Forest response and recovery from drought may be a result of position within landscape. Longleaf pine forests in the United States have been observed to reduce their carbon sequestration capacity during drought. We collected eddy covariance data at the ends of an edaphic longleaf pine gradient (xeric and mesic sites over seven years; two years of normal rainfall were followed by 2.5 years of drought, then 2.5 years of normal or slightly above-average rainfall. Drought played a significant role in reducing the physiological capacity of the sites and was compounded when prescribed fire occurred during the same periods. The mesic site has a 40% greater basal area then the xeric site, which accounts for its larger sequestration capacity; however, both sites show the same range of variance in fluxes over the course of the study. Following drought, both sites became carbon sinks. However, the xeric site had a longer carry-over effect and never returned to pre-drought function. Although this study encompassed seven years, we argue that longer studies with greater spatial variance must be undertaken to develop a more comprehensive understanding of forest response to changing climate.

  5. Adiciones a las haloragaceae de Colombia: Proserpinaca palustris

    Directory of Open Access Journals (Sweden)

    Schmidt Mumm Udo


    Full Text Available Las especies colombianas de la familia Haloragaceae se han asignado a dos subfamilias y tres géneros. Según Mora-Osejo (1984, quién comparte la opinión de Schindler (1905 en incluir el género Gunnera L. en la sub familia terrestre Gunneroideae, la sub familia Haloragoideae distingue las plantas acuáticas y semiacuáticas de tallos herbáceos, raras veces subleñosos, hojas opuestas o verticiladas e inflorescencias terminales. Inicialmente se designaron dos especies del género Myriophyllum L. a esta subfamilia y poco después se señaló también el hallazgo del género Laurembergia Berg. (Mora-Osejo et al. 1988. En la actualidad, sin embargo, se ha generalizado la tendencia a considerar el género Gunnera separadamente en la familia Gunneraceae (Cronquist 1988, L. E. Mora-Osejo, como pers., con lo cual las Haloragaceae de Colombia se encuentran representadas por tres especies de los géneros Myriophyllum y Laurembergia.

  6. Adiciones a las haloragaceae de Colombia: Proserpinaca palustris


    Schmidt Mumm Udo; Posada José Andrés


    Las especies colombianas de la familia Haloragaceae se han asignado a dos subfamilias y tres géneros. Según Mora-Osejo (1984), quién comparte la opinión de Schindler (1905) en incluir el género Gunnera L. en la sub familia terrestre Gunneroideae, la sub familia Haloragoideae distingue las plantas acuáticas y semiacuáticas de tallos herbáceos, raras veces subleñosos, hojas opuestas o verticiladas e inflorescencias terminales. Inicialmente se designaron dos especies del género Myriophyllum L. a...

  7. Biological couplings: Classification and characteristic rules

    Institute of Scientific and Technical Information of China (English)


    The phenomena that biological functions originate from biological coupling are the important biological foundation of multiple bionics and the significant discoveries in the bionic fields. In this paper, the basic concepts related to biological coupling are introduced from the bionic viewpoint. Constitution, classification and characteristic rules of biological coupling are illuminated, the general modes of biological coupling studies are analyzed, and the prospects of multi-coupling bionics are predicted.

  8. Exact Bremsstrahlung and effective couplings

    Energy Technology Data Exchange (ETDEWEB)

    Mitev, Vladimir [Institut für Physik, WA THEP, Johannes Gutenberg-Universität Mainz,Staudingerweg 7, 55128 Mainz (Germany); Institut für Mathematik und Institut für Physik, Humboldt-Universität zu Berlin,IRIS Haus, Zum Großen Windkanal 6, 12489 Berlin (Germany); Pomoni, Elli [DESY Hamburg, Theory Group, Notkestrasse 85, D-22607 Hamburg (Germany); Physics Division, National Technical University of Athens,15780 Zografou Campus, Athens (Greece)


    We calculate supersymmetric Wilson loops on the ellipsoid for a large class of N=2 SCFT using the localization formula of Hama and Hosomichi. From them we extract the radiation emitted by an accelerating heavy probe quark as well as the entanglement entropy following the recent works of Lewkowycz-Maldacena and Fiol-Gerchkovitz-Komargodski. Comparing our results with the N=4 SYM ones, we obtain interpolating functions f(g{sup 2}) such that a given N=2 SCFT observable is obtained by replacing in the corresponding N=4 SYM result the coupling constant by f(g{sup 2}). These “exact effective couplings” encode the finite, relative renormalization between the N=2 and the N=4 gluon propagator and they interpolate between the weak and the strong coupling. We discuss the range of their applicability.

  9. Tunneling of a coupled system

    International Nuclear Information System (INIS)

    Avishai, Y.


    We consider tunneling through a potential barrier V(x) in the presence of a coupling term W(x,y). Let H(y) be the internal Hamiltonian associated with the coordinate y and let E 0 (x) be the ground state energy of the operator H(x;y) = H(y) + W(x,y) in which x is a parameter. Our result for the tunneling probability (in the WKB approximation) is P = exp(2i ∫ k 0 (x)dx) where, at energy E, k 0 (x) = [E-E 0 (x)-V(x)]sup(1/2)/(h/2π) is the local wave number in the presence of coupling. (orig.)

  10. Modulational instability of coupled waves

    International Nuclear Information System (INIS)

    McKinstrie, C.J.; Bingham, R.


    The collinear propagation of an arbitrary number of finite-amplitude waves is modeled by a system of coupled nonlinear Schroedinger equations; one equation for each complex wave amplitude. In general, the waves are modulationally unstable with a maximal growth rate larger than the modulational growth rate of any wave alone. Moreover, waves that are modulationally stable by themselves can be driven unstable by the nonlinear coupling. The general theory is then applied to the relativistic modulational instability of two laser beams in a beat-wave accelerator. For parameters typical of a proposed beat-wave accelerator, this instability can seriously distort the incident laser pulse shapes on the particle-acceleration time scale, with detrimental consequences for particle acceleration

  11. Coupled models in dam engineering


    González Gutiérrez, María De Los Ángeles


    Rock ll dams are certainly one of the most important engineering structures due to their economic advantages and exible design. Unfortunately their vulnerability to overtopping still remains their weakest point. For that reason, several research groups are interested in both the numerical and experimental analysis of this phenomenon. In this work we focused on the numerical analysis. The previous work developed in CIMNE on a coupled PFEM-Eulerian free surface Compu- tational...

  12. Coupled Semi-Supervised Learning (United States)


    Additionally, specify the expected category of each relation argument to enable type-checking. Subsystem components and the KI can benefit from methods that...confirm that our coupled semi-supervised learning approaches can scale to hun- dreds of predicates and can benefit from using a diverse set of...organization yes California Institute of Technology vegetable food yes carrots vehicle item yes airplanes vertebrate animal yes videoGame product yes

  13. Coupling methods for multistage sampling


    Chauvet, Guillaume


    Multistage sampling is commonly used for household surveys when there exists no sampling frame, or when the population is scattered over a wide area. Multistage sampling usually introduces a complex dependence in the selection of the final units, which makes asymptotic results quite difficult to prove. In this work, we consider multistage sampling with simple random without replacement sampling at the first stage, and with an arbitrary sampling design for further stages. We consider coupling ...

  14. Long range supergravity coupling strengths

    International Nuclear Information System (INIS)

    Kenyon, I.R.


    A limit of 2x10 -13 has recently been deduced for the fractional difference between the gravitational masses of the K 0 and anti K 0 mesons. This limit is applied here to put stringent limits on the strengths of the long range vector-scalar gravitational couplings envisaged in supergravity theories. A weaker limit is inferred from the general relativistic fit to the precession of the orbit of the pulsar PSR1913+16. (orig.)

  15. Acoustic wave coupled magnetoelectric effect

    International Nuclear Information System (INIS)

    Gao, J.S.; Zhang, N.


    Magnetoelectric (ME) coupling by acoustic waveguide was developed. Longitudinal and transversal ME effects of larger than 44 and 6 (V cm −1 Oe −1 ) were obtained with the waveguide-coupled ME device, respectively. Several resonant points were observed in the range of frequency lower than 47 kHz. Analysis showed that the standing waves in the waveguide were responsible for those resonances. The frequency and size dependence of the ME effects were investigated. A resonant condition about the geometrical size of the waveguide was obtained. Theory and experiments showed the resonant frequencies were closely influenced by the diameter and length of the waveguide. A series of double-peak curves of longitudinal magnetoelectric response were obtained, and their significance was discussed initially. - Highlights: • Magnetoelectric (ME) coupling by acoustic waveguide was developed. • The frequency and size dependence of the ME effects were investigated. • A resonant condition about the geometrical size of the waveguide was obtained. • A series of double-peak curves of longitudinal magnetoelectric response were obtained, and their significance was discussed initially.

  16. Statefinder diagnostic for coupled quintessence

    International Nuclear Information System (INIS)

    Zhang Xin


    The problem of the cosmic coincidence is a longstanding puzzle. This conundrum may be solved by introducing a coupling between the two dark sectors. In this Letter, we study two cases of the coupled quintessence scenario. (a) Assume that the mass of dark matter particles depends exponentially on the scalar field associated to dark energy and meanwhile the scalar field evolves in an exponential potential; (b) Assume that the mass of dark matter particles depends on a power law function of the scalar field and meanwhile the scalar field evolves in a power law potential. Since the dynamics of this system is dominated by an attractor solution, the mass of dark matter particles is forced to change with time as to ensure that the ratio between the energy densities of dark matter and dark energy becomes a constant at late times, and one thus solve the cosmic coincidence problem naturally. We perform a statefinder diagnostic to both cases of this coupled quintessence scenario. It is shown that the evolving trajectory of this scenario in the s-r diagram is quite different from those of other dark energy models

  17. Chirality, nongauge couplings and compositeness

    International Nuclear Information System (INIS)

    Suzuki, Mahiko


    We study from a phenomenological viewpoint what constraints exist on a possible scale of compositeness for W, Z, leptons, and quarks. A few critical arguments are presented about excited fermions and spinless partners of W and Z. It is argued that irrespective of a compositeness scale, the coupling of an excited fermion to a ground state light fermion is likely to be maximally parity violating. Besides chirality breaking interactions of light fermions, gauge noninvariant, dimensionless, unrenormalizable couplings are specially interesting in many classes of composite theories. The deviation of the W magnetic moment from the standard theory (g = 2) is such an example. We relate the ''g-2'' of W to a compositeness scale through an unitarity argument and make a guess on its effect on the muon g-2 for a given compositeness scale. The present experimental data on the W-Z mass ratio is already accurate enough to indicate that if a compositeness scale is larger than 0(1 TeV), gauge noninvariant couplings of W and Z should be negligibly small and a composite theory is hardly distinguishable from an elementary particle theory at the electroweak energy scale (≅ 250 GeV). However, a compositeness scale close to the electroweak scale can not be ruled out for W and Z at present. (author)

  18. Conduction-coupled Tesla transformer. (United States)

    Reed, J L


    A proof-of-principle Tesla transformer circuit is introduced. The new transformer exhibits the high voltage-high power output signal of shock-excited transformers. The circuit, with specification of proper circuit element values, is capable of obtaining extreme oscillatory voltages. The primary and secondary portions of the circuit communicate solely by conduction. The destructive arcing between the primary and secondary inductors in electromagnetically coupled transformers is ubiquitous. Flashover is eliminated in the new transformer as the high-voltage inductors do not interpenetrate and so do not possess an annular volume of electric field. The inductors are remote from one another. The high voltage secondary inductor is isolated in space, except for a base feed conductor, and obtains earth by its self-capacitance to the surroundings. Governing equations, for the ideal case of no damping, are developed from first principles. Experimental, theoretical, and circuit simulator data are presented for the new transformer. Commercial high-temperature superconductors are discussed as a means to eliminate the counter-intuitive damping due to small primary inductances in both the electromagnetic-coupled and new conduction-coupled transformers.

  19. Optimizing Chromatic Coupling Measurement in the LHC

    CERN Document Server

    Persson, Tobias


    Optimizing chromatic coupling measurement in the LHC Chromatic coupling introduces a dependency of transverse coupling with energy. LHC is equipped with skew sextupoles to compensate the possible adverse effects of chromatic coupling. In 2012 a beam-based correction was calculated and applied successfully for the fist time. However, the method used to reconstruct the chromatic coupling was dependent on stable tunes and equal chromaticities between the horizontal and vertical planes. In this article an improved method to calculate the chromatic coupling without these constraints is presented.

  20. Simultaneous viscous-inviscid coupling via transpiration

    International Nuclear Information System (INIS)

    Yiu, K.F.C.; Giles, M.B.


    In viscous-inviscid coupling analysis, the direct coupling technique and the inverse coupling technique are commonly adopted. However, stability and convergence of the algorithms derived are usually very unsatisfactory. Here, by using the transpiration technique to simulate the effect of the displacement thickness, a new simultaneous coupling method is derived. The integral boundary layer equations and the full potential equation are chosen to be the viscous-inviscid coupled system. After discretization, the Newton-Raphson technique is proposed to solve the coupled nonlinear system. Several numerical results are used to demonstrate the accuracy and efficiency of the proposed method. 15 refs., 23 figs

  1. Coupled variations of fundamental couplings and primordial nucleosynthesis

    International Nuclear Information System (INIS)

    Coc, Alain; Nunes, Nelson J.; Olive, Keith A.; Uzan, Jean-Philippe; Vangioni, Elisabeth


    The effect of variations of the fundamental nuclear parameters on big-bang nucleosynthesis are modeled and discussed in detail taking into account the interrelations between the fundamental parameters arising in unified theories. Considering only 4 He, strong constraints on the variation of the neutron lifetime, neutron-proton mass difference are set. These constraints are then translated into constraints on the time variation of the Yukawa couplings and the fine structure constant. Furthermore, we show that a variation of the deuterium binding energy is able to reconcile the 7 Li abundance deduced from the WMAP analysis with its spectroscopically determined value while maintaining concordance with D and 4 He. (authors)

  2. Coupled seismic and electromagnetic wave propagation

    NARCIS (Netherlands)

    Schakel, M.D.


    Coupled seismic and electromagnetic wave propagation is studied theoretically and experimentally. This coupling arises because of the electrochemical double layer, which exists along the solid-grain/fluid-electrolyte boundaries of porous media. Within the double layer, charge is redistributed,

  3. Congruence Couple Therapy for Pathological Gambling (United States)

    Lee, Bonnie K.


    Couple therapy models for pathological gambling are limited. Congruence Couple Therapy is an integrative, humanistic, systems model that addresses intrapsychic, interpersonal, intergenerational, and universal-spiritual disconnections of pathological gamblers and their spouses to shift towards congruence. Specifically, CCT's theoretical…

  4. Integrable KP Coupling and Its Exact Solution

    International Nuclear Information System (INIS)

    Peng Ling; Yang Xuxong; Lou Senyue


    The integrable coupling is one of the most important topics in the nonlinear physics. This paper creates a novel integrable KP coupling and solves it via a recently-developed dark parameterization procedure. (general)

  5. Fractional dynamical model for neurovascular coupling

    KAUST Repository

    Belkhatir, Zehor; Laleg-Kirati, Taous-Meriem


    The neurovascular coupling is a key mechanism linking the neural activity to the hemodynamic behavior. Modeling of this coupling is very important to understand the brain function but it is at the same time very complex due to the complexity

  6. Globally Coupled Chaotic Maps with Constant Force

    International Nuclear Information System (INIS)

    Li Jinghui


    We investigate the motion of the globally coupled maps (logistic map) with a constant force. It is shown that the constant force can cause multi-synchronization for the globally coupled chaotic maps studied by us.

  7. Synchronization of indirectly coupled Lorenz oscillators

    Indian Academy of Sciences (India)

    Synchronization of indirectly coupled Lorenz oscillators: An experimental study. Amit Sharma Manish Dev Shrimali. Synchronization, Coupled Systems and Networks Volume 77 Issue 5 November 2011 pp 881-889 ... The in-phase and anti-phase synchronization of indirectly coupled chaotic oscillators reported in Phys. Rev ...

  8. Anomalous coupling of scalars to gauge fields

    Energy Technology Data Exchange (ETDEWEB)

    Brax, Philippe [CEA, IPhT, CNRS, URA 2306, Gif-sur-Yvette (France). Inst. de Physique Theorique; Burrage, Clare [Geneve Univ. (Switzerland). Dept. de Physique Theorique; Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Davis, Anne-Christine [Centre for Mathematical Sciences, Cambridge (United Kingdom). Dept. of Applied Mathematics and Theoretical Physics; Seery, David [Sussex Univ., Brighton (United Kingdom). Dept. of Physics and Astronomy; Weltman, Amanda [Cape Town Univ., Rondebosch (South Africa). Astronomy, Cosmology and Gravity Centre


    We study the transformation properties of a scalar-tensor theory, coupled to fermions, under the Weyl rescaling associated with a transition from the Jordan to the Einstein frame. We give a simple derivation of the corresponding modification to the gauge couplings. After changing frames, this gives rise to a direct coupling between the scalar and the gauge fields. (orig.)

  9. Anomalous coupling of scalars to gauge fields

    International Nuclear Information System (INIS)

    Brax, Philippe; Davis, Anne-Christine; Seery, David; Weltman, Amanda


    We study the transformation properties of a scalar-tensor theory, coupled to fermions, under the Weyl rescaling associated with a transition from the Jordan to the Einstein frame. We give a simple derivation of the corresponding modification to the gauge couplings. After changing frames, this gives rise to a direct coupling between the scalar and the gauge fields. (orig.)

  10. Emotional Awareness and Couples' Relationship Satisfaction (United States)

    Croyle, Kristin L.; Waltz, Jennifer


    This study examined the role of emotional awareness in couples' relationships and the effects of a tendency to respond to difficult couples' situations with "soft" emotions (including sadness and fear) versus "hard" emotions (including anger and resentment). Participants were 56 heterosexual couples who completed a measure of relationship…

  11. Spatiotemporal complexity in coupled map lattices

    International Nuclear Information System (INIS)

    Kaneko, Kunihiko


    Some spatiotemporal patterns of couple map lattices are presented. The chaotic kink-like motions are shown for the phase motion of the coupled circle lattices. An extension of the couple map lattice approach to Hamiltonian dynamics is briefly reported. An attempt to characterize the high-dimensional attractor by the extension of the correlation dimension is discussed. (author)

  12. Electromagnetic Pulse Coupling Analysis of Electronic Equipment


    Hong Lei; Qingying LI


    High-intensity nuclear explosion caused by high-altitude nuclear electromagnetic pulse through the antenna, metal cables, holes and other channels, coupled with very high energy into the electronic device, and cause serious threats. In this paper, the mechanism, waveform, coupling path and damage effect of nuclear electromagnetic pulse is analyzed, and the coupling mechanism of nuclear electromagnetic pulse is studied.

  13. Coupled ears in lizards and crocodilians

    DEFF Research Database (Denmark)

    Carr, Catherine E; Christensen-Dalsgaard, Jakob; Bierman, Hilary


    Lizard ears are coupled across the pharynx, and are very directional. In consequence all auditory responses should be directional, without a requirement for computation of sound source location. Crocodilian ears are connected through sinuses, and thus less tightly coupled. Coupling may improve th...... range is reviewed in the light of current theories of sound localization....

  14. Magnetically Coupled Magnet-Spring Oscillators (United States)

    Donoso, G.; Ladera, C. L.; Martin, P.


    A system of two magnets hung from two vertical springs and oscillating in the hollows of a pair of coils connected in series is a new, interesting and useful example of coupled oscillators. The electromagnetically coupled oscillations of these oscillators are experimentally and theoretically studied. Its coupling is electromagnetic instead of…

  15. Palladium-catalyzed coupling reactions

    CERN Document Server

    Molnár, Árpád


    This handbook and ready reference brings together all significant issues of practical importance for interested readers in one single volume. While covering homogeneous and heterogeneous catalysis, the text is unique in focusing on such important aspects as using different reaction media, microwave techniques or catalyst recycling. It also provides a comprehensive treatment of modern-day coupling reactions and emphasizes those topics that show potential for future development, such as continuous flow systems, water as a reaction medium, and catalyst immobilization, among others. With i

  16. On the disordered fermion couplings

    International Nuclear Information System (INIS)

    Bernaschi, M.; Cabasino, S.; Marinari, E.; Rome-2 Univ.; Sarno, R.; Rome-1 Univ.


    We study the possibility of avoiding the fermion doubling problem by using a random coupling. We use numerical simulations in order to study the theory in the strong disorder region. We find a sharp crossover as a function of the strength of the disorder. For weak quenched disorder we find that the species doubling survives, while for strong quenched disorder only with a particular choice of the random term (antihermitian) it is possible to get a theory that seems to avoid fermion doubling. (orig.)

  17. EPR of exchange coupled systems

    CERN Document Server

    Bencini, Alessandro


    From chemistry to solid state physics to biology, the applications of Electron Paramagnetic Resonance (EPR) are relevant to many areas. This unified treatment is based on the spin Hamiltonian approach and makes extensive use of irreducible tensor techniques to analyze systems in which two or more spins are magnetically coupled. This edition contains a new Introduction by coauthor Dante Gatteschi, a pioneer and scholar of molecular magnetism.The first two chapters review the foundations of exchange interactions, followed by examinations of the spectra of pairs and clusters, relaxation in oligon

  18. Structure & Coupling of Semiotic Sets (United States)

    Orsucci, Franco; Giuliani, Alessandro; Zbilut, Joseph


    We investigated the informational structure of written texts (also in the form of speech transcriptions) using Recurrence Quantification Analysis (RQA). RQA technique provides a quantitative description of text sequences at the orthographic level in terms of structuring, and may be useful for a variety of linguistics-related studies. We used RQA to measure differences in linguistic samples from different subjects. They were divided in subgroups based on personality and culture differences. We used RQA and KRQA (Cross Recurrence) to measure the coupling and synchronization during the conversation (semiotic interaction) of different subjects. We discuss results both for the improvement of methodology and some general implications for neurocognitive science.

  19. Can coupling constants be related

    International Nuclear Information System (INIS)

    Nandi, Satyanarayan; Ng, Wing-Chiu.


    We analyze the conditions under which several coupling constants in field theory can be related to each other. When the relation is independent of the renormalization point, the relation between any g and g' must satisfy a differential equation as follows from the renormalization group equations. Using this differential equation, we investigate the criteria for the feasibility of a power-series relation for various theories, especially the Weinberg-Salam type (including Higgs bosons) with an arbitrary number of quark and lepton flavors. (orig./WL) [de

  20. Lectures on the coupling method

    CERN Document Server

    Lindvall, Torgny


    An important tool in probability theory and its applications, the coupling method is primarily used in estimates of total variation distances. The method also works well in establishing inequalities, and it has proven highly successful in the study of Markov and renewal process asymptotics. This text represents a detailed, comprehensive examination of the method and its broad variety of applications. Readers progress from simple to advanced topics, with end-of-discussion notes that reinforce the preceding material. Topics include renewal theory, Markov chains, Poisson approximation, ergodicity

  1. Modeling of Coupled Chaotic Oscillators

    International Nuclear Information System (INIS)

    Lai, Y.; Grebogi, C.


    Chaotic dynamics may impose severe limits to deterministic modeling by dynamical equations of natural systems. We give theoretical argument that severe modeling difficulties may occur for high-dimensional chaotic systems in the sense that no model is able to produce reasonably long solutions that are realized by nature. We make these ideas concrete by investigating systems of coupled chaotic oscillators. They arise in many situations of physical and biological interests, and they also arise from discretization of nonlinear partial differential equations. copyright 1999 The American Physical Society

  2. Acoustic metamaterials with synergetic coupling (United States)

    Ma, Fuyin; Huang, Meng; Wu, Jiu Hui


    In this paper, we propose a general design concept for acoustic metamaterials that introduces a ubiquitous synergetic behavior into the design procedure, in which the structure of the design is driven by its functional requirements. Since the physical properties of the widely used, resonant-type metamaterials are mainly determined by the eigenmodes of the structure, we first introduce the design concept through the modal displacement distributions on two typical plate-type structures. Next, by employing broadband sound attenuations that involve both the insulation and absorption as the typical targets, two synergetic coupling behaviors are systematically revealed among the dense resonant modes and multi-cell. Furthermore, through plate-type multiple-cell structures assembled from nine oscillators, the design is shown to realize strong broadband attenuations with either the average sound transmission loss (STL) below 2000 Hz higher than 40 dB or the absorption approximately 0.99 in the range of 400-700 Hz wherein the average absorption below 800 Hz remains higher than 0.8. Finally, two multi-cell plate-type samples are fabricated and then used experimentally to measure the STLs in support of the proposed synergetic coupling design method. Both the computational and experimental results demonstrate that the proposed synergetic design concept could effectively initiate a design for metamaterials that offer a new degree of freedom for broadband sound attenuations.

