Sinorhizobium meliloti can protect Medicago truncatula against Phoma medicaginis attack

Directory of Open Access Journals (Sweden)

Moncef MRABET

2011-09-01

Full Text Available The Sinorhizobium meliloti microsymbiont of Medicago spp. was used in an antibiosis test against Phoma medicaginis and in bioprotection assays of Medicago truncatula JA17 from the pathogen. Among 17 S. meliloti strains isolated from root nodules of M. truncatula and Medicago laciniata grown in Tunisian soils, six showed up to 60% growth inhibition of five P. medicaginis strains isolated from infected field-grown M. truncatula. Two S. meliloti strains with differing in vitro effects on P. medicaginis, 10.16/R6 antagonist and 5M6 non antagonist, were used in a bioprotection assay of M. truncatula JA17 from the pathogen. The inoculation of P. medicaginis caused complete root and stem rotting, and the mortality of all treated plantlets. Inoculation of the antagonist S. meliloti strain 10.16/R6 to M. truncatula JA17 infected with P. medicaginis was associated with a significant 65% decrease of vegetative rotting length, an 80% decrease of plant mortality, an increase of root length, and enhancement of root and shoot biomass comparatively to control plantlets treated with P. medicaginis. The inoculation of the non antagonistic S. meliloti strain 5M6 slightly decreased disease and slightly increased plant growth parameters.

Cellular Stoichiometry of Methyl-Accepting Chemotaxis Proteins in Sinorhizobium meliloti.

Science.gov (United States)

Zatakia, Hardik M; Arapov, Timofey D; Meier, Veronika M; Scharf, Birgit E

2018-03-15

The chemosensory system in Sinorhizobium meliloti has several important deviations from the widely studied enterobacterial paradigm. To better understand the differences between the two systems and how they are optimally tuned, we determined the cellular stoichiometry of the methyl-accepting chemotaxis proteins (MCPs) and the histidine kinase CheA in S. meliloti Quantitative immunoblotting was used to determine the total amount of MCPs and CheA per cell in S. meliloti The MCPs are present in the cell in high abundance (McpV), low abundance (IcpA, McpU, McpX, and McpW), and very low abundance (McpY and McpZ), whereas McpT was below the detection limit. The approximate cellular ratio of these three receptor groups is 300:30:1. The chemoreceptor-to-CheA ratio is 23.5:1, highly similar to that seen in Bacillus subtilis (23:1) and about 10 times higher than that in Escherichia coli (3.4:1). Different from E. coli , the high-abundance receptors in S. meliloti are lacking the carboxy-terminal NWETF pentapeptide that binds the CheR methyltransferase and CheB methylesterase. Using transcriptional lacZ fusions, we showed that chemoreceptors are positively controlled by the master regulators of motility, VisNR and Rem. In addition, FlbT, a class IIA transcriptional regulator of flagellins, also positively regulates the expression of most chemoreceptors except for McpT and McpY, identifying chemoreceptors as class III genes. Taken together, these results demonstrate that the chemosensory complex and the adaptation system in S. meliloti deviates significantly from the established enterobacterial paradigm but shares some similarities with B. subtilis IMPORTANCE The symbiotic soil bacterium Sinorhizobium meliloti is of great agricultural importance because of its nitrogen-fixing properties, which enhances growth of its plant symbiont, alfalfa. Chemotaxis provides a competitive advantage for bacteria to sense their environment and interact with their eukaryotic hosts. For a better

Cloning-free genome engineering in Sinorhizobium meliloti advances applications of Cre/loxP site-specific recombination.

Science.gov (United States)

Döhlemann, Johannes; Brennecke, Meike; Becker, Anke

2016-09-10

The soil-dwelling α-proteobacterium Sinorhizobium meliloti serves as model for studies of symbiotic nitrogen fixation, a highly important process in sustainable agriculture. Here, we report advancements of the genetic toolbox accelerating genome editing in S. meliloti. The hsdMSR operon encodes a type-I restriction-modification (R-M) system. Transformation of S. meliloti is counteracted by the restriction endonuclease HsdR degrading DNA which lacks the appropriate methylation pattern. We provide a stable S. meliloti hsdR deletion mutant showing enhanced transformation with Escherichia coli-derived plasmid DNA and demonstrate that using an E. coli plasmid donor, expressing S. meliloti methyl transferase genes, is an alternative strategy of increasing the transformation efficiency of S. meliloti. Furthermore, we devise a novel cloning-free genome editing (CFGE) method for S. meliloti, Agrobacterium tumefaciens and Xanthomonas campestris, and demonstrate the applicability of this method for intricate applications of the Cre/lox recombination system in S. meliloti. An enhanced Cre/lox system, allowing for serial deletions of large genomic regions, was established. An assay of lox spacer mutants identified a set of lox sites mediating specific recombination. The availability of several non-promiscuous Cre recognition sites enables simultaneous specific Cre/lox recombination events. CFGE combined with Cre/lox recombination is put forward as powerful approach for targeted genome editing, involving serial steps of manipulation to expedite the genetic accessibility of S. meliloti as chassis. Copyright © 2016 Elsevier B.V. All rights reserved.

Important Late-Stage Symbiotic Role of the Sinorhizobium meliloti Exopolysaccharide Succinoglycan.

Science.gov (United States)

Arnold, Markus F F; Penterman, Jon; Shabab, Mohammed; Chen, Esther J; Walker, Graham C

2018-07-01

Sinorhizobium meliloti enters into beneficial symbiotic interactions with Medicago species of legumes. Bacterial exopolysaccharides play critical signaling roles in infection thread initiation and growth during the early stages of root nodule formation. After endocytosis of S. meliloti by plant cells in the developing nodule, plant-derived nodule-specific cysteine-rich (NCR) peptides mediate terminal differentiation of the bacteria into nitrogen-fixing bacteroids. Previous transcriptional studies showed that the intensively studied cationic peptide NCR247 induces expression of the exo genes that encode the proteins required for succinoglycan biosynthesis. In addition, genetic studies have shown that some exo mutants exhibit increased sensitivity to the antimicrobial action of NCR247. Therefore, we investigated whether the symbiotically active S. meliloti exopolysaccharide succinoglycan can protect S. meliloti against the antimicrobial activity of NCR247. We discovered that high-molecular-weight forms of succinoglycan have the ability to protect S. meliloti from the antimicrobial action of the NCR247 peptide but low-molecular-weight forms of wild-type succinoglycan do not. The protective function of high-molecular-weight succinoglycan occurs via direct molecular interactions between anionic succinoglycan and the cationic NCR247 peptide, but this interaction is not chiral. Taken together, our observations suggest that S. meliloti exopolysaccharides not only may be critical during early stages of nodule invasion but also are upregulated at a late stage of symbiosis to protect bacteria against the bactericidal action of cationic NCR peptides. Our findings represent an important step forward in fully understanding the complete set of exopolysaccharide functions during legume symbiosis. IMPORTANCE Symbiotic interactions between rhizobia and legumes are economically important for global food production. The legume symbiosis also is a major part of the global nitrogen

Co-inoculation of arbusculr mycorrhizae and nitrogen fixing bacteria enhance alfalfa yield under saline conditions

International Nuclear Information System (INIS)

Zhu, R.; Tang, F.; Liu, F.; Chen, J.

2016-01-01

The study was to investigate the effects of combined inoculation of Glomus mosseae (arbusculr mycorrhizae fungi, AMF) and Sinorhizobium meliloti (nitrogen-fixing bacteria, i.e., an Rhizobium meliloti, RM) on yield, nutrient contents, nodulation and mycorrhizal colonization of different alfalfa cultivars under saline conditions. An experiment was conducted to test the efficacy of AMF and RM inoculation in development of salt tolerance in alfalfa cultivars (Zhaodong, Nongjing and Longmu) under different salinity levels (0, 60, 120 and 180 mM NaCl). We found that under non stress condition, double inoculation of alfalfa with rhizobium and AM increased the alfalfa yield, nodule weight and number, as well as shoot proline contents, the most when plants were double inoculated followed by AM and rhizobium inoculation, respectively. Whereas under salinity condition, double inoculation of alfalfa with rhizobium and AM increased alfalfa yield, mycorrhizal infection, nodule weight and number as well as increased in shoot proline content, the most followed by AM and rhizobium inoculation, respectively. The Results suggest that growth of alfalfa may be improved by combined inoculation of alfalfa with AM and rhizobium under salt and non-stress conditions. Alleviation of alfalfa growth under saline condition was perhaps due to an increase in mycorrhizal infection and nodule weight and number as well as an increased in shoot proline content by dual inoculation. (author)

Conjugal properties of the Sinorhizobium meliloti plasmid mobilome.

Science.gov (United States)

Pistorio, Mariano; Giusti, María A; Del Papa, María F; Draghi, Walter O; Lozano, Mauricio J; Tejerizo, Gonzalo Torres; Lagares, Antonio

2008-09-01

The biology and biochemistry of plasmid transfer in soil bacteria is currently under active investigation because of its central role in prokaryote adaptation and evolution. In this work, we examined the conjugal properties of the cryptic plasmids present in a collection of the N(2)-fixing legume-symbiont Sinorhizobium meliloti. The study was performed on 65 S. meliloti isolates recovered from 25 humic soils of Argentina, which were grouped into 22 plasmid-profile types [i.e. plasmid operational taxonomic units (OTUs)]. The cumulative Shannon index calculated for the observed plasmid profiles showed a clear saturation plateau, thus indicating an adequate representation of the S. meliloti plasmid-profile types in the isolates studied. The results show that isolates of nearly 14% of the plasmid OTUs hosted transmissible plasmids and that isolates of 29% of the plasmid OTUs were able to retransfer the previously characterized mobilizable-cryptic plasmid pSmeLPU88b to a third recipient strain. It is noteworthy that isolates belonging to 14% of the plasmid OTUs proved to be refractory to the entrance of the model plasmid pSmeLPU88b, suggesting either the presence of surface exclusion phenomena or the occurrence of restriction incompatibility with the incoming replicon. Incompatibility for replication between resident plasmids and plasmid pSmeLPU88b was observed in c. 20% of the OTUs. The results reported here reveal a widespread compatibility among the conjugal functions of the cryptic plasmids in S. meliloti, and this fact, together with the observed high proportion of existing donor genotypes, points to the extrachromosomal compartment of the species as being an extremely active plasmid mobilome.

PCR Analysis of "expR" Gene Regulating Biosynthesis of Exopolysaccharides in "Sinorhizobium Meliloti"

Science.gov (United States)

Sorroche, Fernando G.; Giordano, Walter

2012-01-01

Exopolysaccharide (EPS) production by the rhizobacterium "Sinorhizobium meliloti" is essential for root nodule formation on its legume host (alfalfa), and for establishment of a nitrogen-fixing symbiosis between the two partners. Production of EPS II (galactoglucan) by certain "S. meliloti" strains results in a mucoid colony…

Toxicity testing of heavy metals with the Rhizobium-legume symbiosis: high sensitivity to cadmium and arsenic compounds

Energy Technology Data Exchange (ETDEWEB)

Neumann, H.; Bode-Kirchhoff, A.; Madeheim, A.; Wetzel, A. [Marburg Univ. (Germany). Fachbereich Biologie

1998-07-01

We present data that the formation of nodules (nodulation) may serve for ecotoxicological evaluation of heavy metals in different binding states. Tests were performed in petri dishes with alfalfa (lucerne) seedlings inoculated with Rhizobium meliloti. Cultivation took place in growth cabinets with carefully standardized and documented growth conditions. Data from stressed plants was recorded after 14 days of cultivation on contaminated substrate. A dose responsive decrease in nodulation was found after application of cadmium acetate, cadmium iodide, cadmium chloride, sodium salts of arsenate and arsenite, arsenic pentoxide, and lead nitrate, whereas lead acetate showed no effect up to a concentration of 3 {mu}M. The dose response curves were used to calculate EC10, EC50 and EC90 values. EC50 values for cadmium compounds range from 1.5 to 9.5 {mu}M. Testing different arsenic compounds results in EC50 from 2.6 to 20.1 {mu}M. EC50 of lead nitrate is 2.2 {mu}M. The sensitivity, reproducibility and reliability of this test system is discussed compared to established biotests. (orig./MG)

Biofertilisasi bakteri rhizobium pada tanaman kedelai (Glycine max (L MERR.

Directory of Open Access Journals (Sweden)

Tini Surtiningsih

2012-02-01

Full Text Available The aim of this research want to know the influence of the addition Rhizobium bacteria species, dose and combination both ofthem, on growth and production of soybean plant (Glycine max (L Merr.. The experimental design of this research was factorial design4×2, 4 species of Rhizobium are R1 = Rhizobium japonicum, R2 = R. phaseoli, R3 = R. leguminosarum, R4 = mixture of R1, R2 andR3, and 2 dose of inoculan Rhizobium (D1 = 5 m/plant, and D2 = 10 ml/plant with 1010 sel bacteria/ml and 5 replications. Independentvariable is species of Rhizobium, dose of inoculan Rhizobium and combination both of them. Dependent variable is dry matter, weightof nodules and dry weight of seeds. The harvest data was analyzed by Kruskal-Wallis Test using 5% level (a = 0.05 followed by Mann-Whitney Test. The result of this research show that species of Rhizobium, dose of inoculan Rhizobium and combination both of thempresent insignificant result (a > 0.05 on soybean growth and production, but the mixture of Rhizobium species with high level doseof bacteria, present better result than single species with low dose of bacteria.

Engineering a vitamin B12 high-throughput screening system by riboswitch sensor in Sinorhizobium meliloti.

Science.gov (United States)

Cai, Yingying; Xia, Miaomiao; Dong, Huina; Qian, Yuan; Zhang, Tongcun; Zhu, Beiwei; Wu, Jinchuan; Zhang, Dawei

2018-05-11

As a very important coenzyme in the cell metabolism, Vitamin B 12 (cobalamin, VB 12 ) has been widely used in food and medicine fields. The complete biosynthesis of VB 12 requires approximately 30 genes, but overexpression of these genes did not result in expected increase of VB 12 production. High-yield VB 12 -producing strains are usually obtained by mutagenesis treatments, thus developing an efficient screening approach is urgently needed. By the help of engineered strains with varied capacities of VB 12 production, a riboswitch library was constructed and screened, and the btuB element from Salmonella typhimurium was identified as the best regulatory device. A flow cytometry high-throughput screening system was developed based on the btuB riboswitch with high efficiency to identify positive mutants. Mutation of Sinorhizobium meliloti (S. meliloti) was optimized using the novel mutation technique of atmospheric and room temperature plasma (ARTP). Finally, the mutant S. meliloti MC5-2 was obtained and considered as a candidate for industrial applications. After 7 d's cultivation on a rotary shaker at 30 °C, the VB 12 titer of S. meliloti MC5-2 reached 156 ± 4.2 mg/L, which was 21.9% higher than that of the wild type strain S. meliloti 320 (128 ± 3.2 mg/L). The genome of S. meliloti MC5-2 was sequenced, and gene mutations were identified and analyzed. To our knowledge, it is the first time that a riboswitch element was used in S. meliloti. The flow cytometry high-throughput screening system was successfully developed and a high-yield VB 12 producing strain was obtained. The identified and analyzed gene mutations gave useful information for developing high-yield strains by metabolic engineering. Overall, this work provides a useful high-throughput screening method for developing high VB 12 -yield strains.

The application of isotopic (32P and 15N) dilution techniques to evaluate the interactive effect of phosphate-solubilizing rhizobacteria, mycorrhizal fungi and Rhizobium to improve the agronomic efficiency of rock phosphate for legume crops

International Nuclear Information System (INIS)

Barea, J.M.; Toro, M.; Azcon, R.; Orozco, M.O.; Campos, E.; Azcon, R.

2002-01-01

A pot experiment was designed to evaluate the interactive effects of multifunctional microbial inoculation treatments and rock phosphate (RP) application on N and P uptake by alfalfa through the use of 15 N and 32 P isotopic dilution approaches. The microbial inocula consisted of a wild type (WT) Rhizobium meliloti strain, the arbuscular mycorrhizal (AM) fungus Glomus mosseae (Nicol. and Gerd.) Gerd. and Trappe, and a phosphate solubilizing rhizobacterium (Enterobacter sp.). Inoculated microorganisms were established in the root tissues and/or in the rhizosphere soil of alfalfa plants (Medicago sativa L.). Improvements in N and P accumulation in alfalfa corroborate beneficial effects of Rhizobium and AM interactions. Inoculation with selected rhizobacteria improved the AM effect on N or P accumulation in both the RP-added soil and in the non RP-amended controls. Measurements of the 15 N/ 14 N ratio in plant shoots indicate an enhancement of the N 2 fixation rates in Rhizobium-inoculated AM-plants, over that achieved by Rhizobium in non-mycorrhizal plants. Whether or not RP was added, AM-inoculated plants showed a lower specific activity ( 32 P/ 31 P) than did their comparable non-mycorrhizal controls, suggesting that the plant was using otherwise unavailable P sources. The phosphate-solubilizing, AM-associated, microbiota could in fact release phosphate ions, either from the added RP or from the indigenous 'less-available' soil phosphate. A low Ca concentrations in the test soil may have benefited P solubilization. Under field conditions, the inoculation with AM fungi significantly increased plant biomass and N and P accumulation in plant tissues. Phosphate-solubilizing rhizobacteria improved mycorrhizal responses in soil dually receiving RP and organic matter amendments. Organic matter addition favoured RP solubilization. This, together with a tailored microbial inoculation, increased the agronomic efficiency of RP in the test soil that was Ca deficient at neutral

A model for the catabolism of rhizopine in Rhizobium leguminosarum involves a ferredoxin oxygenase complex and the inositol degradative pathway.

Science.gov (United States)

Bahar, M; de Majnik, J; Wexler, M; Fry, J; Poole, P S; Murphy, P J

1998-11-01

Rhizopines are nodule-specific compounds that confer an intraspecies competitive nodulation advantage to strains that can catabolize them. The rhizopine (3-O-methyl-scyllo-inosamine, 3-O-MSI) catabolic moc gene cluster mocCABRDE(F) in Rhizobium leguminosarum bv. viciae strain 1a is located on the Sym plasmid. MocCABR are homologous to the mocCABR gene products from Sinorhizobium meliloti. MocD and MocE contain motifs corresponding to a TOL-like oxygenase and a [2Fe-2S] Rieske-like ferredoxin, respectively. The mocF gene encodes a ferredoxin reductase that would complete the oxygenase system, but is not essential for rhizopine catabolism. We propose a rhizopine catabolic model whereby MocB transports rhizopine into the cell and MocDE and MocF (or a similar protein elsewhere in the genome), under the regulation of MocR, act in concert to form a ferredoxin oxygenase system that demethylates 3-O-MSI to form scyllo-inosamine (SI). MocA, an NAD(H)-dependent dehydrogenase, and MocC continue the catabolic process. Compounds formed then enter the inositol catabolic pathway.

Resistance to organic hydroperoxides requires ohr and ohrR genes in Sinorhizobium meliloti

Directory of Open Access Journals (Sweden)

Dufour Virginie

2011-05-01

Full Text Available Abstract Background Sinorhizobium meliloti is a symbiotic nitrogen-fixing bacterium that elicits nodules on roots of host plants Medicago sativa. During nodule formation bacteria have to withstand oxygen radicals produced by the plant. Resistance to H2O2 and superoxides has been extensively studied in S. meliloti. In contrast resistance to organic peroxides has not been investigated while S. meliloti genome encodes putative organic peroxidases. Organic peroxides are produced by plants and are highly toxic. The resistance to these oxygen radicals has been studied in various bacteria but never in plant nodulating bacteria. Results In this study we report the characterisation of organic hydroperoxide resistance gene ohr and its regulator ohrR in S. meliloti. The inactivation of ohr affects resistance to cumene and ter-butyl hydroperoxides but not to hydrogen peroxide or menadione in vitro. The expression of ohr and ohrR genes is specifically induced by organic peroxides. OhrR binds to the intergenic region between the divergent genes ohr and ohrR. Two binding sites were characterised. Binding to the operator is prevented by OhrR oxidation that promotes OhrR dimerisation. The inactivation of ohr did not affect symbiosis and nitrogen fixation, suggesting that redundant enzymatic activity exists in this strain. Both ohr and ohrR are expressed in nodules suggesting that they play a role during nitrogen fixation. Conclusions This report demonstrates the significant role Ohr and OhrR proteins play in bacterial stress resistance against organic peroxides in S. meliloti. The ohr and ohrR genes are expressed in nodule-inhabiting bacteroids suggesting a role during nodulation.

Respon Akasia mangium dan Paraserianthes palcataria (Leguminocae terhadap inokulasi Rhizobium dalam hubungannya dengan kepadatan populasi Rhizobium tanah

Directory of Open Access Journals (Sweden)

Suliasih Suliasih

1997-12-01

Full Text Available The research aimed to discover the response of the fast growing tree legume to Rhizobium inoculation in relation to the population density of soil Rhizobium (indigenous rhizobia. The density of soil Rhizobium bacteria was predicted based on a plant infection test by using the most probable number (MPN of soil bacteria. The experimental design used in this work was Completely Randomized Design with factorial provided and 4 replicates. The first factor of treatment were inoculation and uninoculation, and the second factor was soil taken from 5 locations in Cigaru and Jampang-Sukabumi villages. The response of the plant was marked by the increase of dry weigh of leaf, root, and number of root nodules. The result of this study showed that the plants planted in the soil media with 40 bacteria / gram soil.

Three way interactions between Thymus vulgaris, Medicago truncatula and Sinorhizobium meliloti

DEFF Research Database (Denmark)

Grøndahl, Eva; Ehlers, Bodil Kirstine

2012-01-01

Thymus vulgaris is a dominating component of the Mediterranean garrigue vegetation. It produces aromatic oil, containing monoterpenes, which affects the performance (growth, survival) of other plants, and microorganisms. Annual plant species of the genus Medicago are commonly found in Mediterranean...... shows patterns of adaptation to its thyme neighbor, and 2) if any adaptive response was dependent on the rhizobium, and whether the rhizobium was either "experienced" or "naive" with respect to thyme monoterpenes. Using a G*G*E design, the fitness of 13 genotypes of Medicago truncatula was tested....... Of these genotypes, 7 were ”experienced”, and 6 were ”naive” to thyme. All genotypes were grown on soil either amended with thyme monoterpene or not. In addition, each plant received a rhizobium treatment, which was either: no rhizobium, a mix of thyme experienced Sinorhizobium genotypes, or a mix of thyme naive...

Genetic and phenotypic diversity of Rhizobium isolates from Southern Ecuador

Directory of Open Access Journals (Sweden)

Roldán Torres-Gutiérrez

Full Text Available ABSTRACT Rhizobium-legume symbioses play relevant roles in agriculture but have not been well studied in Ecuador. The aim of this study was to characterize the genetic and phenotypic diversity of Rhizobium isolates associated with Phaseolus vulgaris from southern Ecuador. Morpho-cultural characterization, biochemical tests and physiological analyses were conducted to authenticate and determine the diversity of bacteria Rhizobium-like isolates. The genetic diversity of the isolates was determined by molecular techniques, which consisted of bacteria DNA extraction and amplification and sequencing of the 16S rRNA gene. The nodulation parameters and nitrogen fixation for P. vulgaris under greenhouse conditions were also assessed to determine the phenotypic diversity among isolates. Furthermore, bacteria indole-acetic-acid production was evaluated by the colorimetric method. Morpho-cultural and biochemical characteristic assessments demonstrated that Rhizobium-like bacteria was associated with the P. vulgaris nodules. The diversity among the isolates, as determined by physiological analyses, revealed the potential of several isolates to grow at different pH values, salinity conditions and temperatures. Partial sequencing of the 16S rRNA gene identified the Rhizobium genus in every sampling site. From a total of 20 aligned sequences, nine species of Rhizobium were identified. Nodule formation and biomass, as well as nitrogen fixation, showed an increase in plant phenotypic parameters, which could be influenced by IAA production, especially for the strains R. mesoamericanum NAM1 and R. leguminosarum bv. viciae COL6. These results demonstrated the efficiency of native symbiotic diazotrophic strains inoculants for legume production. This work can serve as the basis for additional studies of native Rhizobium strains and to help spread the use of biofertilizers in Ecuadorian fields.

Alkalinity of Lanzarote soils is a factor shaping rhizobial populations with Sinorhizobium meliloti being the predominant microsymbiont of Lotus lancerottensis.

Science.gov (United States)

León-Barrios, Milagros; Pérez-Yépez, Juan; Dorta, Paola; Garrido, Ana; Jiménez, Concepción

2017-04-01

Lotus lancerottensis is an endemic species that grows widely throughout Lanzarote Island (Canary Is.). Characterization of 48 strains isolated from root nodules of plants growing in soils from eleven locations on the island showed that 38 isolates (79.1%) belonged to the species Sinorhizobium meliloti, whereas only six belonged to Mesorhizobium sp., the more common microsymbionts for the Lotus. Other genotypes containing only one isolate were classified as Pararhizobium sp., Sinorhizobium sp., Phyllobacterium sp. and Bradyrhizobium-like. Strains of S. meliloti were distributed along the island and, in most of the localities they were exclusive or major microsymbionts of L. lancerottensis. Phylogeny of the nodulation nodC gene placed the S. meliloti strains within symbiovar lancerottense and the mesorhizobial strains with the symbiovar loti. Although strains from both symbiovars produced effective N 2 -fixing nodules, S. meliloti symbiovar lancerottense was clearly the predominant microsymbiont of L. lancerottensis. This fact correlated with the better adaptation of strains of this species to the alkaline soils of Lanzarote, as in vitro characterization showed that while the mesorhizobial strains were inhibited by alkaline pH, S. meliloti strains grew well at pH 9. Copyright © 2017 Elsevier GmbH. All rights reserved.

The application of isotopic ({sup 32}P and {sup 15}N) dilution techniques to evaluate the interactive effect of phosphate-solubilizing rhizobacteria, mycorrhizal fungi and Rhizobium to improve the agronomic efficiency of rock phosphate for legume crops

Energy Technology Data Exchange (ETDEWEB)

Barea, J.M. [Departamento de Microbiologia del Suelo y Sistemas Simbioticos (Spain)]. E-mail: jmbarea@eez.csic.es; Toro, M.; Azcon, R. [Departamento de Microbiologia del Suelo y Sistemas Simbioticos (Spain); Orozco, M.O. [Instituto de Sistematica y Ecologia, Academia Cubana de Ciencias, Habana (Cuba); Campos, E. [Departamento de Ciencias de la Tierra y Quimica Ambiental Estacion Experimental del Zaidin (CSIC), Granada (Spain); Azcon, R. [Departamento de Microbiologia del Suelo y Sistemas Simbioticos (Spain)

2002-05-15

A pot experiment was designed to evaluate the interactive effects of multifunctional microbial inoculation treatments and rock phosphate (RP) application on N and P uptake by alfalfa through the use of {sup 15}N and {sup 32}P isotopic dilution approaches. The microbial inocula consisted of a wild type (WT) Rhizobium meliloti strain, the arbuscular mycorrhizal (AM) fungus Glomus mosseae (Nicol. and Gerd.) Gerd. and Trappe, and a phosphate solubilizing rhizobacterium (Enterobacter sp.). Inoculated microorganisms were established in the root tissues and/or in the rhizosphere soil of alfalfa plants (Medicago sativa L.). Improvements in N and P accumulation in alfalfa corroborate beneficial effects of Rhizobium and AM interactions. Inoculation with selected rhizobacteria improved the AM effect on N or P accumulation in both the RP-added soil and in the non RP-amended controls. Measurements of the {sup 15}N/{sup 14}N ratio in plant shoots indicate an enhancement of the N{sub 2} fixation rates in Rhizobium-inoculated AM-plants, over that achieved by Rhizobium in non-mycorrhizal plants. Whether or not RP was added, AM-inoculated plants showed a lower specific activity ({sup 32}P/{sup 31}P) than did their comparable non-mycorrhizal controls, suggesting that the plant was using otherwise unavailable P sources. The phosphate-solubilizing, AM-associated, microbiota could in fact release phosphate ions, either from the added RP or from the indigenous 'less-available' soil phosphate. A low Ca concentrations in the test soil may have benefited P solubilization. Under field conditions, the inoculation with AM fungi significantly increased plant biomass and N and P accumulation in plant tissues. Phosphate-solubilizing rhizobacteria improved mycorrhizal responses in soil dually receiving RP and organic matter amendments. Organic matter addition favoured RP solubilization. This, together with a tailored microbial inoculation, increased the agronomic efficiency of RP in the

Genome-Wide Sensitivity Analysis of the Microsymbiont Sinorhizobium meliloti to Symbiotically Important, Defensin-Like Host Peptides

Directory of Open Access Journals (Sweden)

Markus F. F. Arnold

2017-08-01

Full Text Available The model legume species Medicago truncatula expresses more than 700 nodule-specific cysteine-rich (NCR signaling peptides that mediate the differentiation of Sinorhizobium meliloti bacteria into nitrogen-fixing bacteroids. NCR peptides are essential for a successful symbiosis in legume plants of the inverted-repeat-lacking clade (IRLC and show similarity to mammalian defensins. In addition to signaling functions, many NCR peptides exhibit antimicrobial activity in vitro and in vivo. Bacterial resistance to these antimicrobial activities is likely to be important for symbiosis. However, the mechanisms used by S. meliloti to resist antimicrobial activity of plant peptides are poorly understood. To address this, we applied a global genetic approach using transposon mutagenesis followed by high-throughput sequencing (Tn-seq to identify S. meliloti genes and pathways that increase or decrease bacterial competitiveness during exposure to the well-studied cationic NCR247 peptide and also to the unrelated model antimicrobial peptide polymyxin B. We identified 78 genes and several diverse pathways whose interruption alters S. meliloti resistance to NCR247. These genes encode the following: (i cell envelope polysaccharide biosynthesis and modification proteins, (ii inner and outer membrane proteins, (iii peptidoglycan (PG effector proteins, and (iv non-membrane-associated factors such as transcriptional regulators and ribosome-associated factors. We describe a previously uncharacterized yet highly conserved peptidase, which protects S. meliloti from NCR247 and increases competitiveness during symbiosis. Additionally, we highlight a considerable number of uncharacterized genes that provide the basis for future studies to investigate the molecular basis of symbiotic development as well as chronic pathogenic interactions.

Single acquisition of protelomerase gave rise to speciation of a large and diverse clade within the Agrobacterium/Rhizobium supercluster characterized by the presence of a linear chromid.

Science.gov (United States)

Ramírez-Bahena, Martha H; Vial, Ludovic; Lassalle, Florent; Diel, Benjamin; Chapulliot, David; Daubin, Vincent; Nesme, Xavier; Muller, Daniel

2014-04-01

Linear chromosomes are atypical in bacteria and likely a secondary trait derived from ancestral circular molecules. Within the Rhizobiaceae family, whose genome contains at least two chromosomes, a particularity of Agrobacterium fabrum (formerly A. tumefaciens) secondary chromosome (chromid) is to be linear and hairpin-ended thanks to the TelA protelomerase. Linear topology and telA distributions within this bacterial family was screened by pulse field gel electrophoresis and PCR. In A. rubi, A. larrymoorei, Rhizobium skierniewicense, A. viscosum, Agrobacterium sp. NCPPB 1650, and every genomospecies of the biovar 1/A. tumefaciens species complex (including R. pusense, A. radiobacter, A. fabrum, R. nepotum plus seven other unnamed genomospecies), linear chromid topologies were retrieved concomitantly with telA presence, whereas the remote species A. vitis, Allorhizobium undicola, Rhizobium rhizogenes and Ensifer meliloti harbored a circular chromid as well as no telA gene. Moreover, the telA phylogeny is congruent with that of recA used as a marker gene of the Agrobacterium phylogeny. Collectively, these findings strongly suggest that single acquisition of telA by an ancestor was the founding event of a large and diverse clade characterized by the presence of a linear chromid. This clade, characterized by unusual genome architecture, appears to be a relevant candidate to serve as a basis for a possible redefinition of the controversial Agrobacterium genus. In this respect, investigating telA in sequenced genomes allows to both ascertain the place of concerned strains into Agrobacterium spp. and their actual assignation to species/genomospecies in this genus. Copyright © 2014 Elsevier Inc. All rights reserved.

Analysis of synonymous codon usage patterns in the genus Rhizobium.

Science.gov (United States)

Wang, Xinxin; Wu, Liang; Zhou, Ping; Zhu, Shengfeng; An, Wei; Chen, Yu; Zhao, Lin

2013-11-01

The codon usage patterns of rhizobia have received increasing attention. However, little information is available regarding the conserved features of the codon usage patterns in a typical rhizobial genus. The codon usage patterns of six completely sequenced strains belonging to the genus Rhizobium were analysed as model rhizobia in the present study. The relative neutrality plot showed that selection pressure played a role in codon usage in the genus Rhizobium. Spearman's rank correlation analysis combined with correspondence analysis (COA) showed that the codon adaptation index and the effective number of codons (ENC) had strong correlation with the first axis of the COA, which indicated the important role of gene expression level and the ENC in the codon usage patterns in this genus. The relative synonymous codon usage of Cys codons had the strongest correlation with the second axis of the COA. Accordingly, the usage of Cys codons was another important factor that shaped the codon usage patterns in Rhizobium genomes and was a conserved feature of the genus. Moreover, the comparison of codon usage between highly and lowly expressed genes showed that 20 unique preferred codons were shared among Rhizobium genomes, revealing another conserved feature of the genus. This is the first report of the codon usage patterns in the genus Rhizobium.

The Plasmid Mobilome of the Model Plant-Symbiont Sinorhizobium meliloti: Coming up with New Questions and Answers.

Science.gov (United States)

Lagares, Antonio; Sanjuán, Juan; Pistorio, Mariano

2014-10-01

Rhizobia are Gram-negative Alpha- and Betaproteobacteria living in the underground which have the ability to associate with legumes for the establishment of nitrogen-fixing symbioses. Sinorhizobium meliloti in particular-the symbiont of Medicago, Melilotus, and Trigonella spp.-has for the past decades served as a model organism for investigating, at the molecular level, the biology, biochemistry, and genetics of a free-living and symbiotic soil bacterium of agricultural relevance. To date, the genomes of seven different S. meliloti strains have been fully sequenced and annotated, and several other draft genomic sequences are also available. The vast amount of plasmid DNA that S. meliloti frequently bears (up to 45% of its total genome), the conjugative ability of some of those plasmids, and the extent of the plasmid diversity has provided researchers with an extraordinary system to investigate functional and structural plasmid molecular biology within the evolutionary context surrounding a plant-associated model bacterium. Current evidence indicates that the plasmid mobilome in S. meliloti is composed of replicons varying greatly in size and having diverse conjugative systems and properties along with different evolutionary stabilities and biological roles. While plasmids carrying symbiotic functions (pSyms) are known to have high structural stability (approaching that of chromosomes), the remaining plasmid mobilome (referred to as the non-pSym, functionally cryptic, or accessory compartment) has been shown to possess remarkable diversity and to be highly active in conjugation. In light of the modern genomic and current biochemical data on the plasmids of S. meliloti, the current article revises their main structural components, their transfer and regulatory mechanisms, and their potential as vehicles in shaping the evolution of the rhizobial genome.

Maize growth in response to Azospirillum brasilense, Rhizobium tropici, molybdenum and nitrogen

Directory of Open Access Journals (Sweden)

Angelita A. C. Picazevicz

Full Text Available ABSTRACT The objective of this research was to evaluate the effect of Azospirillum brasilense, Rhizobium tropici, nitrogen (N and molybdenum (Mo fertilization on maize growth. The experiment was carried out in a greenhouse from October to November 2015, in a completely randomized design, in 2 x 2 x 2 x 5 factorial scheme, with 5 replicates, corresponding to the absence and presence of Azospirillum brasilense, Rhizobium tropici, N (30 kg ha-1 and five Mo doses (0, 7.5, 15.0, 22.5 and 30.0 g ha-1. The analyzed variables were: plant height, basal stem diameter, dry biomass of shoots, roots, total and N accumulated in the shoots. There was double or triple interaction between N fertilization, Azospirillum brasilense and Rhizobium tropici for the evaluated variables. However, isolated and/or combined effect of Mo was not observed. Seed inoculation with Azospirillum brasilense as well as their co-inoculation with Rhizobium tropici in the absence of N fertilization was efficient to increase plant growth. Soil N fertilization at sowing was less efficient in promoting plant growth than when it was combined with seed inoculation with Rhizobium tropici.

LysM-Type Mycorrhizal Receptor Recruited for Rhizobium Symbiosis in Nonlegume Parasponia

NARCIS (Netherlands)

Camp, Op den R.H.M.; Streng, A.J.; Mita, De S.; Cao, Q.; Polone, E.; Liu, W.; Ammiraju, J.S.S.; Kudrna, D.; Wing, R.; Untergasser, A.; Bisseling, T.; Geurts, R.

2011-01-01

Rhizobium root nodule symbiosis is generally considered to be unique for legumes. However, there is one exception and that is Parasponia. In this nonlegume, the rhizobial nodule symbiosis evolved independently and is, like in legumes, induced by rhizobium Nod factors. We used Parasponia to identify

Entrapment of Rhizobium sp. by fluidized bed technique using polymers as coating materials

Directory of Open Access Journals (Sweden)

Diego Rivera

2016-04-01

Full Text Available The spray-drying technique was applied for the development of three solid formulations of Rhizobium. Sodium alginate and hydroxypropyl methylcellulose (HPMC with concentrations of 0.5 % were used as polymers. Results showed that none of the solid formulations had negative effects in vitro on the growth-promoting capacities of Rhizobium sp. G58 (p < 0.05. PCA´s first three components explained 84.5 % of the total variance. This analysis concluded that the solid formulation had not negative effects on the biological nitrogen fixation activity in vitro or on the process of nodulation in greenhouse experiments. Symbiosis between Rhizobium and the plant was effective, which suggested that, under controlled conditions, the coating process with the polymers had allowed a controlled release of the bacteria and a proper transfer of Rhizobium sp. from the microparticles to the root of the plant.

Mutations in sit B and sit D genes affect manganese-growth requirements in Sinorhizobium meliloti.

Science.gov (United States)

Platero, Raúl A; Jaureguy, Melina; Battistoni, Federico J; Fabiano, Elena R

2003-01-21

Two transposon-induced mutants of Sinorhizobium meliloti 242 were isolated based on their inability to grow on rich medium supplemented with the metal chelator ethylenediamine di-o-hydroxyphenylacetic acid (EDDHA) and either heme-compounds or siderophores as iron sources. Tagged loci of these mutants were identified as sit B and sit D genes. These genes encode components of an ABC (ATP-binding cassette) metal-type permease in several Gram-negative bacteria. In this work, the phenotypes of these two mutants were compared with those of two siderophore-mediated iron transport mutants. The results strongly implicate a role of the sit genes in manganese acquisition when this metal is limiting in S. meliloti.

Preliminary data on some correlations of Rhizobium and radio-stimulation seed treatments

International Nuclear Information System (INIS)

Soos, T.; Toth, J.; Manninger, E.

1979-01-01

The seeds of peas, beans, soy-beans and lucerne were treated with 60 Co-irradiation (4-10 Gray). The size of the roots and the quantity of seed-crop were measured. Irradiation by itself had no significant effect. Treatment with Rhizobium bacteria and with Rhizobium plus irradiation had considerable positive effects. (L.E.)

Identification and characterization of symbiotic genes on the Rhizobium leguminosarum pre sym-plasmid

NARCIS (Netherlands)

Schetgens, T.M.P.

1986-01-01

Bacteria of the genera Rhizobium and Bradyrhizobium are unique in their quality to form nitrogen-fixing root nodules in symbiosis with leguminous plants. In fast-growing Rhizobium bacteria the genes involved in host recognition and nodule

Extracellular polymeric substances from copper-tolerance Sinorhizobium meliloti immobilize Cu{sup 2+}

Energy Technology Data Exchange (ETDEWEB)

Hou, Wenjie; Ma, Zhanqiang; Sun, Liangliang; Han, Mengsha; Lu, Jianjun; Li, Zhenxiu; Mohamad, Osama Abdalla; Wei, Gehong, E-mail: weigehong@nwsuaf.edu.cn

2013-10-15

Highlights: • EPS produced by Sinorhizobium meliloti CCNWSX0020 restricts uptake of Cu{sup 2+}. • We focused on the EPS, which is divided into three main parts. • LB-EPS played a more important role than S-EPS and TB-EPS in Cu{sup 2+} immobilization. • Proteins and carbohydrates were the main extracellular compounds which had functional groups such as carboxyl (-COOH), hydroxyl (-OH), and amide (N-H), primarily involved in metal ion binding. -- Abstract: The copper tolerance gene of wild-type heavy metal-tolerance Sinorhizobium meliloti CCNWSX0020 was mutated by transposon Tn5-a. The mutant was sensitive up to 1.4 mM Cu{sup 2+}. Production, components, surface morphology, and functional groups of extracellular polymeric substances (EPS) of the wild-type strains were compared with sensitive mutant in immobilization of Cu{sup 2+}. EPS produced by S. meliloti CCNWSX0020 restricts uptake of Cu{sup 2+}. The cell wall EPS were categorized based on the compactness and fastness: soluble EPS (S-EPS), loosely bound EPS (LB-EPS), and tightly bound EPS (TB-EPS). LB-EPS played a more important role than S-EPS and TB-EPS in Cu{sup 2+} immobilization. Scanning electron microscopy (SEM) analysis LB-EPS had rough surface and many honeycomb pores, making them conducive to copper entry; therefore, they may play a role as a microbial protective barrier. Fourier transform-infrared (FT-IR) analysis further confirm that proteins and carbohydrates were the main extracellular compounds which had functional groups such as carboxyl (-COOH), hydroxyl (-OH), and amide (N-H), primarily involved in metal ion binding.

Effects of nano-ZnO on the agronomically relevant Rhizobium-legume symbiosis

Science.gov (United States)

The impact of nano-ZnO (nZnO) on Rhizobium-legume symbiosis was studied with garden pea and its compatible bacterial partner Rhizobium leguminosarum bv. viciae 3841. Exposure of peas to nZnO had no impact on germination, but significantly affected root length. Chronic exposure of plant to nZnO impac...

Rhizobium metallidurans sp. nov., a symbiotic heavy metal resistant bacterium isolated from the Anthyllis vulneraria Zn-hyperaccumulator.

Science.gov (United States)

Grison, Claire M; Jackson, Stephen; Merlot, Sylvain; Dobson, Alan; Grison, Claude

2015-05-01

A Gram-stain-negative, aerobic, rod-shaped, non-spore-forming bacterium (ChimEc512(T)) was isolated from 56 host seedlings of the hyperaccumulating Anthyllis vulneraria legume, which was on an old zinc mining site at Les Avinières, Saint-Laurent-Le-Minier, Gard, South of France. On the basis of 16S rRNA gene sequence similarities, strain ChimEc512(T) was shown to belong to the genus Rhizobium and to be most closely related to Rhizobium endophyticum CCGE 2052(T) (98.4%), Rhizobium tibeticum CCBAU 85039(T) (98.1%), Rhizobium grahamii CCGE 502(T) (98.0%) and Rhizobium mesoamericanum CCGE 501(T) (98.0%). The phylogenetic relationships of ChimEc512(T) were confirmed by sequencing and analyses of recA and atpD genes. DNA-DNA relatedness values of strain ChimEc512(T) with R. endophyticum CCGE 2052(T), R. tibeticum CCBAU 85039(T), R. mesoamericanum CCGE 52(T), Rhizobium grahamii CCGE 502(T), Rhizobium etli CCBAU 85039(T) and Rhizobium radiobacter KL09-16-8-2(T) were 27, 22, 16, 18, 19 and 11%, respectively. The DNA G+C content of strain ChimEc512(T) was 58.9 mol%. The major cellular fatty acid was C18 : 1ω7c, characteristic of the genus Rhizobium . The polar lipid profile included phosphatidylethanolamine, phosphatidylmonomethylethanolamine, phosphatidylglycerol and phosphatidylcholine and moderate amounts of aminolipids, phospholipid and sulfoquinovosyl diacylglycerol. Although ChimEc512(T) was able to nodulate A. vulneraria, the nodC and nifH genes were not detected by PCR. The rhizobial strain was tolerant to high concentrations of heavy metals: up to 35 mM Zn and up to 0.5 mM Cd and its growth kinetics was not impacted by Zn. The results of DNA-DNA hybridizations and physiological tests allowed genotypic and phenotypic differentiation of strain ChimEc512(T) from species of the genus Rhizobium with validly published names. Strain ChimEc512(T), therefore, represents a novel species, for which the name Rhizobium metallidurans sp. nov. is proposed, with the type strain

Coevolutionary genetic variation in the legume-rhizobium transcriptome.

Science.gov (United States)

Heath, Katy D; Burke, Patricia V; Stinchcombe, John R

2012-10-01

Coevolutionary change requires reciprocal selection between interacting species, where the partner genotypes that are favoured in one species depend on the genetic composition of the interacting species. Coevolutionary genetic variation is manifested as genotype × genotype (G × G) interactions for fitness in interspecific interactions. Although quantitative genetic approaches have revealed abundant evidence for G × G interactions in symbioses, the molecular basis of this variation remains unclear. Here we study the molecular basis of G × G interactions in a model legume-rhizobium mutualism using gene expression microarrays. We find that, like quantitative traits such as fitness, variation in the symbiotic transcriptome may be partitioned into additive and interactive genetic components. Our results suggest that plant genetic variation had the largest influence on nodule gene expression and that plant genotype and the plant genotype × rhizobium genotype interaction determine global shifts in rhizobium gene expression that in turn feedback to influence plant fitness benefits. Moreover, the transcriptomic variation we uncover implicates regulatory changes in both species as drivers of symbiotic gene expression variation. Our study is the first to partition genetic variation in a symbiotic transcriptome and illuminates potential molecular routes of coevolutionary change. © 2012 Blackwell Publishing Ltd.

Biodegradable plastics from Sinorhizobium meliloti as plastics compatible with the environment and human health

Directory of Open Access Journals (Sweden)

Mehrdad Hashemi Beidokhti

2016-03-01

Full Text Available Introduction: Polyhydroxyalkanoates (PHAs are natural polyesters and biodegradable plastics that are stored as intracellular inclusion bodies by a great variety of bacteria. The aim of this study was to extract polyhydroxyalkanoate from native Sinorhizobium meliloti in Iran. Materials and methods: Sinorhizobium meliloti isolates were collected from roots of alfalfa plants and were identified by Gram staining, biochemical experiments and amplification of 1500 bp fragment of 16Sr DNA gene. PHA granules were detected by microscopic examination. PHA production was evaluated in nutrient deficient medium and its amount was determined by conversion of PHA into crotonic acid by sulphuric acid treatment. The effect of various temperatures, agitation rate and carbon source (sucrose, mannitol, and maltose were evaluated on dry cell weight and polyhydroxybutyrate (PHB production. Results: The maximum amount of polymer production (43.10% was seen in basal mineral medium at 29°C, pH~7 and 215 revolutions per minute (rpm. The results of this research showed that the S5 isolate was capable to produce maximum poly3- hydroxybutyrate. The produced polymer was analyzed for its purity by GC- mass (gas chromatography- mass spectroscopy and confirmed to be PHB compared with the standard polymer. Discussion and conclusion: Native strains of Sinorhizobium can be used in the production of biodegradable plastics and the results of present study showed that S. meliloti S5 was capable to produce maximum PHB at 29°C, agitation rate of 215 rpm, and pH~7. 

Symbiotic Nitrogen Fixation in Alfalfa (Medicago Sativa L.) by Sinorhizobium Meliloti at Al-Qassim Regions, Saudi Arabia

International Nuclear Information System (INIS)

Al-Barakah, F. N.; Mridha, M. A. U.

2016-01-01

The nodulation status in alfalfa (Medicago sativa L.) plants by Sinorhizobium meliloti under Saudi field condition was assessed in some selected farms in four seasons for two years. In the present study, we also monitored the introduced S. meliloti strains activity under Saudi soil conditions. The samples were collected at regular seasonal intervals from the selected farms. The total number of nodules, morphology of the nodules and the effectiveness of N/sub 2/-fixation was assessed. In general, it was revealed that soils in the selected areas in Saudi Arabia have sufficient bacteria of the proper types to nodulate the alfalfa plants. These nodules are high in number, small in size and white in color. The nodules obtained from most of the selected farms are ineffective for nitrogen fixation. Inoculation of alfalfa seeds with imported S. meliloti strains failed to fix the atmospheric nitrogen sufficiently and also the growth improvement of alfalfa plants. There was a wide variation in the occurrence of number of nodules among the four seasons in two years. It was also observed that summer season severely affected the nodulation making it nearly zero. This low number of nodules exerts a very slow recovery of nodule formation in the next year. The introduced strains were always over competing with the native strains but they did not survive because of hot and dry summer. Nitrogenase activity of the nodules collected from both the inoculated and non-inoculated farms were always very low in all the collected samples, which indicates that the ability of fixing nitrogen by S. meliloti strains in alfalfa under Saudi soils conditions is very low. (author)

First case report of sepsis caused by Rhizobium pusense in Japan.

Science.gov (United States)

Kuchibiro, Tomokazu; Hirayama, Katsuhisa; Houdai, Katsuyuki; Nakamura, Tatsuya; Ohnuma, Kenichirou; Tomida, Junko; Kawamura, Yoshiaki

2018-01-01

Species of the genus Rhizobium are opportunistic, usually saprophytic, glucose-non-fermenting, Gram-negative bacilli found in agricultural soil. Rhizobium pusense infections are the least common Rhizobium infections and have low incidence. Herein, we report the first case of sepsis with R. pusense in Japan in a 67-year-old Japanese woman with a history of hyperlipidaemia, hypertension, diabetes, hypothyroidism and osteoporosis. She had undergone cerebrovascular treatment because she was diagnosed with a subarachnoid haemorrhage. The results of postoperative blood culture showed oxidase-positive, urease-positive, non-lactose-fermenting Gram-stain-negative rods. Using the Vitek2 system, the isolate was distinctly identified as Rhizobium radiobacter . However, 16S rRNA gene sequencing showed 99.93 % similarity with the type strain of R. pusense and 99.06 % similarity with the type strain of R. radiobacter . Additional gene sequencing analysis using recA (97.2 %) and atpD (96.2 %) also showed that the isolated strain is most closely related to R. pusense . The patient was cured by treatment using intravenous meropenem (3 g/d) for 4 weeks and was discharged safely. The definite source of sepsis was unknown. However, the possibility of having been infected through the catheter during the cerebrovascular operation was speculated.

Effects of nano-TiO2 on the agronomically-relevant Rhizobium-legume symbiosis

Science.gov (United States)

The impact of nano-TiO2 on Rhizobium-legume symbiosis was studied using garden peas and the compatible bacterial partner Rhizobium leguminosarum bv. viciae 3841. Exposure to nano-TiO2 did not affect the germination of peas grown aseptically, nor did it impact the gross root structure. However, nano-...

Influence of arbuscular mycorrhizal fungi, rhizobium inoculation and rock phosphate on growth and quality of lentil

International Nuclear Information System (INIS)

Yaseen, T.; Ali, K.

2016-01-01

Effective inoculation of legumes has the ability not only to ensure nutrients availability to plants particularly in N and P-limiting (due to improvement in nutrients fixation) environments but also can manipulate the environmental hazards associated with over inorganic fertilization. To support this view, the current experiment was conducted to study the influence of rock phosphorus fertilization, Arbuscular Mycorrhizae (AM) and Rhizobium inoculation on growth and yield parameters of Lens culinaris (NARC.2008-4). In addition, the current experiments aimed to evaluate the effect of different inoculation practices on crop quality in comparison with control (no inoculation).The experiment was laid out in randomized complete block design with four replications during winter (2010-11 and 2012-13) at the Department of Botany University of Peshawar Pakistan. Overall, inoculated plant performed superior in terms of plant growth and quality over control. All plants measured parameters (Leaf chlorophyll content, seed protein, fiber and ash content, plant height, number of seed pod-1, leaves plant-1, flowers plant-1, pods plant-1, pod length and thousand seed weight) were highest in plant samples inoculated with VAM and Rhizobium in combination as compared to sole application of VAM or Rhizobium. Combined inoculation of VAM and Rhizobium caused 10, 24, 17, 21 and 14% increase in seed protein content, leaf chlorophyll content, seed fiber content, seed ash content and number of seed pod-1 over sole application of VAM and Rhizobium when averaged over two years. Combined application of Rhizobium + VAM enhanced seed yield plant-1 by 45% over control and 24% and 28% over sole inoculation of VAM and Rhizobium respectively. It is therefore concluded that dual inoculation of VAM + Rhizobium and rock phosphate may be of only limited consequence in high input agricultural systems. (author)

Rhizobium pusense sp. nov., isolated from the rhizosphere of chickpea (Cicer arietinum L.).

Science.gov (United States)

Panday, Digvijay; Schumann, Peter; Das, Subrata K

2011-11-01

A novel bacterial strain, designated NRCPB10(T), was isolated from rhizosphere soil of chickpea (Cicer arietinum L.) in Pusa, New Delhi, India. The 16S rRNA gene sequence of strain NRCPB10(T) showed highest similarity (98.9 %) to that of Rhizobium radiobacter NCPPB 2437(T), followed by Rhizobium larrymoorei AF3-10(T) (97.7 %) and Rhizobium rubi IFO 13261(T) (97.4 %). Phylogenetic analysis of strain NRCPB10(T) based on the housekeeping genes recA and atpD confirmed its position as distinct from recognized Rhizobium species. Levels of DNA-DNA relatedness between strain NRCPB10(T) and R. radiobacter ICMP 5785(T), R. larrymoorei LMG 21410(T) and R. rubi ICMP 6428(T) were 51.0, 32.6 and 27.3 %, respectively. Cellular fatty acids of strain NRCPB10(T) were C(18 : 1)ω7c (58.9 %), C(16 : 0) (15.5 %), C(19 : 0) cyclo ω8c (11.5 %), iso-C(16 : 1) (5.8 %), C(16 : 0) 3-OH (4.5 %), C(16 : 1)ω7c (2.1 %) and C(18 : 0) (1.3 %). The G+C content of the genomic DNA of strain NRCPB10(T) was 59.0 mol%. Strain NRCPB10(T) did not nodulate chickpea plants or induce tumours in tobacco plants. Phenotypic and physiological properties along with SDS-PAGE of whole-cell soluble proteins differentiated strain NRCPB10(T) from its closest phylogenetic neighbours. On the basis of data from the present polyphasic taxonomic study, strain NRCPB10(T) is considered to represent a novel species of the genus Rhizobium, for which the name Rhizobium pusense sp. nov. is proposed. The type strain is NRCPB10(T) ( = LMG 25623(T) = JCM 16209(T) = NCIMB 14639(T)).