  3. Middle atmosphere electrical energy coupling (United States)

    Hale, L. C.


    The middle atmosphere (MA) has long been known as an absorber of radio waves, and as a region of nonlinear interactions among waves. The region of highest transverse conductivity near the top of the MA provides a common return for global thunderstorm, auroral Birkeland, and ionospheric dynamo currents, with possibilities for coupling among them. Their associated fields and other transverse fields map to lower altitudes depending on scale size. Evidence now exists for motion-driven aerosol generators, and for charge trapped at the base of magnetic field lines, both capable of producing large MA electric fields. Ionospheric Maxwell currents (curl H) parallel to the magnetic field appear to map to lower altitudes, with rapidly time-varying components appearing as displacement currents in the stratosphere. Lightning couples a (primarily ELF and ULF) current transient to the ionosphere and magnetosphere whose wave shape is largely dependent on the MA conductivity profile. Electrical energy is of direct significance mainly in the upper MA, but electrodynamic transport of minor constituents such as smoke particles or CN may be important at other altitudes.

  4. Resonant coupling applied to superconducting accelerator structures

    International Nuclear Information System (INIS)

    Potter, James M.; Krawczyk, Frank L.


    The concept of resonant coupling and the benefits that accrue from its application is well known in the world of room temperature coupled cavity linacs. Design studies show that it can be applied successfully between sections of conventional elliptical superconducting coupled cavity accelerator structures and internally to structures with spoked cavity resonators. The coupling mechanisms can be designed without creating problems with high field regions or multipactoring. The application of resonant coupling to superconducting accelerators eliminates the need for complex cryogenic mechanical tuners and reduces the time needed to bring a superconducting accelerator into operation.

  5. Dynamics of coupled phantom and tachyon fields

    Energy Technology Data Exchange (ETDEWEB)

    Shahalam, M. [Zhejiang University of Technology, Institute for Advanced Physics and Mathematics, Hangzhou (China); Pathak, S.D.; Li, Shiyuan [Shandong University, School of Physics, Jinan (China); Myrzakulov, R. [Eurasian National University, Department of General and Theoretical Physics, Eurasian International Center for Theoretical Physics, Astana (Kazakhstan); Wang, Anzhong [Zhejiang University of Technology, Institute for Advanced Physics and Mathematics, Hangzhou (China); Baylor University, Department of Physics, GCAP-CASPER, Waco, TX (United States)


    In this paper, we apply the dynamical analysis to a coupled phantom field with scaling potential taking particular forms of the coupling (linear and combination of linear), and present phase space analysis. We investigate if there exists a late time accelerated scaling attractor that has the ratio of dark energy and dark matter densities of the order one. We observe that the scrutinized couplings cannot alleviate the coincidence problem, however, they acquire stable late time accelerated solutions. We also discuss a coupled tachyon field with inverse square potential assuming linear coupling. (orig.)

  6. Dark forces coupled to nonconserved currents (United States)

    Dror, Jeff A.; Lasenby, Robert; Pospelov, Maxim


    New light vectors with dimension-4 couplings to Standard Model states have (energy/vectormass)2-enhanced production rates unless the current they couple to is conserved. These processes allow us to derive new constraints on the couplings of such vectors, that are significantly stronger than the previous literature for a wide variety of models. Examples include vectors with axial couplings to quarks and vectors coupled to currents (such as baryon number) that are only broken by the chiral anomaly. Our new limits arise from a range of processes, including rare Z decays and flavor-changing meson decays, and rule out a number of phenomenologically motivated proposals.

  7. Dynamics of coupled phantom and tachyon fields

    International Nuclear Information System (INIS)

    Shahalam, M.; Pathak, S.D.; Li, Shiyuan; Myrzakulov, R.; Wang, Anzhong


    In this paper, we apply the dynamical analysis to a coupled phantom field with scaling potential taking particular forms of the coupling (linear and combination of linear), and present phase space analysis. We investigate if there exists a late time accelerated scaling attractor that has the ratio of dark energy and dark matter densities of the order one. We observe that the scrutinized couplings cannot alleviate the coincidence problem, however, they acquire stable late time accelerated solutions. We also discuss a coupled tachyon field with inverse square potential assuming linear coupling. (orig.)

  8. Distributed coupling high efficiency linear accelerator (United States)

    Tantawi, Sami G.; Neilson, Jeffrey


    A microwave circuit for a linear accelerator includes multiple monolithic metallic cell plates stacked upon each other so that the beam axis passes vertically through a central acceleration cavity of each plate. Each plate has a directional coupler with coupling arms. A first coupling slot couples the directional coupler to an adjacent directional coupler of an adjacent cell plate, and a second coupling slot couples the directional coupler to the central acceleration cavity. Each directional coupler also has an iris protrusion spaced from corners joining the arms, a convex rounded corner at a first corner joining the arms, and a corner protrusion at a second corner joining the arms.

  9. Enhanced prenatal HIV couple oriented counselling session and couple communication about HIV (ANRS 12127 Prenahtest Trial)

    NARCIS (Netherlands)

    Plazy, M.; Orne-Gliemann, J.; Balestre, E.; Miric, M.; Darak, S.; Butsashvili, M.; Tchendjou, P.; Dabis, F.; du Lou, A. Desgrees

    Background. - The Prenahtest study investigated the efficacy of a couple-oriented HIV counselling session (COC) in encouraging couple HIV counselling and testing, and improving intra-couple communication about sexual and reproductive health. We report here on the effect of COC on intra-couple

  10. Couple Support Schemata in Couples with and without Spinal Cord Injury (United States)

    Gilad, Dvorit; Lavee, Yoav


    This article describes the cognitive schemata of couples' support relationships among 65 couples in which the husband had a long-term spinal cord injury and 65 couples without disability. The structure of the support relations schemata were examined by means of smallest-space analysis. Similarities between men and women in couples with and without…

  11. Coupling regularizes individual units in noisy populations

    International Nuclear Information System (INIS)

    Ly Cheng; Ermentrout, G. Bard


    The regularity of a noisy system can modulate in various ways. It is well known that coupling in a population can lower the variability of the entire network; the collective activity is more regular. Here, we show that diffusive (reciprocal) coupling of two simple Ornstein-Uhlenbeck (O-U) processes can regularize the individual, even when it is coupled to a noisier process. In cellular networks, the regularity of individual cells is important when a select few play a significant role. The regularizing effect of coupling surprisingly applies also to general nonlinear noisy oscillators. However, unlike with the O-U process, coupling-induced regularity is robust to different kinds of coupling. With two coupled noisy oscillators, we derive an asymptotic formula assuming weak noise and coupling for the variance of the period (i.e., spike times) that accurately captures this effect. Moreover, we find that reciprocal coupling can regularize the individual period of higher dimensional oscillators such as the Morris-Lecar and Brusselator models, even when coupled to noisier oscillators. Coupling can have a counterintuitive and beneficial effect on noisy systems. These results have implications for the role of connectivity with noisy oscillators and the modulation of variability of individual oscillators.

  12. Circuit electromechanics with single photon strong coupling

    Energy Technology Data Exchange (ETDEWEB)

    Xue, Zheng-Yuan, E-mail:; Yang, Li-Na [Guangdong Provincial Key Laboratory of Quantum Engineering and Quantum Materials, and School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China); Zhou, Jian, E-mail: [Department of Electronic Communication Engineering, Anhui Xinhua University, Hefei 230088 (China); Guangdong Provincial Key Laboratory of Quantum Engineering and Quantum Materials, and School of Physics and Telecommunication Engineering, South China Normal University, Guangzhou 510006 (China)


    In circuit electromechanics, the coupling strength is usually very small. Here, replacing the capacitor in circuit electromechanics by a superconducting flux qubit, we show that the coupling among the qubit and the two resonators can induce effective electromechanical coupling which can attain the strong coupling regime at the single photon level with feasible experimental parameters. We use dispersive couplings among two resonators and the qubit while the qubit is also driven by an external classical field. These couplings form a three-wave mixing configuration among the three elements where the qubit degree of freedom can be adiabatically eliminated, and thus results in the enhanced coupling between the two resonators. Therefore, our work constitutes the first step towards studying quantum nonlinear effect in circuit electromechanics.

  13. Clinical processes in behavioral couples therapy. (United States)

    Fischer, Daniel J; Fink, Brandi C


    Behavioral couples therapy is a broad term for couples therapies that use behavioral techniques based on principles of operant conditioning, such as reinforcement. Behavioral shaping and rehearsal and acceptance are clinical processes found across contemporary behavioral couples therapies. These clinical processes are useful for assessment and case formulation, as well as teaching couples new methods of conflict resolution. Although these clinical processes assist therapists in achieving efficient and effective therapeutic change with distressed couples by rapidly stemming couples' corrosive affective exchanges, they also address the thoughts, emotions, and issues of trust and intimacy that are important aspects of the human experience in the context of a couple. Vignettes are provided to illustrate the clinical processes described. (PsycINFO Database Record (c) 2014 APA, all rights reserved).

  14. Coherence Phenomena in Coupled Optical Resonators (United States)

    Smith, D. D.; Chang, H.


    We predict a variety of photonic coherence phenomena in passive and active coupled ring resonators. Specifically, the effective dispersive and absorptive steady-state response of coupled resonators is derived, and used to determine the conditions for coupled-resonator-induced transparency and absorption, lasing without gain, and cooperative cavity emission. These effects rely on coherent photon trapping, in direct analogy with coherent population trapping phenomena in atomic systems. We also demonstrate that the coupled-mode equations are formally identical to the two-level atom Schrodinger equation in the rotating-wave approximation, and use this result for the analysis of coupled-resonator photon dynamics. Notably, because these effects are predicted directly from coupled-mode theory, they are not unique to atoms, but rather are fundamental to systems of coherently coupled resonators.

  15. Intermediate coupling collision strengths from LS coupled R-matrix elements

    International Nuclear Information System (INIS)

    Clark, R.E.H.


    Fine structure collision strength for transitions between two groups of states in intermediate coupling and with inclusion of configuration mixing are obtained from LS coupled reactance matrix elements (R-matrix elements) and a set of mixing coefficients. The LS coupled R-matrix elements are transformed to pair coupling using Wigner 6-j coefficients. From these pair coupled R-matrix elements together with a set of mixing coefficients, R-matrix elements are obtained which include the intermediate coupling and configuration mixing effects. Finally, from the latter R-matrix elements, collision strengths for fine structure transitions are computed (with inclusion of both intermediate coupling and configuration mixing). (Auth.)

  16. Welding shield for coupling heaters (United States)

    Menotti, James Louis


    Systems for coupling end portions of two elongated heater portions and methods of using such systems to treat a subsurface formation are described herein. A system may include a holding system configured to hold end portions of the two elongated heater portions so that the end portions are abutted together or located near each other; a shield for enclosing the end portions, and one or more inert gas inlets configured to provide at least one inert gas to flush the system with inert gas during welding of the end portions. The shield may be configured to inhibit oxidation during welding that joins the end portions together. The shield may include a hinged door that, when closed, is configured to at least partially isolate the interior of the shield from the atmosphere. The hinged door, when open, is configured to allow access to the interior of the shield.

  17. Determining chiral couplings at NLO

    International Nuclear Information System (INIS)

    Rosell, Ignasi


    We present a general method that allows to estimate the low-energy constants of Chiral Perturbation Theory up to next-to-leading corrections in the 1/N C expansion, that is, keeping full control of the renormalization scale dependence. As a first step we have determined L 8 and C 38 , the couplings related to the difference of the two-point correlation functions of two scalar and pseudoscalar currents, L 8 r (μ 0 ) = (0.6±0.4)·10 -3 and C 38 r (μ 0 ) = (2±6)·10 -6 , with μ 0 0.77 GeV. As in many effective approaches, one of the main ingredients of this method is the matching procedure: some comments related to this topic are presented here

  18. Seismic coupling of nuclear explosions

    International Nuclear Information System (INIS)

    Larson, D.B.


    The new Giant Magnet Experimental Facility employing digital recording of explosion induced motion has been constructed and successfully tested. Particle velocity and piezoresistance gage responses can be measured simultaneously thus providing the capability for determining the multi-component stress-strain history in the test material. This capability provides the information necessary for validation of computer models used in simulation of nuclear underground testing, chemical explosion testing, dynamic structural response, earth penetration response, and etc. This report discusses fully coupled and cavity decoupled explosions of the same energy (0.622 kJ) were carried out as experiments to study wave propagation and attenuation in polymethylmethacrylate (PMMA). These experiments produced particle velocity time histories at strains from 2 x 10 -3 to as low as 5.8 x 10 -6 . Other experiments in PMMA, reported recently by Stout and Larson 8 provide additional particle velocity data to strains of 10 -1

  19. Fluid-structure-coupling algorithm

    International Nuclear Information System (INIS)

    McMaster, W.H.; Gong, E.Y.; Landram, C.S.; Quinones, D.F.


    A fluid-structure-interaction algorithm has been developed and incorporated into the two dimensional code PELE-IC. This code combines an Eulerian incompressible fluid algorithm with a Lagrangian finite element shell algorithm and incorporates the treatment of complex free surfaces. The fluid structure, and coupling algorithms have been verified by the calculation of solved problems from the literature and from air and steam blowdown experiments. The code has been used to calculate loads and structural response from air blowdown and the oscillatory condensation of steam bubbles in water suppression pools typical of boiling water reactors. The techniques developed here have been extended to three dimensions and implemented in the computer code PELE-3D

  20. Coupled optical resonance laser locking. (United States)

    Burd, S C; du Toit, P J W; Uys, H


    We have demonstrated simultaneous laser frequency stabilization of a UV and IR laser, to coupled transitions of ions in the same spectroscopic sample, by detecting only the absorption of the UV laser. Separate signals for locking the different lasers are obtained by modulating each laser at a different frequency and using lock-in detection of a single photodiode signal. Experimentally, we simultaneously lock a 369 nm and a 935 nm laser to the (2)S(1/2) → (2)(P(1/2) and (2)D(3/2) → (3)D([3/2]1/2) transitions, respectively, of Yb(+) ions generated in a hollow cathode discharge lamp. Stabilized lasers at these frequencies are required for cooling and trapping Yb(+) ions, used in quantum information and in high precision metrology experiments. This technique should be readily applicable to other ion and neutral atom systems requiring multiple stabilized lasers.

  1. Acoustical coupling of lizard eardrums

    DEFF Research Database (Denmark)

    Christensen-Dalsgaard, Jakob; Manley, Geoffrey A


    Lizard ears are clear examples of two-input pressure-difference receivers, with up to 40-dB differences in eardrum vibration amplitude in response to ipsi- and contralateral stimulus directions. The directionality is created by acoustical coupling of the eardrums and interaction of the direct...... and indirect sound components on the eardrum. The ensuing pressure-difference characteristics generate the highest directionality of any similar-sized terrestrial vertebrate ear. The aim of the present study was to measure the gain of the direct and indirect sound components in three lizard species: Anolis...... sagrei and Basiliscus vittatus (iguanids) and Hemidactylus frenatus (gekkonid) by laser vibrometry, using either free-field sound or a headphone and coupler for stimulation. The directivity of the ear of these lizards is pronounced in the frequency range from 2 to 5 kHz. The directivity is ovoidal...

  2. Invasive tightly coupled processor arrays

    CERN Document Server



    This book introduces new massively parallel computer (MPSoC) architectures called invasive tightly coupled processor arrays. It proposes strategies, architecture designs, and programming interfaces for invasive TCPAs that allow invading and subsequently executing loop programs with strict requirements or guarantees of non-functional execution qualities such as performance, power consumption, and reliability. For the first time, such a configurable processor array architecture consisting of locally interconnected VLIW processing elements can be claimed by programs, either in full or in part, using the principle of invasive computing. Invasive TCPAs provide unprecedented energy efficiency for the parallel execution of nested loop programs by avoiding any global memory access such as GPUs and may even support loops with complex dependencies such as loop-carried dependencies that are not amenable to parallel execution on GPUs. For this purpose, the book proposes different invasion strategies for claiming a desire...

  3. Couples' fertility decision-making

    Directory of Open Access Journals (Sweden)

    Petra Stein


    Full Text Available Background: The decision about whether to start a family within a partnership can be viewed as a result of an interaction process. The influence of each of the partners in a couple differs depending on their individual preferences and intentions towards having children. Both of the partners additionally influence each other's fertility intentions and preferences. Objective: We specify, estimate, and test a model that examines the decision about whether to have a child as a choice that is made jointly by the two partners. The transition to the birth of a (further child is investigated with the explicit consideration of both the female partner and the male partner in the partnership context. Methods: An approach for modelling the interactive influences of the two actors in the decision-making process was proposed. A trivariate distribution consisting of both the female and the male partners' fertility intentions, as well as the joint generative decision, was modelled. A multivariate non-linear probit model was chosen and the problem of identification in estimating the relative effects of the actors was resolved. These parameters were used to assess the relative importance of each of the partners' intentions in the decision. We carried out the analysis with MPLUS. Data from the panel of intimate relationships and family dynamics (pairfam was used to estimate the model. Results: The biographical context of each of the partners in relation to their own as well as to their partner's fertility intentions was found to be of considerable importance. Of the significant individual and partner effects, the male partner was shown to have the greater influence. But the female partner was found to have stronger parameters overall and she ultimately has a veto power in the couple's final decision.

  4. Measuring Relative Coupling Strength in Circadian Systems. (United States)

    Schmal, Christoph; Herzog, Erik D; Herzel, Hanspeter


    Modern imaging techniques allow the monitoring of circadian rhythms of single cells. Coupling between these single cellular circadian oscillators can generate coherent periodic signals on the tissue level that subsequently orchestrate physiological outputs. The strength of coupling in such systems of oscillators is often unclear. In particular, effects on coupling strength by varying cell densities, by knockouts, and by inhibitor applications are debated. In this study, we suggest to quantify the relative coupling strength via analyzing period, phase, and amplitude distributions in ensembles of individual circadian oscillators. Simulations of different oscillator networks show that period and phase distributions become narrower with increasing coupling strength. Moreover, amplitudes can increase due to resonance effects. Variances of periods and phases decay monotonically with coupling strength, and can serve therefore as measures of relative coupling strength. Our theoretical predictions are confirmed by studying recently published experimental data from PERIOD2 expression in slices of the suprachiasmatic nucleus during and after the application of tetrodotoxin (TTX). On analyzing the corresponding period, phase, and amplitude distributions, we can show that treatment with TTX can be associated with a reduced coupling strength in the system of coupled oscillators. Analysis of an oscillator network derived directly from the data confirms our conclusions. We suggest that our approach is also applicable to quantify coupling in fibroblast cultures and hepatocyte networks, and for social synchronization of circadian rhythmicity in rodents, flies, and bees.

  5. Optimization of mixed quantum-classical dynamics: Time-derivative coupling terms and selected couplings

    International Nuclear Information System (INIS)

    Pittner, Jiri; Lischka, Hans; Barbatti, Mario


    The usage of time-derivative non-adiabatic coupling terms and partially coupled time-dependent equations are investigated to accelerate non-adiabatic dynamics simulations at multireference configuration interaction (MRCI) level. The quality of the results and computational costs are compared against non-adiabatic benchmark dynamics calculations using non-adiabatic coupling vectors. In the comparison between the time-derivative couplings and coupling vectors, deviations in the adiabatic population of individual trajectories were observed in regions of rapid variation of the coupling terms. They, however, affected the average adiabatic population to only about 5%. For small multiconfiguration spaces, dynamics with time-derivative couplings are significantly faster than those with coupling vectors. This relation inverts for larger configuration spaces. The use of the partially coupled equations approach speeds up the simulations significantly while keeping the deviations in the population below few percent. Imidazole and the methaniminium cation are used as test examples

  6. Magnetosphere - Ionosphere - Thermosphere (MIT) Coupling at Jupiter (United States)

    Yates, J. N.; Ray, L. C.; Achilleos, N.


    Jupiter's upper atmospheric temperature is considerably higher than that predicted by Solar Extreme Ultraviolet (EUV) heating alone. Simulations incorporating magnetosphere-ionosphere coupling effects into general circulation models have, to date, struggled to reproduce the observed atmospheric temperatures under simplifying assumptions such as azimuthal symmetry and a spin-aligned dipole magnetic field. Here we present the development of a full three-dimensional thermosphere model coupled in both hemispheres to an axisymmetric magnetosphere model. This new coupled model is based on the two-dimensional MIT model presented in Yates et al., 2014. This coupled model is a critical step towards to the development of a fully coupled 3D MIT model. We discuss and compare the resulting thermospheric flows, energy balance and MI coupling currents to those presented in previous 2D MIT models.

  7. Coupled oscillators with parity-time symmetry

    Energy Technology Data Exchange (ETDEWEB)

    Tsoy, Eduard N., E-mail:


    Different models of coupled oscillators with parity-time (PT) symmetry are studied. Hamiltonian functions for two and three linear oscillators coupled via coordinates and accelerations are derived. Regions of stable dynamics for two coupled oscillators are obtained. It is found that in some cases, an increase of the gain-loss parameter can stabilize the system. A family of Hamiltonians for two coupled nonlinear oscillators with PT-symmetry is obtained. An extension to high-dimensional PT-symmetric systems is discussed. - Highlights: • A generalization of a Hamiltonian system of linear coupled oscillators with the parity-time (PT) symmetry is suggested. • It is found that an increase of the gain-loss parameter can stabilize the system. • A family of Hamiltonian functions for two coupled nonlinear oscillators with PT-symmetry is obtained.

  8. Further development of the coupling model

    International Nuclear Information System (INIS)

    Kreuser, A.; Stiller, J.C.; Peschke, J.


    Uncertainties arising from different sources have to be considered for the quantification of common cause failures (CCFs). At GRS a CCF model (coupling model) has been developed for the estimation of CCF probabilities. An essential feature of the coupling model is the consideration of these uncertainties by using Bayesian estimation methods. Experiences from applying the coupling model to CCF event data over several years and analyzing the results in detail has led to improvements in the application of the model. In this paper the improved methodology of the coupling model is presented. Special emphasis is given to the description of the sources of uncertainties which are considered in the coupling model and the mathematical methodology, how these uncertainties are represented and propagated through the model. In closing topics of future improvements of the coupling models are discussed. (orig.)

  9. Infidelity in couples seeking marital therapy. (United States)

    Atkins, David C; Yi, Jean; Baucom, Donald H; Christensen, Andrew


    The revelation of an affair is often an emotionally explosive event for a couple, yet little is known about specific individual and relationship factors that accompany infidelity. The present study examined the qualities of individuals and couples that differentiate couples with (n = 19) and without (n = 115) infidelity using couples from a randomized clinical trial of marital therapy. Findings indicated that couples with infidelity showed greater marital instability, dishonesty, arguments about trust, narcissism, and time spent apart. Gender also proved to be a significant moderator of several effects. Men who had participated in affairs showed increased substance use, were older, and were more sexually dissatisfied. Results offer initial clues to concomitants of affairs for couple therapists. (c) 2005 APA, all rights reserved

  10. Chimera states: Effects of different coupling topologies (United States)

    Bera, Bidesh K.; Majhi, Soumen; Ghosh, Dibakar; Perc, Matjaž


    Collective behavior among coupled dynamical units can emerge in various forms as a result of different coupling topologies as well as different types of coupling functions. Chimera states have recently received ample attention as a fascinating manifestation of collective behavior, in particular describing a symmetry breaking spatiotemporal pattern where synchronized and desynchronized states coexist in a network of coupled oscillators. In this perspective, we review the emergence of different chimera states, focusing on the effects of different coupling topologies that describe the interaction network connecting the oscillators. We cover chimera states that emerge in local, nonlocal and global coupling topologies, as well as in modular, temporal and multilayer networks. We also provide an outline of challenges and directions for future research.


    International Nuclear Information System (INIS)



    Coupling correction at RHIC has been operationally achieved through a two-step process: using local triplet skew quadrupoles to compensate coupling corn rolled low-beta triplet quadrupoles, and minimizing the tune separation and residual coupling with orthogonal global skew quadrupole families. An application has been developed for global correction that allows skew quadrupole tuning and tune display with a choice of different tune measurement techniques, including tune-meter, Schottky and phase lock loop (PLL). Coupling effects have been analyzed by using 1024-turn (TBT) information from the beam position monitor (BPM) system. These data allow the reconstruction of the off-diagonal terms of the transfer matrix, a measure of global coupling. At both injection and storage energies, coordination of tune meter kicks with TBT acquisition at 322 BPW's in each ring allows the measurement of local coupling at all BPM locations

  12. Couples coping with discordant HIV status. (United States)

    Beckerman, Nancy L


    As we start the third decade of the human immunodeficiency virus/acquired immunodeficiency syndrome (HIV/AIDS) epidemic, how does HIV/AIDS affect the emotional lives of couples of mixed HIV status? This is a case report based on the findings of an exploratory research study of serodiscordant couples in the New York City area. It focuses on the issues confronting a particular couple who represent the salient issues in the lives of serodiscordant couples. This case report discusses the findings of a study that attempted to ascertain the central emotional challenges facing couples of mixed HIV status and discusses one case in particular that illustrates how these issues might commonly manifest themselves. Fear of HIV transmission, coping with uncertainty of potential illness, shifts in emotional intimacy, and dilemmas regarding how HIV has impacted reproductive alternatives were identified as the most commonly experienced emotional issues for the serodiscordant couple.

  13. Modeling of supermodes in coupled unstable resonators

    International Nuclear Information System (INIS)

    Townsend, S.S.


    A general formalism describing the supermodes of an array of N identical, circulantly coupled resonators is presented. The symmetry of the problem results in a reduction of the N coupled integral equations to N decoupled integral equations. Each independent integral equation defines a set of single-resonator modes derived for a hypothetical resonator whose geometry resembles a member of the real array with the exception that all coupling beams are replaced by feedback beams, each with a prescribed constant phase. A given array supermode consists of a single equivalent resonator mode appearing repetitively in each resonator with a prescribed relative phase between individual resonators. The specific array design chosen for example is that of N adjoint coupled confocal unstable resonators. The impact of coupling on the computer modeling of this system is discussed and computer results for the cases of two- and four-laser coupling are presented

  14. Improved formalism for precision Higgs coupling fits (United States)

    Barklow, Tim; Fujii, Keisuke; Jung, Sunghoon; Karl, Robert; List, Jenny; Ogawa, Tomohisa; Peskin, Michael E.; Tian, Junping


    Future e+e- colliders give the promise of model-independent determinations of the couplings of the Higgs boson. In this paper, we present an improved formalism for extracting Higgs boson couplings from e+e- data, based on the effective field theory description of corrections to the Standard Model. We apply this formalism to give projections of Higgs coupling accuracies for stages of the International Linear Collider and for other proposed e+e- colliders.

  15. Coupled mode theory of periodic waveguides arrays

    DEFF Research Database (Denmark)

    Lavrinenko, Andrei; Chigrin, Dmitry N.

    We apply the scalar coupled mode theory to the case of waveguides array consisting om two periodic waveguides. One of the waveguides is arbitrary shifted along another. A longitudinal shift acts as a parameter in the coupled mode theory. The proposed theory explains peculiarities of modes dispers...... dispersion and transmission in coupled periodic waveguides systems. Analytical results are compared with the numerical ones obtained by the plane wave expansion and FDTD methods....

  16. Improved formalism for precision Higgs coupling fits

    International Nuclear Information System (INIS)

    Barklow, Tim; Peskin, Michael E.; Jung, Sunghoon; Tian, Junping


    Future e + e - colliders give the promise of model-independent determinations of the couplings of the Higgs boson. In this paper, we present an improved formalism for extracting Higgs boson couplings from e + e - data, based on the Effective Field Theory description of corrections to the Standard Model. We apply this formalism to give projections of Higgs coupling accuracies for stages of the International Linear Collider and for other proposed e + e - colliders.

  17. Renormalization group equations with multiple coupling constants

    International Nuclear Information System (INIS)

    Ghika, G.; Visinescu, M.


    The main purpose of this paper is to study the renormalization group equations of a renormalizable field theory with multiple coupling constants. A method for the investigation of the asymptotic stability is presented. This method is applied to a gauge theory with Yukawa and self-quartic couplings of scalar mesons in order to find the domains of asymptotic freedom. An asymptotic expansion for the solutions which tend to the origin of the coupling constants is given

  18. Axial forces in centrifugal compressor couplings (United States)

    Ivanov, A. N.; Ivanov, N. M.; Yun, V. K.


    The article presents the results of the theoretical and experimental investigation of axial forces arising in the toothed and plate couplings of centrifugal compressor shaft lines. Additional loads on the thrust bearing are considered that can develop in the toothed couplings as a result of coupled rotors misalignment. Design relationships to evaluate the level of axial forces and recommendations for their reduction in the operating conditions are given.

  19. Hadronic couplings of open beauty states

    International Nuclear Information System (INIS)

    Ram, S.N.; Singh, C.P.


    Strong interaction coupling parameters of particles with beauty quantum number are obtained using dispersion sum rules in various forms, e.g. current algebra sum rules, superconvergence sum rules and finite energy sum rules etc. These sum rules lead to a set of algebraic relations among masses and coupling constants. We compare the hadronic couplings of beautiful particles as obtained from various techniques and discuss their implications on the hadronic production of these states. (author)

  20. An analytic Pade-motivated QCD coupling

    International Nuclear Information System (INIS)

    Martinez, H. E.; Cvetic, G.


    We consider a modification of the Minimal Analytic (MA) coupling of Shirkov and Solovtsov. This modified MA (mMA) coupling reflects the desired analytic properties of the space-like observables. We show that an approximation by Dirac deltas of its discontinuity function ρ is equivalent to a Pade(rational) approximation of the mMA coupling that keeps its analytic structure. We propose a modification to mMA that, as preliminary results indicate, could be an improvement in the evaluation of low-energy observables compared with other analytic couplings.

  1. Topology Optimisation for Coupled Convection Problems

    DEFF Research Database (Denmark)

    Alexandersen, Joe; Andreasen, Casper Schousboe; Aage, Niels

    stabilised finite elements implemented in a parallel multiphysics analysis and optimisation framework DFEM [1], developed and maintained in house. Focus is put on control of the temperature field within the solid structure and the problems can therefore be seen as conjugate heat transfer problems, where heat...... conduction governs in the solid parts of the design domain and couples to convection-dominated heat transfer to a surrounding fluid. Both loosely coupled and tightly coupled problems are considered. The loosely coupled problems are convection-diffusion problems, based on an advective velocity field from...

  2. RF and microwave coupled-line circuits

    CERN Document Server

    Mongia, R K; Bhartia, P; Hong, J; Gupta, K C


    This extensively revised edition of the 1999 Artech House classic, RF and Microwave Coupled-Line Circuits, offers you a thoroughly up-to-date understanding of coupled line fundamentals, explaining their applications in designing microwave and millimeter-wave components used in today's communications, microwave, and radar systems. The Second Edition includes a wealth of new material, particularly relating to applications. You find brand new discussions on a novel simple design technique for multilayer coupled circuits, high pass filters using coupled lines, software packages used for filter des

  3. Gauge Coupling Unification with Partly Composite Matter

    International Nuclear Information System (INIS)

    Gherghetta, Tony


    It is shown how gauge coupling unification can occur in models with partly composite matter. The particle states which are composite only contribute small logarithmns to the running of gauge couplings, while the elementary states contribute the usual large logarithmns. This introduces a new differential running contribution to the gauge couplings from partly composite SU(5) matter multiplets. In particular, for partly supersymmetric models, the incomplete SU(5) elementary matter multiplets restore gauge coupling unification even though the usual elementary gaugino and Higgsino contributions need not be present

  4. Electrostatic coupling of ion pumps. (United States)

    Nieto-Frausto, J; Lüger, P; Apell, H J


    In this paper the electrostatic interactions between membrane-embedded ion-pumps and their consequences for the kinetics of pump-mediated transport processes have been examined. We show that the time course of an intrinsically monomolecular transport reaction can become distinctly nonexponential, if the reaction is associated with charge translocation and takes place in an aggregate of pump molecules. First we consider the electrostatic coupling of a single dimer of ion-pumps embedded in the membrane. Then we apply the treatment to the kinetic analysis of light-driven proton transport by bacteriorhodopsin which forms two-dimensional hexagonal lattices. Finally, for the case of nonordered molecules, we also consider a model in which the pumps are randomly distributed over the nodes of a lattice. Here the average distance is equal to that deduced experimentally and the elemental size of the lattice is the effective diameter of one single pump. This latter model is applied to an aggregate of membrane-embedded Na, K- and Ca-pumps. In all these cases the electrostatic potential considered is the exact solution calculated from the method of electrical images for a plane membrane of finite thickness immersed in an infinite aqueous solution environment. The distributions of charges (ions or charged binding sites) are considered homogeneous or discrete in the membrane and/or in the external solution. In the case of discrete distributions we compare the results from a mean field approximation and a stochastic simulation.

  5. Advanced screening of electrode couples (United States)

    Giner, J. D.; Cahill, K.


    The chromium (Cr(3+)/Cr(2+)) redox couple (electrolyte and electrode) was investigated to determine its suitability as negative electrode for the iron (Fe(3+)/Fe(2+))-chromium (Cr(3+)/Cr(2+)) redox flow battery. Literature search and laboratory investigation established that the solubility and stability of aqueous acidic solutions of chromium(3) chloride and chromium(2) chloride are sufficient for redox battery application. Four categories of electrode materials were tested; namely, metals and metalloid materials (elements and compounds), alloys, plated materials, and Teflon-bonded materials. In all, the relative performance of 26 candidate electrode materials was evaluated on the basis of slow scan rate linear sweep voltammetry in stirred solution. No single material tested gave both acceptable anodic an acceptable cathodic performance. However, the identification of lead as a good cathodic electrocatalyst and gold as a good anodic electrocatalyst led to the invention of the lead/gold combination electrocatalyst. This type of catalyst can be fabricated in several ways and appears to offer the advantages of each metal without the disadvantages associated with their use as single materials. This lead/gold electrocatalyst was tested by NASA-Lewis Research Center in complete, flowing, redox batteries comprising a stack of several cells. A large improvement in the battery's coulombic and energy efficiency was observed.

  6. Coupling of Plasmas and Liquids (United States)

    Lindsay, Alexander David

    Plasma-liquids have exciting applications to several important socioeconomic areas, including agriculture, water treatment, and medicine. To realize their application potential, the basic physical and chemical phenomena of plasma-liquid systems must be better understood. Additionally, system designs must be optimized in order to maximize fluxes of critical plasma species to the liquid phase. With objectives to increase understanding of these systems and optimize their applications, we have performed both comprehensive modeling and experimental work. To date, models of plasma-liquids have focused on configurations where diffusion is the dominant transport process in both gas and liquid phases. However, convection plays a key role in many popular plasma source designs, including jets, corona discharges, and torches. In this dissertation, we model momentum, heat, and neutral species mass transfer in a convection-dominated system based on a corona discharge. We show that evaporative cooling produced by gas-phase convection can lead to a significant difference between gas and liquid phase bulk temperatures. Additionally, convection induced in the liquid phase by the gas phase flow substantially increases interfacial mass transfer of hydrophobic species like NO and NO2. Finally, liquid kinetic modeling suggests that concentrations of highly reactive species like OH and ONOOH are several orders of magnitude higher at the interface than in the solution bulk. Subsequent modeling has focused on coupling discharge physics with species transport at and through the interface. An assumption commonly seen in the literature is that interfacial loss coefficients of charged species like electrons are equal to unity. However, there is no experimental evidence to either deny or support this assumption. Without knowing the true interfacial behavior of electrons, we have explored the effects on key plasma-liquid variables of varying interfacial parameters like the electron and energy


    Directory of Open Access Journals (Sweden)

    Rozzana Sánchez-Aragón


    Full Text Available There are few studies that focus on the influence that contextual aspects have in marital satisfaction (Meléndez, Aleixandre,& Saez, 1993.However, nowadays the reasons for a divorce are related to the actual social situation (Khalfani-Cox, 2009. Thus, the aim of this study is to identify contextual aspects that are associ-ated with marital satisfaction; in order to accomplish this objective, we conducted two studies. The purpose of the first study was to identify recent context aspects that influence marital satisfaction throughout an open question, which was ap-plied to 131 people. The results indicate that the dimensions of economic, labor time, home safety, stress in the environment, and the place where they live influ-ence marital satisfaction. In the second study, based on the information obtained previously, we formed indicators that were applied together with a scale of mari-tal satisfaction to105 couples. The results show that the context is closely related to marital satisfaction. In addition, the results determine that men give greater importance to the economic and employment situation than women do. Overall, this study indicates that sex differences prove that the roles and cultural expecta-tions have remained in the dynamics of the relationship and thus influence the assessment of marital satisfaction.

  8. A Tightly Coupled Non-Equilibrium Magneto-Hydrodynamic Model for Inductively Coupled RF Plasmas (United States)


    development a tightly coupled magneto-hydrodynamic model for Inductively Coupled Radio- Frequency (RF) Plasmas. Non Local Thermodynamic Equilibrium (NLTE...for Inductively Coupled Radio-Frequency (RF) Plasmas. Non Local Thermodynamic Equilibrium (NLTE) effects are described based on a hybrid State-to-State...Inductively Coupled Plasma (ICP) torches have wide range of possible applications which include deposition of metal coatings, synthesis of ultra-fine powders

  9. Dual-Career Couples: Keeping Them Together. (United States)

    Wolf-Wendel, Lisa E.; Twombly, Susan; Rice, Suzanne


    Reports results of a survey of 360 chief academic officers at member institutions of the American Association of Colleges and Universities regarding their policies and practices for assisting dual-career couples. Examines the motivations, barriers, consequences, and policy implications of institutional responses to dual-career couples. (DB)

  10. Timed intercourse for couples trying to conceive

    NARCIS (Netherlands)

    Manders, M.; McLindon, L.; Schulze, B.; Beckmann, M.M.; Kremer, J.A.M.; Farquhar, C.


    BACKGROUND: Fertility problems are very common, as subfertility affects about 10% to 15% of couples trying to conceive. There are many factors that may impact a couple's ability to conceive and one of these may be incorrect timing of intercourse. Conception is only possible from approximately five

  11. Lie Algebras for Constructing Nonlinear Integrable Couplings

    International Nuclear Information System (INIS)

    Zhang Yufeng


    Two new explicit Lie algebras are introduced for which the nonlinear integrable couplings of the Giachetti-Johnson (GJ) hierarchy and the Yang hierarchy are obtained, respectively. By employing the variational identity their Hamiltonian structures are also generated. The approach presented in the paper can also provide nonlinear integrable couplings of other soliton hierarchies of evolution equations. (general)

  12. Chromium Speciation Analysis by Ion Chromatography Coupled ...

    African Journals Online (AJOL)

    Two methods coupling ion chromatography with inductively coupled plasma - optical emission spectroscopy (ICP-OES) were developed for the simultaneous separation and determination of Cr(III) and Cr(VI) species. In the first method, anion chromatography with sodium bicarbonate/carbonate solution as the eluent was ...

  13. Phase locking of optically coupled lasers

    International Nuclear Information System (INIS)

    Glova, A F


    A review of studies of the properties of radiation from optically coupled lasers is presented. The methods for phase locking the fields in optically coupled lasers of different types are considered and the methods for supermode selection and correction of the radiation pattern are discussed. (review)

  14. Chimera states in Gaussian coupled map lattices (United States)

    Li, Xiao-Wen; Bi, Ran; Sun, Yue-Xiang; Zhang, Shuo; Song, Qian-Qian


    We study chimera states in one-dimensional and two-dimensional Gaussian coupled map lattices through simulations and experiments. Similar to the case of global coupling oscillators, individual lattices can be regarded as being controlled by a common mean field. A space-dependent order parameter is derived from a self-consistency condition in order to represent the collective state.

  15. Compensation of coupling in the SSC complex

    International Nuclear Information System (INIS)

    Pilat, F.; Bourianoff, G.


    This paper will describe a study of the coupling effects and their compensation by means of local depending techniques for some of the accelerators in the SSC Complex. Results concerning corrections and decoupling for the Low Energy and Medium Energy Boosters will be compared to results obtained for the Collider Ring. Some preliminary experimental data about measurement of coupling quantities will also be presented

  16. Identical synchronization of coupled Rossler systems

    DEFF Research Database (Denmark)

    Yanchuk, S.; Maistrenko, Y.; Mosekilde, Erik


    Analyzing the transverse stability of low periodic orbits embedded in the synchronized chaotic state for a system of two coupled Rössler oscillators, we obtain the conditions for synchronization and determine the coupling parameters for which riddled basins of attraction may arise. It is shown how...

  17. Compensation of oscillation coupling induced by solenoids

    International Nuclear Information System (INIS)

    Zelinskij, A.Yu.; Karnaukhov, I.M.; Shcherbakov, A.A.


    Methods for construction of various schemes of oscillation coupling compensation, induced by solenoids in charged particle storage rings, are described. Peculiarities of magnetic structure, enabling to localize oscillation coupling in wide energy range are discussed. Results of calculation of compensation schemes for design of NR-2000 storage ring spin rotation are presented

  18. Locomotive Crash Energy Management Coupling Tests (United States)


    This paper describes the results of the CEM equipped locomotive coupling tests. In this set of tests, a moving CEM locomotive was coupled to a standing cab car. The primary objective was to demonstrate the robustness of the PBC design and determine t...

  19. Bidirectional communication using delay coupled chaotic directly ...

    Indian Academy of Sciences (India)

    A symmetric bidirectional coupling is identified as a suitable method for isochronal synchronization of such lasers. The optimum values of coupling and feedback strength that can provide maximum quality of synchronization are identified. This method is successfully employed for encoding/decoding both analog and digital ...

  20. Developmental Issues in Counseling With Couples. (United States)

    Seligman, Linda; Deutsch, Marjorie B.

    Marriages, just like the individuals in them, go through stages of development. Understanding these relatively predictable stages can be helpful to couples, by allaying apprehension, promoting preparation for change, and putting fluctuations into perspective. Research on marital stages and experiences in counseling couples suggest that marriages…

  1. Subfecundity in overweight and obese couples

    DEFF Research Database (Denmark)

    Ramlau-Hansen, C H; Thulstrup, A M; Bonde, J P


    BACKGROUND: Recent studies indicate that not only women's but also men's obesity has adverse effects on fecundity and since fecundity is a couple concept, we examined fecundity in relation to overweight and obesity of the couple. We also examined the association between weight changes and fecundi...

  2. When Couples Divorce: Issues for Counselors. (United States)

    Chambliss, Catherine

    Couples counseling is about both saving and optimally ending relationships. Some of the factors affecting the counselor's role in couples therapy are addressed in this paper. It opens with a listing of the objectives of counseling, such as the need to remain neutral. Some of the societal influences on divorce rate are discussed, along with…

  3. Transient chaos in weakly coupled Josephson junctions

    Energy Technology Data Exchange (ETDEWEB)

    Koch, B P; Bruhn, B


    This paper considers periodic excitations and coupling of nonlinear Josephson oscillators. The Melnikov method is used to prove the existence of horseshoes in the dynamics. The coupling of two systems yields a reduction of the chaos threshold in comparison with the corresponding threshold of a single system. For some selected parameter values the theoretical predictions are checked by numerical methods.

  4. Dynamics of unidirectionally coupled bistable Henon maps

    International Nuclear Information System (INIS)

    Sausedo-Solorio, J.M.; Pisarchik, A.N.


    We study dynamics of two bistable Henon maps coupled in a master-slave configuration. In the case of coexistence of two periodic orbits, the slave map evolves into the master map state after transients, which duration determines synchronization time and obeys a -1/2 power law with respect to the coupling strength. This scaling law is almost independent of the map parameter. In the case of coexistence of chaotic and periodic attractors, very complex dynamics is observed, including the emergence of new attractors as the coupling strength is increased. The attractor of the master map always exists in the slave map independently of the coupling strength. For a high coupling strength, complete synchronization can be achieved only for the attractor similar to that of the master map. -- Highlights: → We study dynamics of two bistable Henon maps coupled in a master-slave configuration. → Synchronization time for periodic orbits obeys a -1/2 power law with respect to coupling. → For a high coupling strength, the slave map remains bistable. → Complete synchronization can be achieved only when both maps stay at the same attractor.

  5. Rayleigh scattering in coupled microcavities: theory. (United States)

    Vörös, Zoltán; Weihs, Gregor


    In this paper we theoretically study how structural disorder in coupled semiconductor heterostructures influences single-particle scattering events that would otherwise be forbidden by symmetry. We extend the model of Savona (2007 J. Phys.: Condens. Matter 19 295208) to describe Rayleigh scattering in coupled planar microcavity structures, and find that effective filter theories can be ruled out.

  6. Large N baryons, strong coupling theory, quarks

    International Nuclear Information System (INIS)

    Sakita, B.


    It is shown that in QCD the large N limit is the same as the static strong coupling limit. By using the static strong coupling techniques some of the results of large N baryons are derived. The results are consistent with the large N SU(6) static quark model. (author)

  7. Generalized coupling in the Kuramoto model

    DEFF Research Database (Denmark)

    Filatrella, G.; Pedersen, Niels Falsig; Wiesenfeld, K.


    We propose a modification of the Kuramoto model to account for the effective change in the coupling constant among the oscillators, as suggested by some experiments on Josephson junction, laser arrays, and mechanical systems, where the active elements are turned on one by one. The resulting model...... with the behavior of Josephson junctions coupled via a cavity....

  8. Coupling single emitters to quantum plasmonic circuits

    DEFF Research Database (Denmark)

    Huck, Alexander; Andersen, Ulrik Lund


    In recent years, the controlled coupling of single-photon emitters to propagating surface plasmons has been intensely studied, which is fueled by the prospect of a giant photonic nonlinearity on a nanoscaled platform. In this article, we will review the recent progress on coupling single emitters...

  9. Tool-change coupling for robots

    International Nuclear Information System (INIS)

    Cooper, C.


    A coupling device for use in enabling a robotic unit to couple automatically with any one of a number of tools, comprises two coupling parts connected respectively to the tool and the arm. The two parts can be brought into interengaged relationship by appropriate manipulation of the arm and can be locked together by means of a locking element, controlled by piston and cylinder assembly which enters a tapered bore in a spigot after the spigot, which is mounted on the coupling part, has entered a bore in the other coupling part. The parts also incorporate registering passages for providing continuity of pressurised air supply between the robotic unit and a fluid-powered device incorporated in the tool. (author)

  10. Strong Coupling between Plasmons and Organic Semiconductors

    Directory of Open Access Journals (Sweden)

    Joel Bellessa


    Full Text Available In this paper we describe the properties of organic material in strong coupling with plasmon, mainly based on our work in this field of research. The strong coupling modifies the optical transitions of the structure, and occurs when the interaction between molecules and plasmon prevails on the damping of the system. We describe the dispersion relation of different plasmonic systems, delocalized and localized plasmon, coupled to aggregated dyes and the typical properties of these systems in strong coupling. The modification of the dye emission is also studied. In the second part, the effect of the microscopic structure of the organics, which can be seen as a disordered film, is described. As the different molecules couple to the same plasmon mode, an extended coherent state on several microns is observed.