Phenotypic and genetic diversity in Sinorhizobium meliloti and S. medicae from drought and salt affected regions of Morocco

Directory of Open Access Journals (Sweden)

Udupa Sripada M

2010-01-01

Full Text Available Abstract Background Sinorhizobium meliloti and S. medicae are symbiotic nitrogen fixing bacteria in root nodules of forage legume alfalfa (Medicago sativa L.. In Morocco, alfalfa is usually grown in marginal soils of arid and semi-arid regions frequently affected by drought, extremes of temperature and soil pH, soil salinity and heavy metals, which affect biological nitrogen fixing ability of rhizobia and productivity of the host. This study examines phenotypic diversity for tolerance to the above stresses and genotypic diversity at Repetitive Extragenic Pallindromic DNA regions of Sinorhizobium nodulating alfalfa, sampled from marginal soils of arid and semi-arid regions of Morocco. Results RsaI digestion of PCR amplified 16S rDNA of the 157 sampled isolates, assigned 136 isolates as S. meliloti and the rest as S. medicae. Further phenotyping of these alfalfa rhizobia for tolerance to the environmental stresses revealed a large degree of variation: 55.41%, 82.16%, 57.96% and 3.18% of the total isolates were tolerant to NaCl (>513 mM, water stress (-1.5 MPa, high temperature (40°C and low pH (3.5, respectively. Sixty-seven isolates of S. meliloti and thirteen isolates of S. medicae that were tolerant to salinity were also tolerant to water stress. Most of the isolates of the two species showed tolerance to heavy metals (Cd, Mn and Zn and antibiotics (chloramphenicol, spectinomycin, streptomycin and tetracycline. The phenotypic clusters observed by the cluster analysis clearly showed adaptations of the S. meliloti and S. medicae strains to the multiple stresses. Genotyping with rep-PCR revealed higher genetic diversity within these phenotypic clusters and classified all the 157 isolates into 148 genotypes. No relationship between genotypic profiles and the phenotypes was observed. The Analysis of Molecular Variance revealed that largest proportion of significant (P Conclusion High degree of phenotypic and genotypic diversity is present in S

Symbiotic and phenotypic diversity of Rhizobium leguminosarum bv ...

African Journals Online (AJOL)

Administrator

2011-05-23

May 23, 2011 ... root nodule bacteria known as Rhizobium leguminosarum bv. viciae. ... nodules, as before by streaking on Yeast-extract mannitol agar medium ... Colony morphology was characterized on YEMA according to. (Ahmed et al.

Rhizobium altiplani sp. nov., isolated from effective nodules on Mimosa pudica growing in untypically alkaline soil in central Brazil.

Science.gov (United States)

Baraúna, Alexandre C; Rouws, Luc F M; Simoes-Araujo, Jean L; Dos Reis Junior, Fábio B; Iannetta, Pietro P M; Maluk, Marta; Goi, Silvia R; Reis, Veronica M; James, Euan K; Zilli, Jerri E

2016-10-01

Root nodule bacteria were isolated from nodules on Mimosa pudica L. growing in neutral-alkaline soils from the Distrito Federal in central Brazil. The 16S rRNA gene sequence analysis of 10 strains placed them into the genus Rhizobium with the closest neighbouring species (each with 99 % similarity) being Rhizobium grahamii, Rhizobium cauense, Rhizobium mesoamericanum and Rhizobium tibeticum. This high similarity, however, was not confirmed by multi-locus sequence analysis (MLSA) using three housekeeping genes (recA, glnII and rpoB), which revealed R. mesoamericanum CCGE 501T to be the closest type strain (92 % sequence similarity or less). Chemotaxonomic data, including fatty acid profiles [with majority being C19 : 0 cyclo ω8c and summed feature 8 (C18 : 1ω7c/C18 : 1ω6c)], DNA G+C content (57.6 mol%), and carbon compound utilization patterns supported the placement of the novel strains in the genus Rhizobium. Results of average nucleotide identity (ANI) differentiated the novel strains from the closest species of the genus Rhizobium, R. mesoamericanum, R. grahamii and R. tibeticum with 89.0, 88.1 and 87.8 % similarity, respectively. The symbiotic genes essential for nodulation (nodC) and nitrogen fixation (nifH) were most similar (99-100 %) to those of R. mesoamericanum, another Mimosa-nodulating species. Based on the current data, these 10 strains represent a novel species of the genus Rhizobium for which the name Rhizobium altiplani sp. nov. is proposed. The type strain is BR 10423T (=HAMBI 3664T).

Studies on the expression of plasmid-borne genes in the endosymbiotic state of Rhizobium leguminosarum

NARCIS (Netherlands)

Krol, A.J.M.

1982-01-01

The subject matter of the research reported in this thesis is the role of plasmid-borne genes of Rhizobium in symbiosis and nitrogen fixation. Plasmid DNA was isolated from Rhizobium leguminosarum strain PRE and the expression of plasmid DNA in nitrogen

Mapping the genetic basis of symbiotic variation in legume-rhizobium interactions in Medicago truncatula.

Science.gov (United States)

Gorton, Amanda J; Heath, Katy D; Pilet-Nayel, Marie-Laure; Baranger, Alain; Stinchcombe, John R

2012-11-01

Mutualisms are known to be genetically variable, where the genotypes differ in the fitness benefits they gain from the interaction. To date, little is known about the loci that underlie such genetic variation in fitness or whether the loci influencing fitness are partner specific, and depend on the genotype of the interaction partner. In the legume-rhizobium mutualism, one set of potential candidate genes that may influence the fitness benefits of the symbiosis are the plant genes involved in the initiation of the signaling pathway between the two partners. Here we performed quantitative trait loci (QTL) mapping in Medicago truncatula in two different rhizobium strain treatments to locate regions of the genome influencing plant traits, assess whether such regions are dependent on the genotype of the rhizobial mutualist (QTL × rhizobium strain), and evaluate the contribution of sequence variation at known symbiosis signaling genes. Two of the symbiotic signaling genes, NFP and DMI3, colocalized with two QTL affecting average fruit weight and leaf number, suggesting that natural variation in nodulation genes may potentially influence plant fitness. In both rhizobium strain treatments, there were QTL that influenced multiple traits, indicative of either tight linkage between loci or pleiotropy, including one QTL with opposing effects on growth and reproduction. There was no evidence for QTL × rhizobium strain or genotype × genotype interactions, suggesting either that such interactions are due to small-effect loci or that more genotype-genotype combinations need to be tested in future mapping studies.

Response of Arbuscular mycorrhizal fungi and Rhizobium ...

African Journals Online (AJOL)

The aim of the present study was to investigate the effect ofRhizobium and Arbuscular mycorrhizal fungi inoculation, both individually and in combination on growth and chlorophyll content of economically important plant Vigna unguiculata L. A significant (p < 0.05) increase over control in root length (45.6 cm), shoot height ...

Dissecting hormonal pathways in nitrogen-fixing rhizobium symbioses

NARCIS (Netherlands)

Zeijl, van Arjan

2017-01-01

Nitrogen is a key element for plant growth. To meet nitrogen demands, some plants establish an endosymbiotic relationship with nitrogen-fixing rhizobium or Frankia bacteria. This involves formation of specialized root lateral organs, named nodules. These nodules are colonized

Characterization of Rhizobium strain isolated from the roots of ...

African Journals Online (AJOL)

STORAGESEVER

2008-10-20

Oct 20, 2008 ... The Rhizobium species isolated from fenugreek roots have the potential to produce industrially important ... growth of leguminous crops (Dilworth and Parker, 1969). ..... events, such as chemotaxis and root hair colonization,.

Genome sequence of Ensifer meliloti strain WSM1022; a highly effective microsymbiont of the model legume Medicago truncatula A17.

Science.gov (United States)

Terpolilli, Jason; Hill, Yvette; Tian, Rui; Howieson, John; Bräu, Lambert; Goodwin, Lynne; Han, James; Liolios, Konstantinos; Huntemann, Marcel; Pati, Amrita; Woyke, Tanja; Mavromatis, Konstantinos; Markowitz, Victor; Ivanova, Natalia; Kyrpides, Nikos; Reeve, Wayne

2013-12-20

Ensifer meliloti WSM1022 is an aerobic, motile, Gram-negative, non-spore-forming rod that can exist as a soil saprophyte or as a legume microsymbiont of Medicago. WSM1022 was isolated in 1987 from a nodule recovered from the roots of the annual Medicago orbicularis growing on the Cyclades Island of Naxos in Greece. WSM1022 is highly effective at fixing nitrogen with M. truncatula and other annual species such as M. tornata and M. littoralis and is also highly effective with the perennial M. sativa (alfalfa or lucerne). In common with other characterized E. meliloti strains, WSM1022 will nodulate but fixes poorly with M. polymorpha and M. sphaerocarpos and does not nodulate M. murex. Here we describe the features of E. meliloti WSM1022, together with genome sequence information and its annotation. The 6,649,661 bp high-quality-draft genome is arranged into 121 scaffolds of 125 contigs containing 6,323 protein-coding genes and 75 RNA-only encoding genes, and is one of 100 rhizobial genomes sequenced as part of the DOE Joint Genome Institute 2010 Genomic Encyclopedia for Bacteria and Archaea-Root Nodule Bacteria (GEBA-RNB) project.

Effects of salt and pH stress on temperature-tolerant Rhizobium sp. NBRI330 nodulating Prosopis juliflora.

Science.gov (United States)

Kulkarni, S; Nautiyal, C S

2000-04-01

A study was conducted to examine the growth response of a rhizobial strain Rhizobium sp. NBRI330 isolated from root nodules of Prosopis juliflora growing in alkaline soil. The strain had the ability to nodulate P. juliflora. Nursery grown plants inoculated with Rhizobium sp. NBRI330 had 60.6% higher plant dry weight, as compared with uninoculated plants. The individual stress survival limit of a rhizobial strain Rhizobium sp. NBRI330 isolated from alkaline soil in a medium containing 32% (wt/vol) salt was 8 h, and at 55 degrees C up to 3 h. The length of Rhizobium sp. NBRI330 in salt-stressed cells increased significantly to 3.04 microm from 1.75 microm of non-stressed control cells. On the contrary, the length of pH-stressed cells declined to 1.40 microm. Compared with non-stressed control rod-shaped cells, the shape of temperature-stressed cells changed to spherical, of 0.42 microm diameter. High temperature (45 degrees C) was tolerated efficiently by Rhizobium sp. NBRI330 in the presence of salt at pH 12, as compared with pH 7.

Crystallization, preliminary X-ray diffraction and structure solution of MosA, a dihydrodipicolinate synthase from Sinorhizobium meliloti L5-30

International Nuclear Information System (INIS)

Leduc, Yvonne A.; Phenix, Christopher P.; Puttick, Jennifer; Nienaber, Kurt; Palmer, David R. J.; Delbaere, Louis T. J.

2005-01-01

MosA from S. meliloti L5-30 has been crystallized in solution with pyruvate and the 2.3 Å resolution structure has been solved by molecular replacement using E. coli dihydrodipicolinate synthase as the model. The structure of MosA, a dihydrodipicolinate synthase and reported methyltransferase from Sinorhizobium meliloti, has been solved using molecular replacement with Escherichia coli dihydrodipicolinate synthase as the model. A crystal grown in the presence of pyruvate diffracted X-rays to 2.3 Å resolution using synchrotron radiation and belonged to the orthorhombic space group C222 1 , with unit-cell parameters a = 69.14, b = 138.87, c = 124.13 Å

Brucella melitensis MucR, an orthologue of Sinorhizobium meliloti MucR, is involved in resistance to oxidative, detergent, and saline stresses and cell envelope modifications.

Science.gov (United States)

Mirabella, A; Terwagne, M; Zygmunt, M S; Cloeckaert, A; De Bolle, X; Letesson, J J

2013-02-01

Brucella spp. and Sinorhizobium meliloti are alphaproteobacteria that share not only an intracellular lifestyle in their respective hosts, but also a crucial requirement for cell envelope components and their timely regulation for a successful infectious cycle. Here, we report the characterization of Brucella melitensis mucR, which encodes a zinc finger transcriptional regulator that has previously been shown to be involved in cellular and mouse infections at early time points. MucR modulates the surface properties of the bacteria and their resistance to environmental stresses (i.e., oxidative stress, cationic peptide, and detergents). We show that B. melitensis mucR is a functional orthologue of S. meliloti mucR, because it was able to restore the production of succinoglycan in an S. meliloti mucR mutant, as detected by calcofluor staining. Similar to S. meliloti MucR, B. melitensis MucR also represses its own transcription and flagellar gene expression via the flagellar master regulator ftcR. More surprisingly, we demonstrate that MucR regulates a lipid A core modification in B. melitensis. These changes could account for the attenuated virulence of a mucR mutant. These data reinforce the idea that there is a common conserved circuitry between plant symbionts and animal pathogens that regulates the relationship they have with their hosts.

The use of mycorrhiza and Rhizobium in the growth of three months saga seedling (Adenanthera pavonina

Directory of Open Access Journals (Sweden)

Rina Kurniaty

2017-03-01

Full Text Available Abstrak. Kurniaty R. 2016. The use of mycorrhiza and Rhizobium in the growth of three months saga seedling (Adenanthera pavonina. Pros Sem Nas Masy Biodiv Indon 2: 6-9. Plants saga tree (Adenanthera pavonina having benefits versatile because almost all parts of crop can be used so that economically valuable high. Wood saga can be used as building material and furniture . Seeds saga have the potential who has a promising as renewable energy source of them because the seeds his containing 14-28% fatty oil who could be classified as non food . In addition oil derived from the seeds of the saga is also very good to treat a disease in, scurvy, injuries, making candles, batik industry, and materials making soap. Research aims to understand the influence of the use of mycorrhizal and Rhizobium in growth seedlings saga age 3 months. Inoculating Rhizobium liquid as many as 1 mL by means of injecting on roots and plants surrounding the hole . The provision of mycorrhizal done by entering 2 g mycorrhizal (Glomus sp into a hole plant at the same time as Rhizobium. Design used is a random factorials consisting of two factors treatment. The first is Rhizobium (A namely: A1 = control and A2= Rhizobium sp. The second factor is mycorrhizal (B consisting of two the standard: B1 = control and B2 = Glomus sp (2 g/ polybag. The results showed that the treatment A2B2 (Rhizobium + mycorrhizal put a value colonization roots highest namely 68,88% with live percent 99,26%, height 10,08 cm, diameter 1.67mm, biomass 0,56 g, TR ratio 2.01 and IMB 0,06 . Nutrient absorption, treatment A2B2 is the nutrient in N 60,30% compared to control, the nutrient P 66,66% compared to control and the nutrient K 123,17% compared to control.

Permanent draft genome of the malachite-green-tolerant bacterium Rhizobium sp. MGL06.

Science.gov (United States)

Liu, Yang; Wang, Runping; Zeng, Runying

2014-12-01

Rhizobium sp. MGL06, the first Rhizobium isolate from a marine environment, is a malachite-green-tolerant bacterium with a broader salinity tolerance (range: 0.5% to 9%) than other rhizobia. This study sequences and annotates the draft genome sequence of this strain. Genome sequence information provides a basis for analyzing the malachite green tolerance, broad salinity adaptation, nitrogen fixation properties, and taxonomic classification of the isolate. Copyright © 2014 Elsevier B.V. All rights reserved.

Ensifer meliloti overexpressing Escherichia coli phytase gene ( appA) improves phosphorus (P) acquisition in maize plants

Science.gov (United States)

Sharma, Vikas; Kumar, Ajit; Archana, G.; Kumar, G. Naresh

2016-10-01

The Escherichia coli phytase gene appA encoding enzyme AppA was cloned in a broad host range plasmid pBBR1MCS2 ( lac promoter), termed pVA1, and transformed into the Ensifer meliloti 1020. Transformation of pVA1 in Ensifer meliloti { E. m (pVA1)} increased its phosphatase and phytase activity by ˜9- and ˜50-fold, respectively, compared to the transformants containing empty plasmid as control { E. m (pBBR1MCS2)}. The western blot experiments using rabbit anti-AppA antibody showed that AppA is translocated into the periplasm of the host after its expression. Ensifer meliloti harboring AppA protein { E. m (pVA1)} and { E. m (pBBR1MCS2)} could acidify the unbuffered phytate minimal media (pH 8.0) containing Ca-phytate or Na-phytate as sole organic P (Po) source to below pH 5.0 and released P. However, both { E. m (pVA1)} and { E. m (pBBR1MCS2)} neither dropped pH of the medium nor released P when the medium was buffered at pH 8.0 using Tris-Cl, indicating that acidification of medium was important for the enzymatic hydrolysis of phytate. Further experiments proved that maize plants inoculated with { E. m. (pVA1)} showed increase in growth under sterile semi solid agar (SSA) medium containing Na-phytate as sole P source. The present study could be helpful in generating better transgenic bioinoculants harboring phosphate mineralization properties that ultimately promote plant growth.

Polyamines contribute to salinity tolerance in the symbiosis Medicago truncatula-Sinorhizobium meliloti by preventing oxidative damage.

Science.gov (United States)

López-Gómez, Miguel; Hidalgo-Castellanos, Javier; Muñoz-Sánchez, J Rubén; Marín-Peña, Agustín J; Lluch, Carmen; Herrera-Cervera, José A

2017-07-01

Polyamines (PAs) such as spermidine (Spd) and spermine (Spm) are small ubiquitous polycationic compounds that contribute to plant adaptation to salt stress. The positive effect of PAs has been associated to a cross-talk with other anti-stress hormones such as brassinosteroids (BRs). In this work we have studied the effects of exogenous Spd and Spm pre-treatments in the response to salt stress of the symbiotic interaction between Medicago truncatula and Sinorhizobium meliloti by analyzing parameters related to nitrogen fixation, oxidative damage and cross-talk with BRs in the response to salinity. Exogenous PAs treatments incremented the foliar and nodular Spd and Spm content which correlated with an increment of the nodule biomass and nitrogenase activity. Exogenous Spm treatment partially prevented proline accumulation which suggests that this polyamine could replace the role of this amino acid in the salt stress response. Additionally, Spd and Spm pre-treatments reduced the levels of H 2 O 2 and lipid peroxidation under salt stress. PAs induced the expression of genes involved in BRs biosynthesis which support a cross-talk between PAs and BRs in the salt stress response of M. truncatula-S. meliloti symbiosis. In conclusion, exogenous PAs improved the response to salinity of the M. truncatula-S. meliloti symbiosis by reducing the oxidative damage induced under salt stress conditions. In addition, in this work we provide evidences of the cross-talk between PAs and BRs in the adaptive responses to salinity. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

Molecular markers to study competition and diversity of Rhizobium

NARCIS (Netherlands)

Sessitsch, A.

1997-01-01

The research described in this thesis was directed to the development of molecular identification and detection techniques for studying the ecology of Rhizobium, a nitrogen- fixing bacterium of agricultural importance. Competition of inoculant strains with indigenous

Determination of effectiveness of native rhizobium on nodulation ...

African Journals Online (AJOL)

KARACA

2012-05-08

May 8, 2012 ... SINET: Ethiopian J. Sci. 24: 197-211. Beck DP, Materon LA, Afandi F (1993). Practical Rhizobium sp. legume technology manual. Int. Center Agric. Res. Dry Areas. Aleppo, Syria. pp. 1-54. Bouyoucos CA (1951). Hidrometer method improved for making particle size analysis of Soil. Agron. J. 54(5): 464-465.

effect of tillage, rhizobium inoculation in maize-soybean- based ...

African Journals Online (AJOL)

main plot, four rhizobium inoculation in soybean-maize-based cropping systems ... production systems, such as cropping systems, ... of commercial inoculants. Studies ... and distributed by IITA business incubation ... sowing, while the remaining part (2/3) was done as ...... biological nitrogen fixation potential and grain yield.

Cost effective pilot scale production of biofertilizer using Rhizobium ...

African Journals Online (AJOL)

We standardized the protocol for pilot scale production of Rhizobium and Azotobacter biofertilizer technology using region specific and environmental stress compatible strains isolated from various agro climatic regions of Odisha, India. The cost benefit of biofertilizer production through a cottage industry is also presented.

Effects of Rhizobium inoculation on Trifolium resupinatum antioxidant system under sulfur dioxide pollution

Directory of Open Access Journals (Sweden)

Ladan Bayat

2014-01-01

Full Text Available Introduction: Plant growth stimulating rhizobacteria are beneficial bacteria that can cause resistance to various stresses in plants. One of these stresses is SO2 air pollution. SO2 is known as a strong damaging air pollutant that limits growth of plants. The aim of this study is evaluation of the effects of bacterial inoculation with native and standard Rhizobium on Persian clover root growth and antioxidants activity and capacity under air SO2 pollution. Materials and methods: In this study, 31 days plants (no-inoculated and inoculated with two strains of Rhizobium exposed to the different concentrations of SO2 (0 as a control, 0.5, 1, 1.5 and 2 ppm for 5 consecutive days and 2 hours per day. Results: Results showed different concentrations of SO2 had a significant effect on Persian clover root weight and antioxidant system. Increasing SO2 stress decreased root fresh and dry weight and antioxidant capacities (IC50 and increased antioxidant activities (I% of Persian clover leaves significantly in comparison to the control plants (under 0 ppm and increased SOD, CAT and GPX activity. Inoculation of Persian clover plants with native and standard Rhizobium increased root weight and did not show a significant effect on antioxidants activity and capacity, but interaction between Rhizobium inoculation and SO2 treatment reduced significantly the stress effects of high concentration of SO2 on root growth and antioxidants activity and capacity. In fact, level of this change of root growth and antioxidant system under SO2 pollution stress in inoculated plants was lower than in the non-inoculated plants. Discussion and conclusion: As a result, an increase in SO2 concentration caused a decrease in root weight, increase in antioxidants activity and capacity of Persian clover. Inoculation with Rhizobium strains could alleviate the effect of SO2 pollution on antioxidant system by effects on root growth.

Effect of combined inoculations of Rhizobium-Arbuscular Mycorrhiza in Leucaena leucocephala CV: Perú

Directory of Open Access Journals (Sweden)

Lázaro Jesús Ojeda Quintana

2014-07-01

Full Text Available The work was conducted at the Experimental Station of Soil and Fertilizer “Escambray” land of farmers and associated rural extension. The experimental design was randomized blocks, and treatments: Rizhobium loti V-4033 (Research Institute of Pastures and Forages, mycorrhizal fungi trainers, Rhizobium +mycorrhiza fungi trainers, nitrogen and total control. Inoculation with my corrhiza forming fungi was performed at 10 g/bag Certificate MicoFert Strain the Institute of Ecology and Systematics-3: Glomus spurcum, Topes de Collantes, 85 % colonization of rootlets, while the Rhizobium was inoculated in a dose of 50 g/kg of seed. Variant was nitrogen at 25 kg/ha of urea. The plots occupied 18m2 , with an area of 9 m2 evaluable. When the plants reached 7.5 months and an average height of 143.4 cm proceeded to make the Court of establishment and then four foliage cuts were made every 90 days. Each cut dry biomass yield, and phosphorus content was determined crude protein. The combined inoculation of Rhizobium and mycorrhiza fungi Makers increased the yield of dry biomass, and phosphorus content of crude protein. We conclude proposing the adoption of an alternative methodology using mycorrhiza formers Fungi and Rhizobium in Leucaena leucocephala as a way to increase the yield of dry biomass, decreasing mineral fertilization and contribute to environmental protection

The rhizobium-pea symbiosis as affected by high temperatures

NARCIS (Netherlands)

Frings, J.F.J.

1976-01-01

A study has been made concerning the effect of high temperatures on the symbiosis of Rhizobium leguminosarum and pea plants (Pisum sativum). At 30°C, no nodules were found on the roots of plants growing in nutrient solution after inoculation with

Rhizobium pongamiae sp. nov. from Root Nodules of Pongamia pinnata

Directory of Open Access Journals (Sweden)

Vigya Kesari

2013-01-01

Full Text Available Pongamia pinnata has an added advantage of N2-fixing ability and tolerance to stress conditions as compared with other biodiesel crops. It harbours “rhizobia” as an endophytic bacterial community on its root nodules. A gram-negative, nonmotile, fast-growing, rod-shaped, bacterial strain VKLR-01T was isolated from root nodules of Pongamia that grew optimal at 28°C, pH 7.0 in presence of 2% NaCl. Isolate VKLR-01 exhibits higher tolerance to the prevailing adverse conditions, for example, salt stress, elevated temperatures and alkalinity. Strain VKLR-01T has the major cellular fatty acid as C18:1  ω7c (65.92%. Strain VKLR-01T was found to be a nitrogen fixer using the acetylene reduction assay and PCR detection of a nifH gene. On the basis of phenotypic, phylogenetic distinctiveness and molecular data (16S rRNA, recA, and atpD gene sequences, G + C content, DNA-DNA hybridization etc., strain VKLR-01T = (MTCC 10513T = MSCL 1015T is considered to represent a novel species of the genus Rhizobium for which the name Rhizobium pongamiae sp. nov. is proposed. Rhizobium pongamiae may possess specific traits that can be transferred to other rhizobia through biotechnological tools and can be directly used as inoculants for reclamation of wasteland; hence, they are very important from both economic and environmental prospects.

Populasi Bakteri Rhizobium di Tanah pada beberapa Tanaman dari Pulau Buton, Kabupaten Muna, Propinsi Sulawesi Tenggara

Directory of Open Access Journals (Sweden)

Sri Purwaningsih

2009-01-01

Full Text Available The research was conducted in order to know population of Rhizobium bacteria in the soil at several plant from Buton island, Muna regency, Southeast Sulawesi. The purpose of the study was to get the population data and pure cultures of Rhizobium bacteria. Rhizobium bacteria were isolated from 13 sample from rhizosphere of fruit plant, 14 sample soil from rhizosphere of yield plant, 5 sample soil from rhizosphere of horticulture plant, and 8 samples soil was from forest plant. Isolation was conducted in standard medium of Yeast Extract Mannitol Agar (YEMA, the inoculation at (27-280C, and the population was counted by plate count methods. The growth characteristic of strain was observed by using YEMA medium mixed respectively with Brom Thymol Blue and Congo Red as an indicators. The population of Rhizobium bacteria was in the range of 7-115 × 105 CFU g-1 soil, and the highest population was found from the sample soil from rhizosphere with Ipomea batatas plant. Forty nine gave of pure culture, thirty five isolates can be grouped as fast growing, while fourteen can be grouped as slow growing.

Effectiveness of halo-tolerant, auxin producing Pseudomonas and Rhizobium strains to improve osmotic stress tolerance in mung bean (Vigna radiata L.

Directory of Open Access Journals (Sweden)

Maqshoof Ahmad

2013-12-01

Full Text Available Halo-tolerant, auxin producing bacteria could be used to induce salt tolerance in plants. A number of Rhizobium and auxin producing rhizobacterial strains were assessed for their ability to tolerate salt stress by conducting osmoadaptation assay. The selected strains were further screened for their ability to induce osmotic stress tolerance in mung bean seedlings under salt-stressed axenic conditions in growth pouch/jar trials. Three most effective strains of Rhizobium and Pseudomonas containing ACC-deaminase were evaluated in combination, for their ability to induce osmotic stress tolerance in mung bean at original, 4, and 6 dS m-1 under axenic conditions. Results showed that sole inoculation of Rhizobium and Pseudomonas strains improved the total dry matter up to 1.4, and 1.9 fold, respectively, while the increase in salt tolerance index was improved up to 1.3 and 2.0 fold by the Rhizobium and Pseudomonas strains, respectively. However, up to 2.2 fold increase in total dry matter and salt tolerance index was observed due to combined inoculation of Rhizobium and Pseudomonas strains. So, combined application of Rhizobium and Pseudomonas strains could be explored as an effective strategy to induce osmotic stress tolerance in mung bean.

Genetic Factors in Rhizobium Affecting the Symbiotic Carbon Costs of N2 Fixation and Host Plant Biomass Production

DEFF Research Database (Denmark)

Skøt, L.; Hirsch, P. R.; Witty, J. F.

1986-01-01

The effect of genetic factors in Rhizobium on host plant biomass production and on the carbon costs of N2 fixation in pea root nodules was studied. Nine strains of Rhizobium leguminosarum were constructed, each containing one of three symbiotic plasmids in combination with one of three different ...

Comparative toxicity assessment of CeO{sub 2} and ZnO nanoparticles towards Sinorhizobium meliloti, a symbiotic alfalfa associated bacterium: Use of advanced microscopic and spectroscopic techniques

Energy Technology Data Exchange (ETDEWEB)

Bandyopadhyay, Susmita [Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Avenue, El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN), The University of Texas at El Paso (United States); Peralta-Videa, Jose R. [Department of Chemistry, The University of Texas at El Paso, 500 West University Avenue, El Paso, TX 79968 (United States); Plascencia-Villa, German; Jose-Yacaman, Miguel [Department of Physics and Astronomy, The University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States); Gardea-Torresdey, Jorge L., E-mail: jgardea@utep.edu [Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Avenue, El Paso, TX 79968 (United States); Department of Chemistry, The University of Texas at El Paso, 500 West University Avenue, El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN), The University of Texas at El Paso (United States)

2012-11-30

Highlights: Black-Right-Pointing-Pointer First cytotoxicity study of CeO{sub 2} and ZnO nanoparticles to Sinorhizobium meliloti. Black-Right-Pointing-Pointer First report upon the mechanisms of CeO{sub 2} and ZnO NPs toxicity to S. meliloti. Black-Right-Pointing-Pointer ZnO NPs were found to be bactericidal in lower concentration. Black-Right-Pointing-Pointer CeO{sub 2} NPs had bacteriostatic effect on S. meliloti. - Abstract: Cerium oxide (CeO{sub 2}) and zinc oxide (ZnO) nanoparticles (NPs) are extensively used in a variety of instruments and consumer goods. These NPs are of great concern because of potential toxicity towards human health and the environment. The present work aimed to assess the toxic effects of 10 nm CeO{sub 2} and ZnO NPs towards the nitrogen fixing bacterium Sinorhizobium meliloti. Toxicological parameters evaluated included UV/Vis measurement of minimum inhibitory concentration, disk diffusion tests, and dynamic growth. Ultra high-resolution scanning transmission electron microscopy (STEM) and infrared spectroscopy (FTIR) were utilized to determine the spatial distribution of NPs and macromolecule changes in bacterial cells, respectively. Results indicate that ZnO NPs were more toxic than CeO{sub 2} NPs in terms of inhibition of dynamic growth and viable cells counts. STEM images revealed that CeO{sub 2} and ZnO NPs were found on bacterial cell surfaces and ZnO NPs were internalized into the periplasmic space of the cells. FTIR spectra showed changes in protein and polysaccharide structures of extra cellular polymeric substances present in bacterial cell walls treated with both NPs. The growth data showed that CeO{sub 2} NPs have a bacteriostatic effect, whereas ZnO NPs is bactericidal to S. meliloti. Overall, ZnO NPs were found to be more toxic than CeO{sub 2} NPs.

Influence of carbofuran on certain metabolic and symbiotic activities of a cowpea Rhizobium

International Nuclear Information System (INIS)

Palaniappan, S.; Balasubramanian, A.

1983-01-01

Using carbon 14 radioisotope an in-vitro study of the effect of insecticides, carbofuran, on the metabolic and symbiotic activities of Rhizobium sp. cowpea group, was carried out. The study indicated that at 10 ppm carbofuran inhibited the in-vitro growth of the bacterium, suppressed the oxidation of all the Trichloroacetic acid (TCA) cycle intermediates, significantly reduced glucose oxidation and translocation and affected the growth and symbiotic activities of the cowpea as reflected by a reduction in the dry matter production and total nitrogen content. The insecticide was itself degraded by the Rhizobium sp. within 30 days of incubation

The Effects of Seed Inoculation with Rhizobium and Nitrogen Application on Yield and some Agronomi Characterstics of Soybean (Glycine max L. under Ardabil Condition

Directory of Open Access Journals (Sweden)

M.N Seiedi

2014-03-01

Full Text Available In order to study the effects of seed inoculation with rhizobium and nitrogen application on yield and some agronomic characterstics of soybean (Glycine max L., a spilt plot experiment based on randomized complete block design with three replications was conducted in 2011 at the research farm of the Islamic Azad University, Ardabil Branch. Factors were inorganic nitrogen fertilizer urea at four levels (0, 30, 60 and 90 kg urea/ha in the main plot and two levels of inoculation with Rhizobium japanicum bacteria (with and without inoculation assigned to the sub plots. Study the growth indices showed that the maximum total dry matter (435.4 gr/m2 , crop growth rate (6.75 gr/m2.day and relative growth rate (0.1003 gr/gr.day were obtained from compound of treatments high levels of urea application × inoculation with rhizobium while, the minimum values of these indices recorded in without nitrogen application×non inoculation with rhizobium. The highest plant height, number of pod per plant and grain yield were obtained from the highest level of nitrogen fertilizer (90 kg/ha urea and seed inoculation with rhizobium. Number and dry weight of nodules per plant increased significantly with increasing nitrogen application till 60 kg/ha in seed inoculation with rhizobium. The lowest values of these traits recorded in non application of urea×non inoculation with rhizobium. Inoculation with rhizobium bacteria increased the number and dry weight of nodules per plant. Thus, it can be suggested that in order to increasing of grain yield, seed can be inoculated with rhizobium bacteria × application of 60 kg urea/ha in conditions of Ardabil region.

Interacción micorriza vesiculo-arbuscular, Rhizobium leguminosa en un oxisol de los Llanos Orientales de Colombia

Directory of Open Access Journals (Sweden)

Satizabal E. Jorge H.

1987-03-01

Full Text Available En los dos primeros trabajos (la y lb, se evaluó la interacción entre cepas seleccionadas de Rhizobium (apropiadas para la leguminosa forrajera tropical Centrosema macrocarpum y especies (Entrophospora colombiana, Acaulospora longula, Glomus manihotis de micorriza vesiculo arbuscular (MVA, en un suelo esterilizado, fijador de P. Los experimentos se diferenciaron por las fuentes de P utilizadas. Por su mayor producción de materia seca, absorción de minerales, nodulación y infección por MVA, se destacaron las plantas inoculadas con cuales quiera de las cepas de FIlizobiumy Glomus manihotis (Experimento la o Acaulospora longula (Experimento lb. En la tercera investigación (Experimento II, se evalúo en Centrosema la interacción MVA, Rhizobiumo N-químico (niveles equivalentes a 0, 30,55, 105,0 + Rhiz. y 30 + Rhiz. kg N ha-1 y dosis de P (0, 20, 40 y 80 kg ha-1. Es aconsejable aplicar pequeñas dosis (30 kg ha-1 de N al momento de la siembra e inocular con Rhizobium. Plantas inoculadas con MVA presentaron su óptimo crecimiento con 40 kg P ha-1. Dosis de 80 kg P ha-1 favoreció la eficiencia de la bacteria más no la del hongo.In the first two works (la and lb we evaluated the interation between selected stumps of Rhizobium (appropiate for the tropical forage legumes Centrosema macrocarpum and species (Entrophospora colombiana, Acaulospora longula, Glomus manihotis of vesicular-arbuscular mycorrhiza (MVA, in a sterelize soil fixer of P. The two experiments are different because we used different P sources. For the best production of dry matter, absorption of minerals, nodulation and infection for MVA; rebounded the plants with the inoculation with any of the Rhizobium´s stumps and Glomus manihotis (Experiment la of Acaulospora longula (Experiment lb. In the third investigation (Experiment II we evaluated in Centrosema the interaction MVA. Rhizobium and chemical N (levels equivalent to 0,30. 55, 105, O + Rhizobium and 30 + Rhizobium kg N ha

The isolation, enumeration, and characterization of Rhizobium bacteria of the soil in Wamena Biological Garden

Directory of Open Access Journals (Sweden)

SRI PURWANINGSIH

2005-04-01

Full Text Available The eleven soil samples have been isolated and characterized. The aims of the study were to get the pure culture and some data which described about enumeration and especially their characters in relation to the acids and bases reaction in their growth. The isolation of the bacteria use Yeast Extract Mannitol Agar medium (YEMA while the characterization by using YEMA medium mixed with Brom Thymol Blue and Congo Red indicators respectively. The results showed that eighteen isolates have been isolated which consisted of three low growing and fifteen fast growing bacteria. Two isolates were not indicated Rhizobium and sixteen were Rhizobium. Density of Rhizobium enumeration was varied which related to soil organic matter content. The enumeration bacteria in YEMA medium were in the range of 0.6 x 105 and 11.6 x 105 CFU /g soil. The highest population was found in soil sample of Wieb vegetation.

Crystallization and preliminary crystallographic studies of the recombinant dihydropyrimidinase from Sinorhizobium meliloti CECT4114

International Nuclear Information System (INIS)

Martínez-Rodríguez, Sergio; González-Ramírez, Luis Antonio; Clemente-Jiménez, Josefa María; Rodríguez-Vico, Felipe; Las Heras-Vázquez, Francisco Javier; Gavira, Jose A.; García-Ruíz, Juan Manuel

2006-01-01

The dihydropyrimidinase from S. meliloti CECT4114, with activity towards both hydantoin and dihydrouracil substrates, was crystallized, and diffraction data were collected to 1.85 Å resolution. Dihydropyrimidinases are involved in the reductive pathway of pyrimidine degradation, catalysing the hydrolysis of 5,6-dihydrouracil and 5,6-dihydrothymine to the corresponding N-carbamoyl β-amino acids. This enzyme has often been referred to as hydantoinase owing to its industrial application in the production of optically pure amino acids starting from racemic mixtures of 5-monosubstituted hydantoins. Recombinant dihydropyrimidinase from Sinorhizobium meliloti CECT4114 (SmelDhp) has been expressed, purified and crystallized. Crystallization was performed using the counter-diffusion method with capillaries of 0.3 mm inner diameter. Crystals of SmelDhp suitable for data collection and structure determination were grown in the presence of agarose at 0.1%(w/v) in order to ensure mass transport controlled by diffusion. X-ray data were collected to a resolution of 1.85 Å. The crystal belongs to the orthorhombic space group C222 1 , with unit-cell parameters a = 124.89, b = 126.28, c = 196.10 Å and two molecules in the asymmetric unit. A molecular-replacement solution has been determined and refinement is in progress

Effect of Rhizobium and Mycorhiza inoculation on the nursery growth of Acacia and Teline monspessulana

International Nuclear Information System (INIS)

Layton, G; Lozano de Yunda, A; Chaparro, H

1999-01-01

In an experiment accomplished in the tree nursery Tisquesusa located in Madrid (Cundinamarca) was evaluated the effect of the inoculation with strains selected of foreign and Indigenous rhizobium and Arbuscular mycorrhizal fungi am (Glomus folescutolum) on the growth, nitrogen fixation, and micorrization of Acacia (Acacia decurrens) and Retamo (Teline monspessulana) that they are used In soils recovery by the Corporacion Autonoma Regional de Cundinamarca CAR. The studied species presented positive response to the inoculation with rhizobium; the indigenous strain DQ6-09, isolated in Guatavita (Cundinamarca), presented the better results in Retamo and also in Acacia alone and in mixture with the foreign strain T1881. The inoculation with fungi AM increased the heights, dry weights, phosphorus content and percentage of micorrization in Acacia and Retamo. The double inoculation with fungi ma and rhizobium it did not increase the nitrogen fixing of Acacia while in Retamo was presented a positive effect with the strain DQ6-09

An arsenate-reducing and alkane-metabolizing novel bacterium, Rhizobium arsenicireducens sp. nov., isolated from arsenic-rich groundwater.

Science.gov (United States)

Mohapatra, Balaram; Sarkar, Angana; Joshi, Swati; Chatterjee, Atrayee; Kazy, Sufia Khannam; Maiti, Mrinal Kumar; Satyanarayana, Tulasi; Sar, Pinaki

2017-03-01

A novel arsenic (As)-resistant, arsenate-respiring, alkane-metabolizing bacterium KAs 5-22 T , isolated from As-rich groundwater of West Bengal was characterized by physiological and genomic properties. Cells of strain KAs 5-22 T were Gram-stain-negative, rod-shaped, motile, and facultative anaerobic. Growth occurred at optimum of pH 6.0-7.0, temperature 30 °C. 16S rRNA gene affiliated the strain KAs 5-22 T to the genus Rhizobium showing maximum similarity (98.4 %) with the type strain of Rhizobium naphthalenivorans TSY03b T followed by (98.0 % similarity) Rhizobium selenitireducens B1 T . The genomic G + C content was 59.4 mol%, and DNA-DNA relatedness with its closest phylogenetic neighbors was 50.2 %. Chemotaxonomy indicated UQ-10 as the major quinone; phosphatidylethanolamine, phosphatidylglycerol, and diphosphatidylglycerol as major polar lipids; C 16:0 , C 17:0 , 2-OH C 10:0 , 3-OH C 16:0 , and unresolved C 18:1 ɷ7C/ɷ9C as predominant fatty acids. The cells were found to reduce O 2 , As 5+ , NO 3 - , SO 4 2- and Fe 3+ as alternate electron acceptors. The strain's ability to metabolize dodecane or other alkanes as sole carbon source using As 5+ as terminal electron acceptor was supported by the presence of genes encoding benzyl succinate synthase (bssA like) and molybdopterin-binding site (mopB) of As 5+ respiratory reductase (arrA). Differential phenotypic, chemotaxonomic, genotypic as well as physiological properties revealed that the strain KAs 5-22 T is separated from its nearest recognized Rhizobium species. On the basis of the data presented, strain KAs 5-22 T is considered to represent a novel species of the genus Rhizobium, for which the name Rhizobium arsenicireducens sp. nov. is proposed as type strain (=LMG 28795 T =MTCC 12115 T ).

Strain identification in Rhizobium by starch gel electrophoresis of isoenzymes

DEFF Research Database (Denmark)

Engvild, Kjeld Christensen; Nielsen, G.

1985-01-01

Sonieated extracts of rhizobia, especiaUy Rhizobium leguminosarum from pea and vetch, were run in horizontal starch gel electrophoresis in the cold. The rhizobia were grown on agar on a slime suppressing substrate of tryptone-yeast extract-CaCl2 with small amounts of mannitol, sorbitol...

Phylogenetic relationships and host range of Rhizobium spp. that nodulate Phaseolus vulgaris L.

Science.gov (United States)

Hernandez-Lucas, I; Segovia, L; Martinez-Romero, E; Pueppke, S G

1995-07-01

We determined the nucleotide sequences of 16S rRNA gene segments from five Rhizobium strains that have been isolated from tropical legume species. All share the capacity to nodulate Phaseolus vulgaris L., the common bean. Phylogenetic analysis confirmed that these strains are of two different chromosomal lineages. We defined the host ranges of two strains of Rhizobium etli and three strains of R. tropici, comparing them with those of the two most divergently related new strains. Twenty-two of the 43 tested legume species were nodulated by three or more of these strains. All seven strains have broad host ranges that include woody species such as Albizia lebbeck, Gliricidia maculata, and Leucaena leucocephala.

Genome-engineered Sinorhizobium meliloti for the production of poly(lactic-co-3-hydroxybutyric) acid copolymer.

Science.gov (United States)

Tran, Tam T; Charles, Trevor C

2016-02-01

Economically competitive commercial production of biodegradable bioplastics with desirable properties is an important goal. In this study, we demonstrate the use of chromosome engineering of an alternative bacterial host, Sinorhizobium meliloti, for production of the copolymer, poly(lactate-co-3-hydroxybutyrate). Codon-optimized genes for 2 previously engineered enzymes, Clostridium propionicum propionate CoA transferase (Pct532Cp) and Pseudomonas sp. strain MBEL 6-19 polyhydroxyalkanoate (PHA) synthase 1 (PhaC1400Ps6-19), were introduced into S. meliloti Rm1021 by chromosome integration, replacing the native phbC gene. On the basis of phenotypic analysis and detection of polymer product by gas chromatography analysis, synthesis and accumulation of the copolymer was confirmed. The chromosome integrant strain, with the introduced genes under the control of the native phbC promoter, is able to produce over 15% cell dry mass of poly(lactate-co-3-hydroxybutyrate), containing 30 mol% lactate, from growth on mannitol. We were also able to purify the polymer from the culture and confirm the structure by NMR and GC-MS. To our knowledge, this is the first demonstration of production of this copolymer in the Alphaproteobacteria. Further optimization of this system may eventually yield strains that are able to produce economically viable commercial product.

Effect of vanadium and tungsten on nitrogen fixation and the growth of Medicago sativa

Energy Technology Data Exchange (ETDEWEB)

Jha, K K

1969-01-01

In sand culture, it was found that vanadium had no stimulatory effect on nitrogen content or the growth of Medicago sativa inoculated with an effective strain of Rhizobium meliloti or supplied with ammonium nitrate. At the level of 500 ppm it reduced the plant growth, the inhibitory effect being particularly severe on the root. On the other hand tungsten increased nitrogen fixation and the dry matter yield of the inoculated plants. The results are suggestive of a direct role of tungsten in symbiotic nitrogen fixation. 4 references, 2 tables.

Genomic basis of broad host range and environmental adaptability of Rhizobium tropici CIAT 899 and Rhizobium sp. PRF 81 which are used in inoculants for common bean (Phaseolus vulgaris L.

Directory of Open Access Journals (Sweden)

Ormeño-Orrillo Ernesto

2012-12-01

Full Text Available Abstract Background Rhizobium tropici CIAT 899 and Rhizobium sp. PRF 81 are α-Proteobacteria that establish nitrogen-fixing symbioses with a range of legume hosts. These strains are broadly used in commercial inoculants for application to common bean (Phaseolus vulgaris in South America and Africa. Both strains display intrinsic resistance to several abiotic stressful conditions such as low soil pH and high temperatures, which are common in tropical environments, and to several antimicrobials, including pesticides. The genetic determinants of these interesting characteristics remain largely unknown. Results Genome sequencing revealed that CIAT 899 and PRF 81 share a highly-conserved symbiotic plasmid (pSym that is present also in Rhizobium leucaenae CFN 299, a rhizobium displaying a similar host range. This pSym seems to have arisen by a co-integration event between two replicons. Remarkably, three distinct nodA genes were found in the pSym, a characteristic that may contribute to the broad host range of these rhizobia. Genes for biosynthesis and modulation of plant-hormone levels were also identified in the pSym. Analysis of genes involved in stress response showed that CIAT 899 and PRF 81 are well equipped to cope with low pH, high temperatures and also with oxidative and osmotic stresses. Interestingly, the genomes of CIAT 899 and PRF 81 had large numbers of genes encoding drug-efflux systems, which may explain their high resistance to antimicrobials. Genome analysis also revealed a wide array of traits that may allow these strains to be successful rhizosphere colonizers, including surface polysaccharides, uptake transporters and catabolic enzymes for nutrients, diverse iron-acquisition systems, cell wall-degrading enzymes, type I and IV pili, and novel T1SS and T5SS secreted adhesins. Conclusions Availability of the complete genome sequences of CIAT 899 and PRF 81 may be exploited in further efforts to understand the interaction of tropical

Biodegradation pathway of L-glutamatediacetate by Rhizobium radiobacter strain BG-1

NARCIS (Netherlands)

Ginkel, van C.G.; Geerts, R.; Nguyen, P.D.; Plugge, C.M.

2008-01-01

An aerobic bacterium was isolated from activated sludge in a medium containing l-glutamate-N,N-diacetate (l-GLDA) as sole carbon and energy source. The isolate was identified as a Rhizobium radiobacter species. Besides l-GLDA, the strain utilized nitrilotriacetate (NTA) and proposed intermediates in

Crystallization and preliminary crystallographic studies of an active-site mutant hydantoin racemase from Sinorhizobium meliloti CECT4114

International Nuclear Information System (INIS)

Martínez-Rodríguez, Sergio; González-Ramírez, Luis Antonio; Clemente-Jiménez, Josefa María; Rodríguez-Vico, Felipe; Las Heras-Vázquez, Francisco Javier; Gavira, Jose Antonio; García-Ruiz, Juan Ma.

2007-01-01

Crystals of an active-site mutated hydantoin racemase from S. meliloti have been obtained in the presence and absence of d,l-5-isopropyl-hydantoin and characterized by X-ray diffraction. A recombinant active-site mutant of hydantoin racemase (C76A) from Sinorhizobium meliloti CECT 4114 (SmeHyuA) has been crystallized in the presence and absence of the substrate d,l-5-isopropyl hydantoin. Crystals of the SmeHyuA mutant suitable for data collection and structure determination were grown using the counter-diffusion method. X-ray data were collected to resolutions of 2.17 and 1.85 Å for the free and bound enzymes, respectively. Both crystals belong to space group R3 and contain two molecules of SmeHyuA per asymmetric unit. The crystals of the free and complexed SmeHyuA have unit-cell parameters a = b = 85.43, c = 152.37 Å and a = b = 85.69, c = 154.38 Å, crystal volumes per protein weight (V M ) of 1.94 and 1.98 Å 3 Da −1 and solvent contents of 36.7 and 37.9%, respectively

Rhizobium Impacts on Seed Productivity, Quality, and Protection of Pisum sativum upon Disease Stress Caused by Didymella pinodes: Phenotypic, Proteomic, and Metabolomic Traits

Directory of Open Access Journals (Sweden)

Nima Ranjbar Sistani

2017-11-01

Full Text Available In field peas, ascochyta blight is one of the most common fungal diseases caused by Didymella pinodes. Despite the high diversity of pea cultivars, only little resistance has been developed until to date, still leading to significant losses in grain yield. Rhizobia as plant growth promoting endosymbionts are the main partners for establishment of symbiosis with pea plants. The key role of Rhizobium as an effective nitrogen source for legumes seed quality and quantity improvement is in line with sustainable agriculture and food security programs. Besides these growth promoting effects, Rhizobium symbiosis has been shown to have a priming impact on the plants immune system that enhances resistance against environmental perturbations. This is the first integrative study that investigates the effect of Rhizobium leguminosarum bv. viceae (Rlv on phenotypic seed quality, quantity and fungal disease in pot grown pea (Pisum sativum cultivars with two different resistance levels against D. pinodes through metabolomics and proteomics analyses. In addition, the pathogen effects on seed quantity components and quality are assessed at morphological and molecular level. Rhizobium inoculation decreased disease severity by significant reduction of seed infection level. Rhizobium symbiont enhanced yield through increased seed fresh and dry weights based on better seed filling. Rhizobium inoculation also induced changes in seed proteome and metabolome involved in enhanced P. sativum resistance level against D. pinodes. Besides increased redox and cell wall adjustments light is shed on the role of late embryogenesis abundant proteins and metabolites such as the seed triterpenoid Soyasapogenol. The results of this study open new insights into the significance of symbiotic Rhizobium interactions for crop yield, health and seed quality enhancement and reveal new metabolite candidates involved in pathogen resistance.

Robustness encoded across essential and accessory replicons of the ecologically versatile bacterium Sinorhizobium meliloti

Science.gov (United States)

Walker, Graham C.; Finan, Turlough M.; Mengoni, Alessio; Griffitts, Joel S.

2018-01-01

Bacterial genome evolution is characterized by gains, losses, and rearrangements of functional genetic segments. The extent to which large-scale genomic alterations influence genotype-phenotype relationships has not been investigated in a high-throughput manner. In the symbiotic soil bacterium Sinorhizobium meliloti, the genome is composed of a chromosome and two large extrachromosomal replicons (pSymA and pSymB, which together constitute 45% of the genome). Massively parallel transposon insertion sequencing (Tn-seq) was employed to evaluate the contributions of chromosomal genes to growth fitness in both the presence and absence of these extrachromosomal replicons. Ten percent of chromosomal genes from diverse functional categories are shown to genetically interact with pSymA and pSymB. These results demonstrate the pervasive robustness provided by the extrachromosomal replicons, which is further supported by constraint-based metabolic modeling. A comprehensive picture of core S. meliloti metabolism was generated through a Tn-seq-guided in silico metabolic network reconstruction, producing a core network encompassing 726 genes. This integrated approach facilitated functional assignments for previously uncharacterized genes, while also revealing that Tn-seq alone missed over a quarter of wild-type metabolism. This work highlights the many functional dependencies and epistatic relationships that may arise between bacterial replicons and across a genome, while also demonstrating how Tn-seq and metabolic modeling can be used together to yield insights not obtainable by either method alone. PMID:29672509

Response of Phaseolus vulgaris cv. Mantequilla to inoculation of Rhizobium native strains of the Ecuador in greenhouse native races of the Ecuador

Directory of Open Access Journals (Sweden)

Klever Iván Granda Mora

2016-10-01

Full Text Available The development of biofertilizers based on Rhizobium strains for common bean (Phaseolus vulgaris L. requires studies about bacterial interaction with target cultivars. For these reason, the aim of this paper was to determine the effect of the inoculation of Rhizobium native strains, isolated from southern Ecuador, on P. vulgaris cultivar Mantequilla. An assay was performed in greenhouse. It were evaluated the parameters of nodulation, biomass, nitrogen fixation and efficiency of the symbiosis. All inoculated strains were able to nodulate bean seedlings. The total number of nodules, nodular biomass and plant biomass, were favourably affected by inoculation of Rhizobium strains. The best results were obtained with R. mesoamericanum NAM1, R. leguminosarum COL 6 and R. etli PIN 1 strains. The experimental evidences shows the potential of native strains of Rhizobium for it use as biofertilizers because they are able to raise the rates of nitrogen fixation in common bean in southern Ecuador.

Rhizobia from Lanzarote, the Canary Islands, that nodulate Phaseolus vulgars have characteristics in common with Sinorhizobium meliloti isolates from mainland Spain

Science.gov (United States)

Common bean and Medicago rhizobia isolated from five locations on the island of Lanzarote, the Canary Islands, by partial analysis of 10 chromosomal genes were shown to exhibit close similarity to Sinorhizobium meliloti. Several bean isolates from Lanzarote, mainland Spain and Tunisia nodulated Leu...

Pré-seleção de estirpes de Rhizobium sp. para amendoim Preliminary selection of peanut Rhizobium sp. strains

Directory of Open Access Journals (Sweden)

Antonio Roberto Giardini

1984-01-01

Full Text Available Um ensaio foi conduzido em casa de vegetação, com solução nutritiva isenta de N, com o objetivo de selecionar estirpes de Rhizobium eficientes fixadoras de N2, quando associadas com amendoim (Arachis hypogaea L. cultivar Tatu. Foram testadas 35 estirpes de Rhizobium sp., isoladas de quinze diferentes espécies de leguminosas tropicais, e incluído um tratamento de inoculação com solo previamente cultivado com amendoim. Das 35 estirpes testadas, doze formaram nódulos e, entre essas, sete foram eficientes fixadoras de nitrogênio. Das doze estirpes que nodularam, sete foram isoladas de leguminosas da tribo Hedysareae (à qual pertence o género Arachis e, destas, apenas quatro foram eficientes fixadoras de nitrogênio. O peso e o número de nódulos não se mostraram como critérios adequados para avaliação da eficiência.An experiment was carried out in Leonard jars, in the greenhouse, with nitrogen-free nutrient solution to test the efficiency of 35 strains of rhizobia isolated from 15 species of tropical legumes. Twelve of the tested strains were capable of nodule formation in peanut. Seven of those strains were isolated from the trible Hedysareae, which includes the genus Arachis. Only four of the rhizobia strains with inducing nodulation were effective. Dry weight and number of nodules were not good criteria for evaluating effectiveness.

Influence of a carbamate pesticide on growth, respiration (/sup 14/C)-carbon metabolism and symbiosis of a Rhizobium sp

Energy Technology Data Exchange (ETDEWEB)

Sekar, T; Balasubramanian, A [Tamil Nadu Agricultural Univ., Coimbatore (India)

1979-04-01

Addition of aldicarb (2 methyl-2(methyl thio) propionaldehyde-O-methyl carbamoyl oxime) in the growth medium enhanced the growth of Rhizobium sp. (cowpea group) at 2ppm level while an inhibition was observed at the normal (5 ppm) and higher (10 ppm) concentrations. Respiration of the cells was also inhibited by 5 and 10 ppm levels of the chemical eventhough a stimulation was observed at 2 ppm (lower) concentration. The insecticide, when incorporated at 5 and 10 ppm levels in the medium increased the /sup 14/C-glucose incorporation and considerably altered the assimilation of the radioactive carbon in different fractions of rhizobium cells. Soil application of this insecticide (Temik 10 G) reduced the number of nodules formed and the total nitrogen content in cowpea plants inoculated with the Rhizobium sp. but enhanced the dry matter production of cowpea plants.

The study of salinity and drought tolerance of Sinorhizobium meliloti isolated from province of Kerman in vivo condition

Directory of Open Access Journals (Sweden)

mahboobe abolhasani zeraatkar

2009-06-01

Full Text Available It is well known that the host plant inoculation by native strains with high efficiency has a positive effect on plant yield and biological nitrogen fixation process. The main aim of this investigation was to based on salinity and drought experiments, four isolates of Sinorhizobium meliloti (S27K and S36K tolerant isolates, S109K semi-sensitive isolate, S56K sensitive isolate were selected for plant inoculation which was under drought stress in greenhouse condition. This experiment was carried out by using a factorial model in completely randomized design. Results showed that inoculation of alfalfa plants with high salinity and drought tolerant of Sinorhizobium meliloti bacteria could increased biological nitrogen fixation process (symbiotic efficiency, percent crude protein and yield of alfalfa under salinity and drought conditions significantly. There were not any significant differences between S27K and S36K isolates and positive control (no nitrogen limitation. Symbiotic efficiency increased 3.4 times higher than alfalfa plants were inoculated by sensitive isolates S56K when alfalfa plants were inoculated by S27K and S36K isolates.

DEVELOPMENT OF PIGEON PEA INOCULATED WITH RHIZOBIUM ISOLATED FROM COWPEA TRAP HOST PLANTS

Directory of Open Access Journals (Sweden)

SALOMÃO LIMA GUIMARÃES

2016-01-01

Full Text Available Pigeon pea is an important protein source grown in several tropical and sub - tropical countries, and is considered a multi - purpose plant that is resistant to the conditions of the Brazilian Cerrado. Among the possible uses for cowpea, its use as a green manure, increasing soil nitrogen content through the association with diazotrophic bacteria, generically known as rhizobia, is noteworthy. The present work aimed to evaluate the efficiency of Rhizobium strains isolated from cowpea plants in the development of pigeon peas cultured in Red Latosol. The experiment was conducted in a greenhouse, using a completely randomized design with seven treatments and four replications. Treatments consisted of inoculation with four Rhizobium strains (MT8, MT15, MT16, and MT23 and one commercial inoculant comprising Bradyrhizobium spp. strains BR 2801 and BR 2003. There were two controls, one absolute (without inoculation or nitrogen fertilization and the other with nitrogen fertilization. Each experimental plot consisted of an 8 - dm 3 vase containing three plants. Analyzed variables included plant height, SPAD index, number and dry weight of nodules, and shoot and root dry masses. Pigeon peas responded significantly to inoculation treatment, since all the plants inoculated with Rhizobium strains isolated from cowpea strains showed results similar to plants in the nitrogen control and commercial inoculant treatments. This demonstrates a favorable plant – bacteria interaction, which can be utilized as an alternative nitrogen source for pigeon peas.

Phenotypic and molecular characterization of Rhizobium vitis strains from vineyards in Turkey

Directory of Open Access Journals (Sweden)

Didem CANIK OREL

2016-05-01

Full Text Available Crown gall-affected grapevine samples were collected during 2009–2010 from major vineyards, located in different Turkish provinces. One hundred and three bacterial strains were obtained from 88 vineyards and 18 grapevine varieties; they were tumorigenic when inoculated in tobacco, sunflower and Datura stramonium plants and were identified as Rhizobium vitis using biochemical and physiological tests as well as PCR and specific primers. Nineteen R. vitis strains presented a number of anomalous biochemical and physiological characters. PCR and opine-specific primers revealed the presence of octopine/cucumopine-type plasmid in 82 R. vitis strains, nopaline-type plasmids in 18 strains and vitopine-type plasmids in three strains. Clonal relationship of strains was determined using Pulsed Field Gel Electrophoresis following digestion of genomic DNA with the restriction endonuclease PmeI. The greatest genetic diversity was found for the strains from Denizli, Ankara and Nevşehir provinces. Nopaline and vitopine-types of Rhizobium vitis were detected for the first time in Turkey.

Succinoglycan Production Contributes to Acidic pH Tolerance in Sinorhizobium meliloti Rm1021.

Science.gov (United States)

Hawkins, Justin P; Geddes, Barney A; Oresnik, Ivan J

2017-12-01

In this work, the hypothesis that exopolysaccharide plays a role in the survival of Sinorhizobium meliloti at low pH levels is addressed. When S. meliloti was grown at pH 5.75, synthesis of succinoglycan increased, whereas synthesis of galactoglucan decreased. Succinoglycan that was isolated from cultures grown at low pH had a lower degree of polymerization relative to that which was isolated from cultures grown at neutral pH, suggesting that low-molecular weight (LMW) succinoglycan might play a role in adaptation to low pH. Mutants unable to produce succinoglycan or only able to produce high-molecular weight polysaccharide were found to be sensitive to low pH. However, strains unable to produce LMW polysaccharide were 10-fold more sensitive. In response to low pH, transcription of genes encoding proteins for succinoglycan, glycogen, and cyclic β(1-2) glucans biosynthesis increased, while those encoding proteins necessary for the biosynthesis of galactoglucan decreased. While changes in pH did not affect the production of glycogen or cyclic β(1-2) glucan, it was found that the inability to produce cyclic β(1-2) glucan did contribute to pH tolerance in the absence of succinoglycan. Finally, in addition to being sensitive to low pH, a strain carrying mutations in exoK and exsH, which encode the glycanases responsible for the cleavage of succinoglycan to LMW succinoglycan, exhibited a delay in nodulation and was uncompetitive for nodule occupancy. Taken together, the data suggest that the role for LMW succinoglycan in nodule development may be to enhance survival in the colonized curled root hair.

Comparative effectiveness of different Rhizobium sp. for improving growth and yield of maize (Zea mays L.

Directory of Open Access Journals (Sweden)

Ijaz Mehboob, Zahir Ahmad Zahir, Muhammad Arshad, Muhammad Khalid

2012-05-01

Full Text Available During the last couple of decades, it has been demonstrated that rhizobia can associate with roots of non-legumes also without forming true nodules, and can promote their growth by using one or more of the direct or indirect mechanisms of actions. This work examines the growth and yield responses of maize to inoculation with different species of rhizobia, isolated from the root nodules of chickpea (Cicer arietinum L., lentil (Lens culinaris M. and mung bean (Vigna radiata L. in pots and fields. Twenty isolates of rhizobia were isolated from root nodules each of mung bean, lentil and chickpea and were screened under axenic conditions. On the basis of their promising performance under axenic conditions, nine most efficient isolates (three from each legume host were selected, characterized and further evaluated for their growth promoting activities by conducting pot and field experiments. Results of pot experiment revealed that maximum increase in grain yield, 1000 grain weight, N, P and K uptake (up to 47.89, 54.52, 73.46, 84.66 and 59.19% by CRI28, respectively, over un-inoculated control was produced by the isolate of Mesorhizobium ciceri. Whereas, maximum improvement in rest of the parameters was caused by the isolates of Rhizobium phaseoli (i.e. fresh biomass, straw yield and root length up to 36.30% by A18, 25.46% by S6 and 81.89% by A18, respectively over un-inoculated control. Rhizobium leguminosarum isolates came out to be the least effective among the species tested. Similarly, all the selected isolates improved the growth and yield attributing parameters in fields as well but with varying capacity compared with un-inoculated control. The selected isolates of Mesorhizobium ciceri and Rhizobium phaseoli again remained superior compared to the isolates of Rhizobium leguminosarum under field conditions. The results of this study imply that rhizobium species had potential to promote growth and yield of maize but this technology should be

A global analysis of protein expression profiles in Sinorhizobium meliloti: discovery of new genes for nodule occupancy and stress adaptation.

Science.gov (United States)

Djordjevic, Michael A; Chen, Han Cai; Natera, Siria; Van Noorden, Giel; Menzel, Christian; Taylor, Scott; Renard, Clotilde; Geiger, Otto; Weiller, Georg F

2003-06-01

A proteomic examination of Sinorhizobium meliloti strain 1021 was undertaken using a combination of 2-D gel electrophoresis, peptide mass fingerprinting, and bioinformatics. Our goal was to identify (i) putative symbiosis- or nutrient-stress-specific proteins, (ii) the biochemical pathways active under different conditions, (iii) potential new genes, and (iv) the extent of posttranslational modifications of S. meliloti proteins. In total, we identified the protein products of 810 genes (13.1% of the genome's coding capacity). The 810 genes generated 1,180 gene products, with chromosomal genes accounting for 78% of the gene products identified (18.8% of the chromosome's coding capacity). The activity of 53 metabolic pathways was inferred from bioinformatic analysis of proteins with assigned Enzyme Commission numbers. Of the remaining proteins that did not encode enzymes, ABC-type transporters composed 12.7% and regulatory proteins 3.4% of the total. Proteins with up to seven transmembrane domains were identified in membrane preparations. A total of 27 putative nodule-specific proteins and 35 nutrient-stress-specific proteins were identified and used as a basis to define genes and describe processes occurring in S. meliloti cells in nodules and under stress. Several nodule proteins from the plant host were present in the nodule bacteria preparations. We also identified seven potentially novel proteins not predicted from the DNA sequence. Post-translational modifications such as N-terminal processing could be inferred from the data. The posttranslational addition of UMP to the key regulator of nitrogen metabolism, PII, was demonstrated. This work demonstrates the utility of combining mass spectrometry with protein arraying or separation techniques to identify candidate genes involved in important biological processes and niche occupations that may be intransigent to other methods of gene expression profiling.

Selection of Rhizobium strain from Wonogiri, Central Java on the growth of soybean (Glycine max L. on the sand sterile medium in greenhouse

Directory of Open Access Journals (Sweden)

SRI PURWANINGSIH

2005-07-01

Full Text Available An experiment on the selection of Rhizobium strain from Wonogiri, Central Java on the growth of soybean (Glycine max L. on the sand sterile medium in green house. The aim of the experiment the selection and potency of the Rhizobium strain to increase the growth of soybean. The experiment was carried out in green house condition in Microbiology Division, Research Center for Biology-LIPI with sterile sand medium. The research design was Completely Randomized Design with three replications for each treatment. The Rhizobium strains used were 1 W (isolated from bean, Vigna radiata, 2 W (isolated from soybean, 3 W (isolated from bean, 4 W (isolated from soybean, 5 W (isolated from soybean, 6 W (isolated from peanut, Arachis hypogaea, 7 W (isolated from peanut, 8 W (isolated from peanut, the controls were uninoculated with Rhizobium strain and without urea fertilizer (K1, uninoculated and with urea fertilizer equal 100 kg/ha (K2. The plants were harvested after 50 days, the variable of investigation were the dry weight of canopy, roots, nodules root, total plants, number of nodules and ‘symbiotic capacity”. The results showed that all of experiment plant which be inoculated with Rhizobium able to form nodule. Strain of 2 W (isolated from soybean has given the best effects on the growth of soybean.

The symbiosis between Rhizobium leguminosarum and Pisum sativum : regulation of the nitrogenase activity

NARCIS (Netherlands)

Appels, M.A.

1989-01-01

Bacteria of the genus Rhizobium can form a symbiosis with plants of the family Leguminosae. Both bacteria and plant show considerable biochemical and morphological changes in order to develop and carry out the symbiosis. The Rhizobia

Diversity of root nodule bacteria from leguminous crops

Directory of Open Access Journals (Sweden)

Agrawal Pooja

2016-01-01

Full Text Available In the present study, a total of 353 nodule-associated bacteria were isolated from 220 legume plant samples belonging to Cicer arietinum (85, Glycine max (74, Vigna radiata (21 and Cajanus cajan (40. A total of 224 bacteria were identified as fast-growing Rhizobium spp. on the basis of differential staining (Gram staining and carbol fuchsin staining and biochemical tests. All the isolates were tested for indole acetic acid production (IAA, phosphate solubilization and siderophore production on plate assay. To examine the effect of volatile organic metabolites (VOM and water soluble soil components (WSSC on nodule bacteria, culture conditions were optimized by observing the effects of various parameters such as pH, salt content and temperatures on the growth of bacteria. Selected rhizobia were subjected to random amplified polymorphic DNA (RAPD and amplified ribosomal DNA restriction analysis (ARDRA analysis to identify their species. On the basis of RAPD and ARDRA, 10 isolates were identified as Rhizobium meliloti. In this study, Rhizobium GO4, G16, G20, G77, S43, S81, M07, M37, A15 and A55 were observed as the best candidates among the tested bacteria and can be further used as potent bioinoculants.

Inoculation of the nonlegume Capsicum annuum (L.) with Rhizobium strains. 1. Effect on bioactive compounds, antioxidant activity, and fruit ripeness.

Science.gov (United States)

Silva, Luís R; Azevedo, Jessica; Pereira, Maria J; Carro, Lorena; Velazquez, Encarna; Peix, Alvaro; Valentão, Patrícia; Andrade, Paula B

2014-01-22

Pepper (Capsicum annuum L.) is an economically important agricultural crop and an excellent dietary source of natural colors and antioxidant compounds. The levels of these compounds can vary according to agricultural practices, like inoculation with plant growth-promoting rhizobacteria. In this work we evaluated for the first time the effect of the inoculation of two Rhizobium strains on C. annuum metabolites and bioactivity. The results revealed a decrease of organic acids and no effect on phenolics and capsaicinoids of leaves from inoculated plants. In the fruits from inoculated plants organic acids and phenolic compounds decreased, showing that fruits from inoculated plants present a higher ripeness stage than those from uninoculated ones. In general, the inoculation with Rhizobium did not improve the antioxidant activity of pepper fruits and leaves. Considering the positive effect on fruit ripening, the inoculation of C. annuum with Rhizobium is a beneficious agricultural practice for this nonlegume.

VARIATION IN RHIZOBIUM GROWTH DUE TO SEED AND ROOT EXUDATES RELEASED FROM GAMMA IRRADIATED GLYCINE MAX SEEDS

International Nuclear Information System (INIS)

KAMEL, H.A.; ASKER, M.M.S

2008-01-01

In this study, seeds of Glycine max Giza 122 were irradiated with gamma rays from 60 Co source at various doses (10 to 200 Gy), sterilized and soaked into an aerated solution of CaSO 4 (1 mmol and pH 6.5). The capacities of the released seed exudates (SEs) and root exudates (REs) to promote Rhizobium leguminosarum growth were investigated as well as biochemical analysis of the exudates was carried out. SE of both control and gamma irradiated seeds resulted in a higher Rhizobium population and polysaccharide production than RE. Relative to control, the highly effective doses in Rhizobium growth and polysaccharide production were 25 and 200 Gy; the former was a promoter while the later was an inhibitor. HPLC analysis of soluble carbohydrates revealed the presence of glucose (Glu), rhamnose (Rha) and fructose (Fru) in the SE and RE. Protein content in SE was lower than that in RE; the highest values were due to 10 Gy and 25 Gy in SE and RE, respectively. Free amino acids content in SE was increased up to 25 Gy then decreased while RE was increased by increasing gamma doses from 10 to 200 Gy

Cultivar and Rhizobium Strain Effects on the Symbiotic Performance of Pea (Pisum sativum)

DEFF Research Database (Denmark)

Skøt, Leif

1983-01-01

The symbiotic performance of four pea (Pisum sativum L.) cultivars in combination with each of four strains of Rhizobium leguminosarum was studied in growth chamber experiments in order to estimate the effects of cultivars, strains and cultivar × strain interaction on the variation in dry weight, N...

Rhizoplane colonisation of peas by Rhizobium leguminosarum bv. viceae and a deleterious Pseudomonas putida

NARCIS (Netherlands)

Berggren, I.; Alstrom, S.; Vuurde, van J.W.L.; Martensson, A.M.

2005-01-01

Pseudomonas putida strain angstrom 313, a deleterious rhizosphere bacterium, reduced pea nitrogen content when inoculated alone or in combination with Rhizobium leguminosarum bv. viceae on plants in the presence of soil under greenhouse conditions. When plants were grown gnotobiotically in liquid

Energy supply for dinitrogen fixation by Azotobacter vinelandii and by bacteroids of Rhizobium leguminosarum

NARCIS (Netherlands)

Laane, N.C.M.

1980-01-01

The central issue of this thesis is how obligate aerobes, such as Rhizobium leguminosarum bacteroids and Azotobacter vinelandii, generate and regulate the energy supply (in the form of ATP and reducing equivalents) for nitrogenase.
In an effective

The DivJ, CbrA and PleC system controls DivK phosphorylation and symbiosis in Sinorhizobium meliloti

Science.gov (United States)

Pini, Francesco; Frage, Benjamin; Ferri, Lorenzo; De Nisco, Nicole J.; Mohapatra, Saswat S.; Taddei, Lucilla; Fioravanti, Antonella; Dewitte, Frederique; Galardini, Marco; Brilli, Matteo; Villeret, Vincent; Bazzicalupo, Marco; Mengoni, Alessio; Walker, Graham C.; Becker, Anke; Biondi, Emanuele G.

2013-01-01

SUMMARY Sinorhizobium meliloti is a soil bacterium that invades the root nodules it induces on Medicago sativa, whereupon it undergoes an alteration of its cell cycle and differentiates into nitrogen-fixing, elongated and polyploid bacteroid with higher membrane permeability. In Caulobacter crescentus, a related alphaproteobacterium, the principal cell cycle regulator, CtrA, is inhibited by the phosphorylated response regulator DivK. The phosphorylation of DivK depends on the histidine kinase DivJ, while PleC is the principal phosphatase for DivK. Despite the importance of the DivJ in C. crescentus, the mechanistic role of this kinase has never been elucidated in other Alphaproteobacteria. We show here that the histidine kinases DivJ together with CbrA and PleC participate in a complex phosphorylation system of the essential response regulator DivK in S. meliloti. In particular, DivJ and CbrA are involved in DivK phosphorylation and in turn CtrA inactivation, thereby controlling correct cell cycle progression and the integrity of the cell envelope. In contrast, the essential PleC presumably acts as a phosphatase of DivK. Interestingly, we found that a DivJ mutant is able to elicit nodules and enter plant cells, but fails to establish an effective symbiosis suggesting that proper envelope and/or low CtrA levels are required for symbiosis. PMID:23909720

Genomic resources for identification of the minimal N2 -fixing symbiotic genome.

Science.gov (United States)

diCenzo, George C; Zamani, Maryam; Milunovic, Branislava; Finan, Turlough M

2016-09-01

The lack of an appropriate genomic platform has precluded the use of gain-of-function approaches to study the rhizobium-legume symbiosis, preventing the establishment of the genes necessary and sufficient for symbiotic nitrogen fixation (SNF) and potentially hindering synthetic biology approaches aimed at engineering this process. Here, we describe the development of an appropriate system by reverse engineering Sinorhizobium meliloti. Using a novel in vivo cloning procedure, the engA-tRNA-rmlC (ETR) region, essential for cell viability and symbiosis, was transferred from Sinorhizobium fredii to the ancestral location on the S. meliloti chromosome, rendering the ETR region on pSymB redundant. A derivative of this strain lacking both the large symbiotic replicons (pSymA and pSymB) was constructed. Transfer of pSymA and pSymB back into this strain restored symbiotic capabilities with alfalfa. To delineate the location of the single-copy genes essential for SNF on these replicons, we screened a S. meliloti deletion library, representing > 95% of the 2900 genes of the symbiotic replicons, for their phenotypes with alfalfa. Only four loci, accounting for < 12% of pSymA and pSymB, were essential for SNF. These regions will serve as our preliminary target of the minimal set of horizontally acquired genes necessary and sufficient for SNF. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.

Interaction Between the Biotin Carboxyl Carrier Domain and the Biotin Carboxylase Domain in Pyruvate Carboxylase from Rhizobium etli†

Science.gov (United States)

Lietzan, Adam D.; Menefee, Ann L.; Zeczycki, Tonya N.; Kumar, Sudhanshu; Attwood, Paul V.; Wallace, John C.; Cleland, W. Wallace; Maurice, Martin St.

2011-01-01

Pyruvate carboxylase (PC) catalyzes the ATP-dependent carboxylation of pyruvate to oxaloacetate, an important anaplerotic reaction in mammalian tissues. To effect catalysis, the tethered biotin of PC must gain access to active sites in both the biotin carboxylase domain and the carboxyl transferase domain. Previous studies have demonstrated that a mutation of threonine 882 to alanine in PC from Rhizobium etli renders the carboxyl transferase domain inactive and favors the positioning of biotin in the biotin carboxylase domain. We report the 2.4 Å resolution X-ray crystal structure of the Rhizobium etli PC T882A mutant which reveals the first high-resolution description of the domain interaction between the biotin carboxyl carrier protein domain and the biotin carboxylase domain. The overall quaternary arrangement of Rhizobium etli PC remains highly asymmetrical and is independent of the presence of allosteric activator. While biotin is observed in the biotin carboxylase domain, its access to the active site is precluded by the interaction between Arg353 and Glu248, revealing a mechanism for regulating carboxybiotin access to the BC domain active site. The binding location for the biotin carboxyl carrier protein domain demonstrates that tethered biotin cannot bind in the biotin carboxylase domain active site in the same orientation as free biotin, helping to explain the difference in catalysis observed between tethered biotin and free biotin substrates in biotin carboxylase enzymes. Electron density located in the biotin carboxylase domain active site is assigned to phosphonoacetate, offering a probable location for the putative carboxyphosphate intermediate formed during biotin carboxylation. The insights gained from the T882A Rhizobium etli PC crystal structure provide a new series of catalytic snapshots in PC and offer a revised perspective on catalysis in the biotin-dependent enzyme family. PMID:21958016

The beneficial effect of dual inoculation of vesicular-arbuscular mycorrhizae + rhizobium on growth of white clover

Directory of Open Access Journals (Sweden)

Lin, XG.

1993-01-01

Full Text Available Investigation on the effect of phosphorus on vesicular-arbuscular mycorrhizal infection, and dual inoculation of vesicular-arbuscular mycorrhizae + rhizobium on growth of white clover under field microplots and pot experiments was conducted on fluvo-aquic soils of semi-arid region in north China. The results showed that 60 kg P205 ha in form of superphosphate was the most favorable phosphorus level for vesicular-arbuscular mycorrhizal infection ; mycorrhizal infection, nodulation, dry weight of shoots and roots, total uptake of nitrogen, phosphorus and other elements, the final yields and recovery of phosphorus of white clover were significantly increased by vesicular-arbuscular mycorrhizal inoculation and dual inoculation with vesicular-arbuscular mycorrhizal fungi and rhizobium. The highest response of inoculation was obtained by adding fertilizer phosphorus at the level of 60 kg P205 ha in form of superphosphate.

Effet de la co-inoculation du rhizobium et de mycorhizes sur les ...

African Journals Online (AJOL)

SARAH

30 déc. 2013 ... RÉSUMÉ. Objectif : Les sols sahéliens se caractérisent par une faible fertilité dont l'amélioration se fait par la pratique de la jachère ou l'apport du fumier. La fixation de l'azote atmosphérique par certaines légumineuses est peu performante voir inefficace. De nos jours, l'inoculation de rhizobium et de ...

Visualization of Nodulation Gene Activity on the Early Stages of Rhizobium leguminosarum bv. viciae Symbiosis

Czech Academy of Sciences Publication Activity Database

Chovanec, Pavel; Novák, Karel

2005-01-01

Roč. 50, č. 4 (2005), s. 323-331 ISSN 0015-5632 R&D Projects: GA ČR GA521/03/0192 Institutional research plan: CEZ:AV0Z50200510 Keywords : nodulation * rhizobium leguminosarum * vicia tetrasperma Subject RIV: EE - Microbiology, Virology Impact factor: 0.918, year: 2005

Efficacy of wild plant in combination with microbial antagonists for the control of root rot fungi on mungbean and cowpea

International Nuclear Information System (INIS)

Ikram, N.; Dawar, S.

2015-01-01

Present work was carried out to investigate the efficacy of Aerva javanica in combination with different microbial antagonists namely Rhizobium meliloti, Pseudomonas aeruginosa, Trichoderma harzianum and Aspergillus niger. Soil amended with A. javanica stem, leaves, flower powder at the rate1% w/w and seeds of cowpea (Vigna unguiculata L.) and mungbean (Vigna radiata L.) were coated with microbial antagonists for the control of root infecting fungi like Macrophomina phaseolina (Tassi) Goid, Fusarium spp. and Rhizoctonia solani Kiihn. Infection of M. phaseolina and R. solani were completely suppressed when seeds were coated with P. aeruginosa, T. harzianum, A. niger, R. meliloti and A. javanica leaves powder mixed in soil at the rate 1% w/w. All antagonists showed reduction in combination with A. javanica leaves powder at the rate1% but T. harzianum and P. aeruginosa in combination with A. javanica leaves showed promising results in complete reduction of R. solani and M. phaseolina on both crops. All growth parameters were maximum when soil was amended with A. javanica leaves powder at the rate 1% w/w and seeds were coated with T. harzianum and P. aeruginosa. (author)

Diversity and numbers of root-nodule bacteria (rhizobia in Polish soils

Directory of Open Access Journals (Sweden)

Stefan Martyniuk

2011-01-01

Full Text Available Using a sand pouch-plant infection method, populations of several species of root-nodule bacteria (rhizobia were enumerated in eighty soils collected throughout Poland. Rhizobium leguminosarum bv. viciae (symbionts of pea, faba bean, vetch and R. leguminosarum bv. trifolii (symbionts of clover were detected in 77 and 76 soils, respectively. Most of these soils contained moderate and high numbers of these species of the rhizobia. Symbionts of beans, R. leguminosarum bv. phaseoli, were assessed in 76 soils; of this number 15 soils had no detectable populations of bean rhizobia and in 40 soils high or moderate numbers of these bacteria were found. Bradyrhizobium sp. (Lupinus, root-nodule bacteria of lupine and serradella, were absent in 19 soils, out of 80 tested, and 34 soils were colonised by high or moderate populations of bradyrhizobia. Sinorhizobium meliloti, rhizobia nodulating alfalfa, were sparse in the examined soils; with 56 soil containing no detectable numbers of S. meliloti and only 6 soils harbouring high or moderate populations of this species. The estimated numbers of the rhizobia in the studied soils were also related to some physical and chemical properties of these soils.

Study on rhizobium interaction with osmoprotectant rhizobacteria for improving mung bean yield

Science.gov (United States)

Maryani, Y.; Sudadi; Dewi, W. S.; Yunus, A.

2018-03-01

Gunungkidul has calcareous soil with limitations including calcareous stone, mostly hilly terrain, and shallow cultivated layer. Furthermore, nowadays we face the disadvantages climates such as long dry seasons, a short rainy season and high temperatures caused by climate change. Climate change leads to irregular rainwater availability for microbes and crops. Research in this field is currently needed as climate change affected directly on crop production, while we need to find the strategy to keep high productivity of the plant. This research aimed to determine the ability of osmoprotectant rhizobacteria and rhizobium to support mung bean yield. Osmoprotectant rhizobacteria were isolated and screened from the calcareous soil in Gunungkidul with disadvantageous climates such as a long dry season, a short rainy season and high temperature. This research was arranged in Completely Randomized Design. The result showed that osmoprotectant rhizobacteria isolate of strain Al24-k and Ver5-k can produce 9.6306 mg g‑1 cell of glycine betaine in a soil density 1.7667 x 107 CFU g‑1 and 11.4870 mg g‑1 cell of glycine betaine in a soil density 1.9667 x 107 CFU g‑1. Inoculation of isolates osmoprotectant rhizobacteria can support mung bean yield. Osmoprotectant rhizobacteria isolate did not effect rhizobium in mung bean rhizosphere.

A Legume TOR Protein Kinase Regulates Rhizobium Symbiosis and Is Essential for Infection and Nodule Development.

Science.gov (United States)

Nanjareddy, Kalpana; Blanco, Lourdes; Arthikala, Manoj-Kumar; Alvarado-Affantranger, Xóchitl; Quinto, Carmen; Sánchez, Federico; Lara, Miguel

2016-11-01

The target of rapamycin (TOR) protein kinase regulates metabolism, growth, and life span in yeast, animals, and plants in coordination with nutrient status and environmental conditions. The nutrient-dependent nature of TOR functionality makes this kinase a putative regulator of symbiotic associations involving nutrient acquisition. However, TOR's role in these processes remains to be understood. Here, we uncovered the role of TOR during the bean (Phaseolus vulgaris)-Rhizobium tropici (Rhizobium) symbiotic interaction. TOR was expressed in all tested bean tissues, with higher transcript levels in the root meristems and senesced nodules. We showed TOR promoter expression along the progressing infection thread and in the infected cells of mature nodules. Posttranscriptional gene silencing of TOR using RNA interference (RNAi) showed that this gene is involved in lateral root elongation and root cell organization and also alters the density, size, and number of root hairs. The suppression of TOR transcripts also affected infection thread progression and associated cortical cell divisions, resulting in a drastic reduction of nodule numbers. TOR-RNAi resulted in reduced reactive oxygen species accumulation and altered CyclinD1 and CyclinD3 expression, which are crucial factors for infection thread progression and nodule organogenesis. Enhanced expression of TOR-regulated ATG genes in TOR-RNAi roots suggested that TOR plays a role in the recognition of Rhizobium as a symbiont. Together, these data suggest that TOR plays a vital role in the establishment of root nodule symbiosis in the common bean. © 2016 American Society of Plant Biologists. All Rights Reserved.

Intensity of Ground Cover Crop Arachis pintoi, Rhizobium Inoculation and Phosphorus Application and Their Effects on Field Growth and Nutrient Status of Cocoa Plants

Directory of Open Access Journals (Sweden)

John Bako Baon

2006-08-01

Full Text Available Arachis pintoiis potentially as a cover crop for cocoa (Theobroma cacaoL. farm, however information regarding its effect on the growth of cocoa plants in the field is very limited. The objective of this experiment is to investigate the combined influence of ground cover crop A. pintoi, rhizobial bacterial inoculation and phosphorus (P fertilizer on the growth of cocoa in the field and nutrient status. This experiment laid out in split-split plot design consisted of three levels of cover crop (without, A. pintoiand Calopogonium caeruleum, two levels of rhizobium inoculation (not inoculated and inoculated and two levels of phosphorus application (no P added and P added. The results showed that in field condition the presence of A. pintoias cover crop did not affect the growth of cocoa. On the other hand, C. caeruleumas cover crop tended to restrict cocoa growth compared to A. pintoi. Application of P increased leaf number of cocoa plant. Biomass production of A. pintoiwas 40% higher than C. caeruleum. Soil organic carbon and nitrogen contents were not affected by ground cover crops, though higher value (0.235% N and 1.63% organic C was obtained from combined treatments of inoculation and P addition or neither inoculation nor P addition. In the case of no rhizobium inoculation, soil N content in cocoa farm with A. pintoicover crop was lower than that of without cover crop or with C. caeruleum. Cover crop increased plant N content when there was no inoculation, on the other hand rhizobium inoculation decreased N content of cocoa tissue. Tissue P content of cocoa plant was not influenced by A. Pintoicover crop or by rhizobium inoculation, except that the P tissue content of cocoa was 28% higher when the cover crop was C. caeruleumand inoculated. Key words : Arachis pintoi, Theobroma cacao, Calopogonium caeruleum, rhizobium, nitrogen, phosphorus.

Symbiont effect of Rhizobium bacteria and vesicular arbuscular mycorrhizal fungi on Pisum sativum in recultivated mine spoils

Energy Technology Data Exchange (ETDEWEB)

Biro, B.; Voros, I.; Kovespechy, K.; Szegi, J. (Hungarian Academy of Sciences, Budapest (Hungary). Soil Science and Agricultural Chemistry Research Institute)

The frequency (F%) of spontaneous endomycorrhizal fungal infection (AMF) and the root modulation of Pisum sativum L, was studied after 8 and 15 years of recultivation in 4 soils (andesitic tuff yellow sand, yellow clay, and grey clay) disturbed by mining activities. The effects of Rhizobium inoculation and the interaction of both microsymbionts with plant production were also examined along with humus content and the humus stability coefficient, in the following variations: control, NPK fertilizer, NPK+lignite, NPK+straw and sewage sludge. Dump spoils originating from deep geological layers were poor in organic materials. After 12 years of recultivation, the humus content increased significantly. No such increase was noted in grey clay and the natural, brown forest soil used as an undisturbed (control) sample. The degradation of soils by mining brings about a decrease in the rhizobial and mycorrhizal population, so the number of spontaneous Rhizobium nodules is relatively low and does not influence the yield of peas. Inoculation with a selected effective strain of Rhizobium leguminosarum bv. viceae, however, enhanced dry matter production in these microbiologically degraded soils. Although the frequency of AMF infection was also higher after rhizobial inoculation, no positive correlation was found between dry matter production of peas and the F% of AMF. Spoils treated with lignite, straw, and sewage sludge had an especially high level of spontaneous mycorrhizal populations, indicating that organic materials had a favorable effect on the recultivation processes and fertility of mine spoils.

Azospirillum IV

International Nuclear Information System (INIS)

Klingmuller, W.

1988-01-01

This book's contents include: Advances in the genetics of Azospirillum brasilense Sp7: Use of Tn5 mutagenesis for gene mapping and identification; Characterization of DNA segments adjacent to the nifHDK genes of Azospirillum brasilense by Sp7 Tn5 site-directed mutagenesis; Selection at the chemostat of Azospirillum brasilense Cd N 2 -fixing at high O 2 pressure. Root hair deformation induced on maize and medicago by an Azospirillum transconjugant containing a Rhizobium meliloti nodulation region. Azospirilla are bacteria that live in association with the roots of many grain crops. Since these bacteria bind molecular nitrogen from the air and excrete plant growth substances, interest has focussed on their potential to increase crop yields

Genomic characterization of Ensifer aridi, a proposed new species of nitrogen-fixing rhizobium recovered from Asian, African and American deserts.

Science.gov (United States)

Le Quéré, Antoine; Tak, Nisha; Gehlot, Hukam Singh; Lavire, Celine; Meyer, Thibault; Chapulliot, David; Rathi, Sonam; Sakrouhi, Ilham; Rocha, Guadalupe; Rohmer, Marine; Severac, Dany; Filali-Maltouf, Abdelkarim; Munive, Jose-Antonio

2017-01-14

Nitrogen fixing bacteria isolated from hot arid areas in Asia, Africa and America but from diverse leguminous plants have been recently identified as belonging to a possible new species of Ensifer (Sinorhizobium). In this study, 6 strains belonging to this new clade were compared with Ensifer species at the genome-wide level. Their capacities to utilize various carbon sources and to establish a symbiotic interaction with several leguminous plants were examined. Draft genomes of selected strains isolated from Morocco (Merzouga desert), Mexico (Baja California) as well as from India (Thar desert) were produced. Genome based species delineation tools demonstrated that they belong to a new species of Ensifer. Comparison of its core genome with those of E. meliloti, E. medicae and E. fredii enabled the identification of a species conserved gene set. Predicted functions of associated proteins and pathway reconstruction revealed notably the presence of transport systems for octopine/nopaline and inositol phosphates. Phenotypic characterization of this new desert rhizobium species showed that it was capable to utilize malonate, to grow at 48 °C or under high pH while NaCl tolerance levels were comparable to other Ensifer species. Analysis of accessory genomes and plasmid profiling demonstrated the presence of large plasmids that varied in size from strain to strain. As symbiotic functions were found in the accessory genomes, the differences in symbiotic interactions between strains may be well related to the difference in plasmid content that could explain the different legumes with which they can develop the symbiosis. The genomic analysis performed here confirms that the selected rhizobial strains isolated from desert regions in three continents belong to a new species. As until now only recovered from such harsh environment, we propose to name it Ensifer aridi. The presented genomic data offers a good basis to explore adaptations and functionalities that enable them

Effectiveness and competing capacity of native Rhizobium strains evaluated in IX Region soils

International Nuclear Information System (INIS)

Barrientos D, Leticia; Mendez A, Edith; Pino N, Ines

1995-01-01

Symbiotic nitrogen fixation in legumes reaches its optimum when the host plants are nodulated by highly competitive and effective Rhizobium strains. With the purpose of assessing competition and nitrogen fixing capacity of native Rhizobium leguminosarum bio-var trifolii strains, a greenhouse test was carried out using white clover (Trifolium re-pens) and four kinds of soils, which represent the main agroecological areas of the IX Region. Eleven strains were evaluated, they were both native and collected and were streptomycin sulphate antibiotic resistant. A nitrogen and a nitrogen-less without inoculation testers were used as controls. All pots received a solution of ammonium sulphate marked with 10% 15 N a.e, equivalent to 10 kg ha -1 of N. Rye-grass was used as reference crop, cv. Nu-i. In general, the evaluated strains were very efficient. After three or four cuts they became the only source of nitrogen for the plants. They were also very competitive, getting to over 70% of root infection with regard to those present in soils. In Curacautin and Tolten soils, biological nitrogen fixation begins later than other soils evaluated, which is coincident with soils having a higher nitrogen content. Symbiosis occurs when the soil nitrogen content exhausts or diminishes. (author)

Assessment of Qualitative and Quantitative Characters of Two Persian Clover Ecotypes Inoculated by Rhizobium leguminosarum biovartrifoli and Pesudomonas putida Bacteria

Directory of Open Access Journals (Sweden)

R Azamei

2016-02-01

Full Text Available Introduction Over the past decades, world attitude has changed towards the reduction of environmental pollutants. Harmful effects of synthetic fertilizers on environment have been identified. Bio-fertilizers are not harmful to the environment, but also they have favorable effects on plant growth processes. Soil biotechnology can be defined as the study of soil organisms and their metabolic processes which may have positive effects on plant yields. The main goal of this study is to asess the biotechnology fertilizers beneficial effects on soil organisms and their subsequently to maximize the yield. It is also our desire conside the soil quality, hygiene and environmental protection along this process. Among the strain of nitrogen-fixing bacteria, symbiotic bacteria such as rhizobium bacteria are important and essential in planning the sustainable farming systems. Several studies have shown that crop varieties which inoculated with rhizobium and pseudomonas were superior in yield production and performance. Material and Methods An experiment was designed as factorial performed in randomized complete block design (RCBD with three replications in Agricultural Research Center of Golpayegan (Isfahan during 2010 – 2011. the purpose of this study was to evaluate the effects of inoculation of two ecotypes of Persian clover by various strains of Rhizobium leguminosarum. Biovar trifoli bacteria accompanied with plant growth promoting rhizobacteria (PGPR Pseudomonas putida was employed to find certain qualitative and quantitative characteristics of clover yield, The main plots included two local ecotypes of Persian clover; Arak Haft Chin (V1 and Isfahan Haft Chin (V2, the subplots included inoculation by two strain of Rhizobium; Rb-3, Rb-13 and one strain of Pseudomonas; PS -168.4 cuts were performed during the experiment and 60 kg/ha seed was used for cultivation based on local knowledge. According to recommendations of the Institute of Soil and Water

Identificación y Caracterización de Cepas Nativas de Rhizobium en la Provincia de Santa Elena.

Directory of Open Access Journals (Sweden)

Javier Soto

2015-10-01

Full Text Available En los sistemas agrícolas de subsistencia, el nitrógeno es un macronutriente esencial para el buen desarrollo de las plantas; es utilizado en forma de nitrato o amonio. Las bacterias del género Rhizobium poseen la capacidad de fijar el nitrógeno, mediante una relación de simbiosis con leguminosas e influyen en la producción de sustancias promotoras de crecimiento en las plantas no leguminosas. En la península de Santa Elena no existen evidencias del uso y aplicación de biofertilizantes de origen microbiano nativo, por lo que el presente trabajo tuvo como objetivo caracterizar y seleccionar cepas del género Rhizobium procedentes de los nódulos de leguminosas de dos zonas de la provincia de Santa Elena. Los experimentos Aislamiento, identificación y caracterización bioquímica de cepas de Rhizobium encontradas en diferentes zonas de la península de Santa Elena comprende: a Estudio de la morfología nodular de leguminosas; b Presencia de la enzima Leghemoglobina en los nódulos, c Aislamiento de microorganismos de los nódulos de leguminosas, d Respuesta de la enzima catalasa ante el peróxido de hidrógeno, e Crecimiento en diferentes fuentes de carbono , f Crecimiento en tres porcentajes cloruro de sodio; y e Producción de 3-ketolactasa en agar LLA para descartar contaminantes frecuentes como Agrobacterium.

A Legume TOR Protein Kinase Regulates Rhizobium Symbiosis and Is Essential for Infection and Nodule Development1[OPEN

Science.gov (United States)

Blanco, Lourdes; Quinto, Carmen

2016-01-01

The target of rapamycin (TOR) protein kinase regulates metabolism, growth, and life span in yeast, animals, and plants in coordination with nutrient status and environmental conditions. The nutrient-dependent nature of TOR functionality makes this kinase a putative regulator of symbiotic associations involving nutrient acquisition. However, TOR’s role in these processes remains to be understood. Here, we uncovered the role of TOR during the bean (Phaseolus vulgaris)-Rhizobium tropici (Rhizobium) symbiotic interaction. TOR was expressed in all tested bean tissues, with higher transcript levels in the root meristems and senesced nodules. We showed TOR promoter expression along the progressing infection thread and in the infected cells of mature nodules. Posttranscriptional gene silencing of TOR using RNA interference (RNAi) showed that this gene is involved in lateral root elongation and root cell organization and also alters the density, size, and number of root hairs. The suppression of TOR transcripts also affected infection thread progression and associated cortical cell divisions, resulting in a drastic reduction of nodule numbers. TOR-RNAi resulted in reduced reactive oxygen species accumulation and altered CyclinD1 and CyclinD3 expression, which are crucial factors for infection thread progression and nodule organogenesis. Enhanced expression of TOR-regulated ATG genes in TOR-RNAi roots suggested that TOR plays a role in the recognition of Rhizobium as a symbiont. Together, these data suggest that TOR plays a vital role in the establishment of root nodule symbiosis in the common bean. PMID:27698253

[Effect of indolylacetic acid on formation of bacteroid forms of Rhizobium leguminosarum].

Science.gov (United States)

Lobanok, E V; Bakanchikova, T I

1979-01-01

The purpose of this work was to study the effect of indolylacetic acid (IAA) on the strains of Rhizobium leguminosarum, effective and noneffective with respect to symbiotic nitrogen fixation (L4 and 245a, and 14--73, respectively). IAA at a concentration of 50 mcg/ml and higher inhibited the growth of the bacterium, temporarily delayed celular division, and induced intensive formation of elongated bacteroid-like cells, predominantly Y-shaped or having a clavate shape. Many bacteroid-like cells were capable of division after a certain delay.

Differences between strains of Rhizobium in sensitivity to canavanine

Energy Technology Data Exchange (ETDEWEB)

Weaks, T E [Marshall Univ., Huntingdon, West Virginia (USA). Dept. of Biological Sciences

1977-11-01

Four strains of rhizobia that nodulate canavanine-synthesizing legumes and four strains that nodulate noncanavanine-synthesizing legumes were tested for sensitivity to L-canavanine. The effect of canavanine on growth depends upon the strain of Rhizobium tested rather than the canavanine synthesizing capability of the host legume. In both groups of rhizobia, some strains were inhibited in growth by canavanine. Canavanine enhancement of growth was observed in rhizobia that nodulate noncanavanine-synthesizing legumes. Canavanine was found to enhance the incorporation of /sup 3/H-uridine and /sup 3/H-L-leucine into trichloroacetic acid insoluble fractions of starved cells of two strains of rhizobia tested. This demonstrated that under certain conditions, some rhizobia can detoxify canavanine and utilize it in synthetic processes.

PERANAN FUNGI MIKORIZA ARBUSKULA, MIKROORGANISME PELARUT FOSFAT, RHIZOBIUM SP DAN ASAM HUMIK UNTUK MENINGKATKAN PERTUMBUHAN DAN PRODUKTIVITAS LEGUM Calopogonium mucunoides PADA TANAH LATOSOL DAN TAILING TAMBANG EMAS DI PT. ANEKA TAMBANG

Directory of Open Access Journals (Sweden)

- Karti

2014-06-01

Full Text Available Latosols soil conditions are poor in nutrients and tailing of gold mine contain heavy metal causes low productivity of forage. The objective of this research to study the best combination of soil potential microorganisms and soil conditioner that can promote the growth and production of legume crops Calopogonium mucunoides Desv. Seven treatments used were A: control, B: arbuscular mycorrhizal fungi (AMF, C: AMF + Rhizobium, D: AMF + Phosphate Solubilizing Bacteria (BPF, E: AMF + Humic Acid, F: AMF + BPF + Rhizobium, G: AMF + BPF + Humic Acid + Rhizobium. Variables measured were the root dry weight, shoot dry weight, spread length, number of trifoliate leaves, the number of active root nodules, the percentage of root infection. Augmentation of soil microorganisms and soil conditioner not effective enough to improve plant growth of Calopogonium mucunoides Desv because plants can still adapt and grow well on latosols. Plants grown on tailings provide the best response is G (AMF+ Humic Acid + Rhizobium, although the rate of growth is not as good as plants grown in latosols.

Azospirillum IV

Energy Technology Data Exchange (ETDEWEB)

Klingmuller, W.

1988-01-01

This book's contents include: Advances in the genetics of Azospirillum brasilense Sp7: Use of Tn5 mutagenesis for gene mapping and identification; Characterization of DNA segments adjacent to the nifHDK genes of Azospirillum brasilense by Sp7 Tn5 site-directed mutagenesis; Selection at the chemostat of Azospirillum brasilense Cd N/sub 2/-fixing at high O/sub 2/ pressure. Root hair deformation induced on maize and medicago by an Azospirillum transconjugant containing a Rhizobium meliloti nodulation region. Azospirilla are bacteria that live in association with the roots of many grain crops. Since these bacteria bind molecular nitrogen from the air and excrete plant growth substances, interest has focussed on their potential to increase crop yields.

Effect of Rhizobium and Phosphate Solubilizing Bacterial Inoculants on Symbiotic Traits, Nodule Leghemoglobin, and Yield of Chickpea Genotypes

Directory of Open Access Journals (Sweden)

G. S. Tagore

2013-01-01

Full Text Available A field experiment was carried out during the rabi season of 2004-05 to find out the effect of Rhizobium and phosphate solubilizing bacterial (PSB inoculants on symbiotic traits, nodule leghemoglobin, and yield of five elite genotypes of chickpea. Among the chickpea genotypes, IG-593 performed better in respect of symbiotic parameters including nodule number, nodule fresh weight, nodule dry weight, shoot dry weight, yield attributes and yield. Leghemoglobin content (2.55 mg g−1 of fresh nodule was also higher under IG-593. Among microbial inoculants, the Rhizobium + PSB was found most effective in terms of nodule number (27.66 nodules plant−1, nodule fresh weight (144.90 mg plant−1, nodule dry weight (74.30 mg plant−1, shoot dry weight (11.76 g plant−1, and leghemoglobin content (2.29 mg g−1 of fresh nodule and also showed its positive effect in enhancing all the yield attributing parameters, grain and straw yields.

Rhizobia from Lanzarote, the Canary Islands, that nodulate Phaseolus vulgaris have characteristics in common with LMW RNA group II Sinorhizobium meliloti of Medicago, Melilotus and Trigonella from soils of mainland Spain

Science.gov (United States)

Several isolates from nodules of Phaseolus vulgaris grown in soil of Lanzarote, an island of the Canaries, had electrophoretic LMW RNA patterns identical with a less common pattern within S. meliloti (assigned as group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northe...

Chemical characterization of the gels produced by the diazotrophic bacteria Rhizobium tropici and Mesorhizobium sp; Caracterizacao quimica dos geis produzidos pelas bacterias diazotroficas Rhizobium tropici e Mesorhizobium sp.

Energy Technology Data Exchange (ETDEWEB)

Monteiro, Nilson Kobori [Departamento de Engenharia e Tecnologia de Alimentos, Instituto de Biociencias, Letras e Ciencias Exatas, Universidade Estadual Paulista, Sao Jose do Rio Preto - SP (Brazil); Aranda-Selverio, Gabriel; Exposti, Diego Tadeu Degli; Silva, Maria de Lourdes Corradi da [Departamento de Fisica, Quimica e Biologia, Faculdade de Ciencias e Tecnologia, Universidade Estadual Paulista, Presidente Prudente - SP (Brazil); Lemos, Eliana Gertrudes Macedo; Campanharo, Joao Carlos [Departamento de Tecnologia, Faculdade de Ciencias Agrarias e Veterinaria, Universidade Estadual Paulista, Jaboticabal - SP (Brazil); Silveira, Joana Lea Meira [Departamento de Bioquimica e Biologia Molecular, Universidade Federal do Parana, Curitiba - PR (Brazil)

2012-07-01

The exopolysaccharides with characteristics of gel produced by Rhizobium tropici (EPSRT) and Mesorhizobium sp (EPSMR) are acidic heteropolysaccharide composed mainly of glucose and galactose in a molar ratio of 4:1 and 5:1 respectively, with traces of mannose ({approx} 1%). Chemical analysis showed the presence of uronic acid, pyruvate and acetyl-substituents in the structures of both polymers. Experiments of gel permeation chromatography and polyacrylamide gel electrophoresis showed that EPSRT and EPSMR are homogeneous molecules with low grade of polydispersity. The EPS were characterized using spectroscopic techniques of FT-IR, {sup 1}H and {sup 13}C-NMR. (author)

Transformation of pWWO in Rhizobium leguminosarum DPT to Engineer Toluene Degrading Ability for Rhizoremediation

OpenAIRE

Goel, Garima; Pandey, Piyush; Sood, Anchal; Bisht, Sandeep; Maheshwari, D. K.; Sharma, G. D.

2011-01-01

Rhizoremediation of organic xenobiotics is based on interactions between plants and their associated micro-organisms. The present work was designed to engineer a bacterial system having toluene degradation ability along with plant growth promoting characteristics for effective rhizoremediation. pWWO harboring the genes responsible for toluene breakdown was isolated from Pseudomonas putida MTCC 979 and successfully transformed in Rhizobium DPT. This resulted in a bacterial strain (DPTT) which ...

Transcriptomic characterization of soybean (Glycine max) roots in response to rhizobium infection by RNA sequencing

International Nuclear Information System (INIS)

He, Q.; Li, Z.; Wang, S.; Huang, S.; Yang, H.

2018-01-01

Legumes interacting with rhizobium to convert N2 into ammonia for plant use has attracted worldwide interest. However, the plant basal nitrogen fixation mechanisms induced in response to Rhizobium, giving differential gene expression of plants, have not yet been fully realized. The differential expressed genes of soybean between inoculated and mock-inoculated were analyzed by a RNA-Seq. The results of the sequencing were aligned against the Williams 82 genome sequence, which contain 55787 transcripts; 280 and 316 transcripts were found to be up- and down-regulated, respectively, for inoculated and mock-inoculated soybean roots at stage V1. Gene ontology (GO) analyses detected 104, 182 and 178 genes associated with the cell component category, molecular function category and biological process category, respectively. Pathway analysis revealed that 98 differentially expressed genes (115 transcripts) were involved in 169 biological pathways. We selected 19 differentially expressed genes and analyzed their expressions in mock-inoculated, inoculated USDA110 and CCBAU45436 using qRT-PCR. The results were in accordance with those obtained from rhizobia infected RNA-Seq data. These showed that the results of RNA-Seq had reliability and universality. Additionally, this study showed some novel genes associated with the nitrogen fixation process in comparison to previously identified QTLs. (author)

Dual inoculation with an Aarbuscular Mycorrhizal fungus and Rhizobium to facilitate the growth of alfalfa on coal mine substrates

Energy Technology Data Exchange (ETDEWEB)

Wu, F.Y.; Bi, Y.L.; Wong, M.H. [China University of Mining & Technology, Beijing (China)

2009-07-01

A pot experiment was conducted to investigate the effects of Glomus mosseae and Rhizobium on Medicago sativa grown on three types of coal mine substrates, namely a mixture of coal wastes and sands (CS), coal wastes and fly ash (CF), and fly ash (FA). Inoculation with Rhizobium alone did not result in any growth response but G. mosseae alone displayed a significant effect on plant growth. G. mosseae markedly increased the survival rate of M. sativa in CS substrate. In CF and FA substrates the respective oven dry weights of M. sativa inoculated with G. mosseae were 1.8 and 5.1 times higher than those without inoculation. Based on nitrogen (N), phosphorus (P) and potassium (K) uptake and legume growth, the results also show that dual inoculation in CS and CF substrates elicited a synergistic effect. This indicates that inoculation with arbuscular mycorrhizal (AM) fungi may be a promising approach for revegetation of coal mine substrates.

Effect of aldicarb on growth and radio-carbon (14C) and radio-phosphorus (32P) assimilation by Rhizobium japonicum

International Nuclear Information System (INIS)

Balasubramanian, A.; Nilakantan, Gita

1976-01-01

In vitro studies on the effect of aldicarb (2-methyl-2-(methyl thio) propionaldehde-o-methyl carbamoyl oxime), a soil applied systemic insecticide, on Rhizobium japonicum revealed that the chemical (at 1,2 and 5 ppm levels) stimulated the growth of the organism initially upto 48 hr which declined thereafter upto 72 hr. The incorporation of 14 C-glucose by the cells considerably reduced due to the insecticide treatment. The production of extracellular, water-soluble slime (polysacchardes) was also reduced considerably with increased concentrations of the chemical. However, the incorporation of 14 C-radio-activity in the extracellular slime generally enhanced due to the treatment, upto 6 hr after injection of the radioactivity, which declined significantly later at 15 hr, indicating a qualitative difference in the extracellular polysaccharides produced by the insecticide treated cells. The insecticide treatment drastically reduced the incorporation of 32 P-disodium hydrogen phosphate into Rhizobium cells, but enhanced the specific activity of the extracellular polysacchrides. (author)

Inoculation of the nonlegume Capsicum annuum L. with Rhizobium strains. 2. Changes in sterols, triterpenes, fatty acids, and volatile compounds.