  11. Non-minimally coupled tachyon and inflation

    International Nuclear Information System (INIS)

    Piao Yunsong; Huang Qingguo; Zhang Xinmin; Zhang Yuanzhong


    In this Letter, we consider a model of tachyon with a non-minimal coupling to gravity and study its cosmological effects. Regarding inflation, we show that only for a specific coupling of tachyon to gravity this model satisfies observations and solves various problems which exist in the single and multi tachyon inflation models. But noting in the string theory the coupling coefficient of tachyon to gravity is of order g s , which in general is very small, we can hardly expect that the non-minimally coupling of tachyon to gravity could provide a reasonable tachyon inflation scenario. Our work may be a meaningful try for the cosmological effect of tachyon non-minimally coupled to gravity

  12. Couples with dementia: Positioning the 'we'. (United States)

    Hydén, Lars-Christer; Nilsson, Elin


    The aim of this article is to investigate how spouses in couples with dementia position themselves in relation to each other by analysing their use of pronouns, especially the we. The study uses joint interviews with 11 couples. Based on a quantitative analysis of pronoun use, it is argued that the pronoun we is used by all the spouses; however, it is used less frequently by the spouses with dementia in comparison with healthy spouses. A qualitative analysis of the use of the pronoun we shows that the spouses position, experience and consider themselves as a couple and that they position and experience themselves as individuals in relation to the couple. One of the challenges for couples with dementia is to be able to retain a we in face of the progression of the dementia disease. By positioning themselves in various ways, the spouses establish and negotiate quite a complex and emotionally charged web of relationships. © The Author(s) 2013.

  13. Updated Global Analysis of Higgs Couplings

    CERN Document Server

    Ellis, John


    There are many indirect and direct experimental indications that the new particle H discovered by the ATLAS and CMS Collaborations has spin zero and (mostly) positive parity, and that its couplings to other particles are correlated with their masses. Beyond any reasonable doubt, it is a Higgs boson, and here we examine the extent to which its couplings resemble those of the single Higgs boson of the Standard Model. Our global analysis of its couplings to fermions and massive bosons determines that they have the same relative sign as in the Standard Model. We also show directly that these couplings are highly consistent with a dependence on particle masses that is linear to within a few %, and scaled by the conventional electroweak symmetry-breaking scale to within 10%. We also give constraints on loop-induced couplings, on the total Higgs decay width, and on possible invisible decays of the Higgs boson under various assumptions.

  14. Temporality of couple conflict and relationship perceptions. (United States)

    Johnson, Matthew D; Horne, Rebecca M; Hardy, Nathan R; Anderson, Jared R


    Using 5 waves of longitudinal survey data gathered from 3,405 couples, the present study investigates the temporal associations between self-reported couple conflict (frequency and each partner's constructive and withdrawing behaviors) and relationship perceptions (satisfaction and perceived instability). Autoregressive cross-lagged model results revealed couple conflict consistently predicted future relationship perceptions: More frequent conflict and withdrawing behaviors and fewer constructive behaviors foretold reduced satisfaction and conflict frequency and withdrawal heightened perceived instability. Relationship perceptions also shaped future conflict, but in surprising ways: Perceptions of instability were linked with less frequent conflict, and male partner instability predicted fewer withdrawing behaviors for female partners. Higher satisfaction from male partners also predicted more frequent and less constructive conflict behavior in the future. These findings illustrate complex bidirectional linkages between relationship perceptions and couple conflict behaviors in the development of couple relations. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

  15. Vinyldisiloxanes: their synthesis, cross coupling and applications. (United States)

    Sore, Hannah F; Boehner, Christine M; Laraia, Luca; Logoteta, Patrizia; Prestinari, Cora; Scott, Matthew; Williams, Katharine; Galloway, Warren R J D; Spring, David R


    During the studies towards the development of pentafluorophenyldimethylsilanes as a novel organosilicon cross coupling reagent it was revealed that the active silanolate and the corresponding disiloxane formed rapidly under basic conditions. The discovery that disiloxanes are in equilibrium with the silanolate led to the use of disiloxanes as cross coupling partners under fluoride free conditions. Our previous report focused on the synthesis and base induced cross coupling of aryl substituted vinyldisiloxanes with aryl halides; good yields and selectivities were achieved. As a continuation of our research, studies into the factors which influence the successful outcome of the cross coupling reaction with both alkyl and aryl substituted vinyldisiloxanes were examined and a proposed mechanism discussed. Further investigation into expanding the breadth and diversity of substituted vinyldisiloxanes in cross coupling was explored and applied to the synthesis of unsymmetrical trans-stilbenes and cyclic structures containing the trans-alkene architecture.

  16. Holomorphic Yukawa couplings in heterotic string theory

    Energy Technology Data Exchange (ETDEWEB)

    Blesneag, Stefan [Rudolf Peierls Centre for Theoretical Physics, Oxford University,1 Keble Road, Oxford, OX1 3NP (United Kingdom); Buchbinder, Evgeny I. [The University of Western Australia,35 Stirling Highway, Crawley WA 6009 (Australia); Candelas, Philip [Mathematical Institute, University of Oxford,Andrew Wiles Building, Radcliffe Observatory Quarter, Woodstock Road, Oxford, OX2 6GG (United Kingdom); Lukas, Andre [Rudolf Peierls Centre for Theoretical Physics, Oxford University,1 Keble Road, Oxford, OX1 3NP (United Kingdom)


    We develop techniques, based on differential geometry, to compute holomorphic Yukawa couplings for heterotic line bundle models on Calabi-Yau manifolds defined as complete intersections in projective spaces. It is shown explicitly how these techniques relate to algebraic methods for computing holomorphic Yukawa couplings. We apply our methods to various examples and evaluate the holomorphic Yukawa couplings explicitly as functions of the complex structure moduli. It is shown that the rank of the Yukawa matrix can decrease at specific loci in complex structure moduli space. In particular, we compute the up Yukawa coupling and the singlet-Higgs-lepton trilinear coupling in the heterotic standard model described in ref.

  17. Strong Coupling Corrections in Quantum Thermodynamics (United States)

    Perarnau-Llobet, M.; Wilming, H.; Riera, A.; Gallego, R.; Eisert, J.


    Quantum systems strongly coupled to many-body systems equilibrate to the reduced state of a global thermal state, deviating from the local thermal state of the system as it occurs in the weak-coupling limit. Taking this insight as a starting point, we study the thermodynamics of systems strongly coupled to thermal baths. First, we provide strong-coupling corrections to the second law applicable to general systems in three of its different readings: As a statement of maximal extractable work, on heat dissipation, and bound to the Carnot efficiency. These corrections become relevant for small quantum systems and vanish in first order in the interaction strength. We then move to the question of power of heat engines, obtaining a bound on the power enhancement due to strong coupling. Our results are exemplified on the paradigmatic non-Markovian quantum Brownian motion.

  18. Acquired Immune Deficiency Syndrome: A Preliminary Examination of the Effects on Gay Couples and Coupling. (United States)

    Carl, Douglas


    The Acquired Immune Deficiency Syndrome (AIDS) epidemic significantly influences attitudes about life and lifestyles. Homosexuals have to give increased consideration to coupling, the nature of coupled relationships, sex and intimacy, and death long before the normal time. Discusses impact of AIDS on the early stages of gay coupling and on the…

  19. Intimate Partner Violence in Interracial Couples: A Comparison to White and Ethnic Minority Monoracial Couples (United States)

    Fusco, Rachel A.


    The number of interracial couples in the U.S. is growing, but they often receive little support. Although previous studies have explored the relationship between low social support and decreased relationship satisfaction in interracial couples, there are few studies on intimate partner violence (IPV) in these couples. To better understand IPV in…

  20. Comparison of coupled mode theory and FDTD simulations of coupling between bent and straight optical waveguides

    NARCIS (Netherlands)

    Bertolotti, M.; Symes, W.W.; Stoffer, Remco; Hiremath, K.R.; Driessen, A.; Michelotti, F; Hammer, Manfred

    Analysis of integrated optical cylindrical microresonators involves the coupling between a straight waveguide and a bent waveguide. Our (2D) variant of coupled mode theory is based on analytically represented mode profiles. With the bend modes expressed in Cartesian coordinates, coupled mode

  1. FOREWORD: Imaging from coupled physics Imaging from coupled physics (United States)

    Arridge, S. R.; Scherzer, O.


    Due to the increased demand for tomographic imaging in applied sciences, such as medicine, biology and nondestructive testing, the field has expanded enormously in the past few decades. The common task of tomography is to image the interior of three-dimensional objects from indirect measurement data. In practical realizations, the specimen to be investigated is exposed to probing fields. A variety of these, such as acoustic, electromagnetic or thermal radiation, amongst others, have been advocated in the literature. In all cases, the field is measured after interaction with internal mechanisms of attenuation and/or scattering and images are reconstructed using inverse problems techniques, representing spatial maps of the parameters of these perturbation mechanisms. In the majority of these imaging modalities, either the useful contrast is of low resolution, or high resolution images are obtained with limited contrast or quantitative discriminatory ability. In the last decade, an alternative phenomenon has become of increasing interest, although its origins can be traced much further back; see Widlak and Scherzer [1], Kuchment and Steinhaur [2], and Seo et al [3] in this issue for references to this historical context. Rather than using the same physical field for probing and measurement, with a contrast caused by perturbation, these methods exploit the generation of a secondary physical field which can be measured in addition to, or without, the often dominating effect of the primary probe field. These techniques are variously called 'hybrid imaging' or 'multimodality imaging'. However, in this article and special section we suggest the term 'imaging from coupled physics' (ICP) to more clearly distinguish this methodology from those that simply measure several types of data simultaneously. The key idea is that contrast induced by one type of radiation is read by another kind, so that both high resolution and high contrast are obtained simultaneously. As with all

  2. APROS couplings from core to containment

    International Nuclear Information System (INIS)

    Puska, E.K.; Ylijoki, J.


    APROS simulation environment is able to describe the 1-D and 3-D neutronics of the reactor core. It is also able to describe the thermal hydraulics of the core and circuits either with 5- equation or 6-equation thermal hydraulics. It can also describe the plant automation and electrical systems, as well as the behaviour of the containment. The peculiar feature of APROS in comparison to other coupled systems is that all parts in the coupled system are described with the same code instead of coupling two or three separate codes together with information exchange between the separate codes. The most recent possibility is the coupled calculation of the process and the containment. The more traditional coupling, the coupling of the process containing both the process description and the automation description with more or less detailed description of the 3-D core either for safety analysis or real-time simulation purposes has been discussed in previous work. The paper presents and discusses the capabilities of the code in coupling the plant process and automation description with the plant containment description with two example transient cases. An improved boron concentration solution with second order upwind discretization has been recently included in APROS. An example on the increased accuracy acquired in the 3-D core model has been included. (authors)

  3. RNA structure and scalar coupling constants

    Energy Technology Data Exchange (ETDEWEB)

    Tinoco, I. Jr.; Cai, Z.; Hines, J.V.; Landry, S.M.; SantaLucia, J. Jr.; Shen, L.X.; Varani, G. [Univ. of California, Berkeley, CA (United States)


    Signs and magnitudes of scalar coupling constants-spin-spin splittings-comprise a very large amount of data that can be used to establish the conformations of RNA molecules. Proton-proton and proton-phosphorus splittings have been used the most, but the availability of {sup 13}C-and {sup 15}N-labeled molecules allow many more coupling constants to be used for determining conformation. We will systematically consider the torsion angles that characterize a nucleotide unit and the coupling constants that depend on the values of these torsion angles. Karplus-type equations have been established relating many three-bond coupling constants to torsion angles. However, one- and two-bond coupling constants can also depend on conformation. Serianni and coworkers measured carbon-proton coupling constants in ribonucleosides and have calculated their values as a function of conformation. The signs of two-bond coupling can be very useful because it is easier to measure a sign than an accurate magnitude.

  4. Reduction of coupling parameters and duality

    International Nuclear Information System (INIS)

    Oehme, R.; Max-Planck-Institut fuer Physik, Muenchen


    The general method of the reduction in the number of coupling parameters is discussed. Using renormalization group invariance, theories with several independent couplings are related to a set of theories with a single coupling parameter. The reduced theories may have particular symmetries, or they may not be related to any known symmetry. The method is more general than the imposition of invariance properties. Usually, there are only a few reduced theories with an asymptotic power series expansion corresponding to a renormalizable Lagrangian. There also exist 'general' solutions containing non-integer powers and sometimes logarithmic factors. As an example for the use of the reduction method, the dual magnetic theories associated with certain supersymmetric gauge theories are discussed. They have a superpotential with a Yukawa coupling parameter. This parameter is expressed as a function of the gauge coupling. Given some standard conditions, a unique, isolated power series solution of the reduction equations is obtained. After reparameterization, the Yukawa coupling is proportional to the square of the gauge coupling parameter. The coefficient is given explicitly in terms of the numbers of colors and flavors. 'General' solutions with non-integer powers are also discussed. A brief list is given of other applications of the reduction method. (orig.)

  5. Biologically inspired coupled antenna beampattern design

    Energy Technology Data Exchange (ETDEWEB)

    Akcakaya, Murat; Nehorai, Arye, E-mail: makcak2@ese.wustl.ed, E-mail: nehorai@ese.wustl.ed [Department of Electrical and Systems Engineering, Washington University in St Louis, St Louis, MO 63130 (United States)


    We propose to design a small-size transmission-coupled antenna array, and corresponding radiation pattern, having high performance inspired by the female Ormia ochracea's coupled ears. For reproduction purposes, the female Ormia is able to locate male crickets' call accurately despite the small distance between its ears compared with the incoming wavelength. This phenomenon has been explained by the mechanical coupling between the Ormia's ears, which has been modeled by a pair of differential equations. In this paper, we first solve these differential equations governing the Ormia ochracea's ear response, and convert the response to the pre-specified radio frequencies. We then apply the converted response of the biological coupling in the array factor of a uniform linear array composed of finite-length dipole antennas, and also include the undesired electromagnetic coupling due to the proximity of the elements. Moreover, we propose an algorithm to optimally choose the biologically inspired coupling for maximum array performance. In our numerical examples, we compute the radiation intensity of the designed system for binomial and uniform ordinary end-fire arrays, and demonstrate the improvement in the half-power beamwidth, sidelobe suppression and directivity of the radiation pattern due to the biologically inspired coupling.

  6. Coupling correction using closed orbit measurements

    International Nuclear Information System (INIS)

    Safranek, J.; Krinsky, S.


    The authors describe a coupling correction scheme they have developed and used to successfully reduce the vertical emittance of the NSLS X-Ray ring by a factor of 6 to below 2 A. This gives a vertical to horizontal emittance ratio of less than 0.2%. They find the strengths of 17 skew quadrupoles to simultaneously minimize the vertical dispersion and the coupling. As a measure of coupling they utilize the shift in vertical closed orbit resulting from a change in strength of a horizontal steering magnet. Experimental measurements confirm the reduced emittance

  7. A-coupled-expanding and distributional chaos

    International Nuclear Information System (INIS)

    Kim, Cholsan; Ju, Hyonhui; Chen, Minghao; Raith, Peter


    The concept of A-coupled-expanding maps is one of the more natural and useful ideas generalized from the horseshoe map which is commonly known as a criterion of chaos. It is well known that distributional chaos is one of the concepts which reflect strong chaotic behavior. In this paper, we focus on the relationship between A-coupled-expanding and distributional chaos. We prove two theorems which give sufficient conditions for a strictly A-coupled-expanding map to be distributionally chaotic in the senses of two kinds, where A is an m × m irreducible transition matrix

  8. Effect of couplings in the resonance continuum

    International Nuclear Information System (INIS)

    Royal, J; Larson, A; Orel, A E


    Electronic coupling of two or more resonances via the electron scattering continuum is investigated. The effect of this coupling as a function of the resonance curves and autoionization widths is investigated, and the conditions for the maximum effect are determined. The theory is applied to two physical problems, the product state distribution produced by the dissociative recombination of electrons with HeH + and a one-dimensional model for ion-pair production resulting from electron collisions with H + 3 . It is found that the coupling does not affect the product state distribution in HeH + but produces a significant effect in the H + 3 model

  9. Analysis of Synchronization for Coupled Hybrid Systems

    DEFF Research Database (Denmark)

    Li, Zheng; Wisniewski, Rafal


    In the control systems with coupled multi-subsystem, the subsystems might be synchronized (i.e. all the subsystems have the same operation states), which results in negative influence to the whole system. For example, in the supermarket refrigeration systems, the synchronized switch of each...... subsystem will cause low efficiency, inferior control performance and a high wear on the compressor. This paper takes the supermarket refrigeration systems as an example to analyze the synchronization and its coupling strengths of coupled hybrid systems, which may provide a base for further research...... of control strategies. This paper combines topology and section mapping theories together to show a new way of analyzing hybrid systems...

  10. Improved formalism for precision Higgs coupling fits

    Energy Technology Data Exchange (ETDEWEB)

    Barklow, Tim; Peskin, Michael E. [Stanford Univ., Menlo Park, CA (United States). Stanford Linear Accelerator Center; Fujii, Keisuke; Ogawa, Tomohisa [High Energy Accelerator Research Organization (KEK), Tsukuba, Ibaraki (Japan); Jung, Sunghoon [Stanford Univ., Menlo Park, CA (United States). Stanford Linear Accelerator Center; Seoul National Univ. (Korea, Republic of). Dept. of Physics and Astronomy; Karl, Robert; List, Jenny [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Tian, Junping [Tokyo Univ. (Japan). International Center for Elementary Particle Physics (ICEPP)


    Future e{sup +}e{sup -} colliders give the promise of model-independent determinations of the couplings of the Higgs boson. In this paper, we present an improved formalism for extracting Higgs boson couplings from e{sup +}e{sup -} data, based on the Effective Field Theory description of corrections to the Standard Model. We apply this formalism to give projections of Higgs coupling accuracies for stages of the International Linear Collider and for other proposed e{sup +}e{sup -} colliders.

  11. A Pronoun Analysis of Couples' Support Transactions. (United States)

    Hinnekens, Céline; Lemmens, Gilbert; Vanhee, Gaëlle; Verhofstadt, Lesley


    The present study collected data about couples' level of relationship quality and their usage of pronouns that express we-ness or separateness in the context of support interactions. The sample consisted of 48 couples in a long-term relationship who provided questionnaire data and participated in two videotaped social support interaction tasks. Couples' videotaped interactions were subsequently coded for the number of personal pronouns-we-words (e.g., we, ours, ourselves) versus you and me-words (e.g., me, mine, you, yours)-used by both partners.

  12. Bubbling in delay-coupled lasers. (United States)

    Flunkert, V; D'Huys, O; Danckaert, J; Fischer, I; Schöll, E


    We theoretically study chaos synchronization of two lasers which are delay coupled via an active or a passive relay. While the lasers are synchronized, their dynamics is identical to a single laser with delayed feedback for a passive relay and identical to two delay-coupled lasers for an active relay. Depending on the coupling parameters the system exhibits bubbling, i.e., noise-induced desynchronization, or on-off intermittency. We associate the desynchronization dynamics in the coherence collapse and low-frequency fluctuation regimes with the transverse instability of some of the compound cavity's antimodes. Finally, we demonstrate how, by using an active relay, bubbling can be suppressed.

  13. Coupling methodology within the software platform alliances

    Energy Technology Data Exchange (ETDEWEB)

    Montarnal, Ph; Deville, E; Adam, E; Bengaouer, A [CEA Saclay, Dept. de Modelisation des Systemes et Structures 91 - Gif-sur-Yvette (France); Dimier, A; Gaombalet, J; Loth, L [Agence Nationale pour la Gestion des Dechets Radioactifs (ANDRA), 92 - Chatenay Malabry (France); Chavant, C [Electricite de France (EDF), 92 - Clamart (France)


    CEA, ANDRA and EDF are jointly developing the software platform ALLIANCES which aim is to produce a tool for the simulation of nuclear waste storage and disposal repository. This type of simulations deals with highly coupled thermo-hydro-mechanical and chemical (T-H-M-C) processes. A key objective of Alliances is to give the capability for coupling algorithms development between existing codes. The aim of this paper is to present coupling methodology use in the context of this software platform. (author)

  14. Coupling methodology within the software platform alliances

    International Nuclear Information System (INIS)

    Montarnal, Ph.; Deville, E.; Adam, E.; Bengaouer, A.; Dimier, A.; Gaombalet, J.; Loth, L.; Chavant, C.


    CEA, ANDRA and EDF are jointly developing the software platform ALLIANCES which aim is to produce a tool for the simulation of nuclear waste storage and disposal repository. This type of simulations deals with highly coupled thermo-hydro-mechanical and chemical (T-H-M-C) processes. A key objective of Alliances is to give the capability for coupling algorithms development between existing codes. The aim of this paper is to present coupling methodology use in the context of this software platform. (author)

  15. Optical Signatures of Coupled Quantum Dots (United States)

    Stinaff, E. A.; Scheibner, M.; Bracker, A. S.; Ponomarev, I. V.; Korenev, V. L.; Ware, M. E.; Doty, M. F.; Reinecke, T. L.; Gammon, D.


    An asymmetric pair of coupled InAs quantum dots is tuned into resonance by applying an electric field so that a single hole forms a coherent molecular wave function. The optical spectrum shows a rich pattern of level anticrossings and crossings that can be understood as a superposition of charge and spin configurations of the two dots. Coulomb interactions shift the molecular resonance of the optically excited state (charged exciton) with respect to the ground state (single charge), enabling light-induced coupling of the quantum dots. This result demonstrates the possibility of optically coupling quantum dots for application in quantum information processing.

  16. Coupled nanopillar waveguides: optical properties and applications

    DEFF Research Database (Denmark)

    Chigrin, Dmitry N.; Zhukovsky, Sergei V.; Lavrinenko, Andrei


    , while guided modes dispersion is strongly affected by the waveguide structure. We present a systematic analysis of the optical properties of coupled nanopillar waveguides and discuss their possible applications for integrated optics. (C) 2007 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim......In this paper we review basic properties of coupled periodic and aperiodic nanopillar waveguides. A coupled nanopillar waveguide consists of several rows of periodically or aperiodically placed dielectric rods (pillars). In such a waveguide, light confinement is due to the total internal reflection...

  17. Harmonic synchronization in resistively coupled Josephson junctions

    International Nuclear Information System (INIS)

    Blackburn, J.A.; Gronbech-Jensen, N.; Smith, H.J.T.


    The oscillations of two resistively coupled Josephson junctions biased only by a single dc current source are shown to lock harmonically in a 1:2 mode over a significant range of bias current, even when the junctions are identical. The dependence of this locking on both junction and coupling parameters is examined, and it is found that, for this particular two-junction configuration, 1:1 locking can never occur, and also that a minimum coupling coefficient is needed to support harmonic locking. Some issues related to subharmonic locking are also discussed

  18. Linear dynamic coupling in geared rotor systems (United States)

    David, J. W.; Mitchell, L. D.


    The effects of high frequency oscillations caused by the gear mesh, on components of a geared system that can be modeled as rigid discs are analyzed using linear dynamic coupling terms. The coupled, nonlinear equations of motion for a disc attached to a rotating shaft are presented. The results of a trial problem analysis show that the inclusion of the linear dynamic coupling terms can produce significant changes in the predicted response of geared rotor systems, and that the produced sideband responses are greater than the unbalanced response. The method is useful in designing gear drives for heavy-lift helicopters, industrial speed reducers, naval propulsion systems, and heavy off-road equipment.

  19. Traders' behavioral coupling and market phase transition (United States)

    Ma, Rong; Zhang, Yin; Li, Honggang


    Traditional economic theory is based on the assumption that traders are completely independent and rational; however, trading behavior in the real market is often coupled by various factors. This paper discusses behavioral coupling based on the stock index in the stock market, focusing on the convergence of traders' behavior, its effect on the correlation of stock returns and market volatility. We find that the behavioral consensus in the stock market, the correlation degree of stock returns, and the market volatility all exhibit significant phase transitions with stronger coupling.

  20. Coupling effect on the Berry phase

    Directory of Open Access Journals (Sweden)

    Lijing Tian


    Full Text Available The Berry phase has universal applications in various fields. Here, we explore the coupling effect on the Berry phase of a two-level system adiabatically driven by a rotating classical field and interacting with a single quantized mode. Our simulations clearly reveal that the Berry phase change is quadratic proportional to the coupling constant if it is less than the level spacing between neighboring instantaneous eigenstates. Remarkably, if the nearest neighbouring level spacing is comparable with the coupling constant, this simple quadratic dependence is lost. Around this resonance, the Berry phase can be significantly tuned by slightly adjusting the parameters, such as the coupling constant, the frequency of the quantized mode, and the transition frequency. These numerical results, agreeing well with the perturbation theory calculations, provide an alternative approach to tune the Berry phase near the resonance, which is useful in quantum information science, i.e. designing quantum logic gates.