Science.gov (United States)

Silva, Luís R; Azevedo, Jessica; Pereira, Maria J; Carro, Lorena; Velazquez, Encarna; Peix, Alvaro; Valentão, Patrícia; Andrade, Paula B

2014-01-22

Peppers (Capsicum spp.) are consumed worldwide, imparting flavor, aroma, and color to foods, additionally containing high concentrations of biofunctional compounds. This is the first report about the effect of the inoculation of two Rhizobium strains on sterols, triterpenes, fatty acids, and volatile compounds of leaves and fruits of pepper (Capsicum annuum L.) plants. Generally, inoculation with strain TVP08 led to the major changes, being observed a decrease of sterols and triterpenes and an increase of fatty acids, which are related to higher biomass, growth, and ripening of pepper fruits. The increase of volatile compounds may reflect the elicitation of plant defense after inoculation, since the content on methyl salicylate was significantly increased in inoculated material. The findings suggest that inoculation with Rhizobium strains may be employed to manipulate the content of interesting metabolites in pepper leaves and fruits, increasing potential health benefits and defense abilities of inoculated plants.

Effect of Rhizobium and Mycorhiza inoculation on the nursery growth of Acacia and Teline monspessulana; Efecto de la aplicacion de biofertilizantes en Acacia decurrens y Teline monspessulana en vivero

Energy Technology Data Exchange (ETDEWEB)

Layton, G; Lozano de Yunda, A; Chaparro, H

1999-12-01

In an experiment accomplished in the tree nursery Tisquesusa located in Madrid (Cundinamarca) was evaluated the effect of the inoculation with strains selected of foreign and Indigenous rhizobium and Arbuscular mycorrhizal fungi am (Glomus folescutolum) on the growth, nitrogen fixation, and micorrization of Acacia (Acacia decurrens) and Retamo (Teline monspessulana) that they are used In soils recovery by the Corporacion Autonoma Regional de Cundinamarca CAR. The studied species presented positive response to the inoculation with rhizobium; the indigenous strain DQ6-09, isolated in Guatavita (Cundinamarca), presented the better results in Retamo and also in Acacia alone and in mixture with the foreign strain T1881. The inoculation with fungi AM increased the heights, dry weights, phosphorus content and percentage of micorrization in Acacia and Retamo. The double inoculation with fungi ma and rhizobium it did not increase the nitrogen fixing of Acacia while in Retamo was presented a positive effect with the strain DQ6-09.

Electrochemical selective detection of dopamine on microbial carbohydrate-doped multiwall carbon nanotube-modified electrodes.

Science.gov (United States)

Jin, Joon-Hyung; Cho, Eunae; Jung, Seunho

2010-03-01

Microbial carbohydrate-doped multiwall carbon nanotube (MWNT)-modified electrodes were prepared for the purpose of determining if 4-(2-aminoethyl)benzene-1,2-diol (3,4-dihydroxyphenylalanine; dopamine) exists in the presence of 0.5 mM ascorbic acid, a representative interfering agent in neurotransmitter detection. The microbial carbohydrate dopants were alpha-cyclosophorohexadecaose (alpha-C16) from Xanthomonas oryzae and cyclic-(1 --> 2)-beta-d-glucan (Cys) from Rhizobium meliloti. The cyclic voltammetric responses showed that the highest sensitivity (5.8 x 10(-3) mA cm(-2) microM(-1)) is attained with the Cys-doped MWNT-modified ultra-trace carbon electrode, and that the alpha-C16-doped MWNT-modified glassy carbon electrode displays the best selectivity to dopamine (the approximate peak potential separation is 310 mV).

Homology of genes for exopolysaccharide synthesis in Rhizobium leguminosarum and effect of cloned exo genes on nodule formation

International Nuclear Information System (INIS)

Skorupska, A.; Derylo, M.

1993-01-01

A 5.4 kb BamHI fragment of Rhizobium leguminosarum (R.l.) bv. trifolii TA1 was found to carry genes involved in exopolysaccharide synthesis (exo genes). This fragment was strongly hybridized to the total DNA from DNA from R.l. bv. viciae and bv. phaseoli digested with EcoRI. No homology was found with total DNA of R. melilotic and Rhizobium sp. NGR 234. The exo genes R.l. bv. trifolii TA1 conjugally introduced into R.l. bv. viciae 1302 considerably affected the symbiosis: the nodules induced on vetch were abortive and did not fix nitrogen. On the other hand, Phaseolus beans infected with R.l. bv. trifolii exo genes formed the nitrogen-fixing nodules. It can be conduced that additional copies of exo genes introduced into wild type R.l. strains can disturb the synthesis of acidic exopolysaccharides and affect symbiosis of the plants forming indeterminate nodules, but do not affect symbiosis of the plants forming the determinate nodules. (author). 29 refs, 2 figs, 2 tabs

The center for plant and microbial complex carbohydrates at the University of Georgia Complex Carbohydrate Research Center

Energy Technology Data Exchange (ETDEWEB)

Albersheim, P.; Darvill, A.

1991-08-01

Research from the Complex Carbohydrates Research Center at the University of Georgia is presented. Topics include: Structural determination of soybean isoflavones which specifically induce Bradyrhizobium japonicum nodD1 but not the nodYABCSUIJ operon; structural analysis of the lipopolysaccharides (LPSs) from symbiotic mutants of Bradyrhizobium japonicum; structural characterization of lipooligosaccharides from Bradyrhizobium japonicum that are required for the specific nodulation of soybean; structural characterization of the LPSs from R. Leguminosarum biovar phaseoli, the symbiont of bean; characterization of bacteroid-specific LPS epitopes in R. leguminosarum biovar viciae; analysis of the surface polysaccharides of Rhizobium meliloti mutants whose lipopolysaccharides and extracellular polysaccharides can have the same function in symbiosis; characterization of a polysaccharide produced by certain Bradyrhizobium japonicum strains within soybean nodules; structural analysis of a streptococcal adhesin polysaccharide receptor; conformational studies of xyloglucan, the role of the fucosylated side chain in surface-specific cellulose-xyloglucan interactions; the structure of an acylated glucosamine oligosaccharide signal molecule (nod factor) involved in the symbiosis of Rhizobium leguminosarum biovar viciae with its host Vicia sativa; investigating membrane responses induced by oligogalacturonides in cultured cells; the polygalacturonase inhibitor protein; characterization of the self-incompatability glycoproteins from Petunia hybrida; investigation of the cell wall polysaccharide structures of Arabidopsis thaliana; and the glucan inhibition of virus infection of tabacco.

The center for plant and microbial complex carbohydrates at the University of Georgia Complex Carbohydrate Research Center. Annual report, September 15, 1990--December 31, 1991

Energy Technology Data Exchange (ETDEWEB)

Albersheim, P.; Darvill, A.

1991-08-01

Research from the Complex Carbohydrates Research Center at the University of Georgia is presented. Topics include: Structural determination of soybean isoflavones which specifically induce Bradyrhizobium japonicum nodD1 but not the nodYABCSUIJ operon; structural analysis of the lipopolysaccharides (LPSs) from symbiotic mutants of Bradyrhizobium japonicum; structural characterization of lipooligosaccharides from Bradyrhizobium japonicum that are required for the specific nodulation of soybean; structural characterization of the LPSs from R. Leguminosarum biovar phaseoli, the symbiont of bean; characterization of bacteroid-specific LPS epitopes in R. leguminosarum biovar viciae; analysis of the surface polysaccharides of Rhizobium meliloti mutants whose lipopolysaccharides and extracellular polysaccharides can have the same function in symbiosis; characterization of a polysaccharide produced by certain Bradyrhizobium japonicum strains within soybean nodules; structural analysis of a streptococcal adhesin polysaccharide receptor; conformational studies of xyloglucan, the role of the fucosylated side chain in surface-specific cellulose-xyloglucan interactions; the structure of an acylated glucosamine oligosaccharide signal molecule (nod factor) involved in the symbiosis of Rhizobium leguminosarum biovar viciae with its host Vicia sativa; investigating membrane responses induced by oligogalacturonides in cultured cells; the polygalacturonase inhibitor protein; characterization of the self-incompatability glycoproteins from Petunia hybrida; investigation of the cell wall polysaccharide structures of Arabidopsis thaliana; and the glucan inhibition of virus infection of tabacco.

Draft Genome Sequence of the Nitrogen-Fixing Rhizobium sullae Type Strain IS123T Focusing on the Key Genes for Symbiosis with its Host Hedysarum coronarium L.

Directory of Open Access Journals (Sweden)

Gaurav Sablok

2017-07-01

Full Text Available The prominent feature of rhizobia is their molecular dialogue with plant hosts. Such interaction is enabled by the presence of a series of symbiotic genes encoding for the synthesis and export of signals triggering organogenetic and physiological responses in the plant. The genome of the Rhizobium sullae type strain IS123T nodulating the legume Hedysarum coronarium, was sequenced and resulted in 317 scaffolds for a total assembled size of 7,889,576 bp. Its features were compared with those of genomes from rhizobia representing an increasing gradient of taxonomical distance, from a conspecific isolate (Rhizobium sullae WSM1592, to two congeneric cases (Rhizobium leguminosarum bv. viciae and Rhizobium etli and up to different genera within the legume-nodulating taxa. The host plant is of agricultural importance, but, unlike the majority of other domesticated plant species, it is able to survive quite well in the wild. Data showed that that the type strain of R. sullae, isolated from a wild host specimen, is endowed with a richer array of symbiotic genes in comparison to other strains, species or genera of rhizobia that were rescued from domesticated plant ecotypes. The analysis revealed that the bacterium by itself is incapable of surviving in the extreme conditions that its host plant can tolerate. When exposed to drought or alkaline condition, the bacterium depends on its host to survive. Data are consistent with the view of the plant phenotype as the primary factor enabling symbiotic nitrogen fixing bacteria to survive in otherwise limiting environments.

VsENOD5, VsENOD12 and VsENOD40 expression during Rhizobium-induced nodule formation on Vicia sativa roots

DEFF Research Database (Denmark)

Vijn, I; Yang, W C; Pallisgård, N

1995-01-01

We isolated ENOD5, ENOD12 and ENOD40 homologues from Vicia sativa and studied their expression pattern during Rhizobium-induced nodule formation. Comparison of the VsENOD40 nucleotide sequence with the pea, soybean and alfalfa ENOD40 sequences showed that the sequences contain two conserved regions...... the expression pattern of VsENOD5, VsENOD12 and VsENOD40 during Rhizobium-induced nodule formation. Although the expression of these genes is largely similar to that of the pea counterparts, differences where found for the expression of VsENOD12 and VsENOD40 in Vicia. VsENOD12 is expressed in the whole...... prefixation zone II, whereas in pea ENOD12 is only expressed in the distal part of this zone. VsENOD40 is expressed in the uninfected cells of interzone II-III, while in pea ENOD40 is expressed in both the uninfected and infected cells of this zone. Udgivelsesdato: 1995-Sep...

Revegetating fly ash landfills with Prosopis juliflora L.: impact of different amendments and Rhizobium inoculation.

Science.gov (United States)

Rai, U N; Pandey, K; Sinha, S; Singh, A; Saxena, R; Gupta, D K

2004-05-01

A revegetation trial was conducted to evaluate the feasibility of growing a legume species, Prosopis juliflora L., on fly ash ameliorated with combination of various organic amendments, blue-green algal biofertilizer and Rhizobium inoculation. Significant enhancements in plant biomass, photosynthetic pigments, protein content and in vivo nitrate reductase activity were found in the plants grown on ameliorated fly ash in comparison to the plants growing in unamended fly ash or garden soil. Higher growth was obtained in fly ash amended with blue-green algae (BGA) than farmyard manure or press mud (PM), a waste from sugar-processing industry, due to the greater contribution of plant nutrients, supply of fixed nitrogen and increased availability of phosphorus. Nodulation was suppressed in different amendments of fly ash with soil in a concentration-duration-dependent manner, but not with other amendments. Plants accumulated higher amounts of Fe, Mn, Cu, Zn and Cr in various fly ash amendments than in garden soil. Further, inoculation of the plant with a fly ash tolerant Rhizobium strain conferred tolerance for the plant to grow under fly ash stress conditions with more translocation of metals to the above ground parts. The results showed the potential of P. juliflora to grow in plantations on fly ash landfills and to reduce the metal contents of fly ash by bioaccumulation in its tissues.

The beneficial effect of dual inoculation of vesicular-arbuscular mycorrhizae + rhizobium on growth of white clover

OpenAIRE

Lin, XG.; Hao, WY.; Wu, TH.

1993-01-01

Investigation on the effect of phosphorus on vesicular-arbuscular mycorrhizal infection, and dual inoculation of vesicular-arbuscular mycorrhizae + rhizobium on growth of white clover under field microplots and pot experiments was conducted on fluvo-aquic soils of semi-arid region in north China. The results showed that 60 kg P205 ha in form of superphosphate was the most favorable phosphorus level for vesicular-arbuscular mycorrhizal infection ; mycorrhizal infection, nodulation, dry weight ...

STABILITY IN REAL TIME OF SOME CRYOPRESERVED MICROBIAL STRAINS WITH REFERENCE TO GENETICALLY MODIFIED MICROORGANISMS

Directory of Open Access Journals (Sweden)

DANIELA VINTILĂ

2007-05-01

Full Text Available The aim of this work is to analyze the viability of microorganisms from Collection of Industrial Microorganisms from Faculty of Animal Science and Biotechnology – Timisoara, during freezing and thawing as part of cryopreservation technique. The stability in real time of 19 strains cryopreserved in 16% glycerol was evaluated during a 6-months period. The strains studied were: Escherichia coli, Lactobacillus acidophilus, Rhizobium meliloti, Saccharomyces cerevisiae, Aspergillus oryzae, Aspergillus niger, Trichoderma viride, Bacillus globigii, Bacillus licheniformis, and 9 strains of Bacillus subtilis. The strains cryopreserved at -20oC and -70oC were activated using the fast thawing protocol. A better cell recovery was achieved with the -70oC protocol reaching an average viability for E. coli of 86,3%, comparing with 78,6% in -20oC protocol. The cell recovery percentages for the other strains were: 92,4% for L. acidophilus, 93,9% for A.niger, 89% for A. oryzae, 86,7% for T. viride, 94,2% for R. meliloti, 82,1% for S. cerevisiae, 89,9% for B. licheniformis. Regarding the viability of genetically modified microorganisms, the values shows a good recovering after freezing and thawing, even after 180 days of cryopreservation. With the -20oC protocol lower viability was observed due probably to the formation of eutectic mixtures and recrystalization processes.

Inoculação com Rhizobium e aplicação de nitrogênio em amendoim Comparison among Rhizobium strains inoculations and nitrogen applications on peanut, in field conditions

Directory of Open Access Journals (Sweden)

Antonio Roberto Giardini

1985-01-01

Full Text Available Existe, nas nossas condições, uma população autóctone de Rhizobium capaz de nodular o amendoim (Arachis hypogaea L., mas pouco se sabe da contribuição do nitrogênio fixado para esta planta. Foram conduzidos dois ensaios no campo, em solo de baixa fertilidade, um no período "da seca" e outro no "das águas", comparando o crescimento e a produção de plantas de amendoim inoculado com Rhizobium selecionado, com o de plantas noduladas pela população autóctone, adubadas ou não com nitrogênio. A nodulação das plantas inoculadas foi semelhante à observada nos tratamentos não inoculados, com ou sem nitrogênio. Na fase final do ciclo das plantas, houve maior acúmulo e maior taxa de absorção diária de nitrogênio nos tratamentos inoculados ou com adubação nitrogenada, do que no controle sem inoculação e sem nitrogênio. No ensaio da seca, não houve aumento de produção devido à adubação nitrogenada, ou à inoculação. No ensaio das águas, houve resposta à aplicação de nitrogênio no plantio. Os resultados de produção não foram coerentes com os da marcha de absorção de N. A produção de ensaio das águas foi equivalente a 3.400 kg/ha para o tratamento sem nitrogênio e sem inoculação.Two field experiments were carried out with peanut in the same area on a limed and fertilized "cerrado soil" (originally acidic and low fertility. The first experiment was carried out in the autumn/winter (dry season, and the second one in the subsequent spring/summer (wet season, in Campinas, State of São Paulo, Brazil. Plant development and production of inoculated (three Rhizobium strains and nitrogen fertilized treatments (at planting 25 and 45 days after planting were compared with non-inoculated and non-N-fertilized control. Nodulation of inoculated plants was similar to those of non-inoculated, with or without nitrogen. Greater accumulations, and rates for average daily uptake of nitrogen were observed for inoculated as

Sinorhizobium meliloti sigma factors RpoE1 and RpoE4 are activated in stationary phase in response to sulfite.

Directory of Open Access Journals (Sweden)

Bénédicte Bastiat

Full Text Available Rhizobia are soil bacteria able to establish a nitrogen-fixing symbiosis with legume plants. Both in soil and in planta, rhizobia spend non-growing periods resembling the stationary phase of in vitro-cultured bacteria. The primary objective of this work was to better characterize gene regulation in this biologically relevant growth stage in Sinorhizobium meliloti. By a tap-tag/mass spectrometry approach, we identified five sigma factors co-purifying with the RNA polymerase in stationary phase: the general stress response regulator RpoE2, the heat shock sigma factor RpoH2, and three extra-cytoplasmic function sigma factors (RpoE1, RpoE3 and RpoE4 belonging to the poorly characterized ECF26 subgroup. We then showed that RpoE1 and RpoE4 i are activated upon metabolism of sulfite-generating compounds (thiosulfate and taurine, ii display overlapping regulatory activities, iii govern a dedicated sulfite response by controlling expression of the sulfite dehydrogenase SorT, iv are activated in stationary phase, likely as a result of endogenous sulfite generation during bacterial growth. We showed that SorT is required for optimal growth of S. meliloti in the presence of sulfite, suggesting that the response governed by RpoE1 and RpoE4 may be advantageous for bacteria in stationary phase either by providing a sulfite detoxification function or by contributing to energy production through sulfite respiration. This paper therefore reports the first characterization of ECF26 sigma factors, the first description of sigma factors involved in control of sulphur metabolism, and the first indication that endogenous sulfite may act as a signal for regulation of gene expression upon entry of bacteria in stationary phase.

Hydrogen peroxide-regulated genes in the Medicago truncatula-Sinorhizobium meliloti symbiosis.

Science.gov (United States)

Andrio, Emilie; Marino, Daniel; Marmeys, Anthony; de Segonzac, Marion Dunoyer; Damiani, Isabelle; Genre, Andrea; Huguet, Stéphanie; Frendo, Pierre; Puppo, Alain; Pauly, Nicolas

2013-04-01

Reactive oxygen species (ROS), particularly hydrogen peroxide (H(2)O(2)), play an important role in signalling in various cellular processes. The involvement of H(2)O(2) in the Medicago truncatula-Sinorhizobium meliloti symbiotic interaction raises questions about its effect on gene expression. A transcriptome analysis was performed on inoculated roots of M. truncatula in which ROS production was inhibited with diphenylene iodonium (DPI). In total, 301 genes potentially regulated by ROS content were identified 2 d after inoculation. These genes included MtSpk1, which encodes a putative protein kinase and is induced by exogenous H(2)O(2) treatment. MtSpk1 gene expression was also induced by nodulation factor treatment. MtSpk1 transcription was observed in infected root hair cells, nodule primordia and the infection zone of mature nodules. Analysis with a fluorescent protein probe specific for H(2)O(2) showed that MtSpk1 expression and H(2)O(2) were similarly distributed in the nodule infection zone. Finally, the establishment of symbiosis was impaired by MtSpk1 downregulation with an artificial micro-RNA. Several genes regulated by H(2)O(2) during the establishment of rhizobial symbiosis were identified. The involvement of MtSpk1 in the establishment of the symbiosis is proposed. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

Effect of aldicarb on growth and radio-carbon (/sup 14/C) and radio-phosphorus (/sup 32/P) assimilation by Rhizobium japonicum

Energy Technology Data Exchange (ETDEWEB)

Balasubramanian, A; Nilakantan, G [University of Agricultural Sciences, Bangalore (India). Radiotracer Lab.

1976-01-01

In vitro studies on the effect of aldicarb (2-methyl-2-(methyl thio) propionaldehde-o-methyl carbamoyl oxime), a soil applied systemic insecticide, on Rhizobium japonicum revealed that the chemical (at 1,2 and 5 ppm levels) stimulated the growth of the organism initially upto 48 hr which declined thereafter upto 72 hr. The incorporation of /sup 14/C-glucose by the cells considerably reduced due to the insecticide treatment. The production of extracellular, water-soluble slime (polysacchardes) was also reduced considerably with increased concentrations of the chemical. However, the incorporation of /sup 14/C-radio-activity in the extracellular slime generally enhanced due to the treatment, upto 6 hr after injection of the radioactivity, which declined significantly later at 15 hr, indicating a qualitative difference in the extracellular polysaccharides produced by the insecticide treated cells. The insecticide treatment drastically reduced the incorporation of /sup 32/P-disodium hydrogen phosphate into Rhizobium cells, but enhanced the specific activity of the extracellular polysacchrides.

Effect of chickpea in association with Rhizobium to crop productivity and soil fertility

Directory of Open Access Journals (Sweden)

Botir Khaitov

2016-04-01

Full Text Available The growth, development and yield of chickpea (Cicer ariеtinum L. is strongly influenced by abiotic factors such as salinity and drought in the arid conditions. The use of efficient plant growth promoting bacteria in chickpea production is the best solution to overcome those stresses. In the present study, 10 chickpea rhizobial strains were isolated and purified from the nodules of chickpea genotype grown on middle salinated soils with different chickpea cultivation histories, 3 of them were more efficient in salt tolerance and showed higher nodulation abilities. Local chickpea genotype Uzbekistan-32 was inoculated with selected Rhizobium bacterial strains before planting them to the field condition. Inoculation of plants with strains Rhizobium sp. R4, R6 and R9 significantly increased shoot, root dry matter, and nodule number by 17, 12, and 20% above the uninoculated plants, respectively. The shoot length increased by 52%, root length by 43%, shoot dry weight by 36%, and root dry weight by 64%. Inoculation significantly increased the pod number by 28% and yield up to 55% as compared to control plant. The effective indigenous rhizobial strains isolated in this study from chickpeas on middle salinated soils of Uzbekistan have the characters of broad host range, high nodulation efficiency, efficient N fixation, great salt tolerance. Soil nitrogen, phosphorus and carbon content of the soil at the end of experiments were positive in all the treatments compare control. In this study, we are focused with consideration of the relationship between chickpea and its symbiotic nitrogen-fixing root nodule bacterial strains and how it functions to influence plant productivity and soil fertility.

Efeito residual da vinhaça na população autóctone de Rhizobium do solo Residual effects of sugar cane vinasse on indigenous Rhizobia

Directory of Open Access Journals (Sweden)

Eli Sidney Lopes

1986-01-01

Full Text Available A adição de vinhaça na cultura canavieira tem sido praticada em áreas próximas às usinas de cana. Seria de interesse a avaliação do efeito da vinhaça no Rhizobium presente no solo (autóctone, uma vez que leguminosas têm sido indicadas para cultivo intercalar com a cana. Um experimento foi conduzido em casa de vegetação, com o objetivo de verificar a influência da aplicação contínua, durante três anos, de concentrações crescentes de vinhaça (0, 100 e 1.000 m³/ha/ano, com intervalos de seis meses entre aplicações, na população autóctone de Rhizobium que nodula amendoim, soja, feijão e crotalária. Em cada cultura, foram usados controle com solo sem adição da vinhaça e um tratamento inoculado com uma estirpe de Rhizobium de conhecida eficiência, recomendada para a cultura. Uma análise do efeito de uma dose adicional de 1,5 ppm do herbicida 2,4-D no tratamento com 100 m³/ha/ano foi também efetuada. Apesar de os resultados serem variados entre as culturas, ocorreram efeitos da vinhaça sobre a população de Rhizobium, causando aumentos de nodulação na crotalária e diminuição no amendoim. Não foram observados efeitos na nodulação do feijoeiro em nenhum dos tratamentos com a vinhaça, nem na soja, que nodulou somente com a dose mais elevada, sugerindo que o Rhizobium japonicum no solo estudado estava presente em baixo número. O tratamento com herbicida mostrou tendência de favorecer a nodulação e, conseqüentemente, a fixação biológica de N2, medida através do N na planta.The addition of vinasse on sugar cane plantations nearby alcohol fermentation plants is a common practice. Legumes are recommended to be intercropped with sugar cane. A greenhouse experiment was carried out with the objective of verifying the influence of continuous application of vinasse (0; 100 and 1000 m³/ha/year at six month interval during three years on soil rhizobia which nodulate peanuts, soybeans, dry-beans and crotalaria

Medicago sativa--Sinorhizobium meliloti Symbiosis Promotes the Bioaccumulation of Zinc in Nodulated Roots.

Science.gov (United States)

Zribi, Kais; Nouairi, Issam; Slama, Ines; Talbi-Zribi, Ons; Mhadhbi, Haythem

2015-01-01

In this study we investigated effects of Zn supply on germination, growth, inorganic solutes (Zn, Ca, Fe, and Mg) partitioning and nodulation of Medicago sativa This plant was cultivated with and without Zn (2 mM). Treatments were plants without (control) and with Zn tolerant strain (S532), Zn intolerant strain (S112) and 2 mM urea nitrogen fertilisation. Results showed that M. sativa germinates at rates of 50% at 2 mM Zn. For plants given nitrogen fertilisation, Zn increased plant biomass production. When grown with symbionts, Zn supply had no effect on nodulation. Moreover, plants with S112 showed a decrease of shoot and roots biomasses. However, in symbiosis with S532, an increase of roots biomass was observed. Plants in symbiosis with S. meliloti accumulated more Zn in their roots than nitrogen fertilised plants. Zn supply results in an increase of Ca concentration in roots of fertilised nitrogen plants. However, under Zn supply, Fe concentration decreased in roots and increased in nodules of plants with S112. Zn supply showed contrasting effects on Mg concentrations for plants with nitrogen fertilisation (increase) and plants with S112 (decrease). The capacity of M. sativa to accumulate Zn in their nodulated roots encouraged its use in phytostabilisation processes.

Degradación de Fenantreno por bacterias del género Burkholderia y Rhizobium aisladas de nódulos de mimosas

Directory of Open Access Journals (Sweden)

Arnoldo Wong-Villarreal

2017-01-01

Full Text Available El presente trabajo tuvo como objetivo identificar y evaluar la capacidad de degradación de microorganismos aislados de nódulos de mimosas, que puedan ser utilizados en procesos de biorremediación de suelos contaminados con fenantreno . Método . Se realizó el aislamiento de 122 cepas bacterianas de nódulos de mimosas; fueron crecidas en el medio de cultivo Maconkey para descartar enterobacterias. L as cepas bacterianas que dieron resultado negativo a esta prueba, fueron inoculadas en el medio de cultivo que contenía como úni ca fuente de carbono fenantreno; tres aislados tuvieron la capacidad de crecer en este medio. Las tres cepas fueron identificadas por secuencia del gen 1 6s ribosomal, se evaluó su capacidad de crecimiento en presencia de fenantreno mediante curvas de crecimiento microbiano; la capacidad para degradar fenantreno de las tres cepas fue cuantificada por cromatografía de gases acoplado a masas. Resultados . La s secuencias obtenidas del gen 16s ribosomal tienen relación genética con las especies de Burkholderia phenoliruptrix , Burkholderia phymatum y Rhizobium paknamense. El crecimiento microbiano de las tres cepas, suministradas con fenantreno, tuvieron un comp ortamiento similar al control , el cual contenía succinato como fuente de carbono. La cepa de Burkholderia sp. BB26 degradó 78.5 % , Burkholderia sp. BB24 68.5 % y Rhizobium sp. BY8 99%. Discusión . Los resultados de degradación de fenantreno por las cepas de Burkholderia sp. BB26 , Burkholderia sp. BB24 y Rhizobium sp. BY8 sugieren que las tres cepas tienen p otencial para utilizarse en procesos de biorremediación de suelos contaminados con fenantreno.

Potential of the Galega – Rhizobium galegae System for Bioremediation of Oil-Contaminated Soil

Directory of Open Access Journals (Sweden)

Minna M. Jussila

2003-01-01

Full Text Available Bioremediation potential of the nitrogen-fixing leguminous plant Galega orientalis Lam. and its microsymbiont Rhizobium galegae was evaluated in microcosm and mesocosm scale in oil and BTEX (benzene, toluene, ethylbenzene, xylene contaminated soils, with m-toluate serving as a model for the latter group. G. orientalis and Rhizobium galegae remained viable in m-toluate fractions up to 3000 ppm. Plant growth and nodulation were inhibited in 500 ppm m-toluate, but were restored when plants were transferred to clean medium. In soil, G. orientalis nodulated and showed good growth in 2000 ppm m-toluate as well as in diesel-contaminated soil in the field, where the plant was stimulating bacterial growth in the rhizosphere. A collection of 52 indigenous m-toluate-tolerating bacteria isolated from oil-contaminated rhizosphere of G. orientalis was characterised and identified by classical and molecular biological methods. 16SrDNA PCR-RFLP and (GTG5-PCR genomic fingerprinting combined with partial sequencing indicated the presence of five major lineages of the Bacteria domain. A TOL plasmid-specific xylE-PCR was developed in order to detect both active and potential degraders of m-toluate. The ability to degrade m-toluate in the presence of the gene xylE was detected only within the genus Pseudomonas. The isolates were tested for capacity to grow on m-toluate as their sole carbon and energy source. In laboratory experiments, the best rhizosphere isolates performed equally well to the positive control strain and are good candidates for inoculant production in the future. They have been tagged with marker genes for further studies on colonisation and persistence.

Chemical characterization of the gels produced by the diazotrophic bacteria Rhizobium tropici and Mesorhizobium sp

International Nuclear Information System (INIS)

Monteiro, Nilson Kobori; Aranda-Selverio, Gabriel; Exposti, Diego Tadeu Degli; Silva, Maria de Lourdes Corradi da; Lemos, Eliana Gertrudes Macedo; Campanharo, Joao Carlos; Silveira, Joana Lea Meira

2012-01-01

The exopolysaccharides with characteristics of gel produced by Rhizobium tropici (EPSRT) and Mesorhizobium sp (EPSMR) are acidic heteropolysaccharide composed mainly of glucose and galactose in a molar ratio of 4:1 and 5:1 respectively, with traces of mannose (∼ 1%). Chemical analysis showed the presence of uronic acid, pyruvate and acetyl-substituents in the structures of both polymers. Experiments of gel permeation chromatography and polyacrylamide gel electrophoresis showed that EPSRT and EPSMR are homogeneous molecules with low grade of polydispersity. The EPS were characterized using spectroscopic techniques of FT-IR, 1 H and 13 C-NMR. (author)

The roles of plant phenolics in defence and communication during Agrobacterium and Rhizobium infection.

Science.gov (United States)

Bhattacharya, Amita; Sood, Priyanka; Citovsky, Vitaly

2010-09-01

Phenolics are aromatic benzene ring compounds with one or more hydroxyl groups produced by plants mainly for protection against stress. The functions of phenolic compounds in plant physiology and interactions with biotic and abiotic environments are difficult to overestimate. Phenolics play important roles in plant development, particularly in lignin and pigment biosynthesis. They also provide structural integrity and scaffolding support to plants. Importantly, phenolic phytoalexins, secreted by wounded or otherwise perturbed plants, repel or kill many microorganisms, and some pathogens can counteract or nullify these defences or even subvert them to their own advantage. In this review, we discuss the roles of phenolics in the interactions of plants with Agrobacterium and Rhizobium.

Mutualism and Adaptive Divergence: Co-Invasion of a Heterogeneous Grassland by an Exotic Legume-Rhizobium Symbiosis

Science.gov (United States)

Porter, Stephanie S.; Stanton, Maureen L.; Rice, Kevin J.

2011-01-01

Species interactions play a critical role in biological invasions. For example, exotic plant and microbe mutualists can facilitate each other's spread as they co-invade novel ranges. Environmental context may influence the effect of mutualisms on invasions in heterogeneous environments, however these effects are poorly understood. We examined the mutualism between the legume, Medicago polymorpha, and the rhizobium, Ensifer medicae, which have both invaded California grasslands. Many of these invaded grasslands are composed of a patchwork of harsh serpentine and relatively benign non-serpentine soils. We grew legume genotypes collected from serpentine or non-serpentine soil in both types of soil in combination with rhizobium genotypes from serpentine or non-serpentine soils and in the absence of rhizobia. Legumes invested more strongly in the mutualism in the home soil type and trends in fitness suggested that this ecotypic divergence was adaptive. Serpentine legumes had greater allocation to symbiotic root nodules in serpentine soil than did non-serpentine legumes and non-serpentine legumes had greater allocation to nodules in non-serpentine soil than did serpentine legumes. Therefore, this invasive legume has undergone the rapid evolution of divergence for soil-specific investment in the mutualism. Contrary to theoretical expectations, the mutualism was less beneficial for legumes grown on the stressful serpentine soil than on the non-serpentine soil, possibly due to the inhibitory effects of serpentine on the benefits derived from the interaction. The soil-specific ability to allocate to a robust microbial mutualism may be a critical, and previously overlooked, adaptation for plants adapting to heterogeneous environments during invasion. PMID:22174755

Mutualism and adaptive divergence: co-invasion of a heterogeneous grassland by an exotic legume-rhizobium symbiosis.

Directory of Open Access Journals (Sweden)

Stephanie S Porter

Full Text Available Species interactions play a critical role in biological invasions. For example, exotic plant and microbe mutualists can facilitate each other's spread as they co-invade novel ranges. Environmental context may influence the effect of mutualisms on invasions in heterogeneous environments, however these effects are poorly understood. We examined the mutualism between the legume, Medicago polymorpha, and the rhizobium, Ensifer medicae, which have both invaded California grasslands. Many of these invaded grasslands are composed of a patchwork of harsh serpentine and relatively benign non-serpentine soils. We grew legume genotypes collected from serpentine or non-serpentine soil in both types of soil in combination with rhizobium genotypes from serpentine or non-serpentine soils and in the absence of rhizobia. Legumes invested more strongly in the mutualism in the home soil type and trends in fitness suggested that this ecotypic divergence was adaptive. Serpentine legumes had greater allocation to symbiotic root nodules in serpentine soil than did non-serpentine legumes and non-serpentine legumes had greater allocation to nodules in non-serpentine soil than did serpentine legumes. Therefore, this invasive legume has undergone the rapid evolution of divergence for soil-specific investment in the mutualism. Contrary to theoretical expectations, the mutualism was less beneficial for legumes grown on the stressful serpentine soil than on the non-serpentine soil, possibly due to the inhibitory effects of serpentine on the benefits derived from the interaction. The soil-specific ability to allocate to a robust microbial mutualism may be a critical, and previously overlooked, adaptation for plants adapting to heterogeneous environments during invasion.

Competitive nodulation blocking of cv. Afghanistan pea is related to high levels of nodulation factors made by some strains of Rhizobium leguminosarum bv. viciae

NARCIS (Netherlands)

Hogg, B.; Davies, A.E.; Wilson, K.E.; Bisseling, T.; Downie, J.A.

2002-01-01

Cultivar Afghanistan peas are resistant to nodulation by many strains of Rhizobium leguminosarum bv. viciae but are nodulated by strain TOM, which carries the host specificity gene nodX. Some strains that lack nodX can inhibit nodulation of cv. Afghanistan by strain TOM. We present evidence that

Role of O2 in the Growth of Rhizobium leguminosarum bv. viciae 3841 on Glucose and Succinate

OpenAIRE

Wheatley, Rachel M.; Ramachandran, Vinoy K.; Geddes, Barney A.; Perry, Benjamin J.; Yost, Chris K.; Poole, Philip S.

2016-01-01

Insertion sequencing (INSeq) analysis of Rhizobium leguminosarum bv. viciae 3841 (Rlv3841) grown on glucose or succinate at both 21% and 1% O2 was used to understand how O2 concentration alters metabolism. Two transcriptional regulators were required for growth on glucose (pRL120207 [eryD] and RL0547 [phoB]), five were required on succinate (pRL100388, RL1641, RL1642, RL3427, and RL4524 [ecfL]), and three were required on 1% O2 (pRL110072, RL0545 [phoU], and RL4042). A novel toxin-antitoxin s...

Synergy between Rhizobium phaseoli and Acidithiobacillus ferrooxidans in the Bioleaching Process of Copper

Directory of Open Access Journals (Sweden)

Xuecheng Zheng

2016-01-01

Full Text Available This study investigates the synergy of Rhizobium phaseoli and Acidithiobacillus ferrooxidans in the bioleaching process of copper. The results showed that additional R. phaseoli could increase leaching rate and cell number of A. ferrooxidans. When the initial cell number ratio between A. ferrooxidans and R. phaseoli was 2 : 1, A. ferrooxidans attained the highest final cell number of approximately 2 × 108 cells/mL and the highest copper leaching rate of 29%, which is 7% higher than that in the group with A. ferrooxidans only. R. phaseoli may use metabolized polysaccharides from A. ferrooxidans, and organic acids could chelate or precipitate harmful heavy metals to reduce their damage on A. ferrooxidans and promote its growth. Organic acids could also damage the mineral lattice to increase the leaching effect.

Synergy between Rhizobium phaseoli and Acidithiobacillus ferrooxidans in the Bioleaching Process of Copper

Science.gov (United States)

Zheng, Xuecheng; Li, Dongwei

2016-01-01

This study investigates the synergy of Rhizobium phaseoli and Acidithiobacillus ferrooxidans in the bioleaching process of copper. The results showed that additional R. phaseoli could increase leaching rate and cell number of A. ferrooxidans. When the initial cell number ratio between A. ferrooxidans and R. phaseoli was 2 : 1, A. ferrooxidans attained the highest final cell number of approximately 2 × 108 cells/mL and the highest copper leaching rate of 29%, which is 7% higher than that in the group with A. ferrooxidans only. R. phaseoli may use metabolized polysaccharides from A. ferrooxidans, and organic acids could chelate or precipitate harmful heavy metals to reduce their damage on A. ferrooxidans and promote its growth. Organic acids could also damage the mineral lattice to increase the leaching effect. PMID:26942203

Effect of Rhizobium inoculation of seeds and foliar fertilization on productivity of Pisum sativum L.

Directory of Open Access Journals (Sweden)

Tadeusz Zając

2013-07-01

Full Text Available Pea (Pisum sativum L. is the second most important grain legume crop in the world which has a wide array of uses for human food and fodder. One of the major factors that determines the use of field pea is the yield potential of cultivars. Presently, pre-sowing inoculation of pea seeds and foliar application of microelement fertilizers are prospective solutions and may be reasonable agrotechnical options. This research was undertaken because of the potentially high productivity of the 'afila' morphotype in good wheat complex soils. The aim of the study was to determine the effect of vaccination with Rhizobium and foliar micronutrient fertilization on yield of the afila pea variety. The research was based on a two-year (2009–2010 controlled field experiment, conducted in four replicates and carried out on the experimental field of the Bayer company located in Modzurów, Silesian region. experimental field soil was Umbrisol – slightly degraded chernozem, formed from loess. Nitragina inoculant, as a source of symbiotic bacteria, was applied before sowing seeds. Green area index (GAI of the canopy, photosynthetically active radiation (PAR, and normalized difference vegetation index (NDVI were determined at characteristic growth stages. The presented results of this study on symbiotic nitrogen fixation by leguminous plants show that the combined application of Nitragina and Photrel was the best combination for productivity. Remote measurements of the pea canopy indexes indicated the formation of the optimum leaf area which effectively used photosynthetically active radiation. The use of Nitragina as a donor of effective Rhizobium for pea plants resulted in slightly higher GAI values and the optimization of PAR and NDVI. It is not recommended to use foliar fertilizers or Nitragina separately due to the slowing of pea productivity.

Nickel detoxification and plant growth promotion by multi metal resistant plant growth promoting Rhizobium species RL9.

Science.gov (United States)

Wani, Parvaze Ahmad; Khan, Mohammad Saghir

2013-07-01

Pollution of the biosphere by heavy metals is a global threat that has accelerated dramatically since the beginning of industrial revolution. The aim of the study is to check the resistance of RL9 towards the metals and to observe the effect of Rhizobium species on growth, pigment content, protein and nickel uptake by lentil in the presence and absence of nickel. The multi metal tolerant and plant growth promoting Rhizobium strain RL9 was isolated from the nodules of lentil. The strain not only tolerated nickel but was also tolerant o cadmium, chromium, nickel, lead, zinc and copper. The strain tolerated nickel 500 μg/mL, cadmium 300 μg/mL, chromium 400 μg/mL, lead 1,400 μg/mL, zinc 1,000 μg/mL and copper 300 μg/mL, produced good amount of indole acetic acid and was also positive for siderophore, hydrogen cyanide and ammonia. The strain RL9 was further assessed with increasing concentrations of nickel when lentil was used as a test crop. The strain RL9 significantly increased growth, nodulation, chlorophyll, leghaemoglobin, nitrogen content, seed protein and seed yield compared to plants grown in the absence of bioinoculant but amended with nickel The strain RL9 decreased uptake of nickel in lentil compared to plants grown in the absence of bio-inoculant. Due to these intrinsic abilities strain RL9 could be utilized for growth promotion as well as for the remediation of nickel in nickel contaminated soil.

Improvement of Canola (Brassica napus L.) Inoculated with Rhizobium, Azospirillum and/or Mycorrhizal Fungi Under Salinity Stress

International Nuclear Information System (INIS)

El-Ghandour, I. A.; Galal, Y.G; Ebraheem, Rabab M.M.; Yousef, Khayria A.

2004-01-01

Bio fertilization technology was applied for improving canola plant growth and nutrient acquisition in sandy saline soil ,as a biological mean used to develop plant growth and nutrient uptake under salinity stress. Canola was cultivated in pots packed at rate of 7 kg saline sandy soil pot -1 , and inoculated with Rhizobium leguminosarum biovar viceae, Azospirillum brasilense strain no. 40 and arbuscular mycorrhizal fungi either solely or in combinations of them. Nitrogen fertilizer was added in form ( 15 NH 4 ) 2 SO 4 with 5% 15 N atom excess at rate of 0.99 g N pot -1 . Maximum dry matter accumulation induced by composite inoculation (Rh + Azo + AM). Na concentrations were frequently affected by Rhizobium and /or mycorrhizae while K was affected by Azospirillum and /or mycorrhizae. Azospirillum enhanced Ca uptake whereas Mg content was responded well to composite inoculants of Rh + Azo + AM. Dual inoculation with Rh + Azo resulted in the highest values of N uptake by plant. Similar effect was noticed with P uptake when dual inoculums of Azo + AM were applied. Data of 15 N isotope showed that the highest portion and value of N 2 -fixed was recorded with composite inoculums followed by dual inoculations. On the other hand, the infection with AM fungi gave the highest proportion of N derived from fertilizer as compared to other inoculants or uninoculated control. In the same trend, the fertilizer use efficiency (FUE%) was enhanced by AM infection. Dual inoculums of Rh + Azo induced highest content of proline in leaves. (Authors)

The ethylene-inhibitor aminoethoxyvinylglycine restores normal nodulation by Rhizobium leguminosarum biovar. viciae on Vicia sativa subsp. nigra by suppressing the 'Thick and short roots' phenotype

NARCIS (Netherlands)

Zaat, S. A.; van Brussel, A. A.; Tak, T.; Lugtenberg, B. J.; KIJNE, J. W.

1989-01-01

Nodulation of Vicia sativa subsp. nigra L. by Rhizobium bacteria is coupled to the development of thick and short roots (Tsr). This root phenotype as well as root-hair induction (Hai) and root-hair deformation (Had) are caused by a factor(s) produced by the bacteria in response to plant flavonoids.

Effects of high temperature on survival, symbiotic performance and genomic modifications of bean nodulating Rhizobium strains Sobrevivência, fixação de nitrogênio e modificações genéticas em estirpes de Rhizobium sp. efetivas na nodulação do feijoeiro, expostas à altas temperaturas

Directory of Open Access Journals (Sweden)

Patrícia P. Pinto

1998-10-01

Full Text Available High temperatures can affect the survival, establishment and symbiotic properties of Rhizobium strains. Bean nodulating Rhizobium strains are considered particularly sensitive because on this strains genetic recombinations and/or deletions occur frequently, thus compromising the use of these bacteria as inoculants. In this study R. tropici and R. leguminosarum bv. phaseoli strains isolated from Cerrado soils were exposed to thermal stress and the strains’ growth, survival and symbiotic relationships as well as alterations in their genotypic and phenotypic characteristics were analyzed. After successive thermal shocks at 45ºC for four hours, survival capacity appeared to be strain-specific, independent of thermo-tolerance and was more apparent in R. tropici strains. Certain R. leguminosarum bv. phaseoli strains had significant alterations in plant dry weight and DNA patterns obtained by AP-PCR method. R. tropici strains (with the exception of FJ2.21 were more stable than R. leguminosarum bv. phaseoli strains because no significant phenotypic alterations were observed following thermal treatments and they maintained their original genotypic pattern after inoculation in plants.Altas temperaturas podem afetar a sobrevivência, estabelecimento e as propriedades simbióticas em estirpes de Rhizobium. As estirpes capazes de nodular o feijoeiro têm sido consideradas particularmente sensíveis, porque nessas estirpes é comum a ocorrência de recombinações e/ou deleções genômicas comprometendo, muitas vezes, a sua utilização como inoculantes. Neste trabalho, procurou-se avaliar a capacidade de crescimento e sobrevivência em temperaturas elevadas de estirpes de Rhizobium efetivas na fixação de nitrogênio no feijoeiro isoladas dos cerrados, bem como avaliar suas características fenotípicas e genotípicas após choque térmico. A capacidade de sobrevivência à temperaturas elevadas, avaliada após choques térmicos sucessivos (45ºC por 4

[Signaling Systems of Rhizobia (Rhizobiaceae) and Leguminous Plants (Fabaceae) upon the Formation of a Legume-Rhizobium Symbiosis (Review)].

Science.gov (United States)

Glyan'ko, A K

2015-01-01

Data from the literature and our own data on the participation and interrelation of bacterial signaling Nod-factors and components of the calcium, NADPH-oxidase, and NO-synthase signaling systems of a plant at the preinfection and infectious stages of the formation of a legume-rhizobium symbiosis are summarized in this review. The physiological role of Nod-factors, reactive oxygen species (ROS), calcium (Ca2+), NADPH-oxidase, nitric oxide (NO), and their cross influence on the processes determining the formation of symbiotic structures on the roots of the host plant is discussed.

Produção de mudas de acácia colonizadas com micorrizas e rizóbio em diferentes recipientes Production of acacia plants colonized with mycorrhizas and rhizobium in different recipients

Directory of Open Access Journals (Sweden)

Jolimar Antonio Schiavo

2003-02-01

Full Text Available Realizou-se um experimento em casa de vegetação, com o objetivo de avaliar diferentes métodos na produção de mudas de Acacia mangium Willd, colonizadas com fungos micorrízicos arbusculares (FMAs e rizóbio. O delineamento experimental foi o inteiramente casualizado num esquema fatorial 4x2 (controle, FMAs, rizóbio e FMAs + rizóbio x blocos prensados e tubetes de plástico, com seis repetições. Os blocos prensados foram confeccionados com substratos orgânicos (bagaço de cana + torta de filtro de usina açucareira e vermiculita, colocados em fôrma metálica de 60x40x20 cm e prensados a 10 kgf cm-2, a fim de proporcionar agregação do material. A inoculação do rizóbio foi realizada com estirpe selecionada para a espécie (Br 3609, Br 6009. A inoculação de FMAs foi feita no momento da confecção dos blocos. Mudas de Acacia mangium que receberam inóculo de FMAs + rizóbio e produzidas em blocos prensados apresentaram maior produção de matéria seca e conteúdo de N na parte aérea. O conteúdo de P na parte aérea é significativamente maior somente nas mudas infectadas com os FMAs, independentemente do tipo de recipiente.A greenhouse experiment was carried out in order to evaluate different methods to produce Acacia mangium Willd plant seedlings, inoculated with arbuscular mycorrhizal fungi (AMF and rhizobium. A completely randomized design in a factorial scheme 4x2 (control, AMF, rhizobium and AMF + rhizobium x pressed blocks and plastic tubes, with six repetitions was used. The pressed blocks used to produce Acacia mangium plants were made with organic residue from sugarcane (sugarcane bagasse + filter cake and vermiculite. The inoculation with rhizobium was done with selected strain (Br 3609, Br 6009. The inoculation with AMF was done at the time when pressed blocks were made. Acacia mangium plants inoculated with both AMF + rhizobium led to a significant increase in dry matter yield and N content of shoot plants, only in

Effets de la fertilisation azotée, de l'inoculation par Rhizobium sp. et du régime des pluies sur la production de la biomasse et la teneur en azote du pois chiche

Directory of Open Access Journals (Sweden)

Lachaâl M.

2009-01-01

Full Text Available Effect of nitrogen fertilization, inoculation with Rhizobium sp. and precipitation on the biomass production and nitrogen content of chickpea. Water availability and soil fertility (especially soil N content are the major factors affecting chickpea yield in Mediterranean regions, characterized by low rainfall, poorly distributed and rapid mineralization of organic matter. In order to study the effect of N-fertilization and inoculation with Rhizobium on chickpea biomass production and N-content, field experiment were carried out at two stations of INRAT in northern Tunisia during two consecutive years, 2000-2001 and 2001-2002. Results showed that N-fertilization significantly increased shoot biomass and N-content while decreasing nodule mass. Inoculation with both the two Rhizobium strains resulted in nodule mass increase but the shoot N-content was not significantly affected. Regardless of the stations and treatments, rainfall decrease between the two years of the experiment significantly reduced shoot and root biomass while improving nodulation, especially at Oued Beja. However, the nodule developed under water deficit conditions was correlated with a very high decrease of the nitrogen fixed. Nevertheless, the mineral nitrogen apply in soil improved the N-content of aerial parts in the two stations, especially in waterless season.

Interaction of an IHF-like protein with the Rhizobium etli nifA promoter.

Science.gov (United States)

Benhassine, Traki; Fauvart, Maarten; Vanderleyden, Jos; Michiels, Jan

2007-06-01

The nifA gene fulfills an essential role in the regulation of nitrogen fixation genes in Rhizobium etli. Transcription analysis of the nifA gene, assessed using promoter deletions, indicated an oxygen-independent expression, threefold higher during symbiosis as compared with free-living conditions. Electrophoretic mobility shift assays using those nifA promoter deletion fragments, which were actively transcribed, demonstrated the specific interaction with R. etli cellular protein(s) resulting in the formation of two DNA-protein complexes. An interacting protein was purified by liquid chromatography on Heparin Sepharose and Mono S columns. The purified 12 kDa R. etli protein cross-reacted with antibodies directed against Escherichia coli integration host factor (IHF). Furthermore, purified E. coli IHF was able to specifically bind to the R. etli nifA promoter region. These results point to an as yet undisclosed function of IHF in the regulation of R. etli nifA expression.

Efecto de la inoculación con rizobios procedentes de Alberta, Canadá, en sorgo (Sorghum bicolor L. Moench, en condiciones de campo Effect of the inoculation with rhizobia from Alberta, Canada, in sorghum (Sorghum bicolor L. Moench, under field conditions

Directory of Open Access Journals (Sweden)

C. J Bécquer

2011-09-01

Full Text Available Se realizó un experimento de campo con el objetivo de medir el efecto de cepas de rizobio en las variables agronómicas del sorgo, en las condiciones ambientales de Sancti Spíritus, Cuba. Se utilizaron 10 cepas de Sinorhizobium meliloti, procedentes de ecosistemas ganaderos de Alberta, Canadá; así como cuatro cepas de referencia pertenecientes a diferentes géneros y especies de rizobio, que procedían de la colección de Agriculture and AgriFood Canada. La confección de los inóculos y la inoculación de las semillas se realizaron por métodos estándar. El diseño experimental fue de bloques al azar, con 16 tratamientos y cuatro réplicas. Se evaluó el peso seco aéreo, la longitud del tallo y la longitud de la panoja; además, se calculó el incremento del peso seco aéreo en los tratamientos inoculados con relación al control absoluto. Los resultados demostraron la capacidad de las cepas estudiadas de influir en las variables agronómicas, ya que los tratamientos seleccionados igualaron sus valores a los del control fertilizado y presentaron un incremento de más del 100% del peso seco aéreo, comparado con el control absoluto.A field trial was conducted with the objective of measuring the effect of rhizobium strains on the agronomic variables of sorghum under the environmental conditions of Sancti Spiritus, Cuba. Ten Sinorhizobium meliloti strains, from livestock production ecosystems of Alberta, Canada, were used; as well as four reference strains belonging to different rhizobium genera and strains, which were from the collection of Agriculture and AgriFood Canada. The inoculi confection and seed inoculation were made by standard methods. The experimental design was randomized blocks, with 16 treatments and four replications. The dry aerial weight, stem length and ear length were evaluated; in addition, the increase of aerial dry weight was calculated in the inoculated treatments as compared to the absolute control. The results

The Lipopolysaccharide Lipid A Long-Chain Fatty Acid Is Important for Rhizobium leguminosarum Growth and Stress Adaptation in Free-Living and Nodule Environments.

Science.gov (United States)

Bourassa, Dianna V; Kannenberg, Elmar L; Sherrier, D Janine; Buhr, R Jeffrey; Carlson, Russell W

2017-02-01

Rhizobium bacteria live in soil and plant environments, are capable of inducing symbiotic nodules on legumes, invade these nodules, and develop into bacteroids that fix atmospheric nitrogen into ammonia. Rhizobial lipopolysaccharide (LPS) is anchored in the bacterial outer membrane through a specialized lipid A containing a very long-chain fatty acid (VLCFA). VLCFA function for rhizobial growth in soil and plant environments is not well understood. Two genes, acpXL and lpxXL, encoding acyl carrier protein and acyltransferase, are among the six genes required for biosynthesis and transfer of VLCFA to lipid A. Rhizobium leguminosarum mutant strains acpXL, acpXL - /lpxXL - , and lpxXL - were examined for LPS structure, viability, and symbiosis. Mutations in acpXL and lpxXL abolished VLCFA attachment to lipid A. The acpXL mutant transferred a shorter acyl chain instead of VLCFA. Strains without lpxXL neither added VLCFA nor a shorter acyl chain. In all strains isolated from nodule bacteria, lipid A had longer acyl chains compared with laboratory-cultured bacteria, whereas mutant strains displayed altered membrane properties, modified cationic peptide sensitivity, and diminished levels of cyclic β-glucans. In pea nodules, mutant bacteroids were atypically formed and nitrogen fixation and senescence were affected. The role of VLCFA for rhizobial environmental fitness is discussed.

Draft Genome Sequence of Rhizobium sp. Strain TBD182, an Antagonist of the Plant-Pathogenic Fungus Fusarium oxysporum, Isolated from a Novel Hydroponics System Using Organic Fertilizer.

Science.gov (United States)

Iida, Yuichiro; Fujiwara, Kazuki; Someya, Nobutaka; Shinohara, Makoto

2017-03-16

Rhizobium sp. strain TBD182, isolated from a novel hydroponics system, is an antagonistic bacterium that inhibits the mycelial growth of Fusarium oxysporum but does not eliminate the pathogen. We report the draft genome sequence of TBD182, which may contribute to elucidation of the molecular mechanisms of its fungistatic activity. Copyright © 2017 Iida et al.

Effect in field of the native strain COL6 of Rhizobium leguminosarum bv. viciae on common bean cv. Percal in Ecuador

Directory of Open Access Journals (Sweden)

Klever Iván Granda-Mora

2017-07-01

Full Text Available Inoculation with selected Rhizobium strains of common bean (Phaseolus vulgaris L. contributes to the agricultural yield of this legume, improves soil fertility and reduces the use of nitrogen fertilizers in sustainable agricultural systems. The research aimed to determine the effect in field of the native strain Rhizobium leguminosarum bv. viciae COL6 on growth, N fixation and agricultural yield in common bean cv. Percal. A field trial was carried out to evaluate the parameters of nodulation, biomass, nitrogen fixation, yield components and agricultural yield in common bean. In addition, soil analyzes were performed before and after experimentation. Prior to planting an inoculant was formulated with the strain COL6. The seeds of cv. Percal were mixed in 250 g inoculant per 10 kg of seed and it was sown manually in the soil. The results of growth, N fixation (total N % and agricultural yield demonstrated the positive effect of inoculation with the bacterial inoculant comparable with chemical fertilizers. The increase in agricultural yield with bacterial inoculant application and chemical fertilization with respect to control was 62 and 64 %, respectively. The results of the soil analysis were variable with respect to the initial physical-chemical characteristics. The promising results of bacterial inoculant use and the effective stimulation in common bean, open the doors for its potential use in Ecuadorian soils and with that the desired potential yield can be reached.

Identification of the rctA Gene, Which Is Required for Repression of Conjugative Transfer of Rhizobial Symbiotic Megaplasmids†

Science.gov (United States)

Pérez-Mendoza, Daniel; Sepúlveda, Edgardo; Pando, Victoria; Muñoz, Socorro; Nogales, Joaquina; Olivares, José; Soto, Maria J.; Herrera-Cervera, José A.; Romero, David; Brom, Susana; Sanjuán, Juan

2005-01-01

An analysis of the conjugative transfer of pRetCFN42d, the symbiotic plasmid (pSym) of Rhizobium etli, has revealed a novel gene, rctA, as an essential element of a regulatory system for silencing the conjugative transfer of R. etli pSym by repressing the transcription of conjugal transfer genes in standard laboratory media. The rctA gene product lacks sequence conservation with other proteins of known function but may belong to the winged-helix DNA-binding subfamily of transcriptional regulators. Similar to that of many transcriptional repressors, rctA transcription seems to be positively autoregulated. rctA expression is greatly reduced upon overexpression of another gene, rctB, previously identified as a putative activator of R. etli pSym conjugal transfer. Thus, rctB seems to counteract the repressive action of rctA. rctA homologs are present in at least three other bacterial genomes within the order Rhizobiales, where they are invariably located adjacent to and divergently transcribed from putative virB-like operons. We show that similar to that of R. etli pSym, conjugative transfer of the 1.35-Mb symbiotic megaplasmid A of Sinorhizobium meliloti is also subjected to the inhibitory action of rctA. Our data provide strong evidence that the R. etli and S. meliloti pSym plasmids are indeed self-conjugative plasmids and that this property would only be expressed under optimal, as yet unknown conditions that entail inactivation of the rctA function. The rctA gene seems to represent novel but probably widespread regulatory systems controlling the transfer of conjugative elements within the order Rhizobiales. PMID:16237017

Agro-Economic Optimization of Fertilizer Level and Rhizobium Strains for Enhanced Grain Yield in Mungbean (Vigna Radiata L.)

International Nuclear Information System (INIS)

Mansoor, M.; Elahi, M. E.; Islam, Z.; Ali, A.

2016-01-01

To explore the effect of PGPR for improvement in grain yield of mungbean, different levels of fertilizer (00:00, 20:50 and 20:70 kg N:P/sub 2/O/sub 5/ kg ha/sup -1/) were tested on four strains (CB 1015 Australia, Vm-L1, Vm-M1 and Vm-M2) at Agricultural Research Institute, Dera Ismail Khan. A Randomized Complete Block Design with split plot arrangement was used to conduct the experiment by keeping three fertilizer levels in the main plot and Rhizobium strains in sub-plot. The data were recorded for different parameters like number of branches plant/sup -1/, number of clusters plant/sup -1/, number of pods plant/sup -1/., number of grain pod/sup -1/, pod length (cm) and grain yield kg ha/sup -1/. The response of fertilizer levels and inoculation with Rhizobium strains were found significant in most of the parameters under study. The strain Vm-M1 produced the highest number of branches plant/sup -1/(5.42), number of clusters plant/sup -1/(22.92), number of pods plant/sup -1/(77.64), pod length (8.37 cm) when applied in combination of N:P/sub 2/O/sub 5/ at the rate of 20:70 and 20:50 kg ha/sup -1/. Although the grain yield (1421 kg ha/sup -1/) recorded in treatment (20:70 kg N:P/sub 2/O/sub 5/ ha/sup -1/ + Inoculation with strain Vm M1) was highest but economically the treatment (20:50 kg N:P/sub 2/O/sub 5/ ha/sup -1/ + inoculation with strain Vm M1) with net return of Rs. 13618 ha/sup -1/ and BCR of 2.52 was on top. (author)

Analysis of Poly-β-Hydroxybutyrate in Rhizobium japonicum Bacteroids by Ion-Exclusion High-Pressure Liquid Chromatography and UV Detection †

Science.gov (United States)

Karr, Dale B.; Waters, James K.; Emerich, David W.

1983-01-01

Ion-exclusion high-pressure liquid chromatography (HPLC) was used to measure poly-β-hydroxybutyrate (PHB) in Rhizobium japonicum bacteroids. The products in the acid digest of PHB-containing material were fractionated by HPLC on Aminex HPX-87H ion-exclusion resin for organic acid analysis. Crotonic acid formed from PHB during acid digestion was detected by its intense absorbance at 210 nm. The Aminex-HPLC method provides a rapid and simple chromatographic technique for routine analysis of organic acids. Results of PHB analysis by Aminex-HPLC were confirmed by gas chromatography and spectrophotometric analysis. PMID:16346443

Induction of fungal disease resistance in Vicia faba by dual inoculation with Rhizobium leguminosarum and vesicular-arbuscular mycorrhizal fungi.

Science.gov (United States)

Rabie, G H

1998-01-01

Infection of Vicia faba with Bothytis fabae causes significant decreases in growth vigour, total nitrogen content, number of nodules and nutrient accumulation. Na-uptake and phenolics concentration increased compared to that of noninfected plants. In contrast, dual inoculation of Rhizobium and VA mycorrhizae increased all above parameters suggesting a distinct improvement of the plants. The results also revealed that an inverse correlation may exist between phenolic, calcium, magnesium and zinc concentrations in mycorrhizal plant tissues grown in presence of rhizobial bacteria and the disease severity. From these findings we conclude a possible role of both VA mycorrhizal fungi and rhizobial bacteria in the decrease of susceptibility of plants.

Effect of different substrates on growth of Mimosa bimucronata seedlings inoculate with rhizobium

Directory of Open Access Journals (Sweden)

Juliana Müller Freire

2017-06-01

Full Text Available The objective of this study was to evaluate the growth response of Mimosa bimucronata (DC O. Kuntze seedlings in nursery conditions to inoculation with rhizobium strains previously selected using different substrates. An experimental design of randomized blocks with split plots was used, testing three substrates (pure organic-containing clay, sand and manure in 1: 1: 1 v: v: v ratio; organomineral mixed with 30% straw and sand with vermiculite in 1: 1 v: v and four N sources (inoculation with strains BR 3461 and BR 3470, control with N fertilization and control without fertilization, totalizing 12 treatments. Height and stem diameter were evaluate after 90 days and shoot, root and nodules dry mass were evaluate after 120 days. Organomineral substrates provided better seedling growth. However, only organic-substrate with straw and sand with vermiculite showed positive responses of plants inoculated with BR3470 strain. The performance of the inoculated seedlings was not higher than that of seedlings fertilized with N. The rate of N applied stimulated nodulation rather than inhibit it.

Concurrent synthesis and release of nod-gene-inducing flavonoids from alfalfa roots

International Nuclear Information System (INIS)

Maxwell, C.A.; Phillips, D.A.

1990-01-01

Flavonoid signals from alfalfa (Medicago sativa L.) induce transcription of nodulation (nod) genes in Rhizobium meliloti. Alfalfa roots release three major nod-gene inducers: 4',7-dihydroxyflavanone, 4',7-dihydroxyflavone, and 4,4'-dihydroxy-2'-methoxychalcone. The objective of the present study was to define temporal relationships between synthesis and exudation for those flavonoids. Requirements for concurrent flavonoid biosynthesis were assessed by treating roots of intact alfalfa seedlings with [U- 14 C]-L-phenylalanine in the presence or absence of the phenylalanine ammonia-lyase inhibitor L-2-aminoxy-3-phenylpropionic acid (AOPP). In the absence of AOPP, each of the three flavonoids in exudates contained 14 C. In the presence of AOPP, 14 C labeling and release of all the exuded nod-gene inducers were reduced significantly. AOPP inhibited labeling and release of the strongest nod-gene inducer, methoxychalcone, by more than 90%. The release process responsible for exudation of nod-gene inducers appears to be specific rather than a general phenomenon such as a sloughing off of cells during root growth

Re-examination of cellular cyclic beta-1,2-glucans of Rhizobiaceae: distribution of ring sizes and degrees of glycerol-1-phosphate substitution.

Science.gov (United States)

Zevenhuizen, L P; van Veldhuizen, A; Fokkens, R H

1990-04-01

Gel-filtration and thin layer chromatography of low molecular weight carbohydrates from culture filtrates of Agrobacterium radiobacter, Isolate II, have shown, that next to the neutral beta-1,2-glucan fraction a major acidic fraction was present which was found to be glycerophosphorylated cyclic beta-1,2-glucans. Re-examination of cyclic beta-1,2-glucan preparations which had been obtained by extraction of Rhizobium cells with hot phenol-water also showed these acidic modified beta-1,2-glucans to be present. Cyclic beta-1,2-glucans from R. leguminosarum (9 strains) and of R. phaseoli (1 strain) had ring size distribution with degrees of polymerisation (DPs) of 19 and 20 as major ring sizes of which a minor part was glycerophosphorylated; beta-1,2-glucans of R. trifolii (3 strains) had ring sizes with DPs measuring 19-22 as prominent components which were largely unsubstituted, and R. meliloti (7 strains) had beta-1,2-glucans with ring size distributions extending to still higher DPs of 19-25 of which the major part appeared to be glycerophosphorylated.

Forestación de un terreno decapitado con Robinia pseudoacacia inoculada con Rhizobium spp. y Glomus deserticola Afforestation of a desurfaced field with Robinia pseudoacacia inoculated with Rhizobium spp. and Glomus deserticola

Directory of Open Access Journals (Sweden)

Alejandro E Ferrari

2010-07-01

Full Text Available Los terrenos decapitados constituyen un caso extremo de degradación de suelos aptos para agricultura, con graves consecuencias ambientales. El propósito de este trabajo fue ensayar los efectos de la inoculación de acacia blanca (Robinia pseudoacacia L. con una cepa efectiva de Rhizobium y un hongo de micorrizas arbusculares (Glomus deserticola en la supervivencia y crecimiento temprano de plantas trasplantadas a un terreno decapitado de Balcarce, comparando con fresno como árbol no fijador de nitrógeno. La supervivencia inicial fue muy buena (mayor del 77%, especialmente para los fresnos y las acacias inoculadas, las cuales mostraron significativamente mayor supervivencia al estrés por sequía que las acacias control. Todas las plantas se mostraron igualmente tolerantes al ataque de liebres y al estrés por heladas tardías. Durante el primer año las acacias inoculadas crecieron más rápido que las no inoculadas. En el segundo año las alturas se equipararon en parte, probablemente por la colonización de las acacias control con rizobios o micorrizas naturales del suelo. De todos modos, las acacias inoculadas siempre mostraron valores mayores de los distintos parámetros de desarrollo (altura total, diámetro de la copa y cantidad de ramificaciones que las plantas control, tanto en los sectores poco decapitados como en los más severamente degradados. En conclusión, la doble inoculación previa de acacia blanca mejoró la supervivencia inicial, aumentó tolerancia a la sequía y el crecimiento en 2 años y medio desde la plantación. Esta práctica de manejo sería entonces muy recomendable para reducir el período de vivero en la producción de árboles, así como lograr ejemplares más resistentes y mejor adaptados para proyectos de recuperación de suelos degradados.Many agricultural lands in Buenos Aires Province (Argentina have traditionally been desurfaced for the manufacture of bricks and other building materials. The desurfaced

Uso de micorrizas e rizóbio em cultivo consorciado de eucalipto e sesbânia: II - Absorção e eficiência de utilização de fósforo e frações fosfatadas Use of mycorrhizas and rhizobium in intercropping system of eucalyptus and sesbania: II - Phosphorus uptake and efficiency of use and phosphate phosphate -fractions

Directory of Open Access Journals (Sweden)

L. A. Rodrigues

2003-08-01

Full Text Available Realizou-se um experimento em casa de vegetação com o objetivo de avaliar os efeitos de fungos micorrízicos arbusculares (FMAs e rizóbio na absorção e eficiência de utilização de P e nas frações fosfatadas em mudas de Eucalyptus grandis, cultivadas em consorciação com Sesbania virgata. Os tratamentos foram: inoculação ou não com FMAs em ambas as espécies de plantas e inoculação ou não com rizóbio na S. virgata, com quatro repetições. Ambas as plantas foram cultivadas em vasos de 6 L de capacidade, durante 100 dias, quando foram colhidas. A inoculação com FMAs ou FMAs + rizóbio aumentou o conteúdo de P no eucalipto, enquanto a inoculação com rizóbio, FMAs ou FMAs + rizóbio aumentou a eficiência de utilização de P. Nas frações de P, avaliadas nas folhas de eucalipto, observou-se aumento do fósforo total solúvel em ácido (PST nos tratamentos com inoculação de rizóbio ou FMAs + rizobio. Nos tratamentos com inoculação com rizóbio, FMAs, FMAs+rizóbio ou sem inoculação, observou-se que 81, 32, 91 e 68%, respectivamente, do PST foram encontrados como fósforo orgânico (Po. Em uma avaliação conjunta das frações fosfatadas e do conteúdo de P na parte aérea do eucalipto, o que aparentemente influenciou o aumento do PST e do Po não foi o conteúdo interno de P na planta, mas, sim, a inoculação do rizóbio na sesbânia.The effects of arbuscular mycorrhizal fungi (AMF and Rhizobium on P uptake and efficiency of use, as well as on the P fractions of Eucalyptus grandis grown in an intercropping system with Sesbania virgata were evaluated under greenhouse conditions. The treatments were: with or without inoculation with AMF of both plant species and with or without inoculation with Rhizobium of S. virgata plants only, in four replications. The two plant species were grown together in pots with a volume of 6 L for 100 days. Inoculations with AMF or with AMF + Rhizobium increased the P content in Eucalyptus

Damping Effects in Aerospace Structures

Science.gov (United States)

1979-10-01

Fourier transform of the weighting function h(T) + 00 m -00 Is eaUed the frequency response function. TV« H(u) - j h(T) e"Jwt dr , l... traitement par revitemnt simple a permis une attenuation de Vordre de 3 dB, ramenSc I l’enseflfcle sur la frequence de rotation et de 4 (ffi pour...raidisseurs cir- conf§rentiels et longitudinaux. D’autre part, la masse 3 consacrer au traitement acoustlque est fixge. La question est done posfie

A Rhizobium leguminosarum CHDL- (Cadherin-Like-) Lectin Participates in Assembly and Remodeling of the Biofilm Matrix

DEFF Research Database (Denmark)

Vozza, Nicolás F.; Abdian, Patricia L; Russo, Daniela M

2016-01-01

In natural environments most bacteria live in multicellular structures called biofilms. These cell aggregates are enclosed in a self-produced polymeric extracellular matrix, which protects the cells, provides mechanical stability and mediates cellular cohesion and adhesion to surfaces. Although...... important advances were made in the identification of the genetic and extracellular factors required for biofilm formation, the mechanisms leading to biofilm matrix assembly, and the roles of extracellular proteins in these processes are still poorly understood. The symbiont Rhizobium leguminosarum requires...... the synthesis of the acidic exopolysaccharide and the PrsDE secretion system to develop a mature biofilm. PrsDE is responsible for the secretion of the Rap family of proteins that share one or two Ra/CHDL (cadherin-like-) domains. RapA2 is a calcium-dependent lectin with a cadherin-like β sheet structure...

Inter-replicon Gene Flow Contributes to Transcriptional Integration in the Sinorhizobium meliloti Multipartite Genome.

Science.gov (United States)

diCenzo, George C; Wellappili, Deelaka; Golding, G Brian; Finan, Turlough M

2018-05-04

Integration of newly acquired genes into existing regulatory networks is necessary for successful horizontal gene transfer (HGT). Ten percent of bacterial species contain at least two DNA replicons over 300 kilobases in size, with the secondary replicons derived predominately through HGT. The Sinorhizobium meliloti genome is split between a 3.7 Mb chromosome, a 1.7 Mb chromid consisting largely of genes acquired through ancient HGT, and a 1.4 Mb megaplasmid consisting primarily of recently acquired genes. Here, RNA-sequencing is used to examine the transcriptional consequences of massive, synthetic genome reduction produced through the removal of the megaplasmid and/or the chromid. Removal of the pSymA megaplasmid influenced the transcription of only six genes. In contrast, removal of the chromid influenced expression of ∼8% of chromosomal genes and ∼4% of megaplasmid genes. This was mediated in part by the loss of the ETR DNA region whose presence on pSymB is due to a translocation from the chromosome. No obvious functional bias among the up-regulated genes was detected, although genes with putative homologs on the chromid were enriched. Down-regulated genes were enriched in motility and sensory transduction pathways. Four transcripts were examined further, and in each case the transcriptional change could be traced to loss of specific pSymB regions. In particularly, a chromosomal transporter was induced due to deletion of bdhA likely mediated through 3-hydroxybutyrate accumulation. These data provide new insights into the evolution of the multipartite bacterial genome, and more generally into the integration of horizontally acquired genes into the transcriptome. Copyright © 2018 diCenzo, et al.

Inter-replicon Gene Flow Contributes to Transcriptional Integration in the Sinorhizobium meliloti Multipartite Genome

Directory of Open Access Journals (Sweden)

George C. diCenzo

2018-05-01

Full Text Available Integration of newly acquired genes into existing regulatory networks is necessary for successful horizontal gene transfer (HGT. Ten percent of bacterial species contain at least two DNA replicons over 300 kilobases in size, with the secondary replicons derived predominately through HGT. The Sinorhizobium meliloti genome is split between a 3.7 Mb chromosome, a 1.7 Mb chromid consisting largely of genes acquired through ancient HGT, and a 1.4 Mb megaplasmid consisting primarily of recently acquired genes. Here, RNA-sequencing is used to examine the transcriptional consequences of massive, synthetic genome reduction produced through the removal of the megaplasmid and/or the chromid. Removal of the pSymA megaplasmid influenced the transcription of only six genes. In contrast, removal of the chromid influenced expression of ∼8% of chromosomal genes and ∼4% of megaplasmid genes. This was mediated in part by the loss of the ETR DNA region whose presence on pSymB is due to a translocation from the chromosome. No obvious functional bias among the up-regulated genes was detected, although genes with putative homologs on the chromid were enriched. Down-regulated genes were enriched in motility and sensory transduction pathways. Four transcripts were examined further, and in each case the transcriptional change could be traced to loss of specific pSymB regions. In particularly, a chromosomal transporter was induced due to deletion of bdhA likely mediated through 3-hydroxybutyrate accumulation. These data provide new insights into the evolution of the multipartite bacterial genome, and more generally into the integration of horizontally acquired genes into the transcriptome.

Lipopolysaccharides of Rhizobium etli strain G12 act in potato roots as an inducing agent of systemic resistance to infection by the cyst nematode Globodera pallida.

Science.gov (United States)

Reitz, M; Rudolph, K; Schröder, I; Hoffmann-Hergarten, S; Hallmann, J; Sikora, R A

2000-08-01

Recent studies have shown that living and heat-killed cells of the rhizobacterium Rhizobium etli strain G12 induce in potato roots systemic resistance to infection by the potato cyst nematode Globodera pallida. To better understand the mechanisms of induced resistance, we focused on identifying the inducing agent. Since heat-stable bacterial surface carbohydrates such as exopolysaccharides (EPS) and lipopolysaccharides (LPS) are essential for recognition in the symbiotic interaction between Rhizobium and legumes, their role in the R. etli-potato interaction was studied. EPS and LPS were extracted from bacterial cultures, applied to potato roots, and tested for activity as an inducer of plant resistance to the plant-parasitic nematode. Whereas EPS did not affect G. pallida infection, LPS reduced nematode infection significantly in concentrations as low as 1 and 0.1 mg ml(-1). Split-root experiments, guaranteeing a spatial separation of inducing agent and challenging pathogen, showed that soil treatments of one half of the root system with LPS resulted in a highly significant (up to 37%) systemic induced reduction of G. pallida infection of potato roots in the other half. The results clearly showed that LPS of R. etli G12 act as the inducing agent of systemic resistance in potato roots.

Mekanisme Penambatan Nitrogen Udara oleh Bakteri Rhizobium Menginspirasi Perkembangan Teknologi Pemupukan Organik yang Ramah Lingkungan

Directory of Open Access Journals (Sweden)

GEDE MENAKA ADNYANA

2014-01-01

Full Text Available Interaction of microbes with human living in the nature are able to seen from their capabilitiesimproving the environmental by composting waste of agriculture to become organic fertilizer. In thecontrary, the epidemic and infectious phatogens are also its contribution. In agriculture sector, the livingof microbes has been explored to keep the soil fertile, and to improve growth and plant production.The symbiosis of Rhizobium bacteria with the specific host plant from legumes is able to run because ofboth side giving a signal, where host plant give an organic molecoles called inducer. From the bacteriaside, also give an organic materials called nod factor. The step of nitrogen fixation mechanism can bedescribed from infection of root legume as the first step, followed by the nitrogen fixation by thebacteroid and synthesis of the nitrogen organic by host plant as the last step. These natural processesinspire finding and development of the ecologically organic fertilizer technology.

Rhizobium laguerreae is the main nitrogen-fixing symbiont of cultivated lentil (Lens culinaris) in Morocco.

Science.gov (United States)

Taha, Kaoutar; Berraho, El Bekkay; El Attar, Imane; Dekkiche, Samia; Aurag, Jamal; Béna, Gilles

2018-03-01

Genetic diversity and population structure of 268 Lens culinaris symbiotic rhizobia collected from 40 cultivated fields in the main lentil production regions in Morocco were estimated. Three chromosomal housekeeping genes (recA, glnII and atpD) and one common symbiotic gene (nodC) were sequenced and analyzed in order to identify the local symbionts of lentil. The molecular phylogeny of the concatenated housekeeping genes clustered more than 95% of the isolates in one main clade together with Rhizobium laguerreae species. R. laguerreae represents the main symbiont of cultivated lentil in Morocco and, for the first time, a large sample of individuals is obtained for this species. There is a significant and high genetic differentiation of bacterial populations among the four regions for their symbiotic gene, and much lower for their housekeeping genes. The reasons why R. laguerreae is so frequently recovered in our study is discussed. Copyright © 2018 Elsevier GmbH. All rights reserved.

Biotreatment of paper mill effluent using alkaliphilic Rhizobium sp. NCIM 5590 isolated from meteoric alkaline Lonar Lake, Buldhana District, Maharashtra, India

DEFF Research Database (Denmark)

Raut, Avinash A.; Phugare, Swapnil S.; Kalyani, Dayanand C.

2018-01-01

Bacterial strain Rhizobium sp. was isolated from littoral soil of meteoric alkaline Lonar Lake and used to treat paper mill waste water. The bacterium was found to fix 125.7 nmol of C2H4 formed ml−1 culture media in 72 hr by ARA (acetylene reduction assay). The optimum pH for its growth was 12, w...... was studied using Allium cepa root cells, evaluating various biochemical parameters to assess the toxicity, including lipid peroxidation, protein oxidation, antioxidant enzyme status (catalase, superoxide dismutase) and genotoxicity assays using single cell gel electrophoresis (SCGE)....

Rhizobium Strain Effects on Yield and Bleeding Sap Amino Compounds in Pisum sativum

DEFF Research Database (Denmark)

Rosendahl, Lis

1984-01-01

Bleeding sap composition, dry matter production and N distribution in pea (P. sativum L. cv. Bodil) grown with and without nitrate and nodulated with either R. leguminosarum strain 128c53 or strain 1044 were compared. Nitrate increased the total dry matter production of both symbioses, but decrea......Bleeding sap composition, dry matter production and N distribution in pea (P. sativum L. cv. Bodil) grown with and without nitrate and nodulated with either R. leguminosarum strain 128c53 or strain 1044 were compared. Nitrate increased the total dry matter production of both symbioses...... relative to the total N-accumulation was greater with strain 128c53 due to a higher production of nodule tissue. The root bleeding sap of the symbiosis with the greater yield (strain 1044) contained high levels of asparagine and aspartic acid. In the 128c53 symbiosis, glutamine plus homoserine accounted...... for a higher percentage of the organic solutes transporting newly assimilated N from the root system than in the association with 1044. The Rhizobium strain effect on amino compound composition of the bleeding sap may indicate an influence of the bacteroids on either the N-assimilatory enzyme system...

Micorriza arbuscular e rizóbios no enraizamento e nutrição de mudas de angico-vermelho Arbuscular mycorrhizae and rhizobium in rooting and nutrition of angico-vermelho seedlings

Directory of Open Access Journals (Sweden)

Poliana Coqueiro Dias

2012-12-01

Full Text Available O objetivo deste estudo foi avaliar o efeito da inoculação dos fungos micorrízicos arbusculares (FMAs e rizóbio no enraizamento, crescimento e nutrição de mudas de angico-vermelho (Anadenanthera macrocarpa (Benth Brenan propagadas via miniestaquia. Foram utilizadas seis progênies, das quais foram confeccionadas miniestacas com um par de folhas inteiras, bem como tubetes de 55 cm³ contendo substrato comercial Bioplant®. Foram testados quatro tratamentos: 8 kg m-3 de superfosfato simples (SS misturados ao substrato; 4 kg m-3 de SS misturados ao substrato; 4 kg m-3 de SS misturados ao substrato e adição de suspensão contendo rizóbios; e 4 kg m-3 de SS e adição de suspensão contendo rizóbios e 5 g de solo contendo esporos de FMAs. Não houve interação entre os tratamentos para percentagem de sobrevivência das miniestacas e percentagem de miniestacas com raízes observadas na extremidade inferior do tubete, na saída da casa de vegetação (30 dias e da casa de sombra (40 dias, provavelmente em função do sistema radicular ainda estar em formação. Houve diferenças entre as progênies para percentagem de sobrevivência das miniestacas, percentagem de miniestacas com raízes observadas na extremidade inferior do tubete, altura, diâmetro de colo e massa seca da parte aérea. As avaliações das características de crescimento das miniestacas enraizadas, principalmente com relação à sobrevivência a pleno sol (140 dias, evidenciam a eficiência dos rizóbios e FMAs na produção de mudas desta espécie. Conclui-se que a associação simbiótica com rizóbio e/ou FMA favorece a produção de mudas de A. macrocarpa via miniestaquia.The objective of this study was to evaluate the effect of inoculation of arbuscular mycorrhizae fungi (AMF and rhizobium on rooting, growth and nutrition of seedlings of angico-red (Anadenanthera macrocarpa (Benth Brenan propagated by minicutting. Six progenies were used, of which were prepared

Extracellular polysaccharides are involved in the attachment of Azospirillum brasilense and Rhizobium leguminosarum to arbuscular mycorrhizal structures

Directory of Open Access Journals (Sweden)

V Bianciotto

2009-12-01

Full Text Available Arbuscular mycorrhizal (AM fungi, one of the most important component of the soil microbial community, establish physical interactions with naturally occurring and genetically modified bacterial biofertilizers and biopesticides, commonly referred to as plant growth-promoting rhizobacteria (PGPR. We have used a genetic approach to investigate the bacterial components possibly involved in the attachment of two PGPR (Azospirillum and Rhizobium to AM roots and AM fungal structures. Mutants affected in extracellular polysaccharides (EPS have been tested in in vitro adhesion assays and shown to be strongly impaired in the attachment to both types of surfaces as well as to quartz fibers. Anchoring of rhizobacteria to AM fungal structures may have special ecological and biotechnological significance because it may facilitate colonisation of new rhizospheres by the bacteria, and may be an essential trait for the development of mixed inocula.

Perturabation of nodular operation under salt and water deficit stress in rhizobium common bean symbiosis

International Nuclear Information System (INIS)

Harzalli Jebara, Salwa

2006-01-01

This work aims at the search for markers of tolerance to the osmotic stress and nodular efficiency of symbiosis Haricot Rhizobium. Thus, after having fixed the best period of hydroponic culture, we showed that a severe salt treatment generated an inhibition of the parameters of growth and nodulation. These inhibitions are accompanied by an inhibition of the enzymatic activities: ascorbate peroxidase (APX) and catalase (CAT), but an activation of peroxidase (POX) and superoxide dismutase (SOD), suggesting that these two antioxydants can be biochemical markers of the tolerance to salinity. To check the validity of these markers and to see the participation of the vegetable genotype in the response to the stress, we compared the effect of two concentrations salt 25 and 50 mM NaCe at two contrasting genotypes BAT477 tolerant and sensitive COCOT. This study illustrates the role of the vegetable genotype in the tolerance and efficiency and emphasize a significant result that SOD and POX constitute biochemical markers of tolerance to salinity. In order to ensure itself of the validity of this assumption in the event of water deficit stress, a treatment of 50 mM mannitol is applied to 16 symbioses formed by four genotypes of bean BAT477, COCOT, Flamingo and BRB17 inoculated by four strains of rhizobium CIAT899, 12 to 3, 1 to 6 and 8 to 3. This study permits us to make a screening of these symbioses according to their efficiency and their tolerance based on parameters of growth, of fixing and extent of the antioxydant enzymatic activities. It gets clear that the response of enzymatic antioxydants is in relation to the intrinsic potentialities of the partners of symbioses and appears to act as of the first stages of recognition plants bacterium. It will be retained that activities POX and SOD are markers of nodular tolerance. The CAT is the enzyme most connected to each partner of symbiosis and the APX would play a rather functional role. The heterogeneity of found answer

[Formation and function of the bean-rhizobium symbiosis in soy plants upon introduction of strains of Azotobacter and Bacillus species].

Science.gov (United States)

Mel'nikova, N N; Bulavenko, L V; Kurdish, I K; Titova, L V; Kots', S Ia

2002-01-01

The effects of bacteria belonging to the genera Azotobacter and Bacillus in a mixed culture with Bradyrhizobium japonicum strains on formation and function of the legume-rhizobium symbiosis of soybean plants were studied. The data showed that the bacterial compositions B. japonicum 634b + B. subtilis 5, B. japonicum 634b + A. chroococcum 20, and B. japonicum 10k + A. vinelandii 56 with a cell ratio of 1:0.1 increased the number and weight of root nodules as well as the height and weight of the aboveground plant parts in almost all the cases by 22-105% compared with the control variants. These binary microbial cultures may be used for development of combined bacterial preparations for soybean.

Mining the Sinorhizobium meliloti transportome to develop FRET biosensors for sugars, dicarboxylates and cyclic polyols.

Directory of Open Access Journals (Sweden)

Alexandre Bourdès

Full Text Available Förster resonance energy transfer (FRET biosensors are powerful tools to detect biologically important ligands in real time. Currently FRET bisosensors are available for twenty-two compounds distributed in eight classes of chemicals (two pentoses, two hexoses, two disaccharides, four amino acids, one nucleobase, two nucleotides, six ions and three phytoestrogens. To expand the number of available FRET biosensors we used the induction profile of the Sinorhizobium meliloti transportome to systematically screen for new FRET biosensors.Two new vectors were developed for cloning genes for solute-binding proteins (SBPs between those encoding FRET partner fluorescent proteins. In addition to a vector with the widely used cyan and yellow fluorescent protein FRET partners, we developed a vector using orange (mOrange2 and red fluorescent protein (mKate2 FRET partners. From the sixty-nine SBPs tested, seven gave a detectable FRET signal change on binding substrate, resulting in biosensors for D-quinic acid, myo-inositol, L-rhamnose, L-fucose, β-diglucosides (cellobiose and gentiobiose, D-galactose and C4-dicarboxylates (malate, succinate, oxaloacetate and fumarate. To our knowledge, we describe the first two FRET biosensor constructs based on SBPs from Tripartite ATP-independent periplasmic (TRAP transport systems.FRET based on orange (mOrange2 and red fluorescent protein (mKate2 partners allows the use of longer wavelength light, enabling deeper penetration of samples at lower energy and increased resolution with reduced back-ground auto-fluorescence. The FRET biosensors described in this paper for four new classes of compounds; (i cyclic polyols, (ii L-deoxy sugars, (iii β-linked disaccharides and (iv C4-dicarboxylates could be developed to study metabolism in vivo.

BOOKLET TO INSTITUTO PEDAGOGICO NACIONAL TEACHERS ABOUT SYMBIOSIS AND PROCESSES ON BIOTECHNOLOGY: THE BIOFERTILIZER Rhizobium sp IN Phaseolus vulgaris WITH ALTERNATIVE TO SYMBIOSIS FOR Phaseolus vulgaris

Directory of Open Access Journals (Sweden)

María Camila Quevedo Rubiano

2016-09-01

Full Text Available This article presents the results of the thesis carried out in the research group of Biotechnology Teaching in Colombia, with the aim of providing teachers of Biology of Instituto Pedagogico Nacional a booklet that can strengthen the teaching of biotechnology processes using Rhizobium sp reduction of chemical fertilizers and symbiosis with Phaseolus vulgaris.   The booklet contains a proposal of practical activities that enable teachers of this institution to use spaces like the farm, enabling to teach biotechnology related to agronomy. Therefore, for this project was considered two Biological and Pedagogical approaches, the first is within the analytical empirical paradigm in the process of microbiological characterization of Rhizobium and their Biofertilizing ability in beans; and the teaching approach within the design of a booklet that includes the findings of this study as a contribution to the reduction of chemical fertilizers school farm. In order to have a complete analysis of the work it was subjected to quantitative and qualitative methods.   This biotech practice is included in the booklet showing in bioassays that bacteria has biofertilizer without inhibiting potential symbiosis, and that research and teaching biological concepts from scientific expertise can be promoted in Biology class for students to understand its context in a significant way, to be used in different levels of education; also it is a teaching strategy.

Selected Chemical Properties of Soybean Rhizosphere Soil as Influenced by Cropping Systems, Rhizobium Inoculation, and the Supply of Phosphorus and Potassium after Two Consecutive Cropping Seasons

Directory of Open Access Journals (Sweden)

Daniel Nyoki

2018-01-01

Full Text Available The field experiment was carried out in northern Tanzania to assess the effects of intercropping systems, Rhizobium inoculation, and fertilization with P and K on chemical properties of soybean rhizosphere soil. The experiment was laid out in split-split plot design with 2 × 4 × 7 factorial arrangement replicated thrice. The main plots had two inoculation treatments and the subplots were comprised of four cropping systems which were sole maize, sole soybean, and two intercropping at different soybean spacing (75 × 20 and 75 × 40 cm. The fertilizer levels (kg/ha control (0 kg/ha; 20 K; 40 K; 26 P; 52 P; 26 P + 20 K; and 52 P + 40 K were assigned to sub-subplots. Statistical analysis was performed using ANOVA. Least Significant Difference was used to compare treatment means at p=0.05 significance level. The results indicated that rhizosphere soil chemical properties such as pH, organic carbon (OC, and macro- and micronutrients (N, P, Ca, Mg, and Na and Fe, Cu, Mn, and Zn, resp. were significantly increased in the Rhizobium inoculated soybean over the control. The supply of P and K fertilizers significantly increased the rhizosphere content of macronutrients (P, K, Ca, and Mg and also they altered the pH and EC of the rhizosphere soil relative to control.

Response of lupine plants irrigated with saline water to rhizobium inoculation using 15N-isotope dilution

International Nuclear Information System (INIS)

Gadalla, A.M.; El-Ghandour, I.A.; Abdel Aziz, H.A.; Hamdy, A.; Aly, M.M.

2002-01-01

The lupine Rhizobium symbiosis and contribution of N 2 fixation under different levels of irrigation water salinity were examined. Lysimeter experiment was established under greenhouse conditions during the year 2002-2003. In this experiment, inoculated plants were imposed to different salinity levels of irrigation water and N-fertilizer treatment. Plant height was decreased under different salinity levels, nitrogen treatments and bacterial inoculation. Similar trend was noticed with leaf area. The highest leaf area was recorded with salt tolerant bacterial inoculation (SBI) and splitting N-treatment. Highest values of N-uptake occurred after 100 day intervals under the tested factors. Relative decrease in N-uptake did not exceed 40% of those recorded with the fresh water treatment as affected by experimental factors. Nitrogen uptake by the whole plant reflected an increase at 3 dS/m salinity level of irrigation water. Relative increases were 5% and 15% for normal bacteria inoculation under single dose (NI) and splitting

Rhizobium radiobacter Endocarditis in an Intravenous Drug User: Clinical Presentation, Diagnosis, and Treatment.

Science.gov (United States)

Zahoor, Bilal A

2016-08-01

Rhizobium radiobacter, a soil-based organism, is not, usually, pathogenic unless in the immunecompromised. Endocarditis, in the immunocompromised, is a typical presentation generally as a result of catheter-based infections. We describe the presentation of R. radiobacter prosthetic valve endocarditis and the inherent challenges in its presentation and diagnosis. A patient presented with acute limb ischemia secondary to R. radiobacter-mediated endocarditis and subsequent thromboembolization of the distal superior femoral and proximal popliteal arteries in the left lower limb. He underwent an uneventful thrombolectomy that restored blood flow distal to the occlusion and restored the patency of the affected arteries. Postoperatively, the patient maintained several unexplained febrile episodes. Blood cultures remained negative for infection. A cardiac work-up demonstrated the presence of vegetative growth on the prosthetic mitral and native aortic valves. Histopathologic analysis of the extracted thrombus confirmed the presence of R. radiobacter. On further history, it was elucidated that the patient was an intravenous drug user who routinely stored drug paraphernalia in plant beds. The patient recovered uneventfully after Piptazobactam was administered. R. radiobacter, and similarly other soil-based pathogens, should be considered as a potential source of endocarditic infection and thromboembolization in patients who similarly describe a history of intravenous drug use. Copyright © 2016 Elsevier Inc. All rights reserved.

Combined effect of soil amendment with oil cakes and seed priming in the control of root rot fungi of leguminous and non-leguminous crops

International Nuclear Information System (INIS)

Rafi, H.; Dawar, S.; Tariq, M.

2016-01-01

Organic amendments of soil help in proper aeration, rising of temperature and water holding capacity which results in better uptake of nutrients with root system gets extensive establishment. In this study, effects of soil amendment with oil seed cakes including mustard (Brassica campestris L.), cotton (Gossypium hirsutum L.), almond (Prunus amygdalus L.) and black seed (Nigella sativa L.) cakes at the rate of 0.1 and 1% w/w and priming of seeds with Acacia nilotica (L.) Willd. ex Delile and Sapindus mukorossi (L.) leaves extracts and microbial antagonists (Trichoderma harzianum and Rhizobium melilotii) was observed on the growth of plants and in the suppression of root infecting fungi. The results obtained showed that combined effect of bio-priming of seeds with T. harzianum spore suspension and amendment of soil with mustard cake at the rate of 1% was found to be most effective for the growth of leguminous and non-leguminous crop plants (peanut, chickpea, okra and sunflower) and for the reduction of root infecting fungi like Macrophomina phaseolina, Fusarium spp followed by R. meliloti primed seeds in combination with cotton, almond and black seed cakes amendment respectively as compared to control (non treated seeds and soil). (author)

Sensitivity of some nitrogen fixers and the target pest Fusarium oxysporum to fungicide thiram.

Science.gov (United States)

Osman, Awad G; Sherif, Ashraf M; Elhussein, Adil A; Mohamed, Afrah T

2012-03-01

This study was carried out to investigate the toxic effects of the fungicide thiram (TMTD) against five nitrogen fixers and the thiram target pest Fusarium oxysporum under laboratory conditions. Nitrogen fixing bacteria Falvobacterium showed the highest values of LD(50) and proved to be the most resistant to the fungicide followed by Fusarium oxysporum, while Pseudomonas aurentiaca was the most affected microorganism. LD(50) values for these microorganisms were in 2-5 orders of magnitude lower in comparison with LD(50) value for Fusarium oxysporum. Thiram was most toxic to Pseudomonas aurentiaca followed by Azospirillum. The lowest toxicity index was recorded for Fusarium oxysporum and Flavobacterium. The slope of the curve for Azomonas, Fusarium oxysporum and Flavobacterium is more steep than that of the other curves, suggesting that even a slight increase of the dose of the fungicide can cause a very strong negative effect. Thiram was more selective to Pseudomonas aurentiaca followed by Azospirillum, Rhizobium meliloti and Azomonas. The lowest selectivity index of the fungicide was recorded for Falvobacterium followed by Fusarium oxysporum. The highest safety coefficient of the fungicide was assigned for Flavobacterium, while Pseudomonas aurentiaca showed the lowest value.

Mechanisms of protection of pea plants by polysaccharides extracted from a strain of Rhizobium against Orobanche crenata

International Nuclear Information System (INIS)

Khairi, Hanene; Temani, Randa

2009-01-01

The Broomrape causes notable damage on the leguminous crops and became major factor limiting production of pea in the Mediterranean region. The effect of the polysaccharides extracted from P.SOM Rhizobium strain on the development of Orobanche crenata on pea was studied. The results showed that the lipopolysaccharides significantly reduce the infestation of pea by O. crenata. This limitation of infestation results from the reduction of seeds germination rates of the parasite resulting in reduction of the tubercles number on pea roots. Moreover, necrosis of orobanche before or after attachment on pea roots treated by LPS can explain this reduction of parasitism. A correlation was observed between the reduction of pea infection by the broomrape and the activation phenolic compounds pathway. This activation resulted to increase of two enzymes (peroxidase and polyphenoloxidase) activities these enzymes are implicated in plant defense. The results of our study showed that the LPS seem implied in the induction of pea resistance against the broomrape.

Improvement of Faba Bean Yield Using Rhizobium/Agrobacterium Inoculant in Low-Fertility Sandy Soil

Directory of Open Access Journals (Sweden)

Sameh H. Youseif

2017-01-01

Full Text Available Soil fertility is one of the major limiting factors for crop’s productivity in Egypt and the world in general. Biological nitrogen fixation (BNF has a great importance as a non-polluting and a cost-effective way to improve soil fertility through supplying N to different agricultural systems. Faba bean (Vicia faba L. is one of the most efficient nitrogen-fixing legumes that can meet all of their N needs through BNF. Therefore, understanding the impact of rhizobial inoculation and contrasting soil rhizobia on nodulation and N2 fixation in faba bean is crucial to optimize the crop yield, particularly under low fertility soil conditions. This study investigated the symbiotic effectiveness of 17 Rhizobium/Agrobacterium strains previously isolated from different Egyptian governorates in improving the nodulation and N2 fixation in faba bean cv. Giza 843 under controlled greenhouse conditions. Five strains that had a high nitrogen-fixing capacity under greenhouse conditions were subsequently tested in field trials as faba bean inoculants at Ismaillia Governorate in northeast Egypt in comparison with the chemical N-fertilization treatment (96 kg N·ha−1. A starter N-dose (48 kg N·ha−1 was applied in combination with different Rhizobium inoculants. The field experiments were established at sites without a background of inoculation under low fertility sandy soil conditions over two successive winter growing seasons, 2012/2013 and 2013/2014. Under greenhouse conditions, inoculated plants produced significantly higher nodules dry weight, plant biomass, and shoot N-uptake than non-inoculated ones. In the first season (2012/2013, inoculation of field-grown faba bean showed significant improvements in seed yield (3.73–4.36 ton·ha−1 and seed N-yield (138–153 Kg N·ha−1, which were higher than the uninoculated control (48 kg N·ha−1 that produced 2.97 Kg·ha−1 and 95 kg N·ha−1, respectively. Similarly, in the second season (2013

Effects of rhizobial bacteria on K, Ca and Na concentration of wheat (Triticum aestivum L. in saline soils

Directory of Open Access Journals (Sweden)

S homayoon

2016-05-01

Full Text Available Introduction Soil salinity is one of the major agricultural problems and it is limiting crop productivity in many parts of the cultivated areas all over the world. Saline soils are differentiated by the presence of great ratios of Na/Ca, Na/K, Ca2+, Mg2+, and Cl/NO3 (Gratan & Catherine, 1993 and high levels of neutral salts in the surface layers, which are resulting from the capillary action (Al-Falih, 2002. Osmotic stress occurs when soluble salts increase in the soils and then results in specific ion toxicity (Agarwal & Ahmad, 2010. Therefore, one of the most important side effects of salinity is nutritional disorders. High concentration of NaCl in the root medium usually reduces nutrients uptake and affects the transportation of potassium and calcium ions in plant. (Gratan & Catherine, 1993 reported that the salinity of soils changes ionic strength of the substrate and it can influence mineral nutrient uptake and translocation. Salinity also changes the mineral nutrient availability and disrupts the mineral relations of plants. Hence, the main purpose of this research is to evaluate the effects of rhizobial bacteria inoculation on K, Ca and Na concentration of wheat (Triticum aestivum L. in saline soils. Material and methods Soil sample was collected from Astan Ghodse Razavi farm, Mashhad Iran, and then was dried and passed through a 12-mesh (approximately 2 mm screen. Soil sample was divided into three parts and then was placed into three containers. Each container was watered by a different proportion of saline water (EC= 10 dS.m-1. Salinity of soils was regularly monitored until three salinities (2, 6 and 10 dS.m-1 came out. Then, a completely randomized design with a factorial arrangement was carried out in a greenhouse condition. The experimental factors included four levels of inoculation (Sinorhizobium meliloti, Bradyrhizobium japonicum and Rhizobium leguminosarum and control and three levels of soil salinity (2, 6 and 10 dS.m-1 with

Influence of different Sinorhizobium meliloti inocula on abundance of genes involved in nitrogen transformations in the rhizosphere of alfalfa (Medicago sativa L.).

Science.gov (United States)

Babić, Katarina Huić; Schauss, Kristina; Hai, Brigitte; Sikora, Sanja; Redzepović, Sulejman; Radl, Viviane; Schloter, Michael

2008-11-01

Inoculation of leguminous seeds with selected rhizobial strains is practised in agriculture to ameliorate the plant yield by enhanced root nodulation and nitrogen uptake of the plant. However, effective symbiosis between legumes and rhizobia does not only depend on the capacity of nitrogen fixation but also on the entire nitrogen turnover in the rhizosphere. We investigated the influence of seed inoculation with two indigenous Sinorhizobium meliloti strains exhibiting different efficiency concerning plant growth promotion on nitrogen turnover processes in the rhizosphere during the growth of alfalfa. Quantification of six target genes (bacterial amoA, nirK, nirS, nosZ, nifH and archaeal amoA) within the nitrogen cycle was performed in rhizosphere samples before nodule formation, at bud development and at the late flowering stage. The results clearly demonstrated that effectiveness of rhizobial inocula is related to abundance of nifH genes in the late flowering phase of alfalfa. Moreover, other genes involved in nitrogen turnover had been affected by the inocula, e.g. higher numbers of amoA copies were observed during flowering when the more effective strain had been inoculated. However, the respective gene abundances differed overall to a greater extent between the three plant development stages than between the inoculation variants.

Biologic fixation of nitrogen in irradiated rhizobium strips; Fixacao biologica do nitrogenio em estirpes de rizobianas irradiadas

Energy Technology Data Exchange (ETDEWEB)

Caribe, Rebeka Alves; Colaco, Waldeciro [Pernambuco Univ., Recife, PE (Brazil). Dept. de Energia Nuclear

2002-07-01

Native Rhizobium sp. and Bradyrhizobium sp. isolates from the root nodules of bean and cowpea were selected. Six isolates, and the SEMIA 4077 (R. leguminosarum bv. phaseolus) and SEMIA 6145 (Bradyrhizobium sp) strains used as references, were irradiated with ultraviolet light (R-uv) and gamma rays (R-{gamma}). The D{sub 37} values for the rhizobial strain SEMIA 4077 were 43 J.m{sup -2} (UV) and 32 Gy (R-{gamma}) and for the SEMIA 6145 were 45 J.m{sup -2} (UV) and 35 Gy (R-gamma). Through a greenhouse experiment the irradiated isolates were inoculated on bean (P. vulgaris L., cv. Princesa) and on cowpea [Vigna unguiculata, (L.) Walp, cv. IPA-206] seedlings, in an attempt to evaluate the sensitivity of the host plants, and possible effects on their nodulation. Differences in responses to nodulation due to the effect of irradiation were observed for the isolates tested. Significantly differences were observed only for nodules dry matter yield of the IPA-206 cultivar. Gamma irradiated treatment were statistically superior to treatments with ultraviolet light in relation. (author)

Mutation of a Broadly Conserved Operon (RL3499-RL3502) from Rhizobium leguminosarum Biovar viciae Causes Defects in Cell Morphology and Envelope Integrity▿†

Science.gov (United States)

Vanderlinde, Elizabeth M.; Magnus, Samantha A.; Tambalo, Dinah D.; Koval, Susan F.; Yost, Christopher K.

2011-01-01

The bacterial cell envelope is of critical importance to the function and survival of the cell; it acts as a barrier against harmful toxins while allowing the flow of nutrients into the cell. It also serves as a point of physical contact between a bacterial cell and its host. Hence, the cell envelope of Rhizobium leguminosarum is critical to cell survival under both free-living and symbiotic conditions. Transposon mutagenesis of R. leguminosarum strain 3841 followed by a screen to isolate mutants with defective cell envelopes led to the identification of a novel conserved operon (RL3499-RL3502) consisting of a putative moxR-like AAA+ ATPase, a hypothetical protein with a domain of unknown function (designated domain of unknown function 58), and two hypothetical transmembrane proteins. Mutation of genes within this operon resulted in increased sensitivity to membrane-disruptive agents such as detergents, hydrophobic antibiotics, and alkaline pH. On minimal media, the mutants retain their rod shape but are roughly 3 times larger than the wild type. On media containing glycine or peptides such as yeast extract, the mutants form large, distorted spheres and are incapable of sustained growth under these culture conditions. Expression of the operon is maximal during the stationary phase of growth and is reduced in a chvG mutant, indicating a role for this sensor kinase in regulation of the operon. Our findings provide the first functional insight into these genes of unknown function, suggesting a possible role in cell envelope development in Rhizobium leguminosarum. Given the broad conservation of these genes among the Alphaproteobacteria, the results of this study may also provide insight into the physiological role of these genes in other Alphaproteobacteria, including the animal pathogen Brucella. PMID:21357485

Biochemical and Molecular Phylogenetic Study of Agriculturally Useful Association of a Nitrogen-Fixing Cyanobacterium and Nodule Sinorhizobium with Medicago sativa L.

Directory of Open Access Journals (Sweden)

E. V. Karaushu

2015-01-01

Full Text Available Seed inoculation with bacterial consortium was found to increase legume yield, providing a higher growth than the standard nitrogen treatment methods. Alfalfa plants were inoculated by mono- and binary compositions of nitrogen-fixing microorganisms. Their physiological and biochemical properties were estimated. Inoculation by microbial consortium of Sinorhizobium meliloti T17 together with a new cyanobacterial isolate Nostoc PTV was more efficient than the single-rhizobium strain inoculation. This treatment provides an intensification of the processes of biological nitrogen fixation by rhizobia bacteria in the root nodules and an intensification of plant photosynthesis. Inoculation by bacterial consortium stimulates growth of plant mass and rhizogenesis and leads to increased productivity of alfalfa and to improving the amino acid composition of plant leaves. The full nucleotide sequence of the rRNA gene cluster and partial sequence of the dinitrogenase reductase (nifH gene of Nostoc PTV were deposited to GenBank (JQ259185.1, JQ259186.1. Comparison of these gene sequences of Nostoc PTV with all sequences present at the GenBank shows that this cyanobacterial strain does not have 100% identity with any organisms investigated previously. Phylogenetic analysis showed that this cyanobacterium clustered with high credibility values with Nostoc muscorum.

Rhizobium promotes non-legumes growth and quality in several production steps: towards a biofertilization of edible raw vegetables healthy for humans.

Directory of Open Access Journals (Sweden)

Paula García-Fraile

Full Text Available The biofertilization of crops with plant-growth-promoting microorganisms is currently considered as a healthy alternative to chemical fertilization. However, only microorganisms safe for humans can be used as biofertilizers, particularly in vegetables that are raw consumed, in order to avoid sanitary problems derived from the presence of pathogenic bacteria in the final products. In the present work we showed that Rhizobium strains colonize the roots of tomato and pepper plants promoting their growth in different production stages increasing yield and quality of seedlings and fruits. Our results confirmed those obtained in cereals and alimentary oil producing plants extending the number of non-legumes susceptible to be biofertilized with rhizobia to those whose fruits are raw consumed. This is a relevant conclusion since safety of rhizobia for human health has been demonstrated after several decades of legume inoculation ensuring that they are optimal bacteria for biofertilization.

Transformation of pWWO in Rhizobium leguminosarum DPT to Engineer Toluene Degrading Ability for Rhizoremediation.

Science.gov (United States)

Goel, Garima; Pandey, Piyush; Sood, Anchal; Bisht, Sandeep; Maheshwari, D K; Sharma, G D

2012-06-01

Rhizoremediation of organic xenobiotics is based on interactions between plants and their associated micro-organisms. The present work was designed to engineer a bacterial system having toluene degradation ability along with plant growth promoting characteristics for effective rhizoremediation. pWWO harboring the genes responsible for toluene breakdown was isolated from Pseudomonas putida MTCC 979 and successfully transformed in Rhizobium DPT. This resulted in a bacterial strain (DPT(T)) which had the ability to degrade toluene as well as enhance growth of host plant. The frequency of transformation was recorded 5.7 × 10(-6). DPT produced IAA, siderophore, chitinase, HCN, ACC deaminase, solubilized inorganic phosphate, fixed atmospheric nitrogen and inhibited the growth of Fusarium oxysporum and Macrophomina phaseolina in vitro. During pot assay, 50 ppm toluene in soil was found to inhibit the germination of Cajanus cajan seeds. However when the seeds bacterized with toluene degrading P. putida or R. leguminosarum DPT were sown in pots, again no germination was observed. Non-bacterized as well as bacterized seeds germinated successfully in toluene free soil as control. The results forced for an alternative mode of application of bacteria for rhizoremediation purpose. Hence bacterial suspension was mixed with soil having 50 ppm of toluene. Germination index in DPT treated soil was 100% while in P. putida it was 50%. Untreated soil with toluene restricted the seeds to germinate.