  1. Information filtering on coupled social networks. (United States)

    Nie, Da-Cheng; Zhang, Zi-Ke; Zhou, Jun-Lin; Fu, Yan; Zhang, Kui


    In this paper, based on the coupled social networks (CSN), we propose a hybrid algorithm to nonlinearly integrate both social and behavior information of online users. Filtering algorithm, based on the coupled social networks, considers the effects of both social similarity and personalized preference. Experimental results based on two real datasets, Epinions and Friendfeed, show that the hybrid pattern can not only provide more accurate recommendations, but also enlarge the recommendation coverage while adopting global metric. Further empirical analyses demonstrate that the mutual reinforcement and rich-club phenomenon can also be found in coupled social networks where the identical individuals occupy the core position of the online system. This work may shed some light on the in-depth understanding of the structure and function of coupled social networks.

  2. Nanocatalysts for Suzuki cross-coupling reactions

    KAUST Repository

    Fihri, Aziz; Bouhrara, Mohamed; Nekoueishahraki, Bijan; Basset, Jean-Marie; Polshettiwar, Vivek


    This critical review deals with the applications of nanocatalysts in Suzuki coupling reactions, a field that has attracted immense interest in the chemical, materials and industrial communities. We intend to present a broad overview of nanocatalysts

  3. Parenting experiences of couples living with human ...

    African Journals Online (AJOL)

    Belinda Chimphamba Gombachika


    May 12, 2014 ... Data were collected using in-depth interviews with 14 couples purposively sampled in matrilineal. Chiradzulu ..... of a translation was verified by an independent translator who ... formal jobs apart from owning small gardens.

  4. Strong-coupling theory of superconductivity

    International Nuclear Information System (INIS)

    Rainer, D.; Sauls, J.A.


    The electronic properties of correlated metals with a strong electron-phonon coupling may be understood in terms of a combination of Landau''s Fermi liquid theory and the strong-coupling theory of Migdal and Eliashberg. In these lecture notes we discuss the microscopic foundations of this phenomenological Fermi-liquid model of correlated, strong-coupling metals. We formulate the basic equations of the model, which are quasiclassical transport equations that describe both equilibrium and non-equilibrium phenomena for the normal and superconducting states of a metal. Our emphasis is on superconductors close to equilibrium, for which we derive the general linear response theory. As an application we calculate the dynamical conductivity of strong-coupling superconductors. (author)

  5. Electroweak effective couplings for future precision experiments

    International Nuclear Information System (INIS)

    Jegerlehner, F.


    The leading hadronic effects in electroweak theory derive from vacuum polarization which are non-perturbative hadronic contributions to the running of the gauge couplings, the electromagnetic α em (s)and the SU(2) L coupling α 2 (s). I will report on my recent package alphaQED, which besides the effective fine structure constant α em (s) also allows for a fairly precise calculation of the SU(2) L gauge coupling α 2 (s). I will briefly review the role, future requirements and possibilities. Applied together with the R had package by Harlander and Steinhauser, the package allows to calculate all SM running couplings as well as running sin 2 Θ versions with state-of-the-art accuracy.

  6. Electroweak effective couplings for future precision experiments

    International Nuclear Information System (INIS)

    Jegerlehner, F.; Humboldt-Universitaet, Berlin


    The leading hadronic effects in electroweak theory derive from vacuum polarization which are non-perturbative hadronic contributions to the running of the gauge couplings, the electromagnetic α em (s) and the SU(2) L coupling α 2 (s). I report on my recent package alphaQED [1], which besides the effective fine structure constant α em (s) also allows for a fairly precise calculation of the SU(2) L gauge coupling α 2 (s). I will briefly review the role, future requirements and possibilities. Applied together with the Rhad package by Harlander and Steinhauser [2], the package allows to calculate all SM running couplings as well as running sin 2 Θ versions with state-of-the-art accuracy. (orig.)

  7. Nuclear physics from strong coupling QCD

    CERN Document Server

    Fromm, Michael


    The strong coupling limit (beta_gauge = 0) of QCD offers a number of remarkable research possibilities, of course at the price of large lattice artifacts. Here, we determine the complete phase diagram as a function of temperature T and baryon chemical potential mu_B, for one flavor of staggered fermions in the chiral limit, with emphasis on the determination of a tricritical point and on the T ~ 0 transition to nuclear matter. The latter is known to happen for mu_B substantially below the baryon mass, indicating strong nuclear interactions in QCD at infinite gauge coupling. This leads us to studying the properties of nuclear matter from first principles. We determine the nucleon-nucleon potential in the strong coupling limit, as well as masses m_A of nuclei as a function of their atomic number A. Finally, we clarify the origin of nuclear interactions at strong coupling, which turns out to be a steric effect.

  8. A Class Coupling Analyzer for Java Programs

    African Journals Online (AJOL)


    Increasingly, object-oriented measurements are being used to evaluate and predict ... and architecture investigations on already developed systems. ... coupling during design because we know ... applications and the projects that build them.

  9. Plasmonic solutions for coupling and modulation

    DEFF Research Database (Denmark)

    Andryieuski, Andrei; Babicheva, Viktoriia; Malureanu, Radu

    We present our design results for efficient coupling and modulation in plasmonic structures. Fiber coupling to a plasmonic slot waveguide is significantly increased by a metallic nanoantenna with additional reflectors or by the configuration of several connected antennas. We also show that the pl......We present our design results for efficient coupling and modulation in plasmonic structures. Fiber coupling to a plasmonic slot waveguide is significantly increased by a metallic nanoantenna with additional reflectors or by the configuration of several connected antennas. We also show...... that the plasmonic four-layer waveguide with patterned ITO layer can modulate light with higher transmission and the same modulation depth as a waveguide with a uniform ITO layer....

  10. Synchronization in complex networks with adaptive coupling

    International Nuclear Information System (INIS)

    Zhang Rong; Hu Manfeng; Xu Zhenyuan


    Generally it is very difficult to realized synchronization for some complex networks. In order to synchronize, the coupling coefficient of networks has to be very large, especially when the number of coupled nodes is larger. In this Letter, we consider the problem of synchronization in complex networks with adaptive coupling. A new concept about asymptotic stability is presented, then we proved by using the well-known LaSalle invariance principle, that the state of such a complex network can synchronize an arbitrary assigned state of an isolated node of the network as long as the feedback gain is positive. Unified system is simulated as the nodes of adaptive coupling complex networks with different topologies

  11. Intermittent chaotic chimeras for coupled rotators

    DEFF Research Database (Denmark)

    Olmi, Simona; Martens, Erik Andreas; Thutupalli, Shashi


    Two symmetrically coupled populations of N oscillators with inertia m display chaotic solutions with broken symmetry similar to experimental observations with mechanical pendulums. In particular, we report evidence of intermittent chaotic chimeras, where one population is synchronized and the other...

  12. Synchronization of indirectly coupled Lorenz oscillators: An ...

    Indian Academy of Sciences (India)

    [7], the magnetoencephalographic activity of Parkinsonian patients [8], electrosensitive cells of paddlefish [9] ... with coherent electromagnetic field [16]. ... can also be explained with a model of two excitatory synaptically coupled neurons in the.

  13. Linearized holographic isotropization at finite coupling

    Energy Technology Data Exchange (ETDEWEB)

    Atashi, Mahdi; Fadafan, Kazem Bitaghsir [Shahrood University of Technology, Physics Department (Iran, Islamic Republic of); Jafari, Ghadir [Institute for Research in Fundamental Sciences (IPM), School of Physics, Tehran (Iran, Islamic Republic of)


    We study holographic isotropization of an anisotropic homogeneous non-Abelian strongly coupled plasma in the presence of Gauss-Bonnet corrections. It was verified before that one can linearize Einstein's equations around the final black hole background and simplify the complicated setup. Using this approach, we study the expectation value of the boundary stress tensor. Although we consider small values of the Gauss-Bonnet coupling constant, it is found that finite coupling leads to significant increasing of the thermalization time. By including higher order corrections in linearization, we extend the results to study the effect of the Gauss-Bonnet coupling on the entropy production on the event horizon. (orig.)

  14. Improving plasmonic waveguides coupling efficiency using nanoantennas

    DEFF Research Database (Denmark)

    Andryieuski, Andrei; Malureanu, Radu; Bouillard, Jean-Sebastien


    . The classical dipole antenna scheme can be improved by changing the nanoantenna geometry, adding constructive elements such as reflecting bars and mirrors and using arrays of antennas. The modelling designates that the coupling efficiency from a vertical fiber to a plasmonic waveguide can be improved more than......Plasmonic waveguides bear a lot of potential for photonic applications. However, one of the challenges for implementing them in devices is the low coupling efficiency to and from optical fibers. We report on our approach to facilitate the coupling efficiency with the use of metallic nanoantennas...... in 180 times in comparison with a direct fiber-waveguide coupling. Pros and cons of each configuration are discussed. Fabrication and characterisation results are reported....

  15. Atomic precision tests and light scalar couplings

    Energy Technology Data Exchange (ETDEWEB)

    Brax, Philippe [CEA, IPhT, CNRS, URA 2306, Gif-sur-Yvette (France). Inst. de Physique Theorique; Burrage, Clare [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Geneve Univ. (Switzerland). Dept. de Physique Theorique


    We calculate the shift in the atomic energy levels induced by the presence of a scalar field which couples to matter and photons. We find that a combination of atomic measurements can be used to probe both these couplings independently. A new and stringent bound on the matter coupling springs from the precise measurement of the 1s to 2s energy level difference in the hydrogen atom, while the coupling to photons is essentially constrained by the Lamb shift. Combining these constraints with current particle physics bounds we find that the contribution of a scalar field to the recently claimed discrepancy in the proton radius measured using electronic and muonic atoms is negligible. (orig.)

  16. New Magnetically Coupled Impedance (Z-) Source Networks

    DEFF Research Database (Denmark)

    Siwakoti, Yam Prasad; Blaabjerg, Frede; Loh, Poh Chiang


    Various Magnetically Coupled Impedance Source (MCIS) networks have been proposed in the literature for increasing voltage gain and modulation index simultaneously, while reducing the number of passive components used in the converter. However, applications of such networks have been limited...

  17. Pension plan participation among married couples. (United States)

    Dushi, Irena; Iams, Howard M


    We present descriptive statistics on pension participation and types of pensions among married couples, using data from the 1996/2008 Panels of the Survey of Income and Program Participation and Social Security administrative records. Previous research has focused on pension coverage by marital status, but has not examined couples as a unit. Because couples usually share income, viewing them as a unit provides a better picture of potential access to income from retirement plans. Our analysis compares 1998 and 2009 data because substantial changes occurred in the pension landscape over this decade that could have influenced the prevalence of different pension plans, although we observe modest changes in participation rates and types of plans over the period. We find that in 20 percent of couples, neither spouse participated in a pension plan; in 10 percent, the wife was the only participant; and in 37 percent, the husband was the only participant.

  18. Gauge coupling unification in six dimensions

    Energy Technology Data Exchange (ETDEWEB)

    Lee, H.M. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)]|[Carnegie-Mellon Univ., Pittsburgh, PA (United States). Dept. of Physics


    We compute the one-loop gauge couplings in six-dimensional non-Abelian gauge theories on the T{sup 2}/Z{sub 2} orbifold with general GUT breaking boundary conditions. For concreteness, we apply the obtained general formulae to the gauge coupling running in a 6D SO(10) orbifold GUT where the GUT group is broken down to the standard model gauge group up to an extra U(1). We find that the one-loop corrections depend on the parity matrices encoding the orbifold boundary conditions as well as the volume and shape moduli of extra dimensions. When the U(1) is broken by the VEV of bulk singlets, the accompanying extra color triplets also affect the unification of the gauge couplings. In this case, the B-L breaking scale is closely linked to the compactification scales for maintaining a success of the gauge coupling unification. (orig.)

  19. A Miniature Coupled Bistable Vibration Energy Harvester

    International Nuclear Information System (INIS)

    Zhu, D; Arthur, D C; Beeby, S P


    This paper reports the design and test of a miniature coupled bistable vibration energy harvester. Operation of a bistable structure largely depends on vibration amplitude rather than frequency, which makes it very promising for wideband vibration energy harvesting applications. A coupled bistable structure consists of a pair of mobile magnets that create two potential wells and thus the bistable phenomenon. It requires lower excitation to trigger bistable operation compared to conventional bistable structures. Based on previous research, this work focused on miniaturisation of the coupled bistable structure for energy harvesting application. The proposed bistable energy harvester is a combination of a Duffing's nonlinear structure and a linear assisting resonator. Experimental results show that the output spectrum of the miniature coupled bistable vibration energy harvester was the superposition of several spectra. It had a higher maximum output power and a much greater bandwidth compared to simply the Duffing's structure without the assisting resonator

  20. TEK twisted gradient flow running coupling

    CERN Document Server

    Pérez, Margarita García; Keegan, Liam; Okawa, Masanori


    We measure the running of the twisted gradient flow coupling in the Twisted Eguchi-Kawai (TEK) model, the SU(N) gauge theory on a single site lattice with twisted boundary conditions in the large N limit.

  1. Coupled qubits as a quantum heat switch (United States)

    Karimi, B.; Pekola, J. P.; Campisi, M.; Fazio, R.


    We present a quantum heat switch based on coupled superconducting qubits, connected to two LC resonators that are terminated by resistors providing two heat baths. To describe the system, we use a standard second order master equation with respect to coupling to the baths. We find that this system can act as an efficient heat switch controlled by the applied magnetic flux. The flux influences the energy level separations of the system, and under some conditions, the finite coupling of the qubits enhances the transmitted power between the two baths, by an order of magnitude under realistic conditions. At the same time, the bandwidth at maximum power of the switch formed of the coupled qubits is narrowed.

  2. Demonstration of Coupled Tiamat Single Assembly Calculations

    Energy Technology Data Exchange (ETDEWEB)

    Novascone, Stephen R. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Hales, Jason D. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Gardner, Russell [Idaho National Lab. (INL), Idaho Falls, ID (United States); Pawlowski, R. P. P. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Pastore, Giovanni [Idaho National Lab. (INL), Idaho Falls, ID (United States); Toth, Alex [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Clarno, Kevin T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Collins, Benjamin S. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Stimpson, Shane G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Powers, Jeffrey J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)


    This report corresponds to milestone L3:PHI.PCI.P15.03, which was originally intended to investigate the time discretization approaches with the newly developed fully coupled Tiamat capability, targeting single assembly problems.

  3. Coupled DM Heating in SCDEW Cosmologies

    Directory of Open Access Journals (Sweden)

    Silvio Bonometto


    Full Text Available Strongly-Coupled Dark Energy plus Warm dark matter (SCDEW cosmologies admit the stationary presence of ∼1% of coupled-DM and DE, since inflationary reheating. Coupled-DM fluctuations therefore grow up to non-linearity even in the early radiative expansion. Such early non-linear stages are modelized here through the evolution of a top-hat density enhancement, reaching an early virial balance when the coupled-DM density contrast is just 25–26, and the DM density enhancement is ∼10 % of the total density. During the time needed to settle in virial equilibrium, the virial balance conditions, however, continue to modify, so that “virialized” lumps undergo a complete evaporation. Here, we outline that DM particles processed by overdensities preserve a fraction of their virial momentum. Although fully non-relativistic, the resulting velocities (moderately affect the fluctuation dynamics over greater scales, entering the horizon later on.

  4. How initial representations shape coupled learning processes

    DEFF Research Database (Denmark)

    Puranam, Phanish; Swamy, M.


    Coupled learning processes, in which specialists from different domains learn how to make interdependent choices among alternatives, are common in organizations. We explore the role played by initial representations held by the learners in coupled learning processes using a formal agent-based model....... We find that initial representations have important consequences for the success of the coupled learning process, particularly when communication is constrained and individual rates of learning are high. Under these conditions, initial representations that generate incorrect beliefs can outperform...... one that does not discriminate among alternatives, or even a mix of correct and incorrect representations among the learners. We draw implications for the design of coupled learning processes in organizations. © 2016 INFORMS....

  5. Errata :Chromosomal Abnormalities in Couples with Recurrent ...

    African Journals Online (AJOL)

    Chromosomal Abnormalities in Couples with Recurrent Abortions in Lagos, Nigeria. Akinde OR, Daramola A O, Taiwo I A, Afolayan M O and Akinsola Af. Sonographic Mammary Gland Density Pattern in Women in Selected ommunities of Southern Nigeria.

  6. The Optimal Income Taxation of Couples

    DEFF Research Database (Denmark)

    Kleven, Henrik Jacobsen; Kreiner, Claus Thustrup; Satz, Emmanuel

    This paper analyzes the optimal income tax treatment of couples. Each couple is modelled as a single rational economic agent supplying labor along two dimensions: primary and secondary earnings. We consider fully general joint income tax systems. Separate taxation is never optimal if social welfare...... that many actual redistribution systems, featuring family-based transfers combined with individually-based taxes, generate schedules with negative jointness...

  7. Experimental Evidence on Bargaining Power Within Couples


    Beblo, Miriam; Beninger, Denis


    We conducted an experiment on the nature of income sharing within 95 established couples in Germany. In a first step, the partners revealed their individual preferences by making consumption choices independently. In a second step, decisions were taken jointly over five different rounds with varying resource allocations between the partners. From this design we are able to derive a female bargaining power index without structural restrictions, reflecting the sharing rule within the couple. We...

  8. Isolation Mounting for Charge-Coupled Devices (United States)

    Goss, W. C.; Salomon, P. M.


    CCD's suspended by wires under tension. Remote thermoelectric cooling of charge coupled device allows vibration isolating mounting of CCD assembly alone, without having to suspend entire mass and bulk of thermoelectric module. Mounting hardware simple and light. Developed for charge-coupled devices (CCD's) in infrared telescope support adaptable to sensors in variety of environments, e.g., sensors in nuclear reactors, engine exhausts and plasma chambers.

  9. Phase coupling in the cardiorespiratory interaction. (United States)

    Bahraminasab, A; Kenwright, D; Stefanovska, A; Ghasemi, F; McClintock, P V E


    Markovian analysis is applied to derive nonlinear stochastic equations for the reconstruction of heart rate and respiration rate variability data. A model of their 'phase' interactions is obtained for the first time, thereby gaining new insights into the strength and direction of the cardiorespiratory phase coupling. The reconstructed model can reproduce synchronisation phenomena between the cardiac and the respiratory systems, including switches in synchronisation ratio. The technique is equally applicable to the extraction of the multi-dimensional couplings between many interacting subsystems.

  10. Dynamics of Coupled Quantum Spin Chains

    International Nuclear Information System (INIS)

    Schulz, H.J.


    Static and dynamical properties of weakly coupled antiferromagnetic spin chains are treated using a mean-field approximation for the interchain coupling and exact results for the resulting effective one-dimensional problem. Results for staggered magnetization, Nacute eel temperature, and spin wave excitations are in agreement with experiments on KCuF 3 . The existence of a narrow longitudinal mode is predicted. The results are in agreement with general scaling arguments, contrary to spin wave theory. copyright 1996 The American Physical Society

  11. Equine Assisted Couples Therapy: An Exploratory Study


    Ham, Taylor Marie


    Equine assisted psychotherapy (EAP) is an emerging experiential methodologythat has recently gained recognition as a method for addressing a range of presentingproblems for a wide variety of client populations. Couples therapy is one area that thepractice of equine assisted psychotherapy has recently gained traction. This studydescribes the practice of equine assisted couples therapy in terms of practitionercharacteristics, approach to treatment, therapeutic goals and outcomes. Mental healthp...

  12. B-L violating supersymmetric couplings

    International Nuclear Information System (INIS)

    Ramond, P.


    We consider two problems: one is the possible effect of the breaking of Peccei-Quinn symmetry on the inflationary universe scenario; the other is the remark that even the minimal supersymmetric SU 5 theory contains B-L violating couplings which give rise to neutrino masses and family-diagonal proton decay. However the strength of these couplings is limited by the gauge hierarchy

  13. Physics of Coupled CME and Flare Systems (United States)


    AFRL-RV-PS- AFRL-RV-PS- TR-2016-0162 TR-2016-0162 PHYSICS OF COUPLED CME AND FLARE SYSTEMS K. S. Balasubramaniam, et al. 21 December 2016 Final...30 Sep 2016 4. TITLE AND SUBTITLE Physics of Coupled CME and Flare Systems 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 61102F...objectives for this task were: (i) derive measureable physical properties and discernible structural circumstances in solar active regions that

  14. Reintegration Difficulty of Military Couples Following Deployment (United States)


    Response rate for Wave 8 = 88% Our final sample contained 554 men and 556 women (n = 554 cross- sex couples, 1 same- sex couple). Individuals were...story in the Killeen Daily Herald (10 April 2016) kids -deployments-when-a-parent-deploys-children-face- tough...years old), and (c) “Me getting sick and having to go to sick call.” (deployed Army husband, 25 years old). Sex and fidelity. Comments fell into

  15. Probing anomalous gauge boson couplings at LEP

    International Nuclear Information System (INIS)

    Dawson, S.; Valencia, G.


    We bound anomalous gauge boson couplings using LEP data for the Z → bar ∫∫ partial widths. We use an effective field theory formalism to compute the one-loop corrections resulting from non-standard model three and four gauge boson vertices. We find that measurements at LEP constrain the three gauge boson couplings at a level comparable to that obtainable at LEPII

  16. Bicritical behaviors observed in coupled diode resonators

    International Nuclear Information System (INIS)

    Kim, Youngtae


    We have investigated bicritical behaviors of unidirectionally coupled diode resonators having a period doubling route to chaos. Depending on the dynamical states of the drive subsystem, the response subsystem showed a dynamical behavior other than that of the uncoupled system. The experimental results agreed well with the results obtained from the simulation of unidirectionally coupled logistic maps and oscillators. A new type of scaling behavior and a power spectrum of the hyperchaotic attractor appearing near a bicritical point were also observed.

  17. Enhanced photo-H2 production by Rhodopseudomonas faecalis RLD-53 immobilization on activated carbon fibers

    International Nuclear Information System (INIS)

    Xie, Guo-Jun; Liu, Bing-Feng; Ding, Jie; Xing, De-Feng; Ren, Hong-Yu; Guo, Wan-Qian; Ren, Nan-Qi


    Activated carbon fibers (ACFs) were firstly applied as fluidized solid carrier to immobilize photo-fermentative bacteria (PFB) for H 2 production in batch culture. The observations by scanning electronic microscopy (SEM) demonstrated the close interaction between ACFs and PFB. The amount of immobilized bacteria and the performance of H 2 production were strongly affected by specific surface area, length and amount of ACFs, respectively. Large specific surface area provided more surface attachment sites and more PFB were immobilized. ACFs with proper length avoided intertwining with each other and better fluidized during reactor operation. Excessive amount of ACFs not only limited the light conversion efficiency, but also increased biofilm detachment, resulting in low H 2 yield. The maximum yield (3.08 mol H 2 mol −1 acetate) and rate (32.85 ml l −1 h −1 ) of H 2 production were obtained, using specific surface area (1500 m 2 g −1 ), length (1 mm) and amount (0.8 g l −1 ) of ACFs. Compared with the conventional solid carriers, ACFs were effective solid carriers to immobilize PFB for improving H 2 production, due to bacteria immobilized on the external surface of fluidized ACFs and formed a layer of dense biofilm. -- Highlights: ► ACFs were firstly used to immobilize photo-fermentative bacteria for H 2 production. ► ACFs were fluidized in the reactor during the operation. ► Bacteria covered on the external surface of ACFs and formed dense biofilm. ► Each bacterium on the ACFs could absorb the light and convert substrate into H 2 .