Characterisation of SalRAB a salicylic acid inducible positively regulated efflux system of Rhizobium leguminosarum bv viciae 3841.

Directory of Open Access Journals (Sweden)

Adrian J Tett

Full Text Available Salicylic acid is an important signalling molecule in plant-microbe defence and symbiosis. We analysed the transcriptional responses of the nitrogen fixing plant symbiont, Rhizobium leguminosarum bv viciae 3841 to salicylic acid. Two MFS-type multicomponent efflux systems were induced in response to salicylic acid, rmrAB and the hitherto undescribed system salRAB. Based on sequence similarity salA and salB encode a membrane fusion and inner membrane protein respectively. salAB are positively regulated by the LysR regulator SalR. Disruption of salA significantly increased the sensitivity of the mutant to salicylic acid, while disruption of rmrA did not. A salA/rmrA double mutation did not have increased sensitivity relative to the salA mutant. Pea plants nodulated by salA or rmrA strains did not have altered nodule number or nitrogen fixation rates, consistent with weak expression of salA in the rhizosphere and in nodule bacteria. However, BLAST analysis revealed seventeen putative efflux systems in Rlv3841 and several of these were highly differentially expressed during rhizosphere colonisation, host infection and bacteroid differentiation. This suggests they have an integral role in symbiosis with host plants.

NCBI nr-aa BLAST: CBRC-DRER-26-0474 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-26-0474 ref|NP_384172.1| SENSOR HISTIDINE KINASE TRANSMEMBRANE PROTEIN [S...inorhizobium meliloti 1021] emb|CAC41453.1| SENSOR HISTIDINE KINASE TRANSMEMBRANE PROTEIN [Sinorhizobium meliloti] NP_384172.1 1e-159 68% ...

The extracellular proteome of Rhizobium etli CE3 in exponential and stationary growth phase

Directory of Open Access Journals (Sweden)

Mendoza-Hernández Guillermo

2010-10-01

Full Text Available Abstract Background The extracellular proteome or secretome of symbiotic bacteria like Rhizobium etli is presumed to be a key element of their infection strategy and survival. Rhizobia infect the roots of leguminous plants and establish a mutually beneficial symbiosis. To find out the possible role of secreted proteins we analyzed the extracellular proteome of R. etli CE3 in the exponential and stationary growth phases in minimal medium, supplemented with succinate-ammonium. Results The extracellular proteins were obtained by phenol extraction and identified by LC-ESI MS/MS. We identified 192 and 191 proteins for the exponential and stationary phases respectively. Using the software Signal P, we predicted signal peptides for 12.95% and 35.60% of the proteins identified in the exponential and stationary phases, respectively, which could therefore be secreted by the Sec pathway. For the exponential growth phase, we found in abundance proteins like the ribosomal proteins, toxins and proteins belonging to the group "defence mechanisms". For the stationary growth phase, we found that the most abundant proteins were those with unknown function, and in many of these we identified characteristic domains of proteases and peptidases. Conclusions Our study provided the first dataset of the secretome of R. etli and its modifications, which may lead to novel insights into the adaptive response of different stages of growth. In addition, we found a high number of proteins with unknown function; these proteins could be analyzed in future research to elucidate their role in the extracellular proteome of R. etli.

A comparative genomics screen identifies a Sinorhizobium meliloti 1021 sodM-like gene strongly expressed within host plant nodules

Directory of Open Access Journals (Sweden)

Queiroux Clothilde

2012-05-01

Full Text Available Abstract Background We have used the genomic data in the Integrated Microbial Genomes system of the Department of Energy’s Joint Genome Institute to make predictions about rhizobial open reading frames that play a role in nodulation of host plants. The genomic data was screened by searching for ORFs conserved in α-proteobacterial rhizobia, but not conserved in closely-related non-nitrogen-fixing α-proteobacteria. Results Using this approach, we identified many genes known to be involved in nodulation or nitrogen fixation, as well as several new candidate genes. We knocked out selected new genes and assayed for the presence of nodulation phenotypes and/or nodule-specific expression. One of these genes, SMc00911, is strongly expressed by bacterial cells within host plant nodules, but is expressed minimally by free-living bacterial cells. A strain carrying an insertion mutation in SMc00911 is not defective in the symbiosis with host plants, but in contrast to expectations, this mutant strain is able to out-compete the S. meliloti 1021 wild type strain for nodule occupancy in co-inoculation experiments. The SMc00911 ORF is predicted to encode a “SodM-like” (superoxide dismutase-like protein containing a rhodanese sulfurtransferase domain at the N-terminus and a chromate-resistance superfamily domain at the C-terminus. Several other ORFs (SMb20360, SMc01562, SMc01266, SMc03964, and the SMc01424-22 operon identified in the screen are expressed at a moderate level by bacteria within nodules, but not by free-living bacteria. Conclusions Based on the analysis of ORFs identified in this study, we conclude that this comparative genomics approach can identify rhizobial genes involved in the nitrogen-fixing symbiosis with host plants, although none of the newly identified genes were found to be essential for this process.

Co-inoculation with Rhizobium and plant growth promoting rhizobacteria (PGPR for inducing salinity tolerance in mung bean under field condition of semi arid climate

Directory of Open Access Journals (Sweden)

Muhammad Aamir

2013-04-01

Full Text Available Salinity stress severely affects the growth, nodulation and yield of mung bean (Vigna radiata L.. However, its growth can be improved under salinity stress by inoculation/co-inoculation with rhizobia and plant growth promoting rhizobacteria (PGPR containing 1-Aminocyclopropane-1-carboxylic acid (ACC deaminase enzyme. ACC-deaminase containing bacteria regulate the stress induced ethylene production by hydrolyzing the ACC (immediate precursor of ethylene into ammonia and ketobutyric acid, thus improve plant growth by lowering the ethylene level. A study was conducted under salt affected field conditions where pre-isolated strains of Rhizobium and PGPR were used alone as well as in combination for mitigating the salinity stress on growth, nodulation and yield of mung bean by following the randomized complete block design (RCBD. The data were recorded and analyzed statistically to see the difference among treatments.

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15964777 >1v4aA 24 435 49 467 e-101 ... emb|CAC45596.1| PUTATIVE GLUTAMATE-AMMONIA...-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti] ref|NP_385130.1| PUTATIVE ... GLUTAMATE-AMMO...NIA-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti 1021] sp|

Effect of N-rate and P sources on BNF in soybean as affected by rhizobium and VAM fungi lnoculants

Energy Technology Data Exchange (ETDEWEB)

Soliman, S; Elghandour, I A [Soil and Water Dept., Atomic Energy Authority, Cairo, (Egypt); Abbady, A K [Soil and Water Inst., Agric. Res. Center, Giza (Egypt)

1995-10-01

Greenhouse experiment was made to investigate the influence of phosphate fertilizers on nitrogen fixation in soybean. The N-15 isotope dilution method was used to quantify N 2-fixed. In this concern, seed of nodulated and on-nodulated soybean plant bacterized with Bradyrhizobium japonicum and noculated without or with mycorrhizas in the presence of super or rock phosphate. Ammonium sulphate labelled fertilizer (5% N-15 a.e) was applied o 15 kg sandy soil of egypt at the rate of 20 and 100 kg N/acre. At re-flowering stage, the highest amount of N derived from air (Ndfa) was 66.3 and 470.2 (mg/pot) equivalent 47.6 and 47.1 of total N assimilated for noculated soybean with Rhizobium and fertilized with super or rock phosphate, respectively. While the contributions from 15 N labelled fertilizer (Ndff) accounted for 11 and 10.8, respectively. Use of mycorrhizas could increase the amount of N 2-fixed in the presence of rhizobia. There appears to be a strong case for improving N 2-fixation in the presence of mycorrhizas especially in sandy soil. 4 tabs.

Effect of N-rate and P sources on BNF in soybean as affected by rhizobium and VAM fungi lnoculants

International Nuclear Information System (INIS)

Soliman, S.; Elghandour, I.A.; Abbady, A.K.

1995-01-01

Greenhouse experiment was made to investigate the influence of phosphate fertilizers on nitrogen fixation in soybean. The N-15 isotope dilution method was used to quantify N 2-fixed. In this concern, seed of nodulated and on-nodulated soybean plant bacterized with Bradyrhizobium japonicum and noculated without or with mycorrhizas in the presence of super or rock phosphate. Ammonium sulphate labelled fertilizer (5% N-15 a.e) was applied o 15 kg sandy soil of egypt at the rate of 20 and 100 kg N/acre. At re-flowering stage, the highest amount of N derived from air (Ndfa) was 66.3 and 470.2 (mg/pot) equivalent 47.6 and 47.1 of total N assimilated for noculated soybean with Rhizobium and fertilized with super or rock phosphate, respectively. While the contributions from 15 N labelled fertilizer (Ndff) accounted for 11 and 10.8, respectively. Use of mycorrhizas could increase the amount of N 2-fixed in the presence of rhizobia. There appears to be a strong case for improving N 2-fixation in the presence of mycorrhizas especially in sandy soil. 4 tabs

Selecting in vitro of Rhizobiumfor tolerance to acidity and aluminium Selección in vitro de Rhizobium tolerante a acidez y aluminio

Directory of Open Access Journals (Sweden)

Campos Segura Ricardo

1995-12-01

Full Text Available Fifty strains of Rhizobium tropiciisolated of Sabana de Bogotá soils and foreigns collections were screened for tolerance of acidity and aluminium in liquid and sol id culture. Assesment of visible turbidity and colonies growth, respectively, indicated five
(5 strains tolerant of pH 4.5 and pH 5.0 and 10 or 20 u M Aluminium. Strains that tolerated the 10 west pH values in culture were tolerant of the highest aluminium concentrations
The cultural test should be used to predict the ability of Rhizobium to growth and for use as inoculants in low pH area.La apertura económica puso de presente la obligación de revisar las formas de producción de los cultivos comerciales, Con el fin de competir adecuadamente en mercados internacionales. Actualmente, leguminosas, como el frijol (Phaseolus vulgarís se presentan, actualmente, como cultivo alternativo para reemplazar cultivos tradicionales en la Sabana de Bogotá. Existe un alto porcentaje de suelos ácidos en Colombia, así como problemas nutricionales, en los cuales la deficiencia de nitrógeno es muy común. El presente trabajo se realizó con el objetivo de seleccionar "in vitro" cepas de Rizobium tropici tolerantes a acidez y aluminio, en medios de cultivo diferentes. Inicialmente se hizo una preselección "in vitro" de cepas tolerantes a tres niveles de pH 4,0; 4,5 y 5,0, utilizando el medio líquido de Wood y Cooper y usando 50 cepas entre nativas y foráneas. En este caso, se seleccionaron las cepas RC 92, RC 117, C 7, C 11, C 14, C 53, Nifta1182, RC 70, RC 85, CIAT 899, CIAT 144 y Niftal 241. Posteriormente, se realizó una selección "in vitro" de cepas tolerantes a dos niveles de pH: 4,5 y 5,0 y a
cuatro niveles de aluminio: 0,5; 10 y 20 M, utilizando dos fuentes de aluminio: AlCl3 y ALK(S042 y empleando dos medios de cultivo: el líquido de Wood y Cooper y el sólido de Keyser y Munns. Las cepas RC 85, C 11, CIAT 899, CIAT 144 y Niftal 182, fueron seleccionadas como las de

Final report for DOE grant FG02-06ER15805

Energy Technology Data Exchange (ETDEWEB)

Gage, Daniel

2012-05-31

DOE funding was used to investigate the role of the phosphotransferase system (PTS) in the symbiotic, nodulating bacterium Sinorhizobium meliloti. This system is well studied in several bacterial species. However, it's organization and function in S. meliloti is substantially different than in the those other, well-studied bacteria. The S. meliloti PTS, through our DOE-funded work, has become a model for how this important signal transduction system works in the a-proteobacteria. We have found that the PTS is relatively simple, used for only signal transduction and not transport, and is involved in regulation of carbon metabolism in response to carbon availability and nitrogen availability.

ORF Alignment: NC_003037 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003037 gi|16263035 >1nyoA 11 162 8 158 4e-30 ... ref|NP_435828.1| Nex18 Symbiotica...lly induced conserved protein [Sinorhizobium ... meliloti 1021] gb|AAK65240.1| Nex18 Symbiotically ... ... ... induced conserved protein [Sinorhizobium meliloti 1021] ... pir||F95334 Nex18 Symbiotically

Yabani Baklagil Bitkilerinden, Mikrobiyal Gübre Olarak Kullanılan Rhizobium Spp. Bakterilerinin İzolasyonu

Directory of Open Access Journals (Sweden)

Hatice Öğütcü

2014-05-01

Full Text Available Araştırmamızda kullanılan yabani baklagil bitkileri ( Medicago sativa, M.lupulina ve M. varia Erzurum iline ait yüksek rakımlı (2000-2500m bölgelerden (Palandöken dağı, Alibaba dağı, Turnagöl dağı, Hasanbaba dağı, Eğerli dağı, Yıldırım dağı, Çubuklu dağı, Deveboynu mevkii, Kayakyolu mevkii, Telsizler tepesi ve Dumlu tepesi Haziran ve Temmuz aylarında toplandı. Bu bitkilerden elde edilen nodüller steril edilerek YMA (Yeast Mannitol Agar plaklarına çizgi ekim yapıldı ve petriler 28+1ºC’de 3-5 gün süreyle inkübasyona bırakıldı. İnkübasyon süresi sonunda oluşan tipik koloniler oluşturan (beyaz, saydam veya hafif mat, mukozlu, yuvarlak, kabarık 39 izolat seçilerek yatık YMA tüplerine aktarıldı ve buzdolabında +4ºC’de muhafaza edildi. Sonraki aşamada bu izolatlar sitolojik ve biyokimyasal analizlerle tanımlanmaya çalışıldı. Bu amaçla izolatlar; Brom Thymol Mavili ve Kongo Kırmızılı YMA’da üreme, gram özelliği, hareket, katalaz ve oksidaz testlerine tabi tutularak değerlendirildi. Yapılan sitolojik ve biyokimyasal analizler sonucunda elde edilen 39 izolatın 28’inin Rhizobium spp. olduğu tespit edildi.

Cloning and characterization of a galactitol 2-dehydrogenase from Rhizobium legumenosarum and its application in D-tagatose production.

Science.gov (United States)

Jagtap, Sujit Sadashiv; Singh, Ranjitha; Kang, Yun Chan; Zhao, Huimin; Lee, Jung-Kul

2014-05-10

Galactitol 2-dehydrogenase (GDH) belongs to the protein subfamily of short-chain dehydrogenases/reductases and can be used to produce optically pure building blocks and for the bioconversion of bioactive compounds. An NAD(+)-dependent GDH from Rhizobium leguminosarum bv. viciae 3841 (RlGDH) was cloned and overexpressed in Escherichia coli. The RlGDH protein was purified as an active soluble form using His-tag affinity chromatography. The molecular mass of the purified enzyme was estimated to be 28kDa by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and 114kDa by gel filtration chromatography, suggesting that the enzyme is a homotetramer. The enzyme has an optimal pH and temperature of 9.5 and 35°C, respectively. The purified recombinant RlGDH catalyzed the oxidation of a wide range of substrates, including polyvalent aliphatic alcohols and polyols, to the corresponding ketones and ketoses. Among various polyols, galactitol was the preferred substrate of RlGDH with a Km of 8.8mM, kcat of 835min(-1) and a kcat/Km of 94.9min(-1)mM(-1). Although GDHs have been characterized from a few other sources, RlGDH is distinguished from other GDHs by its higher specific activity for galactitol and broad substrate spectrum, making RlGDH a good choice for practical applications. Copyright © 2014 Elsevier Inc. All rights reserved.

Growth of cowpea plants inoculated with Rhizobium in a saline-sodic soil after application of gypsum

Directory of Open Access Journals (Sweden)

Angela Jessyka Pereira Brito Fontenele

Full Text Available Two experiments were carried out with the aim of evaluating the growth of cowpea cultivated in saline-sodic soils corrected with gypsum: one experiment in the laboratory, to identify the best level of gypsum for the correction of the saline-sodic soils of the state of Pernambuco, Brazil; and the other in a greenhouse, after correction of the soils. As the test plant, the cowpea cultivar pele de moça, inoculated with Rhizobium strain BR3267 was used. The experiments were arranged in a randomised block design in a 2 x 5 factorial arrangement, two soils and five levels of the gypsum requirement (GR, equivalent to 50, 100, 150, 200 and 250% of the GR of the soil, as determined by the Schoonover M-1 method, with five replications. The following were evaluated: electrical conductivity of the soil saturation extract (EC, soil exchangeable sodium and percentage of soil exchangeable sodium (ESP, number of nodules (NN, nodule dry weight (NDW, shoot dry weight (SDW, shoot height (PH and nitrogen concentration (N in the shoots. Application of 100% of the GR, followed by the enough water for leaching, was effective for the correction of soil sodicity. The application of increasing levels of soil GR resulted in an increase in the number of nodules, dry weight of the nodules and shoots, and the height and levels of N absorbed by the plants in soil S2. In soil S1, the use of levels of 200 and 250% of soil the GR caused a decrease in all the variables under study.

Formulation of microbes inoculum: AMF, PSB and Rhizobium isolated of ex-coal mining site for Acacia crassicarpa Cunn. Ex-benth seedlings

Directory of Open Access Journals (Sweden)

ENNY WIDYATI

2007-07-01

Full Text Available The shoddier succeed land revegetation particularly caused by least adaptability of the seedlings planted on this site. To encourage their growth and survival rate it can be achieved by means do inoculation with the compatible functional microbes such as rhizobium, Psolubilizing bacteria (PSB and/or arbuscular-mycorrhiza fungy (AMF. This reserach is aimed to formulate the most compatible inoculant to support the growth of A. crassicarpa seedlings. Compatibility study is carried out in RCB design with 3 replications, each contain 5 seedlings. Height and biomass are accessed to measure the growth responses of the seedlings. The result showed that the best reponse is given by consortia that consist of the three kinds of these microbes. This increase the shoot biomass (137% compare to the control. The consortia also improved N 164%, P 335% and K 167% in the plant tissues. While pure AMF improved absorption of N plants 80%, P 383% and K 51% compare to the control. It is suggested that to prepare the A. crassicarpa seedlings is better inoculated by consortium of microbes or AMF as a sole inoculant.

UV-radiation induced changes in antibiotic markers, chemical composition of water soluble polysaccharides and nodulation ability of Rhizobium trifolic 11B

International Nuclear Information System (INIS)

Ghai, Jyotsna; Ghai, S.K.; Kalra, M.S.

1983-01-01

Rhizobium trifolii 11B, which formed effective nodules on its host. Trifolium alexanderinum L. was UV-irradiated to isolate mutants. Out of the 9 variants isolated only 1 strain, viz. 21M11B produced more water soluble polysaccharide [752 mg (100 ml -1 )] than the parent 15 different antibiotics was similar only in two (22M11B and 26M11B) of the 9 UV-mutants. Compositional studies revealed that the water soluble polysaccharides from all strains contained glucose and galactose in the molar ratio of 7:1. Glucuronic acid which was present (2.33 per cent) in the water soluble polysaccharide from strain 11B was absent in all but 2UV-mutants (4.22per cent in 6M11B and 4.04per cent in26M11B). Five of the UB-mutants (1M11B, 17M11B, 20N11B, 22M11B and 26M11B) were Nod - . The organisms which produced more water soluble polysaccharide upon infection of the plants induced the formation of more number of nodules. (author)

Evaluation of the Effects of Biological and Chemical Fertilizers on Some Physiological and Growth Characteristics of Fenugreek (Trigonella foenum-graecum

Directory of Open Access Journals (Sweden)

Samira Menbari

2017-12-01

Full Text Available Nowadays, the use of soil-born microorganisms as biological fertilizers is considered to be a natural and most desirable solution to maintain sustainability of agricultural soil system. Potassium releasing bacteria, nitrogen fixing and phosphorus dissolving bacteria make mentioned elements available to plants. In order to evaluate the effects of bio-fertilizers Potabarvar 2, Sinorhizobium meliloti, as well as urea fertilizer on physiological properties and yield of Fenugreek, an experiment as complete randomized block design was conducted with five treatments and three replications. Treatments included biofertilizer Potabarvar 2, S. meliloti, inoculation with a mixture of Sinorhizobium+Potabarvar 2, positive control (based on soil analysis and negative control (no fertilization and inoculation.The results showed that all morphological traits were significant at 1%. Most physiological traits except for carotenoid were significantly affected by S. meliloti, and a mixture of Sinorhizobium+Potabarvar 2. Seed inoculation with biofertilizer Sinorhizobium meliloti and Potabarvar 2 lead to increase in growth and eventually shoot yield. Separate application of these biofertilizers led to better results than the integrated application. Symbiotic relationship of Sinorhizobium with Fenugreek increased physiological indices data, especially the absorption of nitrogen and phosphorus, as well as the amount of phenolic antioxidant have been significantly affected. In general, application of S. meliloti resulted in better and more effective increase in yield, quality and plant growth than fertilizer Potabarvar 2 and a mixture of Sinorhizobium+Potabarvar 2.

Transcriptome Analysis of Polyhydroxybutyrate Cycle Mutants Reveals Discrete Loci Connecting Nitrogen Utilization and Carbon Storage in Sinorhizobium meliloti.

Science.gov (United States)

D'Alessio, Maya; Nordeste, Ricardo; Doxey, Andrew C; Charles, Trevor C

2017-01-01

Polyhydroxybutyrate (PHB) and glycogen polymers are produced by bacteria as carbon storage compounds under unbalanced growth conditions. To gain insights into the transcriptional mechanisms controlling carbon storage in Sinorhizobium meliloti , we investigated the global transcriptomic response to the genetic disruption of key genes in PHB synthesis and degradation and in glycogen synthesis. Under both nitrogen-limited and balanced growth conditions, transcriptomic analysis was performed with genetic mutants deficient in PHB synthesis ( phbA , phbB , phbAB , and phbC ), PHB degradation ( bdhA , phaZ , and acsA2 ), and glycogen synthesis ( glgA1 ). Three distinct genomic regions of the pSymA megaplasmid exhibited altered expression in the wild type and the PHB cycle mutants that was not seen in the glycogen synthesis mutant. An Fnr family transcriptional motif was identified in the upstream regions of a cluster of genes showing similar transcriptional patterns across the mutants. This motif was found at the highest density in the genomic regions with the strongest transcriptional effect, and the presence of this motif upstream of genes in these regions was significantly correlated with decreased transcript abundance. Analysis of the genes in the pSymA regions revealed that they contain a genomic overrepresentation of Fnr family transcription factor-encoding genes. We hypothesize that these loci, containing mostly nitrogen utilization, denitrification, and nitrogen fixation genes, are regulated in response to the intracellular carbon/nitrogen balance. These results indicate a transcriptional regulatory association between intracellular carbon levels (mediated through the functionality of the PHB cycle) and the expression of nitrogen metabolism genes. IMPORTANCE The ability of bacteria to store carbon and energy as intracellular polymers uncouples cell growth and replication from nutrient uptake and provides flexibility in the use of resources as they are available to

Genome-Wide Transcriptional Changes and Lipid Profile Modifications Induced by Medicago truncatula N5 Overexpression at an Early Stage of the Symbiotic Interaction with Sinorhizobium meliloti

Directory of Open Access Journals (Sweden)

Chiara Santi

2017-12-01

Full Text Available Plant lipid-transfer proteins (LTPs are small basic secreted proteins, which are characterized by lipid-binding capacity and are putatively involved in lipid trafficking. LTPs play a role in several biological processes, including the root nodule symbiosis. In this regard, the Medicago truncatula nodulin 5 (MtN5 LTP has been proved to positively regulate the nodulation capacity, controlling rhizobial infection and nodule primordia invasion. To better define the lipid transfer protein MtN5 function during the symbiosis, we produced MtN5-downregulated and -overexpressing plants, and we analysed the transcriptomic changes occurring in the roots at an early stage of Sinorhizobium meliloti infection. We also carried out the lipid profile analysis of wild type (WT and MtN5-overexpressing roots after rhizobia infection. The downregulation of MtN5 increased the root hair curling, an early event of rhizobia infection, and concomitantly induced changes in the expression of defence-related genes. On the other hand, MtN5 overexpression favoured the invasion of the nodules by rhizobia and determined in the roots the modulation of genes that are involved in lipid transport and metabolism as well as an increased content of lipids, especially galactolipids that characterize the symbiosome membranes. Our findings suggest the potential participation of LTPs in the synthesis and rearrangement of membranes occurring during the formation of the infection threads and the symbiosome membrane.

Roles of Extracellular Polysaccharides and Biofilm Formation in Heavy Metal Resistance of Rhizobia

OpenAIRE

Natalia Nocelli; Pablo C. Bogino; Erika Banchio; Walter Giordano

2016-01-01

Bacterial surface components and extracellular compounds, particularly flagella, lipopolysaccharides (LPSs), and exopolysaccharides (EPSs), in combination with environmental signals and quorum-sensing signals, play crucial roles in bacterial autoaggregation, biofilm development, survival, and host colonization. The nitrogen-fixing species Sinorhizobium meliloti (S. meliloti) produces two symbiosis-promoting EPSs: succinoglycan (or EPS I) and galactoglucan (or EPS II). Studies of the S. melilo...

Studies on phosphorus utilization as influenced by bacterial seed inoculation and phosphorus fertilization in summer mung (Vigna radiata L. Wilczek)

International Nuclear Information System (INIS)

Kothari, S.K.; Saraf, C.S.

1988-01-01

A greenhouse experiment was conducted with four types of bacterial inoculation (Rhizobium alone; Rhizobium along with Azotobacter chroococcum; Rhizobium along with Azospirillum brasilense and no inoculation) and three levels of phosphorus ( 32 P labelled SSP) application (O, 6.5 ppm and 13.0 ppm P). Inoculation with Rhizobium along with Azotobacter chroococcum was found to be better than Rhizobium alone or Rhizobium along with Azospirillum brasilense in respect of leaf, stem, root and nodule dry weight, phosphorus uptake and utilization efficiency. P application upto 6.5 ppm significantly increased leaf, stem, root and nodule dry weight and phosphorus uptake. Per cent phosphorus derived from fertilizer (per cent pdff) and fertilizer P uptake significantly increased while P utilization efficiency significantly decreased with increasing levels of P application. (author). 12 refs., 2 tables

The Role of Teak Leaves (Tectona grandis), Rhizobium, and Vesicular-Arbuscular Mycorrhizae on Improving Soil Structure and Soil Nutrition

Science.gov (United States)

Yuliani; Rahayu, Y. S.

2018-01-01

Calcium is the largest mineral in calcareous soils. High levels of calcium carbonate lead to phosphate deposition. Nutrient deficiencies in calcareous soil (mainly Phosphate and Nitrogen) resulted only certain crops with a wide range of tolerances that can grow. Meanwhile, dynamics nutrient in calcareous soils also depend on the topography and decomposition of the litter in the growing vegetation. The purpose of this study was to describe the pattern of nutrient enhancement and soil-texture structures on calcareous soils after littering the teak leaves, Rhizobium and Vesicular Arbuscular Mycorrhiza. The research parameters were the concentration of N, P, K; C/N ratio, humid acid content, and soil structure, which measured at days 30, 60, and 85 of soil decomposition process. The results showed that at days 30, the texture and structure of the soil tend to be stable (porosity 31.2, DMR 1.93, moisture content 0.36, sandy clay) while at days 85 has been very stable (porosity 49.8; Water content 0.28, sandy clay). While C and N organic, N and K concentration at days 30 showed low value (C organic 1.03, N 0.12, K 0.49, C / N ratio 9). This condition is almost unchanged at days 85. While the P value shows very high value (60.53) at days 30 although after 60 days the P content showed a decrease.

Enhanced Synthesis of Antioxidant Enzymes, Defense Proteins and Leghemoglobin in Rhizobium-Free Cowpea Roots after Challenging with Meloydogine incognita

Directory of Open Access Journals (Sweden)

Jose T. A. Oliveira

2014-11-01

Full Text Available The root knot nematodes (RKN, Meloydogine spp., particularly Meloidogyne incognita and Meloidogyne javanica species, parasitize several plant species and are responsible for large annual yield losses all over the world. Only a few available chemical nematicides are still authorized for RKN control owing to environmental and health reasons. Thus, plant resistance is currently considered the method of choice for controlling RKN, and research performed on the molecular interactions between plants and nematodes to identify genes of interest is of paramount importance. The present work aimed to identify the differential accumulation of root proteins of a resistant cowpea genotype (CE-31 inoculated with M. incognita (Race 3 in comparison with mock-inoculated control, using 2D electrophoresis assay, mass spectrometry identification and gene expression analyses by RT-PCR. The results showed that at least 22 proteins were differentially represented in response to RKN challenge of cowpea roots mainly within 4–6 days after inoculation. Amongst the up-represented proteins were SOD, APX, PR-1, β-1,3-glucanase, chitinases, cysteine protease, secondary metabolism enzymes, key enzymes involved in ethylene biosynthesis, proteins involved in MAPK pathway signaling and, surprisingly, leghemoglobin in non-rhizobium-bacterized cowpea. These findings show that an important rearrangement in the resistant cowpea root proteome occurred following challenge with M. incognita.

Gene Discovery through Genomic Sequencing of Brucella abortus

Science.gov (United States)

Sánchez, Daniel O.; Zandomeni, Ruben O.; Cravero, Silvio; Verdún, Ramiro E.; Pierrou, Ester; Faccio, Paula; Diaz, Gabriela; Lanzavecchia, Silvia; Agüero, Fernán; Frasch, Alberto C. C.; Andersson, Siv G. E.; Rossetti, Osvaldo L.; Grau, Oscar; Ugalde, Rodolfo A.

2001-01-01

Brucella abortus is the etiological agent of brucellosis, a disease that affects bovines and human. We generated DNA random sequences from the genome of B. abortus strain 2308 in order to characterize molecular targets that might be useful for developing immunological or chemotherapeutic strategies against this pathogen. The partial sequencing of 1,899 clones allowed the identification of 1,199 genomic sequence surveys (GSSs) with high homology (BLAST expect value < 10−5) to sequences deposited in the GenBank databases. Among them, 925 represent putative novel genes for the Brucella genus. Out of 925 nonredundant GSSs, 470 were classified in 15 categories based on cellular function. Seven hundred GSSs showed no significant database matches and remain available for further studies in order to identify their function. A high number of GSSs with homology to Agrobacterium tumefaciens and Rhizobium meliloti proteins were observed, thus confirming their close phylogenetic relationship. Among them, several GSSs showed high similarity with genes related to nodule nitrogen fixation, synthesis of nod factors, nodulation protein symbiotic plasmid, and nodule bacteroid differentiation. We have also identified several B. abortus homologs of virulence and pathogenesis genes from other pathogens, including a homolog to both the Shda gene from Salmonella enterica serovar Typhimurium and the AidA-1 gene from Escherichia coli. Other GSSs displayed significant homologies to genes encoding components of the type III and type IV secretion machineries, suggesting that Brucella might also have an active type III secretion machinery. PMID:11159979

Rhizobial peptidase HrrP cleaves host-encoded signaling peptides and mediates symbiotic compatibility.

Science.gov (United States)

Price, Paul A; Tanner, Houston R; Dillon, Brett A; Shabab, Mohammed; Walker, Graham C; Griffitts, Joel S

2015-12-08

Legume-rhizobium pairs are often observed that produce symbiotic root nodules but fail to fix nitrogen. Using the Sinorhizobium meliloti and Medicago truncatula symbiotic system, we previously described several naturally occurring accessory plasmids capable of disrupting the late stages of nodule development while enhancing bacterial proliferation within the nodule. We report here that host range restriction peptidase (hrrP), a gene found on one of these plasmids, is capable of conferring both these properties. hrrP encodes an M16A family metallopeptidase whose catalytic activity is required for these symbiotic effects. The ability of hrrP to suppress nitrogen fixation is conditioned upon the genotypes of both the host plant and the hrrP-expressing rhizobial strain, suggesting its involvement in symbiotic communication. Purified HrrP protein is capable of degrading a range of nodule-specific cysteine-rich (NCR) peptides encoded by M. truncatula. NCR peptides are crucial signals used by M. truncatula for inducing and maintaining rhizobial differentiation within nodules, as demonstrated in the accompanying article [Horváth B, et al. (2015) Proc Natl Acad Sci USA, 10.1073/pnas.1500777112]. The expression pattern of hrrP and its effects on rhizobial morphology are consistent with the NCR peptide cleavage model. This work points to a symbiotic dialogue involving a complex ensemble of host-derived signaling peptides and bacterial modifier enzymes capable of adjusting signal strength, sometimes with exploitative outcomes.

Biostimulation of soil polluted 10000 ppm of waste motor oil and phytoremediation with Cicer arietinum improved by Bacillus cereus/Rhizobium etli

Directory of Open Access Journals (Sweden)

Juárez-Cisneros Gladys

2016-08-01

Full Text Available Soil pollution by waste motor oil (WMO is reducing its productivity. An alternative for removing WMO from soil is by biostimulation (BIS applying animal manure and then phytoremediation (PR by legume improving with plant growth promoting bacteria (PGPB to reduce WMO concentration at level below 4400 ppm limit permit for the NOM-138-SEMARNAT/SSA1-2012 (NOM-138. The aims of this re-search were: i to analyze soil biostimulation polluted by 10000 ppm of WMO applying vermicompost, then subsequent soil phytoremediation with Cicer arietinum inoculated by Bacillus cereus and/or Rhizo-bium etli. In soil after applying BS by VC was measured WMO soil concentration and ii for PR was regarded phenology and biomass of C. arietinum and WMO concentration remaining at the end of this step. The results showed that soil biostimulated by VC, WMO was reduced at 1370 ppm, subsequent PR sowing C. arietinum with R. etli, WMR was reduced at 30 ppm concentration both values below to maxi-mum value accepted by NOM-138. Those data indicate that in soil polluted by WMO the best way to biorecovery soil was to integrate strategy BS/PR the last one improved by genus of PGPB.

Rhizobium leguminosarum COMO ORGANISMO BIOCONTROLADOR DE LA INTERACCIÓN HOSPEDERO-PATÓGENO: CLAVEL (Dianthus caryophyllus – Fusarium Oxysporum f. sp. dianthi

Directory of Open Access Journals (Sweden)

Cheol Woo Lee Park

2010-08-01

Full Text Available Se investigó el efecto de biocontrol de Rhizobium leguminosarum (R. leguminosarum cepa B, contra Fusarium oxysporum f.sp.dianthi (FOD raza 2, en la interacción Clavel - FOD. Se utilizó la raza 2 de FOD por ser la de mayor patogenicidad y distribución en las fincas de cultivo de clavel en Colombia. Para ello se establecieron las condiciones de inoculación de FOD sobre cultivos establecidos de R . leguminosarum, variando la concentración in vitro de la bacteria. Se encontró una reducción en el número de microconidias hasta un 90% y una inhibición en el crecimiento radial del patógeno de hasta un 71 %. En el ensayo de microcultivo dual se detectó fraccionamiento de las hifas después de 48 horas de incubación con R . leguminosarum En el ensayo in vivo, los esquejes de clavel Raggio di solé, variedad susceptible al patógeno, fueron inoculados con 45.0 x 10 células de R. leguminosarum por matero, mostrando una severidad inferior al 5%, una incidencia menor del 20% y una reducción del índice de la enfermedad hasta de un 92% en presencia del patógeno.

Induction of host defences by Rhizobium during ineffective nodulation of pea (Pisum sativum L.) carrying symbiotically defective mutations sym40 (PsEFD), sym33 (PsIPD3/PsCYCLOPS) and sym42.

Science.gov (United States)

Ivanova, Kira A; Tsyganova, Anna V; Brewin, Nicholas J; Tikhonovich, Igor A; Tsyganov, Viktor E

2015-11-01

Rhizobia are able to establish a beneficial interaction with legumes by forming a new organ, called the symbiotic root nodule, which is a unique ecological niche for rhizobial nitrogen fixation. Rhizobial infection has many similarities with pathogenic infection and induction of defence responses accompanies both interactions, but defence responses are induced to a lesser extent during rhizobial infection. However, strong defence responses may result from incompatible interactions between legumes and rhizobia due to a mutation in either macro- or microsymbiont. The aim of this research was to analyse different plant defence reactions in response to Rhizobium infection for several pea (Pisum sativum) mutants that result in ineffective symbiosis. Pea mutants were examined by histochemical and immunocytochemical analyses, light, fluorescence and transmission electron microscopy and quantitative real-time PCR gene expression analysis. It was observed that mutations in pea symbiotic genes sym33 (PsIPD3/PsCYCLOPS encoding a transcriptional factor) and sym40 (PsEFD encoding a putative negative regulator of the cytokinin response) led to suberin depositions in ineffective nodules, and in the sym42 there were callose depositions in infection thread (IT) and host cell walls. The increase in deposition of unesterified pectin in IT walls was observed for mutants in the sym33 and sym42; for mutant in the sym42, unesterified pectin was also found around degrading bacteroids. In mutants in the genes sym33 and sym40, an increase in the expression level of a gene encoding peroxidase was observed. In the genes sym40 and sym42, an increase in the expression levels of genes encoding a marker of hypersensitive reaction and PR10 protein was demonstrated. Thus, a range of plant defence responses like suberisation, callose and unesterified pectin deposition as well as activation of defence genes can be triggered by different pea single mutations that cause perception of an otherwise

Identification and Characterization of RibN, a Novel Family of Riboflavin Transporters from Rhizobium leguminosarum and Other Proteobacteria

Science.gov (United States)

García Angulo, Víctor A.; Bonomi, Hernán R.; Posadas, Diana M.; Serer, María I.; Torres, Alfredo G.; Zorreguieta, Ángeles

2013-01-01

Rhizobia are symbiotic bacteria able to invade and colonize the roots of legume plants, inducing the formation of nodules, where bacteria reduce atmospheric nitrogen (N2) to ammonia (NH3). Riboflavin availability influences the capacity of rhizobia to survive in the rhizosphere and to colonize roots. In this study, we identified the RL1692 gene of Rhizobium leguminosarum downstream of a flavin mononucleotide (FMN) riboswitch. RL1692 encodes a putative transmembrane permease with two EamA domains. The presence of an FMN riboswitch regulating a transmembrane protein is usually observed in riboflavin transporters, suggesting that RL1692 may be involved in riboflavin uptake. The product of RL1692, which we named RibN, is conserved in members of the alpha-, beta-, and gammaproteobacteria and shares no significant identity with any riboflavin transporter previously identified. In this work, we show that RibN is localized in the membrane cellular fraction and its expression is downregulated by riboflavin. By heterologous expression in a Brucella abortus mutant auxotrophic for riboflavin, we demonstrate that RibN possesses flavin transport activity. Similarly, we also demonstrate that RibN orthologues from Ochrobactrum anthropi and Vibrio cholerae (which lacks the FMN riboswitch) are able to transport riboflavin. An R. leguminosarum ribN null mutant exhibited lower nodule occupancy levels in pea plants during symbiosis assays. Thus, we propose that RibN and its homologues belong to a novel family of riboflavin transporters. This work provides the first experimental description of riboflavin transporters in Gram-negative bacteria. PMID:23935051

Co-existence of Rhizobia and Diverse Non-rhizobial Bacteria in the Rhizosphere and Nodules of Dalbergia odorifera Seedlings Inoculated with Bradyrhizobium elkanii, Rhizobium multihospitium–Like and Burkholderia pyrrocinia–Like Strains

Directory of Open Access Journals (Sweden)

Junkun Lu

2017-11-01

Full Text Available Rhizobia induce root nodules and fix atmospheric N2 for most legume species in exchange for carbon. However, the diverse endophytic non-rhizobial bacteria in legume nodules that co-exist with rhizobia are often ignored because they are difficult to cultivate using routine cultivation approaches. To enhance our understanding of the incidence and diversity of legume–bacteria associations, a high-throughput sequencing analysis of bacterial 16S rRNA genes was used to examine the bacterial community in the rhizospheres and root nodules of Dalbergia odorifera seedlings that were uninoculated or inoculated with Bradyrhizobium elkanii H255, Rhizobium multihospitium–like HT221, or Burkholderia pyrrocinia–like H022238, in two growth media (nitrogen [N]-supplied soil or N-omitted potting mix. Seedlings inoculated with Bradyrhizobium had significantly more nodules than seedlings in the other inoculation conditions, regardless of growth media. Using the 15N natural abundance method, it was shown that the inoculated plants had significantly higher N2 fixation efficiency (48–57% and specific nodule activity [269–313 μg N mg−1 of dry weight (dwt nodule] compared to the uninoculated plants (203 μg N mg−1 dwt nodule. The 16S rRNA gene analysis showed that there was generally a higher bacterial diversity in the rhizosphere than in the nodules in the corresponding condition. Both rhizobial inoculation and media status significantly altered the bacterial communities in the rhizospheres and nodules (P < 0.05, with the exception of the inoculated soil rhizospheres. Regarding non-rhizobial bacteria, three genera, i.e., Lactococcus, Bacillus, and Pseudomonas, were consistently enriched in the rhizosphere and Bradyrhizobium, Chloroplast norank (which belongs to Cyanobacteria, and Lactococcus were commonly found in the nodules. In contrast, common rhizobial genera (including Rhizobium, Mesorhizobium, and Burkholderia were only present in the nodules at low

Exo-oligosaccharides of Rhizobium sp. strain NGR234 are required for symbiosis with various legumes.

Science.gov (United States)

Staehelin, Christian; Forsberg, Lennart S; D'Haeze, Wim; Gao, Mu-Yun; Carlson, Russell W; Xie, Zhi-Ping; Pellock, Brett J; Jones, Kathryn M; Walker, Graham C; Streit, Wolfgang R; Broughton, William J

2006-09-01

Rhizobia are nitrogen-fixing bacteria that establish endosymbiotic associations with legumes. Nodule formation depends on various bacterial carbohydrates, including lipopolysaccharides, K-antigens, and exopolysaccharides (EPS). An acidic EPS from Rhizobium sp. strain NGR234 consists of glucosyl (Glc), galactosyl (Gal), glucuronosyl (GlcA), and 4,6-pyruvylated galactosyl (PvGal) residues with beta-1,3, beta-1,4, beta-1,6, alpha-1,3, and alpha-1,4 glycoside linkages. Here we examined the role of NGR234 genes in the synthesis of EPS. Deletions within the exoF, exoL, exoP, exoQ, and exoY genes suppressed accumulation of EPS in bacterial supernatants, a finding that was confirmed by chemical analyses. The data suggest that the repeating subunits of EPS are assembled by an ExoQ/ExoP/ExoF-dependent mechanism, which is related to the Wzy polymerization system of group 1 capsular polysaccharides in Escherichia coli. Mutation of exoK (NGROmegaexoK), which encodes a putative glycanase, resulted in the absence of low-molecular-weight forms of EPS. Analysis of the extracellular carbohydrates revealed that NGROmegaexoK is unable to accumulate exo-oligosaccharides (EOSs), which are O-acetylated nonasaccharide subunits of EPS having the formula Gal(Glc)5(GlcA)2PvGal. When used as inoculants, both the exo-deficient mutants and NGROmegaexoK were unable to form nitrogen-fixing nodules on some hosts (e.g., Albizia lebbeck and Leucaena leucocephala), but they were able to form nitrogen-fixing nodules on other hosts (e.g., Vigna unguiculata). EOSs of the parent strain were biologically active at very low levels (yield in culture supernatants, approximately 50 microg per liter). Thus, NGR234 produces symbiotically active EOSs by enzymatic degradation of EPS, using the extracellular endo-beta-1,4-glycanase encoded by exoK (glycoside hydrolase family 16). We propose that the derived EOSs (and not EPS) are bacterial components that play a crucial role in nodule formation in various legumes.

Roles of Extracellular Polysaccharides and Biofilm Formation in Heavy Metal Resistance of Rhizobia

Directory of Open Access Journals (Sweden)

Natalia Nocelli

2016-05-01

Full Text Available Bacterial surface components and extracellular compounds, particularly flagella, lipopolysaccharides (LPSs, and exopolysaccharides (EPSs, in combination with environmental signals and quorum-sensing signals, play crucial roles in bacterial autoaggregation, biofilm development, survival, and host colonization. The nitrogen-fixing species Sinorhizobium meliloti (S. meliloti produces two symbiosis-promoting EPSs: succinoglycan (or EPS I and galactoglucan (or EPS II. Studies of the S. meliloti/alfalfa symbiosis model system have revealed numerous biological functions of EPSs, including host specificity, participation in early stages of host plant infection, signaling molecule during plant development, and (most importantly protection from environmental stresses. We evaluated functions of EPSs in bacterial resistance to heavy metals and metalloids, which are known to affect various biological processes. Heavy metal resistance, biofilm production, and co-culture were tested in the context of previous studies by our group. A range of mercury (Hg II and arsenic (As III concentrations were applied to S. meliloti wild type strain and to mutant strains defective in EPS I and EPS II. The EPS production mutants were generally most sensitive to the metals. Our findings suggest that EPSs are necessary for the protection of bacteria from either Hg (II or As (III stress. Previous studies have described a pump in S. meliloti that causes efflux of arsenic from cells to surrounding culture medium, thereby protecting them from this type of chemical stress. The presence of heavy metals or metalloids in culture medium had no apparent effect on formation of biofilm, in contrast to previous reports that biofilm formation helps protect various microorganism species from adverse environmental conditions. In co-culture experiments, EPS-producing heavy metal resistant strains exerted a protective effect on AEPS-non-producing, heavy metal-sensitive strains; a phenomenon

Identification of functional residues essential for dehalogenation by the non-stereospecific α-haloalkanoic acid dehalogenase from Rhizobium sp. RC1.

Science.gov (United States)

Hamid, Azzmer Azzar Abdul; Hamid, Tengku Haziyamin Tengku Abdul; Wahab, Roswanira Abdul; Huyop, Fahrul

2015-03-01

The non-stereospecific α-haloalkanoic acid dehalogenase DehE from Rhizobium sp. RC1 catalyzes the removal of the halide from α-haloalkanoic acid D,L-stereoisomers and, by doing so, converts them into hydroxyalkanoic acid L,D-stereoisomers, respectively. DehE has been extensively studied to determine its potential to act as a bioremediation agent, but its structure/function relationship has not been characterized. For this study, we explored the functional relevance of several putative active-site amino acids by site-specific mutagenesis. Ten active-site residues were mutated individually, and the dehalogenase activity of each of the 10 resulting mutants in soluble cell lysates against D- and L-2-chloropropionic acid was assessed. Interestingly, the mutants W34→A,F37→A, and S188→A had diminished activity, suggesting that these residues are functionally relevant. Notably, the D189→N mutant had no activity, which strongly implies that it is a catalytically important residue. Given our data, we propose a dehalogenation mechanism for DehE, which is the same as that suggested for other non-stereospecific α-haloalkanoic acid dehalogenases. To the best of our knowledge, this is the first report detailing a functional aspect for DehE, and our results could help pave the way for the bioengineering of haloalkanoic acid dehalogenases with improved catalytic properties. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Functional relationships between plasmids and their significance for metabolism and symbiotic performance of Rhizobium leguminosarum bv. trifolii.

Science.gov (United States)

Stasiak, Grażyna; Mazur, Andrzej; Wielbo, Jerzy; Marczak, Małgorzata; Zebracki, Kamil; Koper, Piotr; Skorupska, Anna

2014-11-01

Rhizobium leguminosarum bv. trifolii TA1 (RtTA1) is a soil bacterium establishing a highly specific symbiotic relationship with clover, which is based on the exchange of molecular signals between the host plant and the microsymbiont. The RtTA1 genome is large and multipartite, composed of a chromosome and four plasmids, which comprise approximately 65 % and 35 % of the total genome, respectively. Extrachromosomal replicons were previously shown to confer significant metabolic versatility to bacteria, which is important for their adaptation in the soil and nodulation competitiveness. To investigate the contribution of individual RtTA1 plasmids to the overall cell phenotype, metabolic properties and symbiotic performance, a transposon-based elimination strategy was employed. RtTA1 derivatives cured of pRleTA1b or pRleTA1d and deleted in pRleTA1a were obtained. In contrast to the in silico predictions of pRleTA1b and pRleTA1d, which were described as chromid-like replicons, both appeared to be completely curable. On the other hand, for pRleTA1a (symbiotic plasmid) and pRleTA1c, which were proposed to be unessential for RtTA1 viability, it was not possible to eliminate them at all (pRleTA1c) or entirely (pRleTA1a). Analyses of the phenotypic traits of the RtTA1 derivatives obtained revealed the functional significance of individual plasmids and their indispensability for growth, certain metabolic pathways, production of surface polysaccharides, autoaggregation, biofilm formation, motility and symbiotic performance. Moreover, the results allow us to suggest broad functional cooperation among the plasmids in shaping the phenotypic properties and symbiotic capabilities of rhizobia.

Mutation of praR in Rhizobium leguminosarum enhances root biofilms, improving nodulation competitiveness by increased expression of attachment proteins.

Science.gov (United States)

Frederix, Marijke; Edwards, Anne; Swiderska, Anna; Stanger, Andrew; Karunakaran, Ramakrishnan; Williams, Alan; Abbruscato, Pamela; Sanchez-Contreras, Maria; Poole, Philip S; Downie, J Allan

2014-08-01

In Rhizobium leguminosarum bv. viciae, quorum-sensing is regulated by CinR, which induces the cinIS operon. CinI synthesizes an AHL, whereas CinS inactivates PraR, a repressor. Mutation of praR enhanced biofilms in vitro. We developed a light (lux)-dependent assay of rhizobial attachment to roots and demonstrated that mutation of praR increased biofilms on pea roots. The praR mutant out-competed wild-type for infection of pea nodules in mixed inoculations. Analysis of gene expression by microarrays and promoter fusions revealed that PraR represses its own transcription and mutation of praR increased expression of several genes including those encoding secreted proteins (the adhesins RapA2, RapB and RapC, two cadherins and the glycanase PlyB), the polysaccharide regulator RosR, and another protein similar to PraR. PraR bound to the promoters of several of these genes indicating direct repression. Mutations in rapA2, rapB, rapC, plyB, the cadherins or rosR did not affect the enhanced root attachment or nodule competitiveness of the praR mutant. However combinations of mutations in rapA, rapB and rapC abolished the enhanced attachment and nodule competitiveness. We conclude that relief of PraR-mediated repression determines a lifestyle switch allowing the expression of genes that are important for biofilm formation on roots and the subsequent initiation of infection of legume roots. © 2014 The Authors. Molecular Microbiology published by John Wiley & Sons Ltd.

Distribution of hydrogen-metabolizing bacteria in alfalfa field soil

International Nuclear Information System (INIS)

Cunningham, S.D.; Kapulnik, Y.; Phillips, D.A.

1986-01-01

H 2 evolved by alfalfa root nodules during the process of N 2 fixation may be an important factor influencing the distribution of soil bacteria. To test this hypothesis under field conditions, over 700 bacterial isolates were obtained from fallow soil or from the 3-mm layer of soil surrounding alfalfa (Medicago sativa L.) root nodules, alfalfa roots, or bindweed (Convolvulus arvensis L.) roots. Bacteria were isolated under either aerobic or microaerophilic conditions and were tested for their capacity to metabolize H 2 . Isolates showing net H 2 uptake and 3 H 2 incorporation activity under laboratory conditions were assigned a Hup + phenotype, whereas organisms with significant H 2 output capacity were designated as a Hout + phenotype. Under aerobic isolation conditions two Hup + isolates were obtained, whereas under microaerophilic conditions five Hup + and two Hout + isolates were found. The nine isolates differed on the basis of 24 standard bacteriological characteristics or fatty acid composition. Five of the nine organisms were isolated from soil around root nodules, whereas the other four were found distributed among the other three soil environments. On the basis of the microaerophilic isolations, 4.8% of the total procaryotic isolates from soil around root nodules were capable of oxidizing H 2 , and 1.2% could produce H 2 . Two of the Hup + isolates were identified as Rhizobium meliloti by root nodulation tests, but the fact that none of the isolates reduced C 2 H 2 under the assay conditions suggested that the H 2 metabolism traits were associated with various hydrogenase systems rather than with nitrogenase activity

The symbiotic biofilm of Sinorhizobium fredii SMH12, necessary for successful colonization and symbiosis of Glycine max cv Osumi, is regulated by Quorum Sensing systems and inducing flavonoids via NodD1.

Directory of Open Access Journals (Sweden)

Francisco Pérez-Montaño

Full Text Available Bacterial surface components, especially exopolysaccharides, in combination with bacterial Quorum Sensing signals are crucial for the formation of biofilms in most species studied so far. Biofilm formation allows soil bacteria to colonize their surrounding habitat and survive common environmental stresses such as desiccation and nutrient limitation. This mode of life is often essential for survival in bacteria of the genera Mesorhizobium, Sinorhizobium, Bradyrhizobium, and Rhizobium. The role of biofilm formation in symbiosis has been investigated in detail for Sinorhizobium meliloti and Bradyrhizobium japonicum. However, for S. fredii this process has not been studied. In this work we have demonstrated that biofilm formation is crucial for an optimal root colonization and symbiosis between S. fredii SMH12 and Glycine max cv Osumi. In this bacterium, nod-gene inducing flavonoids and the NodD1 protein are required for the transition of the biofilm structure from monolayer to microcolony. Quorum Sensing systems are also required for the full development of both types of biofilms. In fact, both the nodD1 mutant and the lactonase strain (the lactonase enzyme prevents AHL accumulation are defective in soybean root colonization. The impairment of the lactonase strain in its colonization ability leads to a decrease in the symbiotic parameters. Interestingly, NodD1 together with flavonoids activates certain quorum sensing systems implicit in the development of the symbiotic biofilm. Thus, S. fredii SMH12 by means of a unique key molecule, the flavonoid, efficiently forms biofilm, colonizes the legume roots and activates the synthesis of Nod factors, required for successfully symbiosis.

Bacteria–zinc co-localization implicates enhanced synthesis of cysteine-rich peptides in zinc detoxification when Brassica juncea is inoculated with Rhizobium leguminosarum

Science.gov (United States)

Adediran, Gbotemi A; Ngwenya, Bryne T; Mosselmans, J Frederick W; Heal, Kate V

2016-01-01

Some plant growth promoting bacteria (PGPB) are enigmatic in enhancing plant growth in the face of increased metal accumulation in plants. Since most PGPB colonize the plant root epidermis, we hypothesized that PGPB confer tolerance to metals through changes in speciation at the root epidermis. We employed a novel combination of fluorophore-based confocal laser scanning microscopic imaging and synchrotron based microscopic X-ray fluorescence mapping with X-ray absorption spectroscopy to characterize bacterial localization, zinc (Zn) distribution and speciation in the roots of Brassica juncea grown in Zn contaminated media (400 mg kg−1 Zn) with the endophytic Pseudomonas brassicacearum and rhizospheric Rhizobium leguminosarum. PGPB enhanced epidermal Zn sequestration relative to PGBP-free controls while the extent of endophytic accumulation depended on the colonization mode of each PGBP. Increased root accumulation of Zn and increased tolerance to Zn was associated predominantly with R. leguminosarum and was likely due to the coordination of Zn with cysteine-rich peptides in the root endodermis, suggesting enhanced synthesis of phytochelatins or glutathione. Our mechanistic model of enhanced Zn accumulation and detoxification in plants inoculated with R. leguminosarum has particular relevance to PGPB enhanced phytoremediation of soils contaminated through mining and oxidation of sulphur-bearing Zn minerals or engineered nanomaterials such as ZnS. PMID:26263508

Differential regulation of Rhizobium etli rpoN2 gene expression during symbiosis and free-living growth.

Science.gov (United States)

Michiels, J; Moris, M; Dombrecht, B; Verreth, C; Vanderleyden, J

1998-07-01

The Rhizobium etli rpoN1 gene, encoding the alternative sigma factor sigma54 (RpoN), was recently characterized and shown to be involved in the assimilation of several nitrogen and carbon sources during free-living aerobic growth (J. Michiels, T. Van Soom, I. D'hooghe, B. Dombrecht, T. Benhassine, P. de Wilde, and J. Vanderleyden, J. Bacteriol. 180:1729-1740, 1998). We identified a second rpoN gene copy in R. etli, rpoN2, encoding a 54.0-kDa protein which displays 59% amino acid identity with the R. etli RpoN1 protein. The rpoN2 gene is cotranscribed with a short open reading frame, orf180, which codes for a protein with a size of 20.1 kDa that is homologous to several prokaryotic and eukaryotic proteins of similar size. In contrast to the R. etli rpoN1 mutant strain, inactivation of the rpoN2 gene did not produce any phenotypic defects during free-living growth. However, symbiotic nitrogen fixation was reduced by approximately 90% in the rpoN2 mutant, whereas wild-type levels of nitrogen fixation were observed in the rpoN1 mutant strain. Nitrogen fixation was completely abolished in the rpoN1 rpoN2 double mutant. Expression of rpoN1 was negatively autoregulated during aerobic growth and was reduced during microaerobiosis and symbiosis. In contrast, rpoN2-gusA and orf180-gusA fusions were not expressed aerobically but were strongly induced at low oxygen tensions or in bacteroids. Expression of rpoN2 and orf180 was abolished in R. etli rpoN1 rpoN2 and nifA mutants under all conditions tested. Under free-living microaerobic conditions, transcription of rpoN2 and orf180 required the RpoN1 protein. In symbiosis, expression of rpoN2 and orf180 occurred independently of the rpoN1 gene, suggesting the existence of an alternative symbiosis-specific mechanism of transcription activation.

Biosynthesis of compatible solutes in rhizobial strains isolated from Phaseolus vulgaris nodules in Tunisian fields

Directory of Open Access Journals (Sweden)

Nieto Joaquín J

2010-07-01

Full Text Available Abstract Background Associated with appropriate crop and soil management, inoculation of legumes with microbial biofertilizers can improve food legume yield and soil fertility and reduce pollution by inorganic fertilizers. Rhizospheric bacteria are subjected to osmotic stress imposed by drought and/or NaCl, two abiotic constraints frequently found in semi-arid lands. Osmostress response in bacteria involves the accumulation of small organic compounds called compatible solutes. Whereas most studies on rhizobial osmoadaptation have focussed on the model species Sinorhizobium meliloti, little is known on the osmoadaptive mechanisms used by native rhizobia, which are good sources of inoculants. In this work, we investigated the synthesis and accumulations of compatible solutes by four rhizobial strains isolated from root nodules of Phaseolus vulgaris in Tunisia, as well as by the reference strain Rhizobium tropici CIAT 899T. Results The most NaCl-tolerant strain was A. tumefaciens 10c2, followed (in decreasing order by R. tropici CIAT 899, R. leguminosarum bv. phaseoli 31c3, R. etli 12a3 and R. gallicum bv. phaseoli 8a3. 13C- and 1H-NMR analyses showed that all Rhizobium strains synthesized trehalose whereas A. tumefaciens 10c2 synthesized mannosucrose. Glutamate synthesis was also observed in R. tropici CIAT 899, R. leguminosarum bv. phaseoli 31c3 and A. tumefaciens 10c2. When added as a carbon source, mannitol was also accumulated by all strains. Accumulation of trehalose in R. tropici CIAT 899 and of mannosucrose in A. tumefaciens 10c2 was osmoregulated, suggesting their involvement in osmotolerance. The phylogenetic analysis of the otsA gene, encoding the trehalose-6-phosphate synthase, suggested the existence of lateral transfer events. In vivo 13C labeling experiments together with genomic analysis led us to propose the uptake and conversion pathways of different carbon sources into trehalose. Collaterally, the β-1,2-cyclic glucan from R

Functional analysis of NopM, a novel E3 ubiquitin ligase (NEL domain effector of Rhizobium sp. strain NGR234.

Directory of Open Access Journals (Sweden)

Da-Wei Xin

Full Text Available Type 3 effector proteins secreted via the bacterial type 3 secretion system (T3SS are not only virulence factors of pathogenic bacteria, but also influence symbiotic interactions between nitrogen-fixing nodule bacteria (rhizobia and leguminous host plants. In this study, we characterized NopM (nodulation outer protein M of Rhizobium sp. strain NGR234, which shows sequence similarities with novel E3 ubiquitin ligase (NEL domain effectors from the human pathogens Shigella flexneri and Salomonella enterica. NopM expressed in Escherichia coli, but not the non-functional mutant protein NopM-C338A, showed E3 ubiquitin ligase activity in vitro. In vivo, NopM, but not inactive NopM-C338A, promoted nodulation of the host plant Lablab purpureus by NGR234. When NopM was expressed in yeast, it inhibited mating pheromone signaling, a mitogen-activated protein (MAP kinase pathway. When expressed in the plant Nicotiana benthamiana, NopM inhibited one part of the plant's defense response, as shown by a reduced production of reactive oxygen species (ROS in response to the flagellin peptide flg22, whereas it stimulated another part, namely the induction of defense genes. In summary, our data indicate the potential for NopM as a functional NEL domain E3 ubiquitin ligase. Our findings that NopM dampened the flg22-induced ROS burst in N. benthamiana but promoted defense gene induction are consistent with the concept that pattern-triggered immunity is split in two separate signaling branches, one leading to ROS production and the other to defense gene induction.

Interacción de Tsukamurella paurometabola C-924 con Rhizobium leguminosarum biovar phaseoli CFH en el cultivo de frijol

Directory of Open Access Journals (Sweden)

Marieta Marín Bruzos

2013-01-01

Full Text Available En el estudio se evaluaron, mediante análisis de los parámetros fenológicos de las plantas, la interacción de Tsukamurella paurometabola C-924 con Rhizobium leguminosarum biovar phaseoli CFH en el cultivo de frijol. Se emplearon cuatro tratamientos: plantas sin inocular (control, inoculadas con T. paurometabola C-924, inoculadas con R. leguminosarum biovar phaseoli CFH e inoculadas con ambas cepas. Se observaron diferencias significativas (P < 0.01 en los porcentajes de germinación de las plantas tratadas con microorganismos de forma independiente o conjunta con respecto al control sin inocular. Se determinó que la inoculación de T. paurometabola C-924 afectó el proceso de nodulación de R. leguminosarum biovar phaseoli CFH. Sin embargo, esto no incidió de manera significativa en la altura de las plantas ni en el diámetro del tallo, ya que no se encontraron diferencias entre los tratamientos para estos parámetros. Para el número de hojas, los mejores resultados se obtuvieron con la aplicación de T. paurometabola C-924. Se concluyó que la interacción de T. paurometabola C-924 con R. leguminosarum biovar phaseoli CFH en el frijol estimuló significativamente la germinación de las semillas y el número de hojas de las plantas con respecto al control sin inocular. Aunque la aplicación de T. paurometabola C-924 no favoreció la nodulación de R. leguminosarum biovar phaseoli CFH, esto no afectó las características fenológicas del cultivo.

Exploring the plant-associated bacterial communities in Medicago sativa L

Directory of Open Access Journals (Sweden)

Pini Francesco

2012-05-01

Full Text Available Abstract Background Plant-associated bacterial communities caught the attention of several investigators which study the relationships between plants and soil and the potential application of selected bacterial species in crop improvement and protection. Medicago sativa L. is a legume crop of high economic importance as forage in temperate areas and one of the most popular model plants for investigations on the symbiosis with nitrogen fixing rhizobia (mainly belonging to the alphaproteobacterial species Sinorhizobium meliloti. However, despite its importance, no studies have been carried out looking at the total bacterial community associated with the plant. In this work we explored for the first time the total bacterial community associated with M. sativa plants grown in mesocosms conditions, looking at a wide taxonomic spectrum, from the class to the single species (S. meliloti level. Results Results, obtained by using Terminal-Restriction Fragment Length Polymorphism (T-RFLP analysis, quantitative PCR and sequencing of 16 S rRNA gene libraries, showed a high taxonomic diversity as well as a dominance by members of the class Alphaproteobacteria in plant tissues. Within Alphaproteobacteria the families Sphingomonadaceae and Methylobacteriaceae were abundant inside plant tissues, while soil Alphaproteobacteria were represented by the families of Hyphomicrobiaceae, Methylocystaceae, Bradyirhizobiaceae and Caulobacteraceae. At the single species level, we were able to detect the presence of S. meliloti populations in aerial tissues, nodules and soil. An analysis of population diversity on nodules and soil showed a relatively low sharing of haplotypes (30-40% between the two environments and between replicate mesocosms, suggesting drift as main force shaping S. meliloti population at least in this system. Conclusions In this work we shed some light on the bacterial communities associated with M. sativa plants, showing that Alphaproteobacteria may

Rhizobium leguminosarum bv. trifolii rosR is required for interaction with clover, biofilm formation and adaptation to the environment

Directory of Open Access Journals (Sweden)

Piersiak Tomasz

2010-11-01

Full Text Available Abstract Background Rhizobium leguminosarum bv. trifolii is a symbiotic nitrogen-fixing bacterium that elicits nodules on roots of host plants Trifolium spp. Bacterial surface polysaccharides are crucial for establishment of a successful symbiosis with legumes that form indeterminate-type nodules, such as Trifolium, Pisum, Vicia, and Medicago spp. and aid the bacterium in withstanding osmotic and other environmental stresses. Recently, the R. leguminosarum bv. trifolii RosR regulatory protein which controls exopolysaccharide production has been identified and characterized. Results In this work, we extend our earlier studies to the characterization of rosR mutants which exhibit pleiotropic phenotypes. The mutants produce three times less exopolysaccharide than the wild type, and the low-molecular-weight fraction in that polymer is greatly reduced. Mutation in rosR also results in quantitative alterations in the polysaccharide constituent of lipopolysaccharide. The rosR mutants are more sensitive to surface-active detergents, antibiotics of the beta-lactam group and some osmolytes, indicating changes in the bacterial membranes. In addition, the rosR mutants exhibit significant decrease in motility and form a biofilm on plastic surfaces, which differs significantly in depth, architecture, and bacterial viability from that of the wild type. The most striking effect of rosR mutation is the considerably decreased attachment and colonization of root hairs, indicating that the mutation affects the first stage of the invasion process. Infection threads initiate at a drastically reduced rate and frequently abort before they reach the base of root hairs. Although these mutants form nodules on clover, they are unable to fix nitrogen and are outcompeted by the wild type in mixed inoculations, demonstrating that functional rosR is important for competitive nodulation. Conclusions This report demonstrates the significant role RosR regulatory protein plays in

Biorestauration of soil polluted by waste motor oil by biostimulation with vermicompost and phytoremediation with Sorghum vulgare inoculated by Bacillus cereus and Rhizobium etli

Directory of Open Access Journals (Sweden)

Juárez-Cisneros Gladys

2014-11-01

Full Text Available Soil pollution by waste motor oil (WMO caused soil´s lost fertility. The aims of this research where a bioremediation of soil polluted by 10000 ppm of WMO for biostimulation with vermicompost (VC at 3 and 6 % (w/w follow by b phytoremediation (PR of the same soil to eliminate remaining WMO with Sorghum vulgare inoculated with Bacillus cereus and/or Rhizobium etli or Promoting Growth Plant Bacteria (PGPB. At the first step of assay WMO concentration was measured before and after bioremediation. At the second step the same soil phytoremediation was applied for remaining WHO sowing S. vulgare inoculated with PGPB, then at flowering stage its biomass and WHO final concentration was determined. Results showed that soil impacted by WMO biostimulated with VC at 3% was eliminated 8630 ppm of WMO. At the second phase in the same soil PR applied for remaining WMO which was reduced until 210 ppm. Soil polluted by remaining WMO applied PR using S. vulgare plus R. etli WMO was decreased at 260 ppm. While S. vulgare´s biomass inoculated with PGPB was higher compared to S. vulgare grown in soil not polluted by WMO according by ANOVA - Tukey (p > 0.05. These results suggested that soil polluted by WMO could be recovering by applying integrated BR and PR better than just using one type.

effects of rhizobuim leguminosarum inoculation on the growth and ...

African Journals Online (AJOL)

user

beneficial symbiotic microorganisms into the plant. Rhizosphere ... Rhizobium strains in the yeast manitol broth were ... inoculants contained sixteen (16) colonies of Rhizobium leguminosarum bacterial cells per milliliter (ml) of the yeast ...

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Sinorhizobium meliloti 1021] ... Length = 101 ... Query: 1 ... MFAVIKTGGKQYRVAANDVITIEKLEGVAGDKIEF...TEILMVGVGADATIGAPFVEGAVVS 60 ... MFAVIKTGGKQYRVAANDVITIEKLEGVAGDKIEFTEILMV...GVGADATIGAPFVEGAVVS Sbjct: 1 ... MFAVIKTGGKQYRVAANDVITIEKLEGVAGDKIEFTEILMVGVGADATIGAPFVEGAVVS 60 ...

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Sinorhizobium meliloti 1021] ... Length = 118 ... Query: 249 ELTCADIMSRDVVTVPGDTTPDHARYLLLKHDIRT...LPVLDENEKLQGTVGLRELAGKEPG 308 ... ELTCADIMSRDVVTVPGDTTPDHARYLLLKHDIRTLP...VLDENEKLQGTVGLRELAGKEPG Sbjct: 1 ... ELTCADIMSRDVVTVPGDTTPDHARYLLLKHDIRTLPVLDENEKLQGTVGLRELAGKEPG 60 ...

Genetic diversity and community structure of rhizobia nodulating Sesbania cannabina in saline-alkaline soils.

Science.gov (United States)

Li, Yan; Li, Xiangyue; Liu, Yajing; Wang, En Tao; Ren, Chenggang; Liu, Wei; Xu, Hualing; Wu, Hailong; Jiang, Nan; Li, Yunzhao; Zhang, Xiaoli; Xie, Zhihong

2016-05-01

Sesbania cannabina is a plant that grows naturally along the seashores in Rudong County, China (RDC) and it has been introduced into the Yellow River Delta (YRD) as a pioneer plant to improve the saline-alkaline soils. In order to investigate the diversity of S. cannabina rhizobia in these soils, a total of 198 rhizobial isolates were characterized and phylogenetic trees were constructed based on data from multilocus sequence analysis (MLSA) of the housekeeping genes recA, atpD and glnII, as well as 16S rRNA. Symbiotic features were also studied by establishing the phylogeny of the symbiotic genes nodA and nifH, and by performing nodulation assays. The isolates had highly conserved symbiotic genes and were classified into nine genospecies belonging to the genera Ensifer, Agrobacterium, Neorhizobium and Rhizobium. A unique community structure was detected in the rhizobia associated with S. cannabina in the saline-alkaline soils that was characterized by five novel genospecies and four defined species. In addition, Ensifer sp. I was the predominant rhizobia in YRD, whereas Ensifer meliloti and Neorhizobium huautlense were the dominant species in RDC. Therefore, the study demonstrated for the first time that this plant strongly selected the symbiotic gene background but not the genomic background of its microsymbionts. In addition, biogeographic patterns existed in the rhizobial populations associated with S. cannabina, which were mainly correlated with pH and salinity, as well as the mineral nutrient contents. This study provided novel information concerning the interaction between soil conditions, host plant and rhizobia, in addition to revealing the diversity of S. cannabina rhizobia in saline-alkaline soils. Copyright © 2016 Elsevier GmbH. All rights reserved.

Interplay of Pathogen-Induced Defense Responses and Symbiotic Establishment in Medicago truncatula

Directory of Open Access Journals (Sweden)

Tao Chen

2017-05-01

Full Text Available Suppression of host innate immunity appears to be required for the establishment of symbiosis between rhizobia and host plants. In this study, we established a system that included a host plant, a bacterial pathogen and a symbiotic rhizobium to study the role of innate immunity during symbiotic interactions. A pathogenic bacterium, Pseudomonas syringae pv. tomato strain DC3000 (Pst DC3000, was shown to cause chlorosis in Medicago truncatula A17. Sinorhizobium meliloti strain Sm2011 (Sm2011 and Pst DC3000 strain alone induced similar defense responses in M. truncatula. However, when co-inoculated, Sm2011 specifically suppressed the defense responses induced by Pst DC3000, such as MAPK activation and ROS production. Inoculation with Sm2011 suppressed the transcription of defense-related genes triggered by Pst DC3000 infection, including the receptor of bacterial flagellin (FLS2, pathogenesis-related protein 10 (PR10, and the transcription factor WRKY33. Interestingly, inoculation with Pst DC3000 specifically inhibited the expression of the symbiosis marker genes nodule inception and nodulation pectate lyase and reduced the numbers of infection threads and nodules on M. truncatula A17 roots, indicating that Pst DC3000 inhibits the establishment of symbiosis in M. truncatula. In addition, defense-related genes, such as MAPK3/6, RbohC, and WRKY33, exhibited a transient increase in their expression in the early stage of symbiosis with Sm2011, but the expression dropped down to normal levels at later symbiotic stages. Our results suggest that plant innate immunity plays an antagonistic role in symbiosis by directly reducing the numbers of infection threads and nodules.

Bacterial exopolysaccharides as a modern biotechnological tool for modification of fungal laccase properties and metal ion binding.

Science.gov (United States)

Osińska-Jaroszuk, Monika; Jaszek, Magdalena; Starosielec, Magdalena; Sulej, Justyna; Matuszewska, Anna; Janczarek, Monika; Bancerz, Renata; Wydrych, Jerzy; Wiater, Adrian; Jarosz-Wilkołazka, Anna

2018-03-26

Four bacterial EPSs extracted from Rhizobium leguminosarum bv. trifolii Rt24.2, Sinorhizobium meliloti Rm1021, Bradyrhizobium japonicum USDA110, and Bradyrhizobium elkanii USDA76 were determined towards their metal ion adsorption properties and possible modification of Cerrena unicolor laccase properties. The highest magnesium and iron ion-sorption capacity (~ 42 and ~ 14.5%, respectively) was observed for EPS isolated from B. japonicum USDA110. An evident influence of EPSs on the stability of laccase compared to the control values (without EPSs) was shown after 30-day incubation at 25 °C. The residual activity of laccases was obtained in the presence of Rh76EPS and Rh1021EPS, i.e., 49.5 and 41.5% of the initial catalytic activity, respectively. This result was confirmed by native PAGE electrophoresis. The EPS effect on laccase stability at different pH (from 3.8 to 7.0) was also estimated. The most significant changes at the optimum pH value (pH 5.8) was observed in samples of laccase stabilized by Rh76EPS and Rh1021EPS. Cyclic voltamperometry was used for analysis of electrochemical parameters of laccase stabilized by bacterial EPS and immobilized on single-walled carbon nanotubes (SWCNTs) with aryl residues. Laccases with Rh76EPS and Rh1021EPS had an evident shift of the value of the redox potential compared to the control without EPS addition. In conclusion, the results obtained in this work present a new potential use of bacterial EPSs as a metal-binding component and a modulator of laccase properties especially stability of enzyme activity, which can be a very effective tool in biotechnology and industrial applications.

High spatial variation in population size and symbiotic performance of Rhizobium leguminosarum bv. trifolii with white clover in New Zealand pasture soils

Science.gov (United States)

Tillard, Guyléne; van Ham, Robert; Ballard, Ross; Farquharson, Elizabeth; Gerard, Emily; Geurts, Rene; Brown, Matthew; Ridgway, Hayley; O’Callaghan, Maureen

2018-01-01

Biological nitrogen fixation through the legume-rhizobia symbiosis is important for sustainable pastoral production. In New Zealand, the most widespread and valuable symbiosis occurs between white clover (Trifolium repens L.) and Rhizobium leguminosarum bv. trifolii (Rlt). As variation in the population size (determined by most probable number assays; MPN) and effectiveness of N-fixation (symbiotic potential; SP) of Rlt in soils may affect white clover performance, the extent in variation in these properties was examined at three different spatial scales: (1) From 26 sites across New Zealand, (2) at farm-wide scale, and (3) within single fields. Overall, Rlt populations ranged from 95 to >1 x 108 per g soil, with variation similar at the three spatial scales assessed. For almost all samples, there was no relationship between rhizobia population size and ability of the population to fix N during legume symbiosis (SP). When compared with the commercial inoculant strain, the SP of soils ranged between 14 to 143% efficacy. The N-fixing ability of rhizobia populations varied more between samples collected from within a single hill country field (0.8 ha) than between 26 samples collected from diverse locations across New Zealand. Correlations between SP and calcium and aluminium content were found in all sites, except within a dairy farm field. Given the general lack of association between SP and MPN, and high spatial variability of SP at single field scale, provision of advice for treating legume seed with rhizobia based on field-average MPN counts needs to be carefully considered. PMID:29489845

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available SE ... PROTEIN [Sinorhizobium meliloti 1021] ... Length = 130 ... Query: 751 AREDEGAAEASRLRMEIDELRSILETATDGVVVLGRDGDIRT...MNRSASALFDYDEADMRG 810 ... AREDEGAAEASRLRMEIDELRSILETATDGVVVLGRDGDIRT...MNRSASALFDYDEADMRG Sbjct: 1 ... AREDEGAAEASRLRMEIDELRSILETATDGVVVLGRDGDIRTMNRSASALFDYDEADMRG

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Sinorhizobium meliloti 1021] ... Length = 138 ... Query: 9 ... SKAPRSVLFMCGMNAIRSPMAEALARVALPKGTYVASAGVRQGERD...PFVDVVLEEVGLTI 68 ... SKAPRSVLFMCGMNAIRSPMAEALARVALPKGTYVASAGVRQGERD...PFVDVVLEEVGLTI Sbjct: 1 ... SKAPRSVLFMCGMNAIRSPMAEALARVALPKGTYVASAGVRQGERDPFVDVVLEEVGLTI 60 ... Query: 12

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available R ... PROTEIN [Sinorhizobium meliloti 1021] ... Length = 106 ... Query: 12 ... ELTVGEVAERSGLAVSTLHFYEAKGLIRSN...RSRGNQRRYPRSVLRRVAVIKVAQRTGIPL 71 ... ELTVGEVAERSGLAVSTLHFYEAKGLIRSN...RSRGNQRRYPRSVLRRVAVIKVAQRTGIPL Sbjct: 1 ... ELTVGEVAERSGLAVSTLHFYEAKGLIRSNRSRGNQRRYPRSVLRRVAVIKVAQRTGIPL 60 ...

Determination of mycoflora of pea (Pisum sativum) seeds and the ...

African Journals Online (AJOL)

Jane

2011-07-06

Jul 6, 2011 ... Mycoflora of pea seeds and the effectiveness of Rhizobium leguminosarum on important seed-borne pathogens ... seed germination and promoted the plants growth under controlled and ..... 27. Table 3. Summary of fungal inoculation test. .... and lettuce by phosphate-solubilizing Rhizobium leguminosarum.

ORF Alignment: NC_003078 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available lator, ArsR family protein [Sinorhizobium meliloti ... 1021] ... Length = 83 ... Query: 8 ... LSALADPTRRAIVARLAAGEATVNELAAPFEM...SLPAVSKHLKVLERAGLISRGRNAQWRP 67 ... LSALADPTRRAIVARLAAGEATVNELAAPFEMSLPAVSKHL...KVLERAGLISRGRNAQWRP Sbjct: 1 ... LSALADPTRRAIVARLAAGEATVNELAAPFEMSLPAVSKHLKVLERAGLISRGRNAQWRP 60 ...

Parallel loss of symbiosis genes in relatives of nitrogen-fixing non-legume Parasponia

NARCIS (Netherlands)

Velzen, van R.; Holmer, R.; Bu, F.; Rutten, L.J.J.; Zeijl, van A.L.; Liu, W.; Santuari, L.; Cao, Q.; Sharma, Trupti; Shen, D.; Purwana Roswanjaya, Yuda; Wardhani, T.; Seifi Kalhor, M.; Jansen, Joelle; Hoogen, van den D.J.; Gungor, Berivan; Hartog, M.V.; Hontelez, J.; Verver, J.W.G.; Yang, W.C.; Schijlen, E.G.W.M.; Repin, Rimi; Schilthuizen, M.; Schranz, M.E.; Heidstra, R.; Miyata, Kana; Fedorova, E.; Kohlen, W.; Bisseling, A.H.J.; Smit, S.; Geurts, R.

2017-01-01

Rhizobium nitrogen-fixing nodules are a well-known trait of legumes, but nodules also occur in other plant lineages either with rhizobium or the actinomycete Frankia as microsymbiont. The widely accepted hypothesis is that nodulation evolved independently multiple times, with only a few losses.

The ethylene-inhibitor aminoethoxyvinylglycine restores normal nodulation by Rhizobium leguminosarum biovar. viciae on Vicia sativa subsp. nigra by suppressing the 'Thick and short roots' phenotype.

Science.gov (United States)

Zaat, S A; Van Brussel, A A; Tak, T; Lugtenberg, B J; Kijne, J W

1989-02-01

Nodulation of Vicia sativa subsp. nigra L. by Rhizobium bacteria is coupled to the development of thick and short roots (Tsr). This root phenotype as well as root-hair induction (Hai) and root-hair deformation (Had) are caused by a factor(s) produced by the bacteria in response to plant flavonoids. When very low inoculum concentrations (0.5-5 bacteria·ml(-1)) were used, V. sativa plants did not develop the Tsr phenotype and became nodulated earlier than plants with Tsr roots. Furthermore, the nodules of these plants were located on the primary root in contrast to nodules on Tsr roots, which were all located at sites of lateral-root emergence. The average numbers of nodules per plant were not significantly different for these two types of nodulation. Root-growth inhibition and Hai, but not Had, could be mimicked by ethephon, and inhibited by aminoethoxyvinylglycine (AVG). Addition of AVG to co-cultures of Vicia sativa and the standard inoculum concentration of 5·10(5) bacteria·ml(-1) suppressed the development of the Tsr phenotype and restored nodulation to the pattern that was observed with very low concentrations of bacteria (0.5-5 bacteria·ml(-1)). The delay in nodulation on Tsr roots appeared to be caused by the fact that nodule meristems did not develop on the primary root, but only on the emerging laterals. The relationship between Tsr, Hai, Had, and nodulation is discussed.

Rhizobium leguminosarum bv. viciae 3841 Adapts to 2,4-Dichlorophenoxyacetic Acid with "Auxin-Like" Morphological Changes, Cell Envelope Remodeling and Upregulation of Central Metabolic Pathways.

Directory of Open Access Journals (Sweden)

Supriya V Bhat

Full Text Available There is a growing need to characterize the effects of environmental stressors at the molecular level on model organisms with the ever increasing number and variety of anthropogenic chemical pollutants. The herbicide 2,4-dichlorophenoxyacetic acid (2,4-D, as one of the most widely applied pesticides in the world, is one such example. This herbicide is known to have non-targeted undesirable effects on humans, animals and soil microbes, but specific molecular targets at sublethal levels are unknown. In this study, we have used Rhizobium leguminosarum bv. viciae 3841 (Rlv as a nitrogen fixing, beneficial model soil organism to characterize the effects of 2,4-D. Using metabolomics and advanced microscopy we determined specific target pathways in the Rlv metabolic network and consequent changes to its phenotype, surface ultrastructure, and physical properties during sublethal 2,4-D exposure. Auxin and 2,4-D, its structural analogue, showed common morphological changes in vitro which were similar to bacteroids isolated from plant nodules, implying that these changes are related to bacteroid differentiation required for nitrogen fixation. Rlv showed remarkable adaptation capabilities in response to the herbicide, with changes to integral pathways of cellular metabolism and the potential to assimilate 2,4-D with consequent changes to its physical and structural properties. This study identifies biomarkers of 2,4-D in Rlv and offers valuable insights into the mode-of-action of 2,4-D in soil bacteria.

ORF Sequence: NC_003078 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

NCBI nr-aa BLAST: CBRC-TSYR-01-0087 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-0087 ref|YP_002824787.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24034.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824787.1 1e-17 20% ...

NCBI nr-aa BLAST: CBRC-TSYR-01-0156 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-0156 ref|YP_002824783.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24030.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824783.1 3e-18 20% ...

NCBI nr-aa BLAST: CBRC-TSYR-01-1411 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-1411 ref|YP_002824787.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24034.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824787.1 4e-43 18% ...

NCBI nr-aa BLAST: CBRC-TSYR-01-0087 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-0087 ref|YP_002824783.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24030.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824783.1 2e-18 19% ...

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available MOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMONIA CHAIN ... ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium... meliloti] ... ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE ... LARGE CHAIN (AMMONIA

Effect of neem cake/fertilizers on symbiotic and non-symbiotic N2 fixing bacteria

International Nuclear Information System (INIS)

Akhtar, S.; Solangi, A.H.; Gilani, G.; Pirzada, M.H.

2002-01-01

Neem cake amendment in soil at 1.3% no adverse effect on the population of four symbiotic Rhizobium species viz., japonicum, R. leguminosarum, R. Phaseoli and R. Fredii and three non-symbiotic free living nitrogen fixers bacteria viz., Pseudomonas diazotrophicus, Klebsiella planticola and Enterobacter cloacae. Neem cake extracted with n-hexane stimulated the growth of Rhizobium species in vitro, whereas Neem cake expeller extracted neither inhibited nor stimulated the growth of Rhizobium species except for R. Fredii, whose was slightly retarded. The fertilizers (urea, NPK and DAP) had no adverse effect on these bacteria even at the dosage ten times higher the recommended dose. (author)

Effects of Nano-Zinc oxide and Seed Inoculation by Plant Growth Promoting Rhizobacteria (PGPR on Yield, Yield Components and Grain Filling Period of Soybean (Glycine max L.

Directory of Open Access Journals (Sweden)

R. Seyed Sharifi

2016-02-01

Full Text Available Introduction Utilizing biological fertilizer is a proper and cheap method for crop production. Potentially, soybean can be used as biological fertilizers and seed inoculation. Zinc is an essential element that have positive effects on plant growth and its development. Canola, sunflower, soybean and safflower are the main cultivated oilseeds in Iran. Soybean production in Iran is very low as compared to other countries. One of the most effective factor in increasing the soybean yield is seed inoculation with plant growth promoting rhizobacteria (PGPR and application of Zinc fertilizer. Some of the benefits provided by PGPR are the ability to produce gibberellic acid, cytokinins and ethylene, N2 fixation, solubilization of mineral phosphates and other nutrients (56. Numerous studies have shown a substantial increase in dry matter accumulation and seed yield following inoculation with PGPR. Seyed Sharifi (45 reported that seed inoculation with Azotobacter chroococcum strain 5 increased all of the growth indices such as total dry matter, crop growth rate and relative growth rate. Increasing and extending the role of biofertilizers such as Rhizobium can reduce the need for chemical fertilizers and decrease adverse environmental effects. Therefore, in the development and implementation of sustainable agricultural techniques, biofertilization has great importance in alleviating environmental pollution and deterioration of the nature. As a legume, soybean can obtain a significant portion (4-85% of its nitrogen requirement through symbiotic N2 fixation when grown in association with effective and compatible Rhizobium strains. Since there is little available information on nano-zinc oxide and seed inoculation by plant growth promoting rhizobacteria (PGPR on yield in the agro-ecological growing zones of Ardabil province of Iran. Therefore, this research was conducted to investigate the effects of nano-zinc oxide and seed inoculation with plant growth

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

Pretreatment of Cr(VI)-amended soil with chromate-reducing rhizobacteria decreases plant toxicity and increases the yield of Pisum sativum.

Science.gov (United States)

Soni, Sumit K; Singh, Rakshapal; Singh, Mangal; Awasthi, Ashutosh; Wasnik, Kundan; Kalra, Alok

2014-05-01

Pot culture experiments were performed under controlled greenhouse conditions to investigate whether four Cr(VI)-reducing bacterial strains (SUCR44, SUCR140, SUCR186, and SUCR188) were able to decrease Cr toxicity to Pisum sativum plants in artificially Cr(VI)-contaminated soil. The effect of pretreatment of soil with chromate-reducing bacteria on plant growth, chromate uptake, bioaccumulation, nodulation, and population of Rhizobium was found to be directly influenced by the time interval between bacterial treatment and seed sowing. Pretreatment of soil with SUCR140 (Microbacterium sp.) 15 days before sowing (T+15) showed a maximum increase in growth and biomass in terms of root length (93 %), plant height (94 %), dry root biomass (99 %), and dry shoot biomass (99 %). Coinoculation of Rhizobium with SUCR140 further improved the aforementioned parameter. Compared with the control, coinoculation of SUCR140+R showed a 117, 116, 136, and 128 % increase, respectively, in root length, plant height, dry root biomass, and dry shoot biomass. The bioavailability of Cr(VI) decreased significantly in soil (61 %) and in uptake (36 %) in SUCR140-treated plants; the effects of Rhizobium, however, either alone or in the presence of SUCR140, were not significant. The populations of Rhizobium (126 %) in soil and nodulation (146 %) in P. sativum improved in the presence of SUCR140 resulting in greater nitrogen (54 %) concentration in the plants. This study shows the usefulness of efficient Cr(VI)-reducing bacterial strain SUCR140 in improving yields probably through decreased Cr toxicity and improved symbiotic relationship of the plants with Rhizobium. Further decrease in the translocation of Cr(VI) through improved nodulation by Rhizobium in the presence of efficient Cr-reducing bacterial strains could also decrease the accumulation of Cr in shoots.

Uso de micorrizas e rizóbio em cultivo consorciado de eucalipto e sesbânia: I - Crescimento, absorção e tranferência de nitrogênio entre plantas Use of mycorrhizas and rhizobium in intercropping system of eucalyptus and sesbania: I - Growth, uptake and transfer of nitrogen between plants

Directory of Open Access Journals (Sweden)

L. A. Rodrigues

2003-08-01

Rhizobium on dry matter production, N uptake and efficiency of use in Eucalyptus grandis and Sesbania virgata plants grown in intercropping systems. The transfer of N from Sesbania virgata to Eucalyptus was also evaluated, using the isotope 15N. The treatments were: with or without inoculation of both plant species with AMF and with or without inoculation of S. virgata with Rhizobium. Plastic pots divided in three compartments (A, B, and C, with a volume of 2 L were used. A and B compartments were separated by a plastic division, while between the B and C compartments a nylon mesh screen (40 mm allowed the penetration of hyphae only, not of plant roots. Root systems of the S. virgata plants were divided between the compartments A and B at planting, and Eucalyptus plants were cultivated in the compartment C. Seven mg kg-1 of 15N-(NH42SO4 with 99% of 15N were applied in compartment A. The plants were grown for 100 days and then harvested. In Eucalyptus plants, the Rhizobium, AMF and AMF + Rhizobium treatments increased the dry matter production by 119, 223, and 209%, respectively, and the N content by 125, 247, and 310%, respectively, in relation to control plants. In S. virgata plants, all treatments inoculated with microorganisms increased the N content and decreased the C/N rate. The efficiency of N use was greater in Eucalyptus plants inoculated with AMF and did not vary with the treatments in sesbania. A transfer of 15N from S. virgata to Eucalyptus plants was observed in all treatments.

Bioremediation model for atrazine contaminated agricultural soils using phytoremediation (using Phaseolus vulgaris L.) and a locally adapted microbial consortium.

Science.gov (United States)

Madariaga-Navarrete, Alfredo; Rodríguez-Pastrana, Blanca Rosa; Villagómez-Ibarra, José Roberto; Acevedo-Sandoval, Otilio Arturo; Perry, Gregory; Islas-Pelcastre, Margarita

2017-06-03

The objective of the present study was to examine a biological model under greenhouse conditions for the bioremediation of atrazine contaminated soils. The model consisted in a combination of phytoremediation (using Phaseolus vulgaris L.) and rhizopheric bio-augmentation using native Trichoderma sp., and Rhizobium sp. microorganisms that showed no inhibitory growth at 10,000 mg L -1 of herbicide concentration. 33.3 mg of atrazine 50 g -1 of soil of initial concentration was used and an initial inoculation of 1 × 10 9 UFC mL -1 of Rhizobium sp. and 1 × 10 5 conidia mL -1 of Trichoderma sp. were set. Four treatments were arranged: Bean + Trichoderma sp. (B+T); Bean + Rhizobium sp. (BR); Bean + Rhizobium sp. + Trichoderma sp. (B+R+T) and Bean (B). 25.51 mg of atrazine 50 g -1 of soil (76.63%) was removed by the B+T treatment in 40 days (a = 0.050, Tukey). This last indicate that the proposed biological model and methodology developed is useful for atrazine contaminated bioremediation agricultural soils, which can contribute to reduce the effects of agrochemical abuse.

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE

The Micro-RNA172c-APETALA2-1 Node as a Key Regulator of the Common Bean-Rhizobium etli Nitrogen Fixation Symbiosis1[OPEN

Science.gov (United States)

Nova-Franco, Bárbara; Íñiguez, Luis P.; Valdés-López, Oswaldo; Leija, Alfonso; Fuentes, Sara I.; Ramírez, Mario; Paul, Sujay

2015-01-01

Micro-RNAs are recognized as important posttranscriptional regulators in plants. The relevance of micro-RNAs as regulators of the legume-rhizobia nitrogen-fixing symbiosis is emerging. The objective of this work was to functionally characterize the role of micro-RNA172 (miR172) and its conserved target APETALA2 (AP2) transcription factor in the common bean (Phaseolus vulgaris)-Rhizobium etli symbiosis. Our expression analysis revealed that mature miR172c increased upon rhizobial infection and continued increasing during nodule development, reaching its maximum in mature nodules and decaying in senescent nodules. The expression of AP2-1 target showed a negative correlation with miR172c expression. A drastic decrease in miR172c and high AP2-1 mRNA levels were observed in ineffective nodules. Phenotypic analysis of composite bean plants with transgenic roots overexpressing miR172c or a mutated AP2-1 insensitive to miR172c cleavage demonstrated the pivotal regulatory role of the miR172 node in the common bean-rhizobia symbiosis. Increased miR172 resulted in improved root growth, increased rhizobial infection, increased expression of early nodulation and autoregulation of nodulation genes, and improved nodulation and nitrogen fixation. In addition, these plants showed decreased sensitivity to nitrate inhibition of nodulation. Through transcriptome analysis, we identified 114 common bean genes that coexpressed with AP2-1 and proposed these as being targets for transcriptional activation by AP2-1. Several of these genes are related to nodule senescence, and we propose that they have to be silenced, through miR172c-induced AP2-1 cleavage, in active mature nodules. Our work sets the basis for exploring the miR172-mediated improvement of symbiotic nitrogen fixation in common bean, the most important grain legume for human consumption. PMID:25739700

The micro-RNA72c-APETALA2-1 node as a key regulator of the common bean-Rhizobium etli nitrogen fixation symbiosis.

Science.gov (United States)

Nova-Franco, Bárbara; Íñiguez, Luis P; Valdés-López, Oswaldo; Alvarado-Affantranger, Xochitl; Leija, Alfonso; Fuentes, Sara I; Ramírez, Mario; Paul, Sujay; Reyes, José L; Girard, Lourdes; Hernández, Georgina

2015-05-01

Micro-RNAs are recognized as important posttranscriptional regulators in plants. The relevance of micro-RNAs as regulators of the legume-rhizobia nitrogen-fixing symbiosis is emerging. The objective of this work was to functionally characterize the role of micro-RNA172 (miR172) and its conserved target APETALA2 (AP2) transcription factor in the common bean (Phaseolus vulgaris)-Rhizobium etli symbiosis. Our expression analysis revealed that mature miR172c increased upon rhizobial infection and continued increasing during nodule development, reaching its maximum in mature nodules and decaying in senescent nodules. The expression of AP2-1 target showed a negative correlation with miR172c expression. A drastic decrease in miR172c and high AP2-1 mRNA levels were observed in ineffective nodules. Phenotypic analysis of composite bean plants with transgenic roots overexpressing miR172c or a mutated AP2-1 insensitive to miR172c cleavage demonstrated the pivotal regulatory role of the miR172 node in the common bean-rhizobia symbiosis. Increased miR172 resulted in improved root growth, increased rhizobial infection, increased expression of early nodulation and autoregulation of nodulation genes, and improved nodulation and nitrogen fixation. In addition, these plants showed decreased sensitivity to nitrate inhibition of nodulation. Through transcriptome analysis, we identified 114 common bean genes that coexpressed with AP2-1 and proposed these as being targets for transcriptional activation by AP2-1. Several of these genes are related to nodule senescence, and we propose that they have to be silenced, through miR172c-induced AP2-1 cleavage, in active mature nodules. Our work sets the basis for exploring the miR172-mediated improvement of symbiotic nitrogen fixation in common bean, the most important grain legume for human consumption. © 2015 American Society of Plant Biologists. All Rights Reserved.

Exploiting an ancient signalling machinery to enjoy a nitrogen fixing symbiosis.

Science.gov (United States)

Geurts, Rene; Lillo, Alessandra; Bisseling, Ton

2012-08-01

For almost a century now it has been speculated that a transfer of the largely legume-specific symbiosis with nitrogen fixing rhizobium would be profitable in agriculture [1,2]. Up to now such a step has not been achieved, despite intensive research in this era. Novel insights in the underlying signalling networks leading to intracellular accommodation of rhizobium as well as mycorrhizal fungi of the Glomeromycota order show extensive commonalities between both interactions. As mycorrhizae symbiosis can be established basically with most higher plant species it raises questions why is it only in a few taxonomic lineages that the underlying signalling network could be hijacked by rhizobium. Unravelling this will lead to insights that are essential to achieve an old dream. Copyright © 2012. Published by Elsevier Ltd.

The Effects of Clinorotation on the Host Plant, Medicago truncatula, and Its Microbial Symbionts

Directory of Open Access Journals (Sweden)

Ariel J.C. Dauzart

2016-02-01

Full Text Available Understanding the outcome of the plant-microbe symbiosis in altered gravity is vital to developing life support systems for long-distance space travel and colonization of other planets. Thus, the aim of this research was to understand mutualistic relationships between plants and endophytic microbes under the influence of altered gravity. This project utilized the model tripartite relationship among Medicago truncatula ¬– Sinorhizobium meliloti – Rhizophagus irregularis. Plants were inoculated with rhizobial bacteria (S. meliloti, arbuscular mycorrhizal fungi (R. irregularis, or both microbes, and placed on a rotating clinostat. Vertical and horizontal static controls were also performed. Clinorotation significantly reduced M. truncatula dry mass and fresh mass compared to the static controls. The addition of rhizobia treatments under clinorotation also altered total root length and root-to-shoot fresh mass ratio. Nodule size decreased under rhizobia + clinorotation treatment, and nodule density was significantly decreased compared to the vertical treatment. However, inoculation with arbuscular mycorrhizal fungi was shown to increase biomass accumulation and nodule size. Thus, clinorotation significantly affected M. truncatula and its symbiotic relationships with S. meliloti and R. irregularis. In the long term, the results observed in this clinostat study on the changes of plant-microbe mutualism need to be investigated in spaceflight experiments. Thus, careful consideration of the symbiotic microbes of plants should be included in the design of bioregenerative life support systems needed for space travel.

The trehalose utilization gene thuA ortholog in Mesorhizobium loti does not influence competitiveness for nodulation on Lotus spp.

Science.gov (United States)

Ampomah, Osei Yaw; Jensen, John Beck

2014-03-01

Competitiveness for nodulation is a desirable trait in rhizobia strains used as inoculant. In Sinorhizobium meliloti 1021 mutation in either of the trehalose utilization genes thuA or thuB influences its competitiveness for root colonization and nodule occupancy depending on the interacting host. We have therefore investigated whether mutation in the thuA ortholog in Mesorhizobium loti MAFF303099 also leads to a similar competitive phenotype on its hosts. The results show that M. loti thuA mutant Ml7023 was symbiotically effective and was as competitive as the wild type in colonization and nodule occupancy on Lotus corniculatus and Lotus japonicus. The thuA gene in M. loti was not induced during root colonization or in the infection threads unlike in S. meliloti, despite its induction by trehalose and high osmolarity in in vitro assays.

The Rhizobium etli rpoN locus: DNA sequence analysis and phenotypical characterization of rpoN, ptsN, and ptsA mutants.

Science.gov (United States)

Michiels, J; Van Soom, T; D'hooghe, I; Dombrecht, B; Benhassine, T; de Wilde, P; Vanderleyden, J

1998-04-01

The rpoN region of Rhizobium etli was isolated by using the Bradyrhizobium japonicum rpoN1 gene as a probe. Nucleotide sequence analysis of a 5,600-bp DNA fragment of this region revealed the presence of four complete open reading frames (ORFs), ORF258, rpoN, ORF191, and ptsN, coding for proteins of 258, 520, 191, and 154 amino acids, respectively. The gene product of ORF258 is homologous to members of the ATP-binding cassette-type permeases. ORF191 and ptsN are homologous to conserved ORFs found downstream from rpoN genes in other bacterial species. Unlike in most other microorganisms, rpoN and ORF191 are separated by approximately 1.6 kb. The R. etli rpoN gene was shown to control in free-living conditions the production of melanin, the activation of nifH, and the metabolism of C4-dicarboxylic acids and several nitrogen sources (ammonium, nitrate, alanine, and serine). Expression of the rpoN gene was negatively autoregulated and occurred independently of the nitrogen source. Inactivation of the ptsN gene resulted in a decrease of melanin synthesis and nifH expression. In a search for additional genes controlling the synthesis of melanin, an R. etli mutant carrying a Tn5 insertion in ptsA, a gene homologous to the Escherichia coli gene coding for enzyme I of the phosphoenolpyruvate:sugar phosphotransferase system, was obtained. The R. etli ptsA mutant also displayed reduced expression of nifH. The ptsN and ptsA mutants also displayed increased sensitivity to the toxic effects of malate and succinate. Growth of both mutants was inhibited by these C4-dicarboxylates at 20 mM at pH 7.0, while wild-type cells grow normally under these conditions. The effect of malate occurred independently of the nitrogen source used. Growth inhibition was decreased by lowering the pH of the growth medium. These results suggest that ptsN and ptsA are part of the same regulatory cascade, the inactivation of which renders the cells sensitive to toxic effects of elevated concentrations of

Symbiotic N fixation of several soybean varieties and mutants

International Nuclear Information System (INIS)

Soertini, G.; Hendratno

1988-01-01

Symbiotic N fixation of several soybean varieties and mutants. Research activities comprising of three experiments were carried out to screen several soybean varieties and mutants for symbiotic N fixation potential. The first two experiments involved screening of seven rhizobium strains/isolate for effective N fixation. Depending on the medium used, plant response to strains was different. In sterile medium, rhizobium strain USDA 136, 142 and TAL 102 showed a high nitrogen fixation potential. In soil only rhizobium strain USDA 110 had better performance and proved to be competitive to the native strains. Nitrogen-15 dilution method was used to screen nitrogen fixing ability of several soybean varieties and mutants. Guntur variety showed a better response to high dose of N fertilizer without disturbance in its fixing ability. This variety then was considered good to be introduced in the cropping system. (author). 8 refs

A farmer friendly and economic IPM strategy to combat root-knot nematodes infesting lentil

OpenAIRE

Rose Rizvi; Rizwan Ali Ansari; Gulshan Zehra; Irshad Mahmood

2015-01-01

An experiment was conducted to assess the effect of Rhizobium sp., waste tea leaves, eggshell powder, and composted cow dung manure on the root-knot nematode, Meloidogyne incognita, on lentil in Botany department AMU, Aligarh, India. When used alone, composted cow dung was better in reducing galling and nematode multiplication and improving lentil growth followed by eggshell powder, Rhizobium sp., and waste tea leaves. Significant result in the integrated management of M. incognita was obtain...

Effect of Symbiosis of Arbuscular Mycorhiza and Like-endo Mycorhiza on Yield and Uptake of MacroandMicro Elements in Chickpea Genotypes (Cicer arietinum L.

Directory of Open Access Journals (Sweden)

M. J Arshadi

2017-12-01

Full Text Available Introduction Improving of nutrients absorption by biological approaches, in addition to emphasis on sustainable agriculture, will increase or stabilize crop yield. It seems that microorganisms such as mycorrhiza and rhizobium can improve the nutrients absorption in crops such as chickpea. Rhizobiums are effective to provide biological nitrogen for crops and mycorrhizal fungi are involved to supply biological phosphorus to the plants. Among them, the endo myccorihza (or Vesicular Arbuscular Mycorrhiza that is abbreviated VAM, in creation of symbiosis with the roots of crops such as legumes have been more successful. Of course, the mycorrhizal fungi and rhizobium bacteria before creating symbiosis with host plant, directly affect in the overlay in rhizosphere environment of host plant. Creating colonies in the roots by mycorrhizal fungi leads to conducive for forming nodulation of rhizobium. In other words, mycorrhiza fungi creats favorable conditions for the production of rhizobium nodules on the roots and also they affect on greater availability of phosphorus for nitrogenase enzymes involved in rhizobium bacteria. In contrast, rhizobiums affect in better absorption of nitrogen and followed by the synthesis of amino acids and amino acid availability for required mycorrhiza. It seems that this symbiotic relationship between plants, mycorrhizal and rhizobium can be either normal or adverse environmental conditions, which is effective in promoting the product of crop. However, the Triplet symbiosis of chickpea, mycorrhiza and rhizobium and also chickpea genotypes response to this symbiosis should be examined. Materials and Methods This study was conducted to investigate the inoculation of kabuli seeds of chickpea genotypes with arbuscular mycorrhiza and like - endomycorhiza, in 2014, in split plot by arrangement of two factors with a randomized complete block design and three replications in Research Field, Faculty of Agriculture, Ferdowsi

Nitrous oxide reduction in nodules: denitrification or N2 fixation?

International Nuclear Information System (INIS)

Coyne, M.S.; Focht, D.D.

1987-01-01

Detached cowpea nodules that contained a nitrous oxide reductase-positive (Nor + ) rhizobium strain (8A55) and a nitrous oxide reductase-negative (Nor - ) rhizobium strain (32H1) were incubated with 1% 15 N 2 O (95 atom% 15 N) in the following three atmospheres: aerobic with C 2 H 2 (10%), aerobic without C 2 H 2 , and anaerobic (argon atmosphere) without C 2 H 2 . The greatest production of 15 N 2 occurred anaerobically with 8A55, yet very little was formed with 32H1. Although acetylene reduction activity was slightly higher with 32H1, about 10 times more 15 N 2 was produced aerobically by 8A55 than by 32H1 in the absence of acetylene. The major reductive pathway of N 2 O reduction by denitrifying rhizobium strain 8A55 is by nitrous oxide reductase rather than nitrogenase

Rhizobial symbiosis effect on the growth, metal uptake, and antioxidant responses of Medicago lupulina under copper stress.

Science.gov (United States)

Kong, Zhaoyu; Mohamad, Osama Abdalla; Deng, Zhenshan; Liu, Xiaodong; Glick, Bernard R; Wei, Gehong

2015-08-01

The effects of rhizobial symbiosis on the growth, metal uptake, and antioxidant responses of Medicago lupulina in the presence of 200 mg kg(-1) Cu(2+) throughout different stages of symbiosis development were studied. The symbiosis with Sinorhizobium meliloti CCNWSX0020 induced an increase in plant growth and nitrogen content irrespective of the presence of Cu(2+). The total amount of Cu uptake of inoculated plants significantly increased by 34.0 and 120.4% in shoots and roots, respectively, compared with non-inoculated plants. However, although the rhizobial symbiosis promoted Cu accumulation both in shoots and roots, the increase in roots was much higher than in shoots, thus decreasing the translocation factor and helping Cu phytostabilization. The rate of lipid peroxidation was significantly decreased in both shoots and roots of inoculated vs. non-inoculated plants when measured either 8, 13, or 18 days post-inoculation. In comparison with non-inoculated plants, the activities of superoxide dismutase and ascorbate peroxidase of shoots of inoculated plants exposed to excess Cu were significantly elevated at different stages of symbiosis development; similar increases occurred in the activities of superoxide dismutase, catalase, and glutathione reductase of inoculated roots. The symbiosis with S. meliloti CCNWSX0020 also upregulated the corresponding genes involved in antioxidant responses in the plants treated with excess Cu. The results indicated that the rhizobial symbiosis with S. meliloti CCNWSX0020 not only enhanced plant growth and metal uptake but also improved the responses of plant antioxidant defense to excess Cu stress.

Characterization of rhizobia that nodulate Arachis pintoi by RAPD analysis Caracterização de rizóbios capazes de nodular Arachis pintoi via análise de "RAPD"

Directory of Open Access Journals (Sweden)

Patrícia Pereira Pinto

2004-09-01

Full Text Available The genetic relationships of 85 Arachis pintoi nodulating Rhizobium strains were determined using the random amplified polymorphic DNA (RAPD methods. The analysis included 75 strains isolated from Cerrado soils and 10 other ones of different origins. The results indicated that there is a high level of similarity between these strains and that geographic distribution may affect their phylogenetic relationship. In addition, the results allowed the selection of the most suitable primers for characterisation of these Rhizobium strains which will be useful for implementation of competitiveness studies in Cerrado soils.As relações genéticas de 85 estirpes de Rhizobium capazes de nodular Arachis pintoi foram determinadas usando o método de "RAPD" (Random Amplified Polymorphic DNA. As análises incluíram 75 estirpes isoladas de solos de Cerrado e 10 de diferentes origens. Os resultados indicaram que existe um alto grau de similaridade entre estas estirpes e que a distribuição geográfica pode afetar suas relações filogenéticas. Além disso, os resultados permitiram a seleção de "primers" mais adequados para a caracterização dessas estirpes de Rhizobium, os quais serão úteis para a implementação de estudos de competitividade nos solos de Cerrado.