  18. Neuron-glia metabolic coupling and plasticity. (United States)

    Magistretti, Pierre J


    The coupling between synaptic activity and glucose utilization (neurometabolic coupling) is a central physiological principle of brain function that has provided the basis for 2-deoxyglucose-based functional imaging with positron emission tomography (PET). Astrocytes play a central role in neurometabolic coupling, and the basic mechanism involves glutamate-stimulated aerobic glycolysis; the sodium-coupled reuptake of glutamate by astrocytes and the ensuing activation of the Na-K-ATPase triggers glucose uptake and processing via glycolysis, resulting in the release of lactate from astrocytes. Lactate can then contribute to the activity-dependent fuelling of the neuronal energy demands associated with synaptic transmission. An operational model, the 'astrocyte-neuron lactate shuttle', is supported experimentally by a large body of evidence, which provides a molecular and cellular basis for interpreting data obtained from functional brain imaging studies. In addition, this neuron-glia metabolic coupling undergoes plastic adaptations in parallel with adaptive mechanisms that characterize synaptic plasticity. Thus, distinct subregions of the hippocampus are metabolically active at different time points during spatial learning tasks, suggesting that a type of metabolic plasticity, involving by definition neuron-glia coupling, occurs during learning. In addition, marked variations in the expression of genes involved in glial glycogen metabolism are observed during the sleep-wake cycle, with in particular a marked induction of expression of the gene encoding for protein targeting to glycogen (PTG) following sleep deprivation. These data suggest that glial metabolic plasticity is likely to be concomitant with synaptic plasticity.

  19. Surrogate versus couple therapy in vaginismus. (United States)

    Ben-Zion, Itzhak; Rothschild, Shelly; Chudakov, Bella; Aloni, Ronit


    Women who do not have a cooperative partner cannot complete the usual therapeutic process in the treatment of vaginismus, because they cannot progress to the stage of practicing the insertion of the man partner's fingers and the insertion of a penis. To compare traditional couple therapy with therapy utilizing a surrogate partner. The study was controlled and retrospective. Data were obtained from the treatment charts of patients who had come to the clinic for treatment of vaginismus. Sixteen vaginismus patients who were treated with a man surrogate partner were compared with 16 vaginismus patients who were treated with their own partners. Successful pain-free intercourse upon completion of therapy. One hundred percent of the surrogate patients succeeded in penile-vaginal intercourse compared with 75% in the couples group (P = 0.1). All surrogate patients ended the therapy because it was fully successful, compared with 69% in the couples group. Twelve percent of the couples group ended the therapy because it failed, and 19% because the couples decided to separate. Treating vaginismus with a man surrogate partner was at least as effective as couple therapy. Surrogate therapy may be considered for vaginismus patients who have no cooperative partner.

  20. Rapid roll inflation with conformal coupling

    International Nuclear Information System (INIS)

    Kofman, Lev; Mukohyama, Shinji


    Usual inflation is realized with a slow rolling scalar field minimally coupled to gravity. In contrast, we consider dynamics of a scalar with a flat effective potential, conformally coupled to gravity. Surprisingly, it contains an attractor inflationary solution with the rapidly rolling inflaton field. We discuss models with the conformal inflaton with a flat potential (including hybrid inflation). There is no generation of cosmological fluctuations from the conformally coupled inflaton. We consider realizations of modulated (inhomogeneous reheating) or curvaton cosmological fluctuations in these models. We also implement these unusual features for the popular string-theoretic warped inflationary scenario, based on the interacting D3-D3 branes. The original warped brane inflation suffers a large inflaton mass due to conformal coupling to 4-dimensional gravity. Instead of considering this as a problem and trying to cure it with extra engineering, we show that warped inflation with the conformally coupled, rapidly rolling inflaton is yet possible with N=37 efoldings, which requires low-energy scales 1-100 TeV of inflation. Coincidentally, the same warping numerology can be responsible for the hierarchy. It is shown that the scalars associated with angular isometries of the warped geometry of compact manifold (e.g. S 3 of Klebanov-Strassler (KS) geometry) have solutions identical to conformally coupled modes and also cannot be responsible for cosmological fluctuations. We discuss other possibilities

  1. Rapid roll inflation with conformal coupling (United States)

    Kofman, Lev; Mukohyama, Shinji


    Usual inflation is realized with a slow rolling scalar field minimally coupled to gravity. In contrast, we consider dynamics of a scalar with a flat effective potential, conformally coupled to gravity. Surprisingly, it contains an attractor inflationary solution with the rapidly rolling inflaton field. We discuss models with the conformal inflaton with a flat potential (including hybrid inflation). There is no generation of cosmological fluctuations from the conformally coupled inflaton. We consider realizations of modulated (inhomogeneous reheating) or curvaton cosmological fluctuations in these models. We also implement these unusual features for the popular string-theoretic warped inflationary scenario, based on the interacting D3-D¯3 branes. The original warped brane inflation suffers a large inflaton mass due to conformal coupling to 4-dimensional gravity. Instead of considering this as a problem and trying to cure it with extra engineering, we show that warped inflation with the conformally coupled, rapidly rolling inflaton is yet possible with N=37 efoldings, which requires low-energy scales 1 100 TeV of inflation. Coincidentally, the same warping numerology can be responsible for the hierarchy. It is shown that the scalars associated with angular isometries of the warped geometry of compact manifold (e.g. S3 of Klebanov-Strassler (KS) geometry) have solutions identical to conformally coupled modes and also cannot be responsible for cosmological fluctuations. We discuss other possibilities.

  2. Coupling Strength and System Size Induce Firing Activity of Globally Coupled Neural Network

    International Nuclear Information System (INIS)

    Wei Duqu; Luo Xiaoshu; Zou Yanli


    We investigate how firing activity of globally coupled neural network depends on the coupling strength C and system size N. Network elements are described by space-clamped FitzHugh-Nagumo (SCFHN) neurons with the values of parameters at which no firing activity occurs. It is found that for a given appropriate coupling strength, there is an intermediate range of system size where the firing activity of globally coupled SCFHN neural network is induced and enhanced. On the other hand, for a given intermediate system size level, there exists an optimal value of coupling strength such that the intensity of firing activity reaches its maximum. These phenomena imply that the coupling strength and system size play a vital role in firing activity of neural network

  3. Generalized N-coupled maps with invariant measure in Bose ...

    Indian Academy of Sciences (India)

    chronization problem of an array of the linearly coupled map lattices of ... groups and graphs and also in the design of experiments, coding theory, partition ... coupled map lattice which covers internal and external couplings in a form of asso-.

  4. Sexual and Reproductive Health in HIV Serodiscordant Couples

    African Journals Online (AJOL)

    AJRH Managing Editor

    Keywords: HIV, Serodiscordant couple, Conception, Contraception, infertility. Résumé. Les couples ... risk of sexual transmission of HIV from male-to- female as 0.1-0.3% per ... Antiretroviral Drugs in Serodiscordant Couples. The use of ARV ...

  5. [Enhanced prenatal HIV couple oriented counselling session and couple communication about HIV (ANRS 12127 Prenahtest Trial)]. (United States)

    Plazy, M; Orne-Gliemann, J; Balestre, E; Miric, M; Darak, S; Butsashvili, M; Tchendjou, P; Dabis, F; Desgrées du Loû, A


    The Prenahtest study investigated the efficacy of a couple-oriented HIV counselling session (COC) in encouraging couple HIV counselling and testing, and improving intra-couple communication about sexual and reproductive health. We report here on the effect of COC on intra-couple communication about HIV. Within this 4-country trial (India, Georgia, Dominican Republic and Cameroon), 484 to 491 pregnant women per site were recruited and individually randomized to receive either the COC intervention, enhanced counselling with role playing, or standard post-test HIV counselling. Women were interviewed at recruitment, before HIV testing (T0), and 2 to 8 weeks after post-test HIV counselling (T1). Four dichotomous variables documented intra-couple communication about HIV at T1: 1) discussion about HIV, 2) discussion about condom use, 3) suggesting HIV testing and 4) suggesting couple HIV counselling to the partner. An intra-couple HIV communication index was created: low degree of communication ("yes" response to zero or one of the four variables), intermediate degree of communication ("yes" to two or three variables) or high degree of communication ("yes" to the four variables). To estimate the impact of COC on the intra-couple HIV communication index, multivariable logistic regressions were conducted. One thousand six hundred and seven women were included in the analysis of whom 54 (3.4%) were HIV-infected (49 in Cameroon). In the four countries, the counselling group was associated with intra-couple HIV communication (P≤0.03): women allocated to the COC group were significantly more likely to report high or intermediate degrees of intra-couple communication about HIV (versus low degree of communication) than women allocated to standard counselling. COC improved short-term communication about HIV within couples in different sociocultural contexts, a positive finding for a couple approach to HIV prevention. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  6. Coupled intertwiner dynamics: A toy model for coupling matter to spin foam models


    Steinhaus, Sebastian


    The universal coupling of matter and gravity is one of the most important features of general relativity. In quantum gravity, in particular spin foams, matter couplings have been defined in the past, yet the mutual dynamics, in particular if matter and gravity are strongly coupled, are hardly explored, which is related to the definition of both matter and gravitational degrees of freedom on the discretisation. However extracting this mutual dynamics is crucial in testing the viability of the ...

  7. Slower speed and stronger coupling: adaptive mechanisms of chaos synchronization. (United States)

    Wang, Xiao Fan


    We show that two initially weakly coupled chaotic systems can achieve synchronization by adaptively reducing their speed and/or enhancing the coupling strength. Explicit adaptive algorithms for speed reduction and coupling enhancement are provided. We apply these algorithms to the synchronization of two coupled Lorenz systems. It is found that after a long-time adaptive process, the two coupled chaotic systems can achieve synchronization with almost the minimum required coupling-speed ratio.

  8. Outcomes of couples with infidelity in a community-based sample of couple therapy. (United States)

    Atkins, David C; Marín, Rebeca A; Lo, Tracy T Y; Klann, Notker; Hahlweg, Kurt


    Infidelity is an often cited problem for couples seeking therapy, but the research literature to date is very limited on couple therapy outcomes when infidelity is a problem. The current study is a secondary analysis of a community-based sample of couple therapy in Germany and Austria. Outcomes for 145 couples who reported infidelity as a problem in their relationship were compared with 385 couples who sought therapy for other reasons. Analyses based on hierarchical linear modeling revealed that infidelity couples were significantly more distressed and reported more depressive symptoms at the start of therapy but continued improving through the end of therapy and to 6 months posttherapy. At the follow-up assessment, infidelity couples were not statistically distinguishable from non-infidelity couples, replicating previous research. Sexual dissatisfaction did not depend on infidelity status. Although there was substantial missing data, sensitivity analyses suggested that the primary findings were not due to missing data. The current findings based on a large community sample replicated previous work from an efficacy trial and show generally optimistic results for couples in which there has been an affair. 2010 APA, all rights reserved

  9. Stability regions for synchronized τ-periodic orbits of coupled maps with coupling delay τ

    Energy Technology Data Exchange (ETDEWEB)

    Karabacak, Özkan, E-mail: [Department of Electronics and Communication Engineering, Istanbul Technical University, 34469 Istanbul (Turkey); Department of Electronic Systems, Aalborg University, 9220 Aalborg East (Denmark); Alikoç, Baran, E-mail: [Department of Control and Automation Engineering, Istanbul Technical University, 34469 Istanbul (Turkey); Atay, Fatihcan M., E-mail: [Department of Mathematics, Bilkent University, 06800 Ankara (Turkey)


    Motivated by the chaos suppression methods based on stabilizing an unstable periodic orbit, we study the stability of synchronized periodic orbits of coupled map systems when the period of the orbit is the same as the delay in the information transmission between coupled units. We show that the stability region of a synchronized periodic orbit is determined by the Floquet multiplier of the periodic orbit for the uncoupled map, the coupling constant, the smallest and the largest Laplacian eigenvalue of the adjacency matrix. We prove that the stabilization of an unstable τ-periodic orbit via coupling with delay τ is possible only when the Floquet multiplier of the orbit is negative and the connection structure is not bipartite. For a given coupling structure, it is possible to find the values of the coupling strength that stabilizes unstable periodic orbits. The most suitable connection topology for stabilization is found to be the all-to-all coupling. On the other hand, a negative coupling constant may lead to destabilization of τ-periodic orbits that are stable for the uncoupled map. We provide examples of coupled logistic maps demonstrating the stabilization and destabilization of synchronized τ-periodic orbits as well as chaos suppression via stabilization of a synchronized τ-periodic orbit.

  10. AFM imaging of bacteria in liquid media immobilized on gelatin coated mica surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Doktycz, M.J.; Sullivan, C.J.; Hoyt, P.R.; Pelletier, D.A.; Wu, S.; Allison, D.P


    Immobilization of particulates, especially biomolecules and cells, onto surfaces is critical for imaging with the atomic force microscope (AFM). In this paper, gelatin coated mica surfaces are shown to be suitable for immobilizing and imaging both gram positive, Staphylococcus aureus, and gram negative, Escherichia coli, bacteria in both air and liquid environments. Gelatin coated surfaces are shown to be superior to poly-L-lysine coated surfaces that are commonly used for the immobilization of cells. This cell immobilization technique is being developed primarily for live cell imaging of Rhodopseudomonas palustris. The genome of R. palustris has been sequenced and the organism is the target of intensive studies aimed at understanding genome function. Images of R. palustris grown both aerobically and anaerobically in liquid media are presented. Images in liquid media show the bacteria is rod shaped and smooth while images in air show marked irregularity and folding of the surface. Significant differences in the vertical dimension are also apparent with the height of the bacteria in liquid being substantially greater than images taken in air. In air immobilized bacterial flagella are clearly seen while in liquid this structure is not visible. Additionally, significant morphological differences are observed that depend on the method of bacterial growth.

  11. Towards understanding the biological function of hopanoids (Invited) (United States)

    Doughty, D. M.; Hunter, R.; Summons, R. E.; Newman, D. K.


    Rhodopseudomonas palustris TIE-1 expresses bacterial hopanoid lipids that are structurally similar and evolutionarily related to eukaryotic sterols. The genome of R. palustris TIE-1 contains two copies of the hpnN gene (hpnN1 and hpnN2) that are orthologs of genes encoding eukaryotic sterol and lipid transporters. Hopanoid localization to the outer membrane was found to be dependent upon hpnN1. Since the cell cycle of R. palustris TIE-1 is obligately bimodal with each cell division resulting in the generation of one mother and one swarmer cell, evidence was obtained that hopanoids where specifically localized to the outer membrane of mother cells. The sequestration of hopanoids to the mother cells was also disrupted by the deletion of the hpnN1 gene. Mutants lacking the hopanoid transporters were able to grow normally at 30 °C but showed decreased growth at 38 °C. The hopanoid transporter mutant formed cellular filaments when grown at elevated temperature. Because sedimentary steranes and hopanes comprise some of the earliest evidence for the emergence of distinct bacteria and eukaryotic phyla, a better appreciation of the function of hopanoids will improve our ability to interpret the evolution of life on Earth.

  12. Overtreatment in couples with unexplained infertility. (United States)

    Kersten, F A M; Hermens, R P G M; Braat, D D M; Hoek, A; Mol, B W J; Goddijn, M; Nelen, W L D M


    What is the percentage of overtreatment, i.e. fertility treatment started too early, in couples with unexplained infertility who were eligible for tailored expectant management? Overtreatment occurred in 36% of couples with unexplained infertility who were eligible for an expectant management of at least 6 months. Prognostic models in reproductive medicine can help to identify infertile couples that would benefit from fertility treatment. In couples with unexplained infertility with a good chance of natural conception within 1 year, based on the Hunault prediction model, an expectant management of 6-12 months, as recommended in international fertility guidelines, prevents unnecessary treatment. A retrospective cohort study in 25 participating clinics, with follow-up of all couples who were seen for infertility in 2011-2012. In all, 9818 couples were seen for infertility in the participating clinics. Couples were eligible to participate if they were diagnosed with unexplained infertility and had a good prognosis of natural conception (>30%) within 1 year based on the Hunault prediction model. Data to assess overtreatment were collected from medical records. Multilevel regression analyses were performed to investigate associations of overtreatment with patient and clinic characteristics. Five hundred and forty-four couples eligible for expectant management were included in this study. Among these, overtreatment, i.e. starting medically assisted reproduction within 6 months, occurred in 36%. The underlying quality indicators showed that in 34% no prognosis was calculated and that in 42% expectant management was not recommended. Finally, 16% of the couples for whom a correct recommendation of expectant management for at least 6 months was made, started treatment within 6 months anyway. Overtreatment was associated with childlessness, higher female age and a longer duration of infertility. No associations between overtreatment and clinic characteristics were found. The

  13. Mode coupling in spin torque oscillators

    International Nuclear Information System (INIS)

    Zhang, Steven S.-L.; Zhou, Yan; Li, Dong; Heinonen, Olle


    A number of recent experimental works have shown that the dynamics of a single spin torque oscillator can exhibit complex behavior that stems from interactions between two or more modes of the oscillator, such as observed mode-hopping or mode coexistence. There has been some initial work indicating how the theory for a single-mode (macro-spin) spin torque oscillator should be generalized to include several modes and the interactions between them. In the present work, we rigorously derive such a theory starting with the Landau–Lifshitz–Gilbert equation for magnetization dynamics by expanding up to third-order terms in deviation from equilibrium. Our results show how a linear mode coupling, which is necessary for observed mode-hopping to occur, arises through coupling to a magnon bath. The acquired temperature dependence of this coupling implies that the manifold of orbits and fixed points may shift with temperature. - Highlights: • Deriving equations for coupled modes in spin torque oscillators. • Including Hamiltonian formalism and elimination of three–magnon processes. • Thermal bath of magnons central to mode coupling. • Numerical examples of circular and elliptical devices.

  14. Dynamic Coupling Between Respiratory and Cardiovascular System (United States)

    Censi, Federica; Calcagnini, Giovanni; Cerutti, Sergio

    The analysis of non-linear dynamics of the coupling among interacting quantities can be very useful for understanding the cardiorespiratory and cardiovascular control mechanisms. In this chapter RP is used to detect and quantify the degree of non-linear coupling between respiration and spontaneous rhythms of both heart rate and blood pressure variability signals. RQA turned out to be suitable for a quantitative evaluation of the observed coupling patterns among rhythms, both in simulated and real data, providing different degrees of coupling. The results from the simulated data showed that the increased degree of coupling between the signals was marked by the increase of PR and PD, and by the decrease of ER. When the RQA was applied to experimental data, PD and ER turned out to be the most significant variables, compared to PR. A remarkable finding is the detection of transient 1:2 PL episodes between respiration and cardiovascular variability signals. This phenomenon can be associated to a sub-harmonic synchronization between the two main rhythms of HR and BP variability series.

  15. Nanocatalysts for Suzuki cross-coupling reactions

    KAUST Repository

    Fihri, Aziz


    This critical review deals with the applications of nanocatalysts in Suzuki coupling reactions, a field that has attracted immense interest in the chemical, materials and industrial communities. We intend to present a broad overview of nanocatalysts for Suzuki coupling reactions with an emphasis on their performance, stability and reusability. We begin the review with a discussion on the importance of Suzuki cross-coupling reactions, and we then discuss fundamental aspects of nanocatalysis, such as the effects of catalyst size and shape. Next, we turn to the core focus of this review: the synthesis, advantages and disadvantages of nanocatalysts for Suzuki coupling reactions. We begin with various nanocatalysts that are based on conventional supports, such as high surface silica, carbon nanotubes, polymers, metal oxides and double hydroxides. Thereafter, we reviewed nanocatalysts based on non-conventional supports, such as dendrimers, cyclodextrin and magnetic nanomaterials. Finally, we discuss nanocatalyst systems that are based on non-conventional media, i.e., fluorous media and ionic liquids, for use in Suzuki reactions. At the end of this review, we summarise the significance of nanocatalysts, their impacts on conventional catalysis and perspectives for further developments of Suzuki cross-coupling reactions (131 references). © 2011 The Royal Society of Chemistry.

  16. Perturbative Critical Behavior from Spacetime Dependent Couplings

    International Nuclear Information System (INIS)

    Torroba, Gonzalo


    We find novel perturbative fixed points by introducing mildly spacetime-dependent couplings into otherwise marginal terms. In four-dimensional QFT, these are physical analogues of the small-ε Wilson-Fisher fixed point. Rather than considering 4-ε dimensions, we stay in four dimensions but introduce couplings whose leading spacetime dependence is of the form λx κ μ κ , with a small parameter κ playing a role analogous to ε. We show, in φ 4 theory and in QED and QCD with massless flavors, that this leads to a critical theory under perturbative control over an exponentially wide window of spacetime positions x. The exact fixed point coupling λ * (x) in our theory is identical to the running coupling of the translationally invariant theory, with the scale replaced by 1/x. Similar statements hold for three-dimensional φ 6 theories and two-dimensional sigma models with curved target spaces. We also describe strongly coupled examples using conformal perturbation theory.

  17. Coupled geochemical and solute transport code development

    International Nuclear Information System (INIS)

    Morrey, J.R.; Hostetler, C.J.


    A number of coupled geochemical hydrologic codes have been reported in the literature. Some of these codes have directly coupled the source-sink term to the solute transport equation. The current consensus seems to be that directly coupling hydrologic transport and chemical models through a series of interdependent differential equations is not feasible for multicomponent problems with complex geochemical processes (e.g., precipitation/dissolution reactions). A two-step process appears to be the required method of coupling codes for problems where a large suite of chemical reactions must be monitored. Two-step structure requires that the source-sink term in the transport equation is supplied by a geochemical code rather than by an analytical expression. We have developed a one-dimensional two-step coupled model designed to calculate relatively complex geochemical equilibria (CTM1D). Our geochemical module implements a Newton-Raphson algorithm to solve heterogeneous geochemical equilibria, involving up to 40 chemical components and 400 aqueous species. The geochemical module was designed to be efficient and compact. A revised version of the MINTEQ Code is used as a parent geochemical code

  18. Mode coupling in spin torque oscillators

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Steven S.-L., E-mail: [Department of Physics and Astronomy, University of Missouri, Columbia, MO 65211 (United States); Zhou, Yan, E-mail: [Department of Physics, The University of Hong Kong, Hong Kong (China); Center of Theoretical and Computational Physics, University of Hong Kong, Hong Kong (China); Li, Dong, E-mail: [Department of Physics, Centre for Nonlinear Studies, and Beijing-Hong Kong-Singapore Joint Centre for Nonlinear and Complex Systems, Hong Kong Baptist University, Kowloon Tong, Hong Kong (China); Heinonen, Olle, E-mail: [Material Science Division, Argonne National Laboratory, Lemont, IL 60439 (United States); Northwestern-Argonne Institute of Science and Technology, 2145 Sheridan Road, Evanston, IL 60208 (United States); Computation Institute, The Unversity of Chicago, 5735 S Ellis Avenue, Chicago, IL 60637 (United States)


    A number of recent experimental works have shown that the dynamics of a single spin torque oscillator can exhibit complex behavior that stems from interactions between two or more modes of the oscillator, such as observed mode-hopping or mode coexistence. There has been some initial work indicating how the theory for a single-mode (macro-spin) spin torque oscillator should be generalized to include several modes and the interactions between them. In the present work, we rigorously derive such a theory starting with the Landau–Lifshitz–Gilbert equation for magnetization dynamics by expanding up to third-order terms in deviation from equilibrium. Our results show how a linear mode coupling, which is necessary for observed mode-hopping to occur, arises through coupling to a magnon bath. The acquired temperature dependence of this coupling implies that the manifold of orbits and fixed points may shift with temperature. - Highlights: • Deriving equations for coupled modes in spin torque oscillators. • Including Hamiltonian formalism and elimination of three–magnon processes. • Thermal bath of magnons central to mode coupling. • Numerical examples of circular and elliptical devices.

  19. Automatic design of permanent magnet coupling

    International Nuclear Information System (INIS)

    Yonnet, J.-P.; Pandele, P.; Coutel, C.; Wurtz, F.


    Up to now, two main methods have been used to design permanent magnet couplings : finite element calculation, and analytical expressions of the forces between the magnets. The two methods use the same starting point, the permanent magnet coupling dimensions. The calculated parameters are the forces and the torques. The optimization of the couplings shape is generally done by using different curves describing torque variations as a function of the different geometrical parameters. We have developed a very new approach solving the reverse problem. Choosing the value of the torque, the airgap and an optimization criterium, the new method automatically calculates the size of the magnets and the ideal number of poles. It is based on a software, PASCOSMA, using an analytical model of the coupling which can be eventually corrected by a finite element method like FLUX2D. The coupling optimization is automatically made, keeping the parameters between predefined values. For a given application, it is very easy to obtain the best design, for example with the minimum magnet volume. (orig.)

  20. Qubit absorption refrigerator at strong coupling (United States)

    Mu, Anqi; Agarwalla, Bijay Kumar; Schaller, Gernot; Segal, Dvira


    We demonstrate that a quantum absorption refrigerator (QAR) can be realized from the smallest quantum system, a qubit, by coupling it in a non-additive (strong) manner to three heat baths. This function is un-attainable for the qubit model under the weak system-bath coupling limit, when the dissipation is additive. In an optimal design, the reservoirs are engineered and characterized by a single frequency component. We then obtain closed expressions for the cooling window and refrigeration efficiency, as well as bounds for the maximal cooling efficiency and the efficiency at maximal power. Our results agree with macroscopic designs and with three-level models for QARs, which are based on the weak system-bath coupling assumption. Beyond the optimal limit, we show with analytical calculations and numerical simulations that the cooling efficiency varies in a non-universal manner with model parameters. Our work demonstrates that strongly-coupled quantum machines can exhibit function that is un-attainable under the weak system-bath coupling assumption.

  1. Methods work better when couples talk. (United States)

    Keller, S


    Sexual partners who communicate about reproductive health issues reduce their risk of acquiring a sexually transmitted disease (STD) or of unintended pregnancy, but few couples feel comfortable talking openly about sex. AIDS prevention programs have focused on improving couple communication, but family planning programs have emphasized women-controlled contraception as more reliable than barrier methods. The effectiveness of barrier methods would likely improve, however, if clients are counseled in couple communication. Effective communication about sexual issues requires self-confidence, and strengthening a woman's self-confidence may also improve her ability to negotiate condom use. Small discussion groups held among female factory workers in Thailand in 1993-94 led to an increase from 60% to 90% in the number of women who felt confident in discussing STD risk with a partner and to an increase from 36% to 82% in those who said they would not be embarrassed to give a partner a condom. A Nigerian study also suggested that more education may also improve prospects for couple communication and contraceptive usage. A US study showed that adolescent women who communicated openly with their partners reduced their risks of unintended pregnancy and STDs, and a Kenyan study indicated that communication increases contraceptive usage among married couples. Various projects around the world are attempting to counsel women on communication and condom negotiation, and counselors are beginning the difficult task of teaching women how to convince men to use condoms.

  2. Status report on SHARP coupling framework.

    Energy Technology Data Exchange (ETDEWEB)

    Caceres, A.; Tautges, T. J.; Lottes, J.; Fischer, P.; Rabiti, C.; Smith, M. A.; Siegel, A.; Yang, W. S.; Palmiotti, G.


    This report presents the software engineering effort under way at ANL towards a comprehensive integrated computational framework (SHARP) for high fidelity simulations of sodium cooled fast reactors. The primary objective of this framework is to provide accurate and flexible analysis tools to nuclear reactor designers by simulating multiphysics phenomena happening in complex reactor geometries. Ideally, the coupling among different physics modules (such as neutronics, thermal-hydraulics, and structural mechanics) needs to be tight to preserve the accuracy achieved in each module. However, fast reactor cores in steady state mode represent a special case where weak coupling between neutronics and thermal-hydraulics is usually adequate. Our framework design allows for both options. Another requirement for SHARP framework has been to implement various coupling algorithms that are parallel and scalable to large scale since nuclear reactor core simulations are among the most memory and computationally intensive, requiring the use of leadership-class petascale platforms. This report details our progress toward achieving these goals. Specifically, we demonstrate coupling independently developed parallel codes in a manner that does not compromise performance or portability, while minimizing the impact on individual developers. This year, our focus has been on developing a lightweight and loosely coupled framework targeted at UNIC (our neutronics code) and Nek (our thermal hydraulics code). However, the framework design is not limited to just using these two codes.

  3. Transitions to Synchrony in Coupled Bursting Neurons (United States)

    Dhamala, Mukeshwar; Jirsa, Viktor K.; Ding, Mingzhou


    Certain cells in the brain, for example, thalamic neurons during sleep, show spike-burst activity. We study such spike-burst neural activity and the transitions to a synchronized state using a model of coupled bursting neurons. In an electrically coupled network, we show that the increase of coupling strength increases incoherence first and then induces two different transitions to synchronized states, one associated with bursts and the other with spikes. These sequential transitions to synchronized states are determined by the zero crossings of the maximum transverse Lyapunov exponents. These results suggest that synchronization of spike-burst activity is a multi-time-scale phenomenon and burst synchrony is a precursor to spike synchrony.

  4. Transitions to synchrony in coupled bursting neurons

    International Nuclear Information System (INIS)

    Dhamala, Mukeshwar; Jirsa, Viktor K.; Ding Mingzhou


    Certain cells in the brain, for example, thalamic neurons during sleep, show spike-burst activity. We study such spike-burst neural activity and the transitions to a synchronized state using a model of coupled bursting neurons. In an electrically coupled network, we show that the increase of coupling strength increases incoherence first and then induces two different transitions to synchronized states, one associated with bursts and the other with spikes. These sequential transitions to synchronized states are determined by the zero crossings of the maximum transverse Lyapunov exponents. These results suggest that synchronization of spike-burst activity is a multi-time-scale phenomenon and burst synchrony is a precursor to spike synchrony

  5. Coupled Photonic Crystal Cavity Array Laser

    DEFF Research Database (Denmark)

    Schubert, Martin

    in the quadratic lattice. Processing techniques are developed and optimized in order fabricate photonic crystals membranes in gallium arsenide with quantum dots as gain medium and in indium gallium arsenide phosphide with quantum wells as gain medium. Several key issues in process to ensure good quality....... The results are in good agreement with standard coupled mode theory. Also a novel type of photonic crystal structure is proposed called lambda shifted cavity which is a twodimensional photonic crystal laser analog of a VCSEL laser. Detailed measurements of the coupled modes in the photonic crystals...... with quantum dots are carried out. In agreement with a simple gain model the structures do not show stimulated emission. The spectral splitting due to the coupling between single cavities as well as arrays of cavities is studied theoretically and experimentally. Lasing is observed for photonic crystal cavity...

  6. Chameleons with field-dependent couplings

    International Nuclear Information System (INIS)

    Brax, Philippe; Bruck, Carsten van de; Mota, David F.; Winther, Hans A.; Nunes, Nelson J.


    Certain scalar-tensor theories exhibit the so-called chameleon mechanism, whereby observational signatures of scalar fields are hidden by a combination of self-interactions and interactions with ambient matter. Not all scalar-tensor theories exhibit such a chameleon mechanism, which has been originally found in models with inverse power runaway potentials and field-independent couplings to matter. In this paper we investigate field theories with field-dependent couplings and a power-law potential for the scalar field. We show that the theory indeed is a chameleon field theory. We find the thin-shell solution for a spherical body and investigate the consequences for Eoet-Wash experiments, fifth-force searches and Casimir-force experiments. Requiring that the scalar field evades gravitational tests, we find that the coupling is sensitive to a mass scale which is of order of the Hubble scale today.

  7. Vehicle systems: coupled and interactive dynamics analysis (United States)

    Vantsevich, Vladimir V.


    This article formulates a new direction in vehicle dynamics, described as coupled and interactive vehicle system dynamics. Formalised procedures and analysis of case studies are presented. An analytical consideration, which explains the physics of coupled system dynamics and its consequences for dynamics of a vehicle, is given for several sets of systems including: (i) driveline and suspension of a 6×6 truck, (ii) a brake mechanism and a limited slip differential of a drive axle and (iii) a 4×4 vehicle steering system and driveline system. The article introduces a formal procedure to turn coupled system dynamics into interactive dynamics of systems. A new research direction in interactive dynamics of an active steering and a hybrid-electric power transmitting unit is presented and analysed to control power distribution between the drive axles of a 4×4 vehicle. A control strategy integrates energy efficiency and lateral dynamics by decoupling dynamics of the two systems thus forming their interactive dynamics.

  8. Coherent Vortices in Strongly Coupled Liquids

    International Nuclear Information System (INIS)

    Ashwin, J.; Ganesh, R.


    Strongly coupled liquids are ubiquitous in both nature and laboratory plasma experiments. They are unique in the sense that their average potential energy per particle dominates over the average kinetic energy. Using ''first principles'' molecular dynamics (MD) simulations, we report for the first time the emergence of isolated coherent tripolar vortices from the evolution of axisymmetric flows in a prototype two-dimensional (2D) strongly coupled liquid, namely, the Yukawa liquid. Linear growth rates directly obtained from MD simulations are compared with a generalized hydrodynamic model. Our MD simulations reveal that the tripolar vortices persist over several turn over times and hence may be observed in strongly coupled liquids such as complex plasma, liquid metals and astrophysical systems such as white dwarfs and giant planetary interiors, thereby making the phenomenon universal.

  9. Coherent Vortices in Strongly Coupled Liquids (United States)

    Ashwin, J.; Ganesh, R.


    Strongly coupled liquids are ubiquitous in both nature and laboratory plasma experiments. They are unique in the sense that their average potential energy per particle dominates over the average kinetic energy. Using “first principles” molecular dynamics (MD) simulations, we report for the first time the emergence of isolated coherent tripolar vortices from the evolution of axisymmetric flows in a prototype two-dimensional (2D) strongly coupled liquid, namely, the Yukawa liquid. Linear growth rates directly obtained from MD simulations are compared with a generalized hydrodynamic model. Our MD simulations reveal that the tripolar vortices persist over several turn over times and hence may be observed in strongly coupled liquids such as complex plasma, liquid metals and astrophysical systems such as white dwarfs and giant planetary interiors, thereby making the phenomenon universal.

  10. Nonlocal synchronization in nearest neighbour coupled oscillators

    International Nuclear Information System (INIS)

    El-Nashar, H.F.; Elgazzar, A.S.; Cerdeira, H.A.


    We investigate a system of nearest neighbour coupled oscillators. We show that the nonlocal frequency synchronization, that might appear in such a system, occurs as a consequence of the nearest neighbour coupling. The power spectra of nonadjacent oscillators shows that there is no complete coincidence between all frequency peaks of the oscillators in the nonlocal cluster, while the peaks for neighbouring oscillators approximately coincide even if they are not yet in a cluster. It is shown that nonadjacent oscillators closer in frequencies, share slow modes with their adjacent oscillators which are neighbours in space. It is also shown that when a direct coupling between non-neighbours oscillators is introduced explicitly, the peaks of the spectra of the frequencies of those non-neighbours coincide. (author)

  11. Magnetically coupled impedance-source inverters

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Blaabjerg, Frede


    input-to-output gain, and the presence of an impedance network. The former means a high dc-link voltage, which can stress the semiconductor switches unnecessarily. The latter leads to increases in cost and size, which similarly are undesirable. To lessen these concerns, an interesting approach is to use...... magnetically coupled transformers or inductors to raise the gain and modulation ratio simultaneously, while reducing the number of passive components needed. A study of the approach is now presented to show how various existing magnetically coupled inverters can be derived by applying a generic methodology....... The same methodology is then applied to develop more magnetically coupled Z-source inverters with advantages that have not been identified in the literature. These findings have already been proven in experiments....

  12. Numerical simulations of coupled problems in engineering

    CERN Document Server


    This book presents and discusses mathematical models, numerical methods and computational techniques used for solving coupled problems in science and engineering. It takes a step forward in the formulation and solution of real-life problems with a multidisciplinary vision, accounting for all of the complex couplings involved in the physical description. Simulation of multifaceted physics problems is a common task in applied research and industry. Often a suitable solver is built by connecting together several single-aspect solvers into a network. In this book, research in various fields was selected for consideration: adaptive methodology for multi-physics solvers, multi-physics phenomena and coupled-field solutions, leading to computationally intensive structural analysis. The strategies which are used to keep these problems computationally affordable are of special interest, and make this an essential book.

  13. Strategic Coupling Based on Natural Resources

    DEFF Research Database (Denmark)

    Hauge, Mads Martinus

    The topic of this thesis is the resourced-based industrialization of the Mekong River Delta (MRD) Region of Vietnam. It shows how a region is linked with the world market and how settlements and living conditions are being transformed as part of a globalized regional development. A modular theory......-building approach rooted in the Global Production Network (GPN) framework constitutes the analytical approach to the thesis, providing pertinent conceptualizations to explore and discuss how a globalized regional development unfolds. The main theoretical concept of the thesis is that of strategic coupling......, an established concept within the GPN framework that explores and explains how local assets are molded to complement the needs of the global market. However, existing applications of the notion of strategic coupling do not cover the situation in which a resource-based economy is coupled with the world market...

  14. Obesity and Sexuality Among Older Couples. (United States)

    Kwon, Soyoung; Schafer, Markus H


    We investigate whether obesity is associated with sexual activity, sexual frequency, and the range of sexual behaviors in heterosexual older couples. We assess to what extent associations between obesity and sexuality are explained by physical, psychological, and sexual health, and by relationship quality. We use data from 1,698 older adults in 849 partnered dyads in the 2010-2011 wave of the National Social Life, Health, and Aging Project and conduct couple-level analysis featuring women's and men's characteristics. Women's obesity-particularly at severe levels-is negatively associated with coupled sexual activity, and that the association is not mediated by hypothesized mediators. Men's obesity did not have any association with sexual activity. There was no significant difference between overweight and normal weight adults across all three sexuality measures. The growing number of older adults with high levels of body mass index, particularly women, may face certain difficulties in maintaining active sexual lives.

  15. Scalable BDDC Algorithms for Cardiac Electromechanical Coupling

    KAUST Repository

    Pavarino, L. F.; Scacchi, S.; Verdi, C.; Zampieri, E.; Zampini, Stefano


    The spread of electrical excitation in the cardiac muscle and the subsequent contraction-relaxation process is quantitatively described by the cardiac electromechanical coupling model. The electrical model consists of the Bidomain system, which is a degenerate parabolic system of two nonlinear partial differential equations (PDEs) of reaction-diffusion type, describing the evolution in space and time of the intra- and extracellular electric potentials. The PDEs are coupled through the reaction term with a stiff system of ordinary differential equations (ODEs), the membrane model, which describes the flow of the ionic currents through the cellular membrane and the dynamics of the associated gating variables. The mechanical model consists of the quasi-static finite elasticity system, modeling the cardiac tissue as a nearly-incompressible transversely isotropic hyperelastic material, and coupled with a system of ODEs accounting for the development of biochemically generated active force.

  16. Modeling of Coupled Nano-Cavity Lasers

    DEFF Research Database (Denmark)

    Skovgård, Troels Suhr

    -of-states and it is argued that Purcell enhancement should also be included in stimulated recombination term, contrary to the common practice in the literature. It is shown that for quantum well devices, the Purcell enhancement is effectively independent of the cavity quality factor due to the broad electronic density......-of-states relative to the optical density-of-states. The low effective Purcell eect for quantum well devices limits the highest possible modulation bandwidth to a few tens of gigahertz, which is comparable to the performance of conventional diode lasers. Compared to quantum well devices, quantum dot devices have...... is useful for design of coupled systems. A tight-binding description for coupled nanocavity lasers is developed and employed to investigate the phase-locking behavior for the system of two coupled cavities. Phase-locking is found to be critically dependent on exact parameter values and to be dicult...

  17. The Optimal Income Taxation of Couples

    DEFF Research Database (Denmark)

    Kleven, Henrik Jacobsen; Kreiner, Claus Thustrup; Saez, Emmanuel


    This paper analyzes the general nonlinear optimal income tax for couples, a multidimensional screening problem. Each couple consists of a primary earner who always participates in the labor market, but makes an hours-of-work choice, and a secondary earner who chooses whether or not to work....... If second-earner participation is a signal of the couple being better (worse) off, we prove that optimal tax schemes display a positive tax (subsidy) on secondary earnings and that the tax (subsidy) on secondary earnings decreases with primary earnings and converges to zero asymptotically. We present...... calibrated microsimulations for the United Kingdom showing that decreasing tax rates on secondary earnings is quantitatively significant and consistent with actual income tax and transfer programs....

  18. Scalable BDDC Algorithms for Cardiac Electromechanical Coupling

    KAUST Repository

    Pavarino, L. F.


    The spread of electrical excitation in the cardiac muscle and the subsequent contraction-relaxation process is quantitatively described by the cardiac electromechanical coupling model. The electrical model consists of the Bidomain system, which is a degenerate parabolic system of two nonlinear partial differential equations (PDEs) of reaction-diffusion type, describing the evolution in space and time of the intra- and extracellular electric potentials. The PDEs are coupled through the reaction term with a stiff system of ordinary differential equations (ODEs), the membrane model, which describes the flow of the ionic currents through the cellular membrane and the dynamics of the associated gating variables. The mechanical model consists of the quasi-static finite elasticity system, modeling the cardiac tissue as a nearly-incompressible transversely isotropic hyperelastic material, and coupled with a system of ODEs accounting for the development of biochemically generated active force.

  19. Compensating strong coupling with large charge

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez-Gaume, Luis [Theory Department - CERN,CH-1211 Geneva 23 (Switzerland); Simons Center for Geometry and Physics, State University of New York,Stony Brook, NY-11794-3636 (United States); Loukas, Orestis; Orlando, Domenico; Reffert, Susanne [Albert Einstein Center for Fundamental Physics,Institute for Theoretical Physics, University of Bern,Sidlerstrasse 5, CH-3012 Bern (Switzerland)


    We study some (conformal) field theories with global symmetries in the sector where the value of the global charge Q is large. We find (as expected) that the low energy excitations of this sector are described by the general form of Goldstone’s theorem in the non-relativistic regime. We also derive the unexpected result, first presented in, that the effective field theory describing such sector of fixed Q contains effective couplings λ{sub eff}∼λ{sup b}/Q{sup a}, where λ is the original coupling. Hence, large charge leads to weak coupling. In the last section of the paper we present an outline of how to compute anomalous dimensions of the O(n) model in this limit.

  20. Deterministic Diffusion in Delayed Coupled Maps

    International Nuclear Information System (INIS)

    Sozanski, M.


    Coupled Map Lattices (CML) are discrete time and discrete space dynamical systems used for modeling phenomena arising in nonlinear systems with many degrees of freedom. In this work, the dynamical and statistical properties of a modified version of the CML with global coupling are considered. The main modification of the model is the extension of the coupling over a set of local map states corresponding to different time iterations. The model with both stochastic and chaotic one-dimensional local maps is studied. Deterministic diffusion in the CML under variation of a control parameter is analyzed for unimodal maps. As a main result, simple relations between statistical and dynamical measures are found for the model and the cases where substituting nonlinear lattices with simpler processes is possible are presented. (author)

  1. Dynamics of microbubble oscillators with delay coupling (United States)

    Heckman, C. R.; Sah, S. M.; Rand, R. H.


    We investigate the stability of the in-phase mode in a system of two delay-coupled bubble oscillators. The bubble oscillator model is based on a 1956 paper by Keller and Kolodner. Delay coupling is due to the time it takes for a signal to travel from one bubble to another through the liquid medium that surrounds them. Using techniques from the theory of differential-delay equations as well as perturbation theory, we show that the equilibrium of the in-phase mode can be made unstable if the delay is long enough and if the coupling strength is large enough, resulting in a Hopf bifurcation. We then employ Lindstedt's method to compute the amplitude of the limit cycle as a function of the time delay. This work is motivated by medical applications involving noninvasive localized drug delivery via microbubbles.

  2. Coupled seismoacoustic modes on the seafloor (United States)

    Butler, Rhett; Lomnitz, Cinna


    Wave-to-wave coupling arises when an acoustic pulse selects a Rayleigh mode of the same speed and both travel together swapping energy across an interface [Ewing et al., 1957]. A distinctive signal is observed at the Hawaii-2 Observatory for purely oceanic paths from earthquakes on the Blanco and Mendocino Fracture Zones, off the coast of North America. The signal appears to be a composite of undispersed higher Rayleigh modes propagating along the ocean floor both in the sediments and in the water. The new coupled modes are identified by their frequency composition and their phase and group velocities. Seismoacoustic coupling at the seafloor is conditioned on (a) the presence of a low-velocity interface at the ocean floor, and (b) the wavelength of the Rayleigh component being shorter than the depth of the water layer.

  3. Synchronization in networks with heterogeneous coupling delays (United States)

    Otto, Andreas; Radons, Günter; Bachrathy, Dániel; Orosz, Gábor


    Synchronization in networks of identical oscillators with heterogeneous coupling delays is studied. A decomposition of the network dynamics is obtained by block diagonalizing a newly introduced adjacency lag operator which contains the topology of the network as well as the corresponding coupling delays. This generalizes the master stability function approach, which was developed for homogenous delays. As a result the network dynamics can be analyzed by delay differential equations with distributed delay, where different delay distributions emerge for different network modes. Frequency domain methods are used for the stability analysis of synchronized equilibria and synchronized periodic orbits. As an example, the synchronization behavior in a system of delay-coupled Hodgkin-Huxley neurons is investigated. It is shown that the parameter regions where synchronized periodic spiking is unstable expand when increasing the delay heterogeneity.

  4. Coupling slots without shunt impedance drop

    International Nuclear Information System (INIS)

    Balleyguier, P.


    It is well known that coupling slots between adjacent cells in a π-mode structure reduce shunt impedance per unit length with respect to single cell cavities. To design optimized coupling slots, one has to answer the following question: for a given coupling factor, what shape, dimension, position and number of slots lead to the lowest shunt impedance drop? A numerical study using the 3D code MAFIA has been carried out. The aim was to design the 352 MHz cavities for the high intensity proton accelerator of the TRISPAL project. The result is an unexpected set of four 'petal' slots. Such slots should lead to a quasi-negligible drop in shunt impedance: about -1% on average, for particle velocity from 0.4 c to 0.8 c. (author)

  5. Mesoscopic quantum emitters coupled to plasmonic nanostructures

    DEFF Research Database (Denmark)

    Andersen, Mads Lykke

    for the spontaneous emission of mesoscopic quantum emitters is developed. The light-matter interaction is in this model modied beyond the dipole expectancy and found to both suppress and enhance the coupling to plasmonic modes in excellent agreement with our measurements. We demonstrate that this mesoscopic effect......This thesis reports research on quantum dots coupled to dielectric and plasmonic nano-structures by way of nano-structure fabrication, optical measurements, and theoretical modeling. To study light-matter interaction, plasmonic gap waveguides with nanometer dimensions as well as samples for studies...... to allow for e- cient plasmon-based single-photon sources. Theoretical studies of coupling and propagation properties of plasmonic waveguides reveal that a high-refractive index of the medium surrounding the emitter, e.g. nGaAs = 3.5, limits the realizability of ecient plasmon-based single-photon sources...

  6. Direction selective structural-acoustic coupled radiator (United States)

    Seo, Hee-Seon; Kim, Yang-Hann


    This paper presents a method of designing a structural-acoustic coupled radiator that can emit sound in the desired direction. The structural-acoustic coupled system is consisted of acoustic spaces and wall. The wall composes two plates and an opening, and the wall separates one space that is highly reverberant and the other that is unbounded without any reflection. An equation is developed that predicts energy distribution and energy flow in the two spaces separated by the wall, and its computational examples are presented including near field acoustic characteristics. To design the directional coupled radiator, Pareto optimization method is adapted. An objective is selected to maximize radiation power on a main axis and minimize a side lobe level and a subjective is selected direction of the main axis and dimensions of the walls geometry. Pressure and intensity distribution of the designed radiator is also presented.

  7. Beam echoes in the presence of coupling

    Energy Technology Data Exchange (ETDEWEB)

    Gross, Axel [Case Western Reserve U.


    Transverse beam echoes could provide a new technique of measuring diusion characteristics orders of magnitude faster than the current methods; however, their interaction with many accelerator parameters is poorly understood. Using a program written in C, we explored the relationship between coupling and echo strength. We found that echoes could be generated in both dimensions, even with a dipole kick in only one dimension. We found that the echo eects are not destroyed even when there is strong coupling, falling o only at extremely high coupling values. We found that at intermediate values of skew quadrupole strength, the decoherence time of the beam is greatly increased, causing a destruction of the echo eects. We found that this is caused by a narrowing of the tune width of the particles. Results from this study will help to provide recommendations to IOTA (Integrable Optics Test Accelerator) for their upcoming echo experiment.

  8. Compensating strong coupling with large charge

    CERN Document Server

    Alvarez-Gaume, Luis; Orlando, Domenico; Reffert, Susanne


    We study (conformal) field theories with global symmetries in the sector where the value of the global charge $Q$ is large. We find (as expected) that the low energy excitations of this sector are described by the general form of Goldstone's theorem in the non-relativistic regime. We also derive the unexpected result, first presented in [Hellerman:2015], that the effective field theory describing such sector of fixed $Q$ contains effective couplings $\\lambda_{\\text{eff}}\\sim \\lambda^b /Q^{a}$, where $\\lambda$ is the original coupling. Hence, large charge leads to weak coupling. In the last section of the paper we present an outline of how to compute anomalous dimensions in this limit.

  9. Orthogonal Coupling in Cavity BPM with Slots

    CERN Document Server

    Lipka, D; Siemens, M; Vilcins, S; Caspers, Friedhelm; Stadler, M; Treyer, DM; Maesaka, H; Shintake, T


    XFELs require high precision orbit control in their long undulator sections. Due to the pulsed operation of drive linacs the high precision has to be reached by single bunch measurements. So far only cavity BPMs achieve the required performance and will be used at the European XFEL, one between each of the up to 116 undulators. Coupling between the orthogonal planes limits the performance of beam position measurements. A first prototype build at DESY shows a coupling between orthogonal planes of about -20 dB, but the requirement is lower than -40 dB (1%). The next generation cavity BPM was build with tighter tolerances and mechanical changes, the orthogonal coupling is measured to be lower than -43 dB. This report discusses the various observations, measurements and improvements which were done.

  10. Coupled processes and the tropical climatology : part III : instabilities of the fully coupled climatology

    NARCIS (Netherlands)

    Dijkstra, H.A.; Neelin, J.D.


    Coupled processes between the equatorial ocean and atmosphere control the spatial structure of the annual mean state in the Pacific region,in particular the warm-pool/cold- tongue structure.At the same time,coupled processes are known to be responsible for the variability about this mean state,in

  11. Uzawa smoother in multigrid for the coupleD porous medium and stokes flow system

    NARCIS (Netherlands)

    P. Luo (Peiyao); C. Rodrigo (Carmen); F.J. Gaspar Lorenz (Franscisco); C.W. Oosterlee (Kees)


    textabstractThe multigrid solution of coupled porous media and Stokes flow problems is considered. The Darcy equation as the saturated porous medium model is coupled to the Stokes equations by means of appropriate interface conditions. We focus on an efficient multigrid solution technique for the

  12. Coupled intertwiner dynamics: A toy model for coupling matter to spin foam models (United States)

    Steinhaus, Sebastian


    The universal coupling of matter and gravity is one of the most important features of general relativity. In quantum gravity, in particular spin foams, matter couplings have been defined in the past, yet the mutual dynamics, in particular if matter and gravity are strongly coupled, are hardly explored, which is related to the definition of both matter and gravitational degrees of freedom on the discretization. However, extracting these mutual dynamics is crucial in testing the viability of the spin foam approach and also establishing connections to other discrete approaches such as lattice gauge theories. Therefore, we introduce a simple two-dimensional toy model for Yang-Mills coupled to spin foams, namely an Ising model coupled to so-called intertwiner models defined for SU (2 )k. The two systems are coupled by choosing the Ising coupling constant to depend on spin labels of the background, as these are interpreted as the edge lengths of the discretization. We coarse grain this toy model via tensor network renormalization and uncover an interesting dynamics: the Ising phase transition temperature turns out to be sensitive to the background configurations and conversely, the Ising model can induce phase transitions in the background. Moreover, we observe a strong coupling of both systems if close to both phase transitions.

  13. Computation of expectation values from vibrational coupled-cluster at the two-mode coupling level

    DEFF Research Database (Denmark)

    Zoccante, Alberto; Seidler, Peter; Christiansen, Ove


    In this work we show how the vibrational coupled-cluster method at the two-mode coupling level can be used to calculate zero-point vibrational averages of properties. A technique is presented, where any expectation value can be calculated using a single set of Lagrangian multipliers computed...

  14. Synchronization of hypernetworks of coupled dynamical systems

    International Nuclear Information System (INIS)

    Sorrentino, Francesco


    We consider the synchronization of coupled dynamical systems when different types of interactions are simultaneously present. We assume that a set of dynamical systems is coupled through the connections of two or more distinct networks (each of which corresponds to a distinct type of interaction), and we refer to such a system as a dynamical hypernetwork. Applications include neural networks made up of both electrical gap junctions and chemical synapses, the coordinated motion of shoals of fish communicating through both vision and flow sensing, and hypernetworks of coupled chaotic oscillators. We first analyze the case of a hypernetwork made up of m = 2 networks. We look for the necessary and sufficient conditions for synchronization. We attempt to reduce the linear stability problem to a master stability function (MSF) form, i.e. decoupling the effects of the coupling functions from the structure of the networks. Unfortunately, we are unable to obtain a reduction in an MSF form for the general case. However, we show that such a reduction is possible in three cases of interest: (i) the Laplacian matrices associated with the two networks commute; (ii) one of the two networks is unweighted and fully connected; and (iii) one of the two networks is such that the coupling strength from node i to node j is a function of j but not of i. Furthermore, we define a class of networks such that if either one of the two coupling networks belongs to this class, the reduction can be obtained independently of the other network. As an example of interest, we study synchronization of a neural hypernetwork for which the connections can be either chemical synapses or electrical gap junctions. We propose a generalization of our stability results to the case of hypernetworks formed of m ⩾ 2 networks. (paper)

  15. Controllable nonlinearity in a dual-coupling optomechanical system under a weak-coupling regime (United States)

    Zhu, Gui-Lei; Lü, Xin-You; Wan, Liang-Liang; Yin, Tai-Shuang; Bin, Qian; Wu, Ying


    Strong quantum nonlinearity gives rise to many interesting quantum effects and has wide applications in quantum physics. Here we investigate the quantum nonlinear effect of an optomechanical system (OMS) consisting of both linear and quadratic coupling. Interestingly, a controllable optomechanical nonlinearity is obtained by applying a driving laser into the cavity. This controllable optomechanical nonlinearity can be enhanced into a strong coupling regime, even if the system is initially in the weak-coupling regime. Moreover, the system dissipation can be suppressed effectively, which allows the appearance of phonon sideband and photon blockade effects in the weak-coupling regime. This work may inspire the exploration of a dual-coupling optomechanical system as well as its applications in modern quantum science.

  16. Composite systems of dilute and dense couplings

    International Nuclear Information System (INIS)

    Raymond, J R; Saad, D


    Composite systems, where couplings are of two types, a combination of strong dilute and weak dense couplings of Ising spins, are examined through the replica method. The dilute and dense parts are considered to have independent canonical disordered or uniform bond distributions; mixing the models by variation of a parameter γ alongside inverse temperature β we analyse the respective thermodynamic solutions. We describe the variation in high temperature transitions as mixing occurs; in the vicinity of these transitions we exactly analyse the competing effects of the dense and sparse models. By using the replica symmetric ansatz and population dynamics we described the low temperature behaviour of mixed systems

  17. Warm Inflation with Nonminimal Derivative Coupling

    International Nuclear Information System (INIS)

    Rashidi, N.; Nozari, Kourosh; Shoukrani, M.


    We study the effects of the nonminimal derivative coupling on the dissipative dynamics of the warm inflation where the scalar field is nonminimally coupled to gravity via its kinetic term. We present a detailed calculation of the cosmological perturbations in this setup. We use the recent observational data from the joint data set of WMAP9 + BAO + H 0 and also the Planck satellite data to constrain our model parameters for natural and chaotic inflation potentials. We study also the levels of non-Gaussianity in this warm inflation model and we confront the result with recent observational data from the Planck satellite

  18. Superstring threshold corrections to Yukawa couplings

    International Nuclear Information System (INIS)

    Antoniadis, I.; Taylor, T.R.


    A general method of computing string corrections to the Kaehler metric and Yukawa couplings is developed at the one-loop level for a general compactification of the heterotic superstring theory. It also provides a direct determination of the so-called Green-Schwarz term. The matter metric has an infrared divergent part which reproduces the field-theoretical anomalous dimensions, and a moduli-dependent part which gives rise to threshold corrections in the physical Yukawa couplings. Explicit expressions are derived for symmetric orbifold compactifications. (author). 20 refs

  19. Money: a therapeutic tool for couples therapy. (United States)

    Shapiro, Margaret


    This article addresses the therapeutic importance of discussing money at every stage of a couple's relationship, both as a concrete reality and as a metaphor for security, adequacy, competence, commitment, acceptance, and acknowledgment in a relationship. I will present a developmental schema looking at financial issues that couples confront at various stages in the adult life cycle and how these affect and reflect relationship problems. The article also presents a money questionnaire as a useful tool for exploring family-of-origin financial history, affect, and behavior.

  20. Theory of imperfect magnetosphere-ionosphere coupling

    International Nuclear Information System (INIS)

    Kan, J.R.; Lee, L.C.


    Atheory of magnetosphere-ionosphere coupling in the presence of field-aligned potential drops is formulated within the framework of magnetohydrodynamic equations. Our formulation allows the magnetosphere as well as the ionosphere to respond self-consistently to the parallel potential drop along auroral field lines. Equipotential contours are distorted into a V-shaped structure near the convection reversal boundary and S-shaped on the equatorward side, each gives rise to an inverted V precipitation band. The loading effect of the imperfect coupling results in a valley in the electric field profile which occurs equatorward of the convection reversal boundary

  1. Coherence protection in coupled quantum systems (United States)

    Cammack, H. M.; Kirton, P.; Stace, T. M.; Eastham, P. R.; Keeling, J.; Lovett, B. W.


    The interaction of a quantum system with its environment causes decoherence, setting a fundamental limit on its suitability for quantum information processing. However, we show that if the system consists of coupled parts with different internal energy scales then the interaction of one part with a thermal bath need not lead to loss of coherence from the other. Remarkably, we find that the protected part can remain coherent for longer when the coupling to the bath becomes stronger or the temperature is raised. Our theory will enable the design of decoherence-resistant hybrid quantum computers.

  2. Canonical formalism for coupled beam optics

    International Nuclear Information System (INIS)

    Kheifets, S.A.


    Beam optics of a lattice with an inter-plane coupling is treated using canonical Hamiltonian formalism. The method developed is equally applicable both to a circular (periodic) machine and to an open transport line. A solution of the equation of a particle motion (and correspondingly transfer matrix between two arbitrary points of the lattice) are described in terms of two amplitude functions (and their derivatives and corresponding phases of oscillations) and four coupling functions, defined by a solution of the system of the first-order nonlinear differential equations derived in the paper. Thus total number of independent parameters is equal to ten. 8 refs

  3. Ultrastrong Coupling Few-Photon Scattering Theory (United States)

    Shi, Tao; Chang, Yue; García-Ripoll, Juan José


    We study the scattering of individual photons by a two-level system ultrastrongly coupled to a waveguide. The scattering is elastic for a broad range of couplings and can be described with an effective U (1 )-symmetric Hamiltonian. This simple model allows the prediction of scattering resonance line shapes, validated up to α =0.3 , and close to the Toulouse point α =1 /2 , where inelastic scattering becomes relevant. Our predictions model experiments with superconducting circuits [P. Forn-Díaz et al., Nat. Phys. 13, 39 (2017), 10.1038/nphys3905] and can be extended to study multiphoton scattering.

  4. Strategies for waveguide coupling for SRF cavities

    International Nuclear Information System (INIS)

    Doolittle, L.R.


    Despite widespread use of coaxial couplers in SRF cavities, a single, simple waveguide coupling can be used both to transmit generator power to a cavity, and to remove a large class of Higher Order Modes (HOMs, produced by the beam). There are balances and tradeoffs to be made, such as the coupling strength of the various frequencies, the transverse component of the coupler fields on the beam axis, and the magnitude of the surface fields and currents. This paper describes those design constraints, categories of solutions, and examples from the CEBAF Energy Upgrade studies

  5. Calculating luminosity for a coupled Tevatron lattice

    International Nuclear Information System (INIS)

    Holt, J.A.; Martens, M.A.; Michelotti, L.; Goderre, G.


    The traditional formula for calculating luminosity assumes an uncoupled lattice and makes use of one-degree-of-freedom lattice functions, β H and β v , for relating transverse beam widths to emittances. Strong coupling requires changing this approach. It is simplest to employ directly the linear normal form coordinates of the one turn map. An equilibrium distribution in phase space is expressed as a function of the Jacobian's eigenvectors and beam size parameters or emittances. Using the equilibrium distributions an expression for the luminosity was derived and applied to the Tevatron lattice, which was coupled due to a quadrupole roll

  6. Analytical model of internally coupled ears

    DEFF Research Database (Denmark)

    Vossen, Christine; Christensen-Dalsgaard, Jakob; Leo van Hemmen, J


    Lizards and many birds possess a specialized hearing mechanism: internally coupled ears where the tympanic membranes connect through a large mouth cavity so that the vibrations of the tympanic membranes influence each other. This coupling enhances the phase differences and creates amplitude...... additionally provides the opportunity to incorporate the effect of the asymmetrically attached columella, which leads to the activation of higher membrane vibration modes. Incorporating this effect, the analytical model can explain measurements taken from the tympanic membrane of a living lizard, for example...

  7. Bright branes for strongly coupled plasmas

    International Nuclear Information System (INIS)

    Mateos, David; Patino, Leonardo


    We use holographic techniques to study photon production in a class of finite temperature, strongly coupled, large-N c SU(N c ) quark-gluon plasmas with N f c quark flavours. Our results are valid to leading order in the electromagnetic coupling constant but non-perturbatively in the SU(N c ) interactions. The spectral function of electromagnetic currents and other related observables exhibit an interesting structure as a function of the photon frequency and the quark mass. We discuss possible implications for heavy ion collision experiments

  8. Voids and overdensities of coupled Dark Energy

    International Nuclear Information System (INIS)

    Mainini, Roberto


    We investigate the clustering properties of dynamical Dark Energy even in association of a possible coupling between Dark Energy and Dark Matter. We find that within matter inhomogeneities, Dark Energy migth form voids as well as overdensity depending on how its background energy density evolves. Consequently and contrarily to what expected, Dark Energy fluctuations are found to be slightly suppressed if a coupling with Dark Matter is permitted. When considering density contrasts and scales typical of superclusters, voids and supervoids, perturbations amplitudes range from |δ φ | ∼ O(10 −6 ) to |δ φ | ∼ O(10 −4 ) indicating an almost homogeneous Dark Energy component

  9. On matter couplings in N=1 supergravities

    International Nuclear Information System (INIS)

    Galperin, A.; Ogievskiy, V.; Sokatchev, E.


    A flexible version of N=1 supergravity is proposed. It contains 28+28 fields and is an extension of the new minimal supergravity version. Matter couplings in various N=1 supergravity versions are discussed. The chiral densities are constructed for non-minimal and flexible versions. Therefore these versions admit a general R-non-invariant matter coupling as the minimal supergravity does. A modified Fayet-Iliopoulos type mechanism is conjectured which apparently can work in the non-minimal and flexible versions without R-symmetry of the superpotential unlike the minimal and new minimal ones

  10. Nonlinear coupling of kink modes in Tokamaks

    International Nuclear Information System (INIS)

    Dagazian, R.Y.


    The m = 2, n = 1 kink mode is shown to be capable of destabilizing the m = 1, n = 1 internal kink. A nonlinear Lagrangian theory is developed for the coupling of modes of different pitch, and it is applied to the interaction of these modes. The coupling to the m = 2 mode provides sufficient additional destabilization to the internal mode to permit it to account even quantitatively (where it had failed when considered by itself) for many of the features of the disruptive instability. (U.S.)

  11. Link prediction via generalized coupled tensor factorisation

    DEFF Research Database (Denmark)

    Ermiş, Beyza; Evrim, Acar Ataman; Taylan Cemgil, A.


    and higher-order tensors. We propose to use an approach based on probabilistic interpretation of tensor factorisation models, i.e., Generalised Coupled Tensor Factorisation, which can simultaneously fit a large class of tensor models to higher-order tensors/matrices with com- mon latent factors using...... different loss functions. Numerical experiments demonstrate that joint analysis of data from multiple sources via coupled factorisation improves the link prediction performance and the selection of right loss function and tensor model is crucial for accurately predicting missing links....

  12. A general analysis of Wtb anomalous couplings (United States)

    Cao, Qing-Hong; Yan, Bin; Yu, Jiang-Hao; Zhang, Chen


    We investigate new physics effects on the Wtb effective couplings in a model-independent framework. The new physics effects can be parametrized by four independent couplings, , , and . We further introduce a set of parameters x 0, x m , x p and x 5 which exhibit a linear relation to the single top production cross sections. Using recent data for the t-channel single top production cross section σ t , tW associated production cross section σ tW, s-channel single top production cross section σ s , and W-helicity fractions F 0, F L and F R collected at the 8 TeV LHC and Tevatron, we perform a global fit to impose constraints on the top quark effective couplings. Our global fitting results show that the top quark effective couplings are strongly correlated. We show that (i) improving the measurements of σ t and σ tW is important in constraining the correlation of (,) and (,); (ii) and are anti-correlated, and are sensitive to all the four experiments; (iii) and are also anti-correlated, and are sensitive to the F 0 and F L measurements; (iv) the correlation between and is sensitive to the precision of the σ t , σ tW and F 0 measurements. The effective Wtb couplings are studied in three kinds of new physics models: the G(221) = SU(2)1 ⊗ SU(2)2 ⊗ U(1) X models, the vector-like quark models and the Littlest Higgs model with and without T-parity. We show that the Wtb couplings in the left-right model and the un-unified model are sensitive to the ratio of gauge couplings when the new heavy gauge boson’s mass (M W‧) is less than several hundred GeV, but the constraint is loose if M W‧ > 1 TeV. Furthermore, the Wtb couplings in vector-like quark models and the Littlest Higgs models are sensitive to the mixing angles of new heavy particles and SM particles. Supported by National Science Foundation of China (11275009, 11675002, 11635001), National Science Foundation (PHY-1315983, PHY-1316033) and DOE (DE- SC0011095)

  13. Coupled Transmission Lines as Impedance Transformer

    DEFF Research Database (Denmark)

    Jensen, Thomas; Zhurbenko, Vitaliy; Krozer, Viktor


    A theoretical investigation of the use of a coupled line section as an impedance transformer is presented. We show how to properly select the terminations of the coupled line structures for effective matching of real and complex loads in both narrow and wide frequency ranges. The corresponding...... circuit configurations and the design procedures are proposed. Synthesis relations are derived and provided for efficient matching circuit construction. Design examples are given to demonstrate the flexibility and limitations of the design methods and to show their validity for practical applications...

  14. Optimal estimation of the optomechanical coupling strength (United States)

    Bernád, József Zsolt; Sanavio, Claudio; Xuereb, André


    We apply the formalism of quantum estimation theory to obtain information about the value of the nonlinear optomechanical coupling strength. In particular, we discuss the minimum mean-square error estimator and a quantum Cramér-Rao-type inequality for the estimation of the coupling strength. Our estimation strategy reveals some cases where quantum statistical inference is inconclusive and merely results in the reinforcement of prior expectations. We show that these situations also involve the highest expected information losses. We demonstrate that interaction times on the order of one time period of mechanical oscillations are the most suitable for our estimation scenario, and compare situations involving different photon and phonon excitations.

  15. Spin–orbit coupling in actinide cations

    DEFF Research Database (Denmark)

    Bagus, Paul S.; Ilton, Eugene S.; Martin, Richard L.


    The limiting case of Russell–Saunders coupling, which leads to a maximum spin alignment for the open shell electrons, usually explains the properties of high spin ionic crystals with transition metals. For actinide compounds, the spin–orbit splitting is large enough to cause a significantly reduced...... spin alignment. Novel concepts are used to explain the dependence of the spin alignment on the 5f shell occupation. We present evidence that the XPS of ionic actinide materials may provide direct information about the angular momentum coupling within the 5f shell....

  16. Reciprocity relation for multichannel coupling kernels

    International Nuclear Information System (INIS)

    Cotanch, S.R.; Satchler, G.R.


    Assuming time-reversal invariance of the many-body Hamiltonian, it is proven that the kernels in a general coupled-channels formulation are symmetric, to within a specified spin-dependent phase, under the interchange of channel labels and coordinates. The theorem is valid for both Hermitian and suitably chosen non-Hermitian Hamiltonians which contain complex effective interactions. While of direct practical consequence for nuclear rearrangement reactions, the reciprocity relation is also appropriate for other areas of physics which involve coupled-channels analysis

  17. Coupled modes, frequencies and fields of a dielectric resonator and a cavity using coupled mode theory (United States)

    Elnaggar, Sameh Y.; Tervo, Richard; Mattar, Saba M.


    Probes consisting of a dielectric resonator (DR) inserted in a cavity are important integral components of electron paramagnetic resonance (EPR) spectrometers because of their high signal-to-noise ratio. This article studies the behavior of this system, based on the coupling between its dielectric and cavity modes. Coupled-mode theory (CMT) is used to determine the frequencies and electromagnetic fields of this coupled system. General expressions for the frequencies and field distributions are derived for both the resulting symmetric and anti-symmetric modes. These expressions are applicable to a wide range of frequencies (from MHz to THz). The coupling of cavities and DRs of various sizes and their resonant frequencies are studied in detail. Since the DR is situated within the cavity then the coupling between them is strong. In some cases the coupling coefficient, κ, is found to be as high as 0.4 even though the frequency difference between the uncoupled modes is large. This is directly attributed to the strong overlap between the fields of the uncoupled DR and cavity modes. In most cases, this improves the signal to noise ratio of the spectrometer. When the DR and the cavity have the same frequency, the coupled electromagnetic fields are found to contain equal contributions from the fields of the two uncoupled modes. This situation is ideal for the excitation of the probe through an iris on the cavity wall. To verify and validate the results, finite element simulations are carried out. This is achieved by simulating the coupling between a cylindrical cavity's TE011 and the dielectric insert's TE01δ modes. Coupling between the modes of higher order is also investigated and discussed. Based on CMT, closed form expressions for the fields of the coupled system are proposed. These expressions are crucial in the analysis of the probe's performance.

  18. Effect of Couple Therapy Based on the Choice Theory on Social Commitment of Couples

    Directory of Open Access Journals (Sweden)

    Hossein Abbasi


    Full Text Available Background and Objective: Commitment to spouse, marriage, and family is one of the most important factors ensuring the continuity of marriage and strength of family bonds that has attracted considerable attention in the contemporary family and marriage studies. In this study, we sought to determine the effect of couple therapy based on the choice theory on the social commitment of couples. Materials and Methods: This was a quasi-experimental study with pretest-posttest design and a control group that was performed among volunteer couples visiting Isfahan Counseling and Psychology Centers in Isfahan, Iran, during 2015. The subjects consisted of 32 incompatible couples who were selected through convenience sampling and were randomly assigned into experimental (16 couples and control (16 couples groups. Then, the experimental group received nine sessions of group couple therapy during three months on family life skills based on choice theory. It is worth mentioning that the dependent variable was the social commitment of couples evaluated by the dimensions of commitment inventory of Adams and Jones (1997. The collected data were analyzed by multivariate analysis of covariance in SPSS, version 20. Results: At the post-test stage, couple therapy based on choice theory significantly enhanced social commitment in the experimental group compared to the control group (P<0.001. Conclusion: According to the findings of this study, couple therapy based on the choice theory is an effective strategy in promoting commitment and loyalty to spouse, marriage, and family and can decrease and prevent family-related problems and threats such as divorce and marital infidelity.

  19. Chaotic Motion of Nonlinearly Coupled Quintic Oscillators | Adeloye ...

    African Journals Online (AJOL)

    With a fixed energy, we investigate the motion of two nonlinearly coupled quintic oscillators for various values of the coupling strength with the aid of the Poincare surface of section. It is observed that chaotic motion sets in for coupling strength as low as 0.001. The degree of chaoticity generally increases as the coupling ...

  20. Renormalization group coupling flow of SU(3) gauge theory


    QCDTARO Collaboration


    We present our new results on the renormalization group coupling flow obtained i n 3 dimensional coupling space $(\\beta_{11},\\beta_{12},\\beta_{twist})$. The value of $\\beta_{twist}$ turns out to be small and the coupling flow projected on $(\\beta_{11},\\beta_{12})$ plane is very similar with the previous result obtained in the 2 dimensional coupling space.