Characterization and functional analysis of seven flagellin genes in Rhizobium leguminosarum bv. viciae. Characterization of R. leguminosarum flagellins

Directory of Open Access Journals (Sweden)

Tambalo Dinah D

2010-08-01

Full Text Available Abstract Background Rhizobium leguminosarum bv. viciae establishes symbiotic nitrogen fixing partnerships with plant species belonging to the Tribe Vicieae, which includes the genera Vicia, Lathyrus, Pisum and Lens. Motility and chemotaxis are important in the ecology of R. leguminosarum to provide a competitive advantage during the early steps of nodulation, but the mechanisms of motility and flagellar assembly remain poorly studied. This paper addresses the role of the seven flagellin genes in producing a functional flagellum. Results R. leguminosarum strains 3841 and VF39SM have seven flagellin genes (flaA, flaB, flaC, flaD, flaE, flaH, and flaG, which are transcribed separately. The predicted flagellins of 3841 are highly similar or identical to the corresponding flagellins in VF39SM. flaA, flaB, flaC, and flaD are in tandem array and are located in the main flagellar gene cluster. flaH and flaG are located outside of the flagellar/motility region while flaE is plasmid-borne. Five flagellin subunits (FlaA, FlaB, FlaC, FlaE, and FlaG are highly similar to each other, whereas FlaD and FlaH are more distantly related. All flagellins exhibit conserved amino acid residues at the N- and C-terminal ends and are variable in the central regions. Strain 3841 has 1-3 plain subpolar flagella while strain VF39SM exhibits 4-7 plain peritrichous flagella. Three flagellins (FlaA/B/C and five flagellins (FlaA/B/C/E/G were detected by mass spectrometry in the flagellar filaments of strains 3841 and VF39SM, respectively. Mutation of flaA resulted in non-motile VF39SM and extremely reduced motility in 3841. Individual mutations of flaB and flaC resulted in shorter flagellar filaments and consequently reduced swimming and swarming motility for both strains. Mutant VF39SM strains carrying individual mutations in flaD, flaE, flaH, and flaG were not significantly affected in motility and filament morphology. The flagellar filament and the motility of 3841 strains

A farmer friendly and economic IPM strategy to combat root-knot nematodes infesting lentil

Directory of Open Access Journals (Sweden)

Rose Rizvi

2015-12-01

Full Text Available An experiment was conducted to assess the effect of Rhizobium sp., waste tea leaves, eggshell powder, and composted cow dung manure on the root-knot nematode, Meloidogyne incognita, on lentil in Botany department AMU, Aligarh, India. When used alone, composted cow dung was better in reducing galling and nematode multiplication and improving lentil growth followed by eggshell powder, Rhizobium sp., and waste tea leaves. Significant result in the integrated management of M. incognita was obtained when Rhizobium sp. was used in combination with cow dung and eggshell powder (with or without waste tea leaves. Combined application of root nodule bacterium and organic wastes like waste tea leaves, eggshell, and cow dung may be suggested to the farmers/growers or related persons who are having great enthusiasm to establish a lentil production business. Application of these organic materials along with the root nodule bacteria may be helpful to foster soil ecosystem which has been a hot topic in the present scenario.

Antifungal genes expressed in transgenic pea (Pisum sativum L.) do not affect root colonization of arbuscular mycorrhizae fungi.

Science.gov (United States)

Kahlon, Jagroop Gill; Jacobsen, Hans-Jörg; Cahill, James F; Hall, Linda M

2017-10-01

Genetically modified crops have raised concerns about unintended consequences on non-target organisms including beneficial soil associates. Pea transformed with four antifungal genes 1-3 β glucanase, endochitinase, polygalacturonase-inhibiting proteins, and stilbene synthase is currently under field-testing for efficacy against fungal diseases in Canada. Transgenes had lower expression in the roots than leaves in greenhouse experiment. To determine the impact of disease-tolerant pea or gene products on colonization by non-target arbuscular mycorrhizae and nodulation by rhizobium, a field trial was established. Transgene insertion, as single gene or stacked genes, did not alter root colonization by arbuscular mycorrhiza fungus (AMF) or root nodulation by rhizobium inoculation in the field. We found no effect of transgenes on the plant growth and performance although, having a dual inoculant with both AMF and rhizobium yielded higher fresh weight shoot-to-root ratio in all the lines tested. This initial risk assessment of transgenic peas expressing antifungal genes showed no deleterious effect on non-target organisms.

"Ménage à trois"

DEFF Research Database (Denmark)

Ehlers, Bodil K; Grøndahl, Eva; Ronfort, Joëlle

2012-01-01

of both partners. So far these studies have been typically carried out in a single environment. Here, we ask if the genetic correlation between fitness of the host plant Medicago truncatula (Fabaceae) and its bacterial symbiont Sinorhizobium meliloti is affected by the presence/absence of a monoterpene...

Effect of exogenous application of rhizopine on lucerne root nodulation

African Journals Online (AJOL)

Rhizopine, 3-0 -methyl scyllo-inosamine was applied to the roots of luceme seedling inoculated with either rhizopine synthesizing Sinorhizobium meliloti strain L530 or the non-rhizopine synthesizing strain Rm 1021 . There was an initial delay in nodule formation. A significant increase in the number of nodules formed in ...

Crystallization and X-ray diffraction analysis of an l-arabinonate dehydratase from Rhizobium leguminosarum bv. trifolii and a d-xylonate dehydratase from Caulobacter crescentus

Energy Technology Data Exchange (ETDEWEB)

Rahman, Mohammad Mubinur [University of Eastern Finland, Joensuu Campus, PO Box 111, FIN-80101 Joensuu (Finland); Andberg, Martina; Koivula, Anu [VTT Technical Research Centre of Finland Ltd, PO Box 1000, FIN-02044 VTT Espoo (Finland); Rouvinen, Juha; Hakulinen, Nina, E-mail: nina.hakulinen@uef.fi [University of Eastern Finland, Joensuu Campus, PO Box 111, FIN-80101 Joensuu (Finland)

2016-07-13

l-Arabinonate dehydratase and d-xylonate dehydratase from the IlvD/EDD family were crystallized by the vapour-diffusion method. Diffraction data sets were collected to resolutions of 2.40 and 2.66 Å from crystals of l-arabinonate dehydratase and d-xylonate dehydratase, respectively. l-Arabinonate dehydratase (EC 4.2.1.25) and d-xylonate dehydratase (EC 4.2.1.82) are two enzymes that are involved in a nonphosphorylative oxidation pathway of pentose sugars. l-Arabinonate dehydratase converts l-arabinonate into 2-dehydro-3-deoxy-l-arabinonate, and d-xylonate dehydratase catalyzes the dehydration of d-xylonate to 2-dehydro-3-deoxy-d-xylonate. l-Arabinonate and d-xylonate dehydratases belong to the IlvD/EDD family, together with 6-phosphogluconate dehydratases and dihydroxyacid dehydratases. No crystal structure of any l-arabinonate or d-xylonate dehydratase is available in the PDB. In this study, recombinant l-arabinonate dehydratase from Rhizobium leguminosarum bv. trifolii (RlArDHT) and d-xylonate dehydratase from Caulobacter crescentus (CcXyDHT) were heterologously expressed in Escherichia coli and purified by the use of affinity chromatography followed by gel-filtration chromatography. The purified proteins were crystallized using the hanging-drop vapour-diffusion method at 293 K. Crystals of RlArDHT that diffracted to 2.40 Å resolution were obtained using sodium formate as a precipitating agent. They belonged to space group P2{sub 1}, with unit-cell parameters a = 106.07, b = 208.61, c = 147.09 Å, β = 90.43°. Eight RlArDHT molecules (two tetramers) in the asymmetric unit give a V{sub M} value of 3.2 Å{sup 3} Da{sup −1} and a solvent content of 62%. Crystals of CcXyDHT that diffracted to 2.66 Å resolution were obtained using sodium formate and polyethylene glycol 3350. They belonged to space group C2, with unit-cell parameters a = 270.42, b = 236.13, c = 65.17 Å, β = 97.38°. Four CcXyDHT molecules (a tetramer) in the asymmetric unit give a V{sub M

Dinitrogen fixation measurements in some legume crops grown under irrigated condition without bacteria inoculation using 15N

International Nuclear Information System (INIS)

Kurdali, F.; Sharabi, N.D.

1991-01-01

N 2 -fixation in some legume crops: Faba bean Vicia faba, common bean pisum sativum, lentil lens esculenta, chick pea cicer artinum and vetch vicia arvillia grown under irrigated conditions without Rhizobium inoculation was estimated using 15 N-labelled fertilizer method. Barley was used as a reference crop. Significant differences occured in N 2 -fixation capacity among legume crops at flowering and podding stages. The highest percentage of Nitrogen fixed occured in faba bean (88% of total N), while lower values were observed in the other crops: Lentil 84%, vetch 68%, common pea 67% and chick pea 57%. Moreover, amounts of N 2 -fixed were 171, 138, 100, 90 and 13 Kg. N. ha -1 respectively for faba bean, lentil, vetch, common pea and chick pea. This clearly indicates the importance of biological dinitrogen fixation in local legume crops nodulated with indigenous Rhizobium strains regarding to N-soil enrichment. Further investigations must be focused on the selection of both plant species and Rhizobium strains in order to obtain a good symbiotic system. (author). 2 figs

Analysis of nodule meristem persistence and ENOD40 functioning in Medicago truncatula nodule formation

NARCIS (Netherlands)

Wan Xi,

2007-01-01

Medicago root nodules are formed as a result of the interaction of the plant with the soil-borne bacterium Sinorhizobium meliloti. Several plant genes are induced during nodule formation and MtENOD40 is one of the earliest genes activated. The precise function as well as the molecule

The alternative Medicago truncatula defense proteome of ROS – defective transgenic roots during early microbial infection

Directory of Open Access Journals (Sweden)

Leonard Muriithi Kiirika

2014-07-01

Full Text Available ROP-type GTPases of plants function as molecular switches within elementary signal transduction pathways such as the regulation of ROS synthesis via activation of NADPH oxidases (RBOH-respiratory burst oxidase homologue in plants. Previously, we reported that silencing of the Medicago truncatula GTPase MtROP9 led to reduced ROS production and suppressed induction of ROS-related enzymes in transgenic roots (MtROP9i infected with pathogenic (Aphanomyces euteiches and symbiotic microorganisms (Glomus intraradices, Sinorhizobium meliloti. While fungal infections were enhanced, S. meliloti infection was drastically impaired. In this study, we investigate the temporal proteome response of M. truncatula MtROP9i transgenic roots during the same microbial interactions under conditions of deprived potential to synthesize ROS. In comparison with control roots (Mtvector, we present a comprehensive proteomic analysis using sensitive MS protein identification. For four early infection time-points (1, 3, 5, 24 hpi, 733 spots were found to be different in abundance: 213 spots comprising 984 proteins (607 unique were identified after S. meliloti infection, 230 spots comprising 796 proteins (580 unique after G. intraradices infection, and 290 spots comprising 1240 proteins (828 unique after A. euteiches infection. Data evaluation by GelMap in combination with a heatmap tool allowed recognition of key proteome changes during microbial interactions under conditions of hampered ROS synthesis. Overall, the number of induced proteins in MtROP9i was low as compared with controls, indicating a dual function of ROS in defense signaling as well as alternative response patterns activated during microbial infection. Qualitative analysis of induced proteins showed that enzymes linked to ROS production and scavenging were highly induced in control roots, while in MtROP9i the majority of proteins were involved in alternative defense pathways such as cell wall and protein

Effectivenes of inoculation in alfalfa breeding in ecological conditions of the Bjelovar and Bilogora county

Directory of Open Access Journals (Sweden)

Darko Uher

2012-09-01

Full Text Available Development and basic existence of animal production as well as production of high quality milk depends upon possibility of sufficient production of quality and protein sufficient forage. Forage crop that satisfies these demands is alfalfa which is one of the most important perennial forage crop legumes. The aim of this study was to enhance alfalfa production on acid soil by liming and alfalfa seed inoculation with efficient Sinorhizobium meliloti strains in order to reduce the use of mineral nitrogen fertilization and enable qualitative and cost effective production of forage on the dairy farms. Field trial was established at family farm in the area of Bjelovar and Bilogora county. During two years experimental period statistically significant influence of inoculation and liming on forage and dry matteryield was determined. Significantly the lowest yields were determined on untreated plots without liming material. In all untreated plots, significantly lower yields were determined, but significant differences in yields were also obtained by inoculation with different S. meliloti strains, emphasizing the importance of strains selection used for alfalfa inoculation. In both experimental years total forage yield were ranging from 34 t/ha (untreated plots without liming up to 60 t/ha on plots inoculated with strain 2011 and without liming. Values of total dry matter yield for both experimental years ranged from 6.5 t/ha (untreated plots without liming up to 15,7 t/ha on plots inoculated with strain 2011 without liming. Results of this study showed that application of liming materials for acidity removal had positive effect on alfalfa yields in both experimental years and significantly improved alfalfa production on acid soils. The results of this study clearly showed that inoculation with selected S. meliloti strains may improve alfalfa production on acid soils and may contribute to more efficient forage production for dairy farms under particular

Populasi jamur mikoriza vesikular-arbuskular pada lahan bekas galian emas yang direklamasi dengan legum tumbuh cepat dikombinasikan dengan penutup tanah dan mikroba

Directory of Open Access Journals (Sweden)

Suciatmih Suciatmih

2012-02-01

Full Text Available field work has been carried out to study the population of vesicular-arbuscular mycorrhizal (VAM fungi on degraded gold mining land that was reclamated with fast growing legume (Enterolobium sp. and Acacia mangium trees in combination with cover crops (Centrosema pubescen dan Flemingia congesta and microbe (VAM fungi, Rhizobium sp. and mixed Rhizobium sp. and phosphate solubilizing bacteria inoculation. Reclamation with fast growing legumes in combination with cover crops and microbe inoculation on the degraded land increased the population of VAM fungi. After 1.5 years, the population of the fungi on the reclamated land increased from 3.4 (control to 6.1–80.5 spore/g soil. The highest spore population resulted by combination between Acacia mangium, C. pubescen, and VAM fungi (V2I1C1 plot followed by combination between Acacia mangium without cover crop, and VAM fungi inoculation (V2I1C0 plot and combination between Enterolobium sp. without cover crop and mixed Rhizobium and phosphate solubilizing bacteria inoculation (V1I3Co plot were 80.5, 56.0 and 51.8 respectively.

Transcriptomic profiling of Burkholderia phymatum STM815, Cupriavidus taiwanensis LMG19424 and Rhizobium mesoamericanum STM3625 in response to Mimosa pudica root exudates illuminates the molecular basis of their nodulation competitiveness and symbiotic evolutionary history.

Science.gov (United States)

Klonowska, Agnieszka; Melkonian, Rémy; Miché, Lucie; Tisseyre, Pierre; Moulin, Lionel

2018-01-30

Rhizobial symbionts belong to the classes Alphaproteobacteria and Betaproteobacteria (called "alpha" and "beta"-rhizobia). Most knowledge on the genetic basis of symbiosis is based on model strains belonging to alpha-rhizobia. Mimosa pudica is a legume that offers an excellent opportunity to study the adaptation toward symbiotic nitrogen fixation in beta-rhizobia compared to alpha-rhizobia. In a previous study (Melkonian et al., Environ Microbiol 16:2099-111, 2014) we described the symbiotic competitiveness of M. pudica symbionts belonging to Burkholderia, Cupriavidus and Rhizobium species. In this article we present a comparative analysis of the transcriptomes (by RNAseq) of B. phymatum STM815 (BP), C. taiwanensis LMG19424 (CT) and R. mesoamericanum STM3625 (RM) in conditions mimicking the early steps of symbiosis (i.e. perception of root exudates). BP exhibited the strongest transcriptome shift both quantitatively and qualitatively, which mirrors its high competitiveness in the early steps of symbiosis and its ancient evolutionary history as a symbiont, while CT had a minimal response which correlates with its status as a younger symbiont (probably via acquisition of symbiotic genes from a Burkholderia ancestor) and RM had a typical response of Alphaproteobacterial rhizospheric bacteria. Interestingly, the upregulation of nodulation genes was the only common response among the three strains; the exception was an up-regulated gene encoding a putative fatty acid hydroxylase, which appears to be a novel symbiotic gene specific to Mimosa symbionts. The transcriptional response to root exudates was correlated to each strain nodulation competitiveness, with Burkholderia phymatum appearing as the best specialised symbiont of Mimosa pudica.

Effect of arbuscular mycorrhizal fungi and multi-combination of bioinoculants on regenerated seedlings of cotton

International Nuclear Information System (INIS)

Pindi, P.K.; Sultana, T.

2014-01-01

Effect of arbuscular mycorrhizal fungi and multi-combination of bioinoculants on regenerated seedlings of cotton Cotton, referred as 'The white gold' is an important commercial crop in India and stands third in the world by means of area of cultivation. Cotton plant regeneration from callus by somatic embryogenesis and its efficiency has been improved significantly in recent times. Our primary investigation was on regenerative studies and multiple shoot induction system focusing mainly on meristematic tissues like seedling cotyledonary nodal explants in RAH-9750 cotton cultivar. An attempt has been made to improve the rate of surveillance and growth of regenerated cotton seedlings by bio-inoculant (mainly AMF) treatment under greenhouse conditions. Out of a total seven pure cultures of AMF fungi, R1-R2 have shown maximum mycorrhizal colonization with RAH-9750 (R) and was identified as Glomus mosseae. This variety was also tested with three different bioinoculants i.e., Rhizobium sp. RHPU-7, Azospirillum sp. PPK-27, Bacillus sp. PU-1, apart from AMF R1-R2 in different combinations. The cotton seedlings have shown the best results in single, dual, triple and multiple combinations i.e R+R1-R2, R+R1-R2+Rhizobium, R+R1-R2+Rhizobium+Azospirillum and R+R1-R2+Rhizobium+Azospirillum+Bacillus respectively. The growth of cotton plants (RAH-9750) generated from meristematic tissue culture was found to be increasing significantly when compared with the normal seeds. Similar results were noticed when the same experiment was subjected to the different soil types of Mahabubnagar district. The investigation clearly infers that better yield of cotton RAH-9750 (R) could be achieved by treating the regenerated cotton seedlings with bioinoculants in different combination in various soil types of Mahabubnagar district. (author)

Fly-ash-induced oxidative stress and tolerance in Prosopis juliflora L. grown on different amended substrates.

Science.gov (United States)

Sinha, S; Rai, U N; Bhatt, K; Pandey, K; Gupta, A K

2005-03-01

Field experiments were conducted to study the impact of metal accumulation on malondialdehyde (MDA), cysteine and non-protein thiol (NPSH) contents in the plants of Prosopis juliflora grown on the fly ash (FA) amended with soil, blue green algae (BGA) biofertilizer, farm yard manure, press mud and Rhizobium inoculation. The analysis of data revealed that the level of MDA, cysteine and NPSH was higher in the roots of the plant than leaves, which was found positively correlated with metal accumulation. An increase of 361.14, 64.25 and 305.62% in MDA, cysteine and NPSH contents, respectively was observed after 45 days in the roots of the plants grown in 100% FA as compared to 100% garden soil (GS). The level of MDA, cysteine and NPSH was found less in the plants grown on various amendments of FA showing ameliorating effect on the toxicity induced due to the accumulation of metals. The decrease in MDA, cysteine and NPSH contents was higher in Rhizobium-inoculated plants as compared to uninoculated plants grown on 100% FA. The results showed a high tolerance potential of the plant, which is further increased by inoculating the plant with FA-tolerant Rhizobium showing feasibility of using P. julifilora in environmental monitoring of FA landfills.

Comportamento de variedades de soja cujas sementes foram inoculadas com diferentes misturas de estirpes de Rhizobium,em latosol roxo do Estado de São Paulo Behavior of soybean varieties inoculated wtth different mixtures of Rhizobiumstrains in latosol soils of the State of São Paulo

Directory of Open Access Journals (Sweden)

H. A. A. Mascarenhas

1968-01-01

Full Text Available Em solo Latosol Roxo, estudou-se o comportamento de cinco variedades de soja cujas sementes foram inoculadas, ou não, com diferentes misturas de estirpes de Rhizobium. Na produção de sementes, a variedade Hardee foi equivalente à IAC-1 e superior às variedades E-2006, L-571 e Bienville. IAC-1 também foi superior a Bienville. A adubação nitrogenada não aumentou a produção, e as pequenas respostas aos inoculantes não foram significativas. Conquanto a área experimental nunca tivesse cultura de soja, a nodulação foi intensa em todos os canteiros, e não se notou aumento em conseqüência da inoculação experimental.The performance of five soybean varieties whose seeds were inoculated with four different mixtures of Rhizobiumstrains was studied at Ribeirão Prêto, State of São Paulo. In the seed yields, Hardee was statistically equivalent to IAC-1 and superior to L-2006, L-571 and Bienville. Mineral nitrogen did not increase the seed yields and the small responses to the inoculants were not significant. Although the experimental field had never been cropped with soybeans, the nodule formation was very good in all of the plots, so that no increase due to the experimental inoculants was observed.

Genetic diversity in rhizobial isolates determined by RAPDs

African Journals Online (AJOL)

STORAGESEVER

2009-06-17

Jun 17, 2009 ... diversity. It was found that Rhizobium isolates from Agricultural Research Station - Aliyar Nagar ... establish effective nitrogen fixing symbiosis system with .... package (Numerical taxonomy analysis program package, Exeter.

Aerobic granulation strategy for bioaugmentation of a sequencing batch reactor (SBR) treating high strength pyridine wastewater

Energy Technology Data Exchange (ETDEWEB)

Liu, Xiaodong; Chen, Yan [Jiangsu Key Laboratory for Chemical Pollution Control and Resources Reuse, School of Environmental and Biological Engineering, Nanjing University of Science and Technology, Nanjing 210094, Jiangsu Province (China); Zhang, Xin [Jiangsu Key Laboratory for Chemical Pollution Control and Resources Reuse, School of Environmental and Biological Engineering, Nanjing University of Science and Technology, Nanjing 210094, Jiangsu Province (China); Suzhou Institute of Architectural Design Co., Ltd, Suzhou 215021, Jiangsu Province (China); Jiang, Xinbai; Wu, Shijing [Jiangsu Key Laboratory for Chemical Pollution Control and Resources Reuse, School of Environmental and Biological Engineering, Nanjing University of Science and Technology, Nanjing 210094, Jiangsu Province (China); Shen, Jinyou, E-mail: shenjinyou@mail.njust.edu.cn [Jiangsu Key Laboratory for Chemical Pollution Control and Resources Reuse, School of Environmental and Biological Engineering, Nanjing University of Science and Technology, Nanjing 210094, Jiangsu Province (China); Sun, Xiuyun; Li, Jiansheng; Lu, Lude [Jiangsu Key Laboratory for Chemical Pollution Control and Resources Reuse, School of Environmental and Biological Engineering, Nanjing University of Science and Technology, Nanjing 210094, Jiangsu Province (China); Wang, Lianjun, E-mail: wanglj@mail.njust.edu.cn [Jiangsu Key Laboratory for Chemical Pollution Control and Resources Reuse, School of Environmental and Biological Engineering, Nanjing University of Science and Technology, Nanjing 210094, Jiangsu Province (China)

2015-09-15

Abstract: Aerobic granules were successfully cultivated in a sequencing batch reactor (SBR), using a single bacterial strain Rhizobium sp. NJUST18 as the inoculum. NJUST18 presented as both a good pyridine degrader and an efficient autoaggregator. Stable granules with diameter of 0.5–1 mm, sludge volume index of 25.6 ± 3.6 mL g{sup −1} and settling velocity of 37.2 ± 2.7 m h{sup −1}, were formed in SBR following 120-day cultivation. These granules exhibited excellent pyridine degradation performance, with maximum volumetric degradation rate (V{sub max}) varied between 1164.5 mg L{sup −1} h{sup −1} and 1867.4 mg L{sup −1} h{sup −1}. High-throughput sequencing analysis exhibited a large shift in microbial community structure, since the SBR was operated under open condition. Paracoccus and Comamonas were found to be the most predominant species in the aerobic granule system after the system had stabilized. The initially inoculated Rhizobium sp. lost its dominance during aerobic granulation. However, the inoculation of Rhizobium sp. played a key role in the start-up process of this bioaugmentation system. This study demonstrated that, in addition to the hydraulic selection pressure during settling and effluent discharge, the selection of aggregating bacterial inocula is equally important for the formation of the aerobic granule.

The Effect Different Fertilizers, on Germination, Yield, of Vicia vilosa Roth

Directory of Open Access Journals (Sweden)

R Kamaei

2015-09-01

Full Text Available In order to study the interaction of germination, yield of Vicia vilosa Roth to use of biological fertilizer, chemical, and manure, an experiment was conducted as a randomized complete block design with three replications at Research greenhouse, Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, in 2013-2014 growing season. The experimental treatments was included three kinds of bio fertilizers and their integration with each other and vermicompost and chemical fertilizer as following : 1- mycorhhizaarbuscular species Glomus mosseae+vermicompost2- mycorhhiza+Nitrocsin (included bacteries Azospirillum sp. and Azotobacter sp. 3- mycorhhiza arbuscular+ Rhizobium (Rhizobium sp. 4-mycorhhiza arbuscular + Chemical fertilizer NPK 5- mycorhhizaarbuscular (Glomus moseae 6-control. The results showed that, although the treatments has not significant effects on height of stem , it has significant effects on characteristics of root length colonization percent, number the root node, Root dry weight, soggy yield, yield dry and protein Percent. The results showed that the highest percent of root length colonization(76 percent, number the root node (20, Root dry weight (.94 g, soggy yield (1894.5 g m-2, yield dry (473.63 g m-2 and protein Percent (27.33 percent was gained in integrated mycorhhiza and nitrocsine treatment. On the basis of results, the integration of mycrhhoriza and biological rhizobium is suggested as the best fertilizer treatment for Vicia vilosa Roth.

Phenotypic, genetic and symbiotic characterization of Erythrina velutina rhizobia from Caatinga dry forest.

Science.gov (United States)

Rodrigues, Dalila Ribeiro; Silva, Aleksandro Ferreira da; Cavalcanti, Maria Idaline Pessoa; Escobar, Indra Elena Costa; Fraiz, Ana Carla Resende; Ribeiro, Paula Rose de Almeida; Ferreira Neto, Reginaldo Alves; Freitas, Ana Dolores Santiago de; Fernandes-Júnior, Paulo Ivan

2018-02-02

Erythrina velutina ("mulungu") is a legume tree from Caatinga that associates with rhizobia but the diversity and symbiotic ability of "mulungu" rhizobia are poorly understood. The aim of this study was to characterize "mulungu" rhizobia from Caatinga. Bacteria were obteined from Serra Talhada and Caruaru in Caatinga under natural regeneration. The bacteria were evaluated to the amplification of nifH and nodC and to metabolic characteristics. Ten selected bacteria identified by 16S rRNA sequences. They were tested in vitro to NaCl and temperature tolerance, auxin production and calcium phosphate solubilization. The symbiotic ability were assessed in an greenhouse experiment. A total of 32 bacteria were obtained and 17 amplified both symbiotic genes. The bacteria showed a high variable metabolic profile. Bradyrhizobium (6), Rhizobium (3) and Paraburkholderia (1) were identified, differing from their geographic origin. The isolates grew up to 45°C to 0.51molL -1 of NaCl. Bacteria which produced more auxin in the medium with l-tryptophan and two Rhizobium and one Bradyrhizobium were phosphate solubilizers. All bacteria nodulated and ESA 90 (Rhizobium sp.) plus ESA 96 (Paraburkholderia sp.) were more efficient symbiotically. Diverse and efficient rhizobia inhabit the soils of Caatinga dry forests, with the bacterial differentiation by the sampling sites. Copyright © 2018 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.

Aerobic granulation strategy for bioaugmentation of a sequencing batch reactor (SBR) treating high strength pyridine wastewater

International Nuclear Information System (INIS)

Liu, Xiaodong; Chen, Yan; Zhang, Xin; Jiang, Xinbai; Wu, Shijing; Shen, Jinyou; Sun, Xiuyun; Li, Jiansheng; Lu, Lude; Wang, Lianjun

2015-01-01

Abstract: Aerobic granules were successfully cultivated in a sequencing batch reactor (SBR), using a single bacterial strain Rhizobium sp. NJUST18 as the inoculum. NJUST18 presented as both a good pyridine degrader and an efficient autoaggregator. Stable granules with diameter of 0.5–1 mm, sludge volume index of 25.6 ± 3.6 mL g −1 and settling velocity of 37.2 ± 2.7 m h −1 , were formed in SBR following 120-day cultivation. These granules exhibited excellent pyridine degradation performance, with maximum volumetric degradation rate (V max ) varied between 1164.5 mg L −1 h −1 and 1867.4 mg L −1 h −1 . High-throughput sequencing analysis exhibited a large shift in microbial community structure, since the SBR was operated under open condition. Paracoccus and Comamonas were found to be the most predominant species in the aerobic granule system after the system had stabilized. The initially inoculated Rhizobium sp. lost its dominance during aerobic granulation. However, the inoculation of Rhizobium sp. played a key role in the start-up process of this bioaugmentation system. This study demonstrated that, in addition to the hydraulic selection pressure during settling and effluent discharge, the selection of aggregating bacterial inocula is equally important for the formation of the aerobic granule

Host-secreted antimicrobial peptide enforces symbiotic selectivity in Medicago truncatula.

Science.gov (United States)

Wang, Qi; Yang, Shengming; Liu, Jinge; Terecskei, Kata; Ábrahám, Edit; Gombár, Anikó; Domonkos, Ágota; Szűcs, Attila; Körmöczi, Péter; Wang, Ting; Fodor, Lili; Mao, Linyong; Fei, Zhangjun; Kondorosi, Éva; Kaló, Péter; Kereszt, Attila; Zhu, Hongyan

2017-06-27

Legumes engage in root nodule symbioses with nitrogen-fixing soil bacteria known as rhizobia. In nodule cells, bacteria are enclosed in membrane-bound vesicles called symbiosomes and differentiate into bacteroids that are capable of converting atmospheric nitrogen into ammonia. Bacteroid differentiation and prolonged intracellular survival are essential for development of functional nodules. However, in the Medicago truncatula - Sinorhizobium meliloti symbiosis, incompatibility between symbiotic partners frequently occurs, leading to the formation of infected nodules defective in nitrogen fixation (Fix - ). Here, we report the identification and cloning of the M. truncatula NFS2 gene that regulates this type of specificity pertaining to S. meliloti strain Rm41. We demonstrate that NFS2 encodes a nodule-specific cysteine-rich (NCR) peptide that acts to promote bacterial lysis after differentiation. The negative role of NFS2 in symbiosis is contingent on host genetic background and can be counteracted by other genes encoded by the host. This work extends the paradigm of NCR function to include the negative regulation of symbiotic persistence in host-strain interactions. Our data suggest that NCR peptides are host determinants of symbiotic specificity in M. truncatula and possibly in closely related legumes that form indeterminate nodules in which bacterial symbionts undergo terminal differentiation.

Geographically structured genetic variation in the Medicago lupulina-Ensifer mutualism.

Science.gov (United States)

Harrison, Tia L; Wood, Corlett W; Heath, Katy D; Stinchcombe, John R

2017-07-01

Gene flow between genetically differentiated populations can maintain variation in species interactions, especially when population structure is congruent between interacting species. However, large-scale empirical comparisons of the population structure of interacting species are rare, particularly in positive interspecific interactions (mutualisms). One agriculturally and ecologically important mutualism is the partnership between legume plants and rhizobia. Through characterizing and comparing the population genomic structure of the legume Medicago lupulina and two rhizobial species (Ensifer medicae and E. meliloti), we explored the spatial scale of population differentiation between interacting partners in their introduced range in North America. We found high proportions of E. meliloti in southeastern populations and high proportions of E. medicae in northwestern populations. Medicago lupulina and the Ensifer genus showed similar patterns of spatial genetic structure (isolation by distance). However, we detected no evidence of isolation by distance or population structure within either species of bacteria. Genome-wide nucleotide diversity within each of the two Ensifer species was low, suggesting limited introduction of strains, founder events, or severe bottlenecks. Our results suggest that there is potential for geographically structured coevolution between M. lupulina and the Ensifer genus, but not between M. lupulina and either Ensifer species. © 2017 The Author(s). Evolution © 2017 The Society for the Study of Evolution.

Distribution and Phylogeny of Microsymbionts Associated with Cowpea (Vigna unguiculata) Nodulation in Three Agroecological Regions of Mozambique.

Science.gov (United States)

Chidebe, Ifeoma N; Jaiswal, Sanjay K; Dakora, Felix D

2018-01-15

Cowpea derives most of its N nutrition from biological nitrogen fixation (BNF) via symbiotic bacteroids in root nodules. In Sub-Saharan Africa, the diversity and biogeographic distribution of bacterial microsymbionts nodulating cowpea and other indigenous legumes are not well understood, though needed for increased legume production. The aim of this study was to describe the distribution and phylogenies of rhizobia at different agroecological regions of Mozambique using PCR of the BOX element (BOX-PCR), restriction fragment length polymorphism of the internal transcribed spacer (ITS-RFLP), and sequence analysis of ribosomal, symbiotic, and housekeeping genes. A total of 122 microsymbionts isolated from two cowpea varieties (IT-1263 and IT-18) grouped into 17 clades within the BOX-PCR dendrogram. The PCR-ITS analysis yielded 17 ITS types for the bacterial isolates, while ITS-RFLP analysis placed all test isolates in six distinct clusters (I to VI). BLAST n sequence analysis of 16S rRNA and four housekeeping genes ( glnII , gyrB , recA , and rpoB ) showed their alignment with Rhizobium and Bradyrhizobium species. The results revealed a group of highly diverse and adapted cowpea-nodulating microsymbionts which included Bradyrhizobium pachyrhizi , Bradyrhizobium arachidis , Bradyrhizobium yuanmingense , and a novel Bradyrhizobium sp., as well as Rhizobium tropici , Rhizobium pusense , and Neorhizobium galegae in Mozambican soils. Discordances observed in single-gene phylogenies could be attributed to horizontal gene transfer and/or subsequent recombinations of the genes. Natural deletion of 60 bp of the gyrB region was observed in isolate TUTVU7; however, this deletion effect on DNA gyrase function still needs to be confirmed. The inconsistency of nifH with core gene phylogenies suggested differences in the evolutionary history of both chromosomal and symbiotic genes. IMPORTANCE A diverse group of both Bradyrhizobium and Rhizobium species responsible for cowpea

Effects of Rhizobuim leguminosarum inoculation on the growth and ...

African Journals Online (AJOL)

g per plant in 2008 and 2009 seasons, respectively. The findings suggested that inoculation of Mucuna flagellipies with Rhizobium is beneficial and produced high seed yield and could be use as biofertilizer an alternative to nitrogen fertilizer.

Search Results | Page 125 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

2013-01-01

Physiological and biochemical response of local landrace and chickpea varieties to rhizobium inoculation and planting dates under different agro-ecological zones of Ethiopia. Published date. January 1, 2013. Papers. Sanitation URBAN AREAS HEALTH HAZARDS WATER QUALITY DISADVANTAGED GROUPS SLUMS ...

Chemically synthesized 58-mer LysM domain binds lipochitin oligosaccharide

DEFF Research Database (Denmark)

Sørensen, Kasper Kildegaard; Simonsen, Jens Bæk; Maolanon, Nicolai Nareth

2014-01-01

Recognition of carbohydrates by proteins is a ubiquitous biochemical process. In legume-rhizobium symbiosis, lipochitin oligosaccharides, also referred to as nodulation (nod) factors, function as primary rhizobial signal molecules to trigger root nodule development. Perception of these signal mol...

Can mushrooms fix atmospheric nitrogen?

Indian Academy of Sciences (India)

Unknown

Introduction. Rhizobium is a genus of symbiotic N2-fixing soil bacteria that induce ... To produce biofilm cultures, a 2 × 2 cm yeast manitol agar. (YMA) slab was .... determination of antibiotic susceptibilities of bacterial biofilms;. J. Clin. Microbiol.

Download this PDF file

African Journals Online (AJOL)

home

2014-05-25

May 25, 2014 ... Rhizobium leguminosarum bv. viciae Strains Isolated from Faba Bean. Producing ... dietary protein to the majority of population in the country. Soil acidity ...... and nitrogenase activity of pea nodules as affected by low. pH and ...

The formation of endosymbiotic membrane compartments: membrane identity markers and the regulation of vesicle trafficking

NARCIS (Netherlands)

Ivanov, S.

2012-01-01

In symbiosis of plants and arbuscular mycorrhizal fungi as well as in rhizobium-legume symbiosis the microbes are hosted intracellularly, inside specialized membrane compartments of the host. These membrane compartments are morphologically different but similar in function, since they control

Search for microorganisms which can disrupt communication between plant pathogenic bacteria causing hairy roots disease in greenhouse vegetables

NARCIS (Netherlands)

Streminska, M.A.; Stijger, I.

2016-01-01

Hairy roots disease is an important problem in cultivation of greenhouse vegetables (tomato, aubergine and cucumber). Infection is caused by rhizogenic bacteria from Agrobacterium/Rhizobium group. It has been shown that infection process is regulated by environmental factors and quorum sensing

AcEST: DK945559 [AcEST

Lifescience Database Archive (English)

Full Text Available DEC_RHILO Adenine deaminase OS=Rhizobium loti GN=ade ... 34 0.58 sp|O24006|AMP_IMPBA Antimicrobial peptides ...A E DH+GT Sbjct: 222 YASRDLGLP-FHGYVAGGPEDDHEGT 246 >sp|O24006|AMP_IMPBA Antimicrobial peptides OS=Impatiens

Utilisation de la Technique D\\'électrophorèse des Protéines Totales ...

African Journals Online (AJOL)

Utilisation de la Technique D\\'électrophorèse des Protéines Totales sur Gel de Polyacrylamide-SDS (SDS-PAGE) pour L\\'étude de la Diversité des Rhizobiums D\\'Acacia tortilis (Forsk.) Hayne Subsp. Raddiana (Savi) Brenan.

Impact of heavy metals on the rhizosphere microflora of Jatropha ...

African Journals Online (AJOL)

The pot culture experiment of J. multifida dealt with the biochemical characteristics of heavy metals contaminated soil amended with waste water biosludge and biofertilizer (Azotobacter vinelandii). Plant growth promoting rhizobacteria such as Pseudomonas, Azotobacter and Rhizobium were isolated, characterized and ...

Detection and isolation of novel rhizopine-catabolizing bacteria from the environment

Science.gov (United States)

Gardener; de Bruijn FJ

1998-12-01

Microbial rhizopine-catabolizing (Moc) activity was detected in serial dilutions of soil and rhizosphere washes. The activity observed generally ranged between 10(6) and 10(7) catabolic units per g, and the numbers of nonspecific culture-forming units were found to be approximately 10 times higher. A diverse set of 37 isolates was obtained by enrichment on scyllo-inosamine-containing media. However, none of the bacteria that were isolated were found to contain DNA sequences homologous to the known mocA, mocB, and mocC genes of Sinorhizobium meliloti L5-30. Twenty-one of the isolates could utilize an SI preparation as the sole carbon and nitrogen source for growth. Partial sequencing of 16S ribosomal DNAs (rDNAs) amplified from these strains indicated that five distinct bacterial genera (Arthrobacter, Sinorhizobium, Pseudomonas, Aeromonas, and Alcaligenes) were represented in this set. Only 6 of these 21 isolates could catabolize 3-O-methyl-scyllo-inosamine under standard assay conditions. Two of these, strains D1 and R3, were found to have 16S rDNA sequences very similar to those of Sinorhizobium meliloti. However, these strains are not symbiotically effective on Medicago sativa, and DNA sequences homologous to the nodB and nodC genes were not detected in strains D1 and R3 by Southern hybridization analysis.

The Effects of Clinorotation on the Host Plant, Medicago truncatula, and Its Microbial Symbionts

Energy Technology Data Exchange (ETDEWEB)

Dauzart, Ariel J. C.; Vandenbrink, Joshua P.; Kiss, John Z., E-mail: jzkiss@olemiss.edu [Department of Biology, Graduate School, University of Mississippi, University, MS (United States)

2016-02-26

Understanding the outcome of the plant-microbe symbiosis in reduced or altered is vital to developing life support systems for long-distance space travel and colonization of other planets. Thus, the aim of this research was to understand mutualistic relationships between plants and endophytic microbes under the influence of altered gravity. This project utilized the model tripartite relationship among Medicago truncatula—Sinorhizobium meliloti—Rhizophagus irregularis. Plants were inoculated with rhizobial bacteria (S. meliloti), arbuscular mycorrhizal fungi (R. irregularis), or both microbes, and placed on a rotating clinostat. Vertical and horizontal static controls were also performed. Clinorotation significantly reduced M. truncatula dry mass and fresh mass compared to the static controls. The addition of rhizobia treatments under clinorotation also altered total root length and root-to-shoot fresh mass ratio. Nodule size decreased under rhizobia + clinorotation treatment, and nodule density was significantly decreased compared to the vertical treatment. However, inoculation with arbuscular mycorrhizal fungi was shown to increase biomass accumulation and nodule size. Thus, clinorotation significantly affected M. truncatula and its symbiotic relationships with S. meliloti and R. irregularis. In the long term, the results observed in this clinostat study on the changes of plant-microbe mutualism need to be investigated in spaceflight experiments. Thus, careful consideration of the symbiotic microbes of plants should be included in the design of bioregenerative life support systems needed for space travel.

Practical use of CMC-amended rhizobial inoculant for Mucuna pruriens cultivation to enhance the growth and protection against Macrophomina phaseolina.

Science.gov (United States)

Aeron, Abhinav; Khare, Ekta; Kumar Arora, Naveen; Kumar Maheshwari, Dinesh

2012-01-01

In many parts of the world Mucuna pruriens is used as an important medicinal, forage and green manure crop. In the present investigation the effect of the addition of CMC in carrier during development of bioformulation on shelflife, plant growth promotive and biocontrol activity against Macrophomina phaseolina was screened taking M. pruriens as a test crop. Ensifer meliloti RMP6(Ery+Kan+) and Bradyrhizobium sp. BMP7(Tet+Kan+) (kanamycin resistance engineered by Tn5 transposon mutagenesis) used in the study showed production of siderophore, IAA, solubilizing phosphate and biocontrol of M. phaseolina. RMP6(Ery+Kan+) also showed ACC deaminase activity. The survival of both the strains in sawdust-based bioformulation was enhanced with an increase in the concentration of CMC from 0 to 1%. At 0% CMC Bradyrhizobium sp. BMP7(Tet+Kan+) showed more increase in nodule number/plant (500.00%) than E. meliloti RMP6(Ery+Kan+) (52.38%), over the control in M. phaseolina-infested soil. There was 185.94% and 59.52% enhancement in nodule number/plant by RMP6(Ery+Kan+) and BMP7(Tet+Kan+) with an increase in the concentration of CMC from 0% to 1% in the bioformulations. However further increase in concentration of CMC did not result in enhancement in survival of either the strains or nodule number/plant.

The Effects of Clinorotation on the Host Plant, Medicago truncatula, and Its Microbial Symbionts

International Nuclear Information System (INIS)

Dauzart, Ariel J. C.; Vandenbrink, Joshua P.; Kiss, John Z.

2016-01-01

Understanding the outcome of the plant-microbe symbiosis in reduced or altered is vital to developing life support systems for long-distance space travel and colonization of other planets. Thus, the aim of this research was to understand mutualistic relationships between plants and endophytic microbes under the influence of altered gravity. This project utilized the model tripartite relationship among Medicago truncatula—Sinorhizobium meliloti—Rhizophagus irregularis. Plants were inoculated with rhizobial bacteria (S. meliloti), arbuscular mycorrhizal fungi (R. irregularis), or both microbes, and placed on a rotating clinostat. Vertical and horizontal static controls were also performed. Clinorotation significantly reduced M. truncatula dry mass and fresh mass compared to the static controls. The addition of rhizobia treatments under clinorotation also altered total root length and root-to-shoot fresh mass ratio. Nodule size decreased under rhizobia + clinorotation treatment, and nodule density was significantly decreased compared to the vertical treatment. However, inoculation with arbuscular mycorrhizal fungi was shown to increase biomass accumulation and nodule size. Thus, clinorotation significantly affected M. truncatula and its symbiotic relationships with S. meliloti and R. irregularis. In the long term, the results observed in this clinostat study on the changes of plant-microbe mutualism need to be investigated in spaceflight experiments. Thus, careful consideration of the symbiotic microbes of plants should be included in the design of bioregenerative life support systems needed for space travel.

Irradiation Effect on the symbiotic fixation of nitrogen in Bean (Phaseolus vulgaris L)

International Nuclear Information System (INIS)

Roveda Hoyos, Gabriel; Rozo Avila, Liliana; Sierra Daza, Soraya

1997-01-01

The efficiency of legume - Rhizobium association is determined by biological (plant and bacteria) and environmental factors (soil and climate); for that reason, the best cultivars -Rhizobium strains combinations for each specie of legume must be selected according to the specifics environmental conditions. One of the most important sun light qualities are the irradiance levels to which the plants are exposed, because these levels have a close relation with the photosynthetic process, and also affect the biological nitrogen fixation, which has a high energetic requirements for symbiosis. The propose of this work was to determine the effect of irradiance on the Biological Nitrogen Fixation in common bean seedlings, under two environments conditions 100 and 500 moles m - 2 seg - 1 (IA and IB respectively), an nutrition control. The experimental results suggest that in the case of common bean, the irradiance requirements change depending on the Rhizobium strain that has be used in the symbiotic association. Both inoculated and non-inoculated plants with Rhizobium showed different behavior according to the levels of irradiance under which the plants were exposed. Under the irradiance of 500 moles m 2 seg - 1 (IA) the highest values of weight, area of plants, number and weight of nodules, nitrogen and phosphors content in leaves were founded, however under the lowest irradiance 100 μ moles m 2 seg - 1 (IB), the plants showed the largest root and steam, as a result of increase of bud distance, this behavior is known etiolation. The irradiance levels under which the plants are exposed determine the efficiency of symbiosis. The experimental results showed that the irradiance levels, no only affect the plant growth, but also the strains behavior. These results were easily observed in the treatments where ICA P-12 and ICA P-19 strains were used, for the dry weight of leaves, root and leaves area, number and weight of nodules, and nitrogen content of leaves in the plant. The

Complete genome sequencing of Agrobacterium sp. H13-3, the former Rhizobium lupini H13-3, reveals a tripartite genome consisting of a circular and a linear chromosome and an accessory plasmid but lacking a tumor-inducing Ti-plasmid.

Science.gov (United States)

Wibberg, Daniel; Blom, Jochen; Jaenicke, Sebastian; Kollin, Florian; Rupp, Oliver; Scharf, Birgit; Schneiker-Bekel, Susanne; Sczcepanowski, Rafael; Goesmann, Alexander; Setubal, Joao Carlos; Schmitt, Rüdiger; Pühler, Alfred; Schlüter, Andreas

2011-08-20

Agrobacterium sp. H13-3, formerly known as Rhizobium lupini H13-3, is a soil bacterium that was isolated from the rhizosphere of Lupinus luteus. The isolate has been established as a model system for studying novel features of flagellum structure, motility and chemotaxis within the family Rhizobiaceae. The complete genome sequence of Agrobacterium sp. H13-3 has been established and the genome structure and phylogenetic assignment of the organism was analysed. For de novo sequencing of the Agrobacterium sp. H13-3 genome, a combined strategy comprising 454-pyrosequencing on the Genome Sequencer FLX platform and PCR-based amplicon sequencing for gap closure was applied. The finished genome consists of three replicons and comprises 5,573,770 bases. Based on phylogenetic analyses, the isolate could be assigned to the genus Agrobacterium biovar I and represents a genomic species G1 strain within this biovariety. The highly conserved circular chromosome (2.82 Mb) of Agrobacterium sp. H13-3 mainly encodes housekeeping functions characteristic for an aerobic, heterotrophic bacterium. Agrobacterium sp. H13-3 is a motile bacterium driven by the rotation of several complex flagella. Its behaviour towards external stimuli is regulated by a large chemotaxis regulon and a total of 17 chemoreceptors. Comparable to the genome of Agrobacterium tumefaciens C58, Agrobacterium sp. H13-3 possesses a linear chromosome (2.15 Mb) that is related to its reference replicon and features chromosomal and plasmid-like properties. The accessory plasmid pAspH13-3a (0.6 Mb) is only distantly related to the plasmid pAtC58 of A. tumefaciens C58 and shows a mosaic structure. A tumor-inducing Ti-plasmid is missing in the sequenced strain H13-3 indicating that it is a non-virulent isolate. Copyright © 2011 Elsevier B.V. All rights reserved.

Economic evaluation of soil fertility management in groundnut fields ...

African Journals Online (AJOL)

This paper provides the economic evaluation of soil fertility replenishing technologies (use of inorganic fertilizers, organic manure, and rhizobium inoculant) that were tested and recommended. Data on groundnut technologies used, yields, resource availability and use, and farmers' characteristics were collected through ...

Expression of a complete soybean leghemoglobin gene in root nodules of transgenic Lotus corniculatus

DEFF Research Database (Denmark)

Stougaard, J; Petersen, T E; Marcker, K A

1987-01-01

The complete soybean leghemoglobin lbc(3) gene was transferred into the legume Lotus corniculatus using an Agrobacterium rhizogenes vector system. Organ-specific expression of the soybean gene was observed in root nodules formed on regenerated transgenic plants after infection with Rhizobium loti...

Root developmental programs shape the Medicago truncatula nodule meristem

NARCIS (Netherlands)

Franssen, H.; Xiao, T.T.; Kulikova, O.; Wan, X.; Bisseling, T.; Scheres, B.; Heidstra, R.

2015-01-01

Nodules on the roots of legume plants host nitrogen-fixing Rhizobium bacteria. Several lines of evidence indicate that nodules are evolutionarily related to roots. We determined whether developmental control of the Medicago truncatula nodule meristem bears resemblance to that in root meristems

Early nodulins in root nodule development

NARCIS (Netherlands)

Scheres, B.

1990-01-01

The symbiotic interaction between bacteria of the genus Rhizobium and leguminous plants leads to the formation of root nodules, which are specific nitrogen-fixing organs on the roots of plants. Bacteria enter the root by infection threads, and concomitantly cell

PLANT GROWTH-PROMOTING MICROBIAL INOCULANT FOR Schizolobium parahyba pv. parahyba

Directory of Open Access Journals (Sweden)

Priscila Jane Romano de Oliveira Gonçalves

2015-08-01

Full Text Available ABSTRACTSchizolobium parahyba pv. amazonicum (Huber ex Ducke Barneby (paricá occurs naturally in the Amazon and is significant commercial importance due to its rapid growth and excellent performance on cropping systems. The aim of this paper was to evaluate a microbial inoculants such as arbuscular mycorrhiza fungi (AMF and Rhizobium sp. that promote plant growth. The inocula was 10 g of root colonized and spores of Glomus clarum and/or 1 mL of cell suspension (107 CFU/mL of Rhizobium sp. and/or 100 g of chemical fertilizer NPK 20-05-20 per planting hole. The experimental design was complete randomized blocks with five replications and eight treatments (n = 800. Plant height, stem diameter and plant survival were measured. The results were tested for normality and homogeneity of variances and analyzed by ANOVA and Tukey test (p < 0.05. Rhizobium sp and AM fungi showed no effect on plant growth. Environmental factors probably influenced the effectiveness of symbiosis of both microorganisms and plant growth. The chemical fertilizer increased S. parahyba growth. During the first 120 days plants suffered with drought and frost, and at 180 days plants inoculated with microorganism plus chemical fertilizer showed higher survival when compared with control. The results showed that the microbial inoculants used showed an important role on plant survival after high stress conditions, but not in plant growth. Also was concluded that the planting time should be between November to December to avoid the presence of young plants during winter time that is dry and cold.

Benefits from Bio and organic fertilization by cucumber (Cucumis Sativus) with application of 15N stable isotope

International Nuclear Information System (INIS)

Galal, Y. G. M.; Soliman, S. M.; Ahmed, F. A.; El-Sherbiny, A. E. A.; Dahdouh, S. M.

2012-12-01

Benefits from bio and organic fertilizer were evaluated under cucumber (Cucumis Sativus) crop grown on sandy soil at a field scale. The experiment was conducted under drip irrigation system. Fertilization treatment indicated that the combination of 50% mineral fertilizer (MF) + 50% organic compost (OC) was superior over all other fertilization treatment when the fresh weight of cucumber biomass or fruits was considered. It means that half of the recommended dose of of mineral fertilizer is enough to meet the requirement of cucumber crop when supplemented with organic compost. Nitrogen derived from mineral fertilizer (Ndff) by cucumber at different plant growth stages was significantly affected by the rate of addition and enhanced with microbial inoculation. Arbuscular mycorrhizea (AMF) was superior over Azospirillum and Rhizobium inoculations. The enhancement of Ndff uptake by plants was more pronounced at the fruit stage than at vegetative, flowering and hay growth stages. The highest values of Ndfa were induced by Rhizobium at hay stage followed by fruit. Similar trend, but to different extents was noticed with AMF and Azospirillum inoculum s. Most of nitrogen derived from compost (Ndfc) was occurred by addition of 50% MF + 50% Oc. Rhizobium and AMF were more effective than Azospirilum. High quantities of Ndfc were recognized at hay stage compared to other growth stages.The efficient use of mineral fertilizer-N (%NUE) was increased by addition of half:half mineral and organic fertilizer. Similarly, it seems that microbial inoculation in general has a synergistic effect on enhancement of %NUE. Higher NUE occurred at hay growth stage than others. (Author)

Production efficiency and economic potential of different soil fertility ...

African Journals Online (AJOL)

This paper provides the economic evaluation of different soil fertility replenishing technologies (use of inorganic fertilizers, organic manure, and rhizobium inoculant) that were tested during field studies and recommended to groundnut farmers. Data on soil fertility technologies used by households, groundnut yields, and ...

Dicty_cDB: Contig-U11322-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 0 CP001389_3336( CP001389 |pid:none) Rhizobium sp. NGR234, complete ... 39 0.50 AB471639_28( AB471639 |pid:none) Desulfotignum baltic...um genomic DN... 39 0.50 CP000092_304( CP000092 |pid:none) Ralstonia eutropha JMP13

Increased heavy metal tolerance of cowpea plants by dual ...

African Journals Online (AJOL)

Through biological inoculation technology, the bacterial-mycorrhizal-legume tripartite symbiosis in artificially heavy metal polluted soil was documented and the effects of dual inoculation with arbuscular mycorrhizal (AM) fungus and Rhizobium (N-fixing bacteria, NFB) on the host plant cowpea (Vigna sinensis) in pot ...

Cis-regulatory PLETHORA promoter elements directing root and nodule expression are conserved between Arabidopsis thaliana and Medicago truncatula

NARCIS (Netherlands)

Franssen, H.G.J.M.; Kulikova, O.; Willemsen, V.A.; Heidstra, R.

2017-01-01

Nodules are unique organs formed on roots of legumes by soil-borne bacteria, collectively known as rhizobium. Recently, we have shown that orthologs of the AINTEGUMENTA-like (AIL) AP2 transcription factors PLETHORA (PLT) 1 to 4, that redundantly regulate Arabidopsis thaliana root development are

Using information campaigns to bring proven solutions to more ...

International Development Research Centre (IDRC) Digital Library (Canada)

Despite the well-documented advantages of improved legume technologies, adoption is slow. Constraints include the lack of information reaching farmers, along with the availability and affordability of high-quality seeds, fertilizers, and Rhizobium inoculants. This project aims to resolve these limitations to make the ...

Nonlegumes, legumes, and root nodules harbor different arbuscular mycorrhizal fungal communities.

NARCIS (Netherlands)

Scheublin, T.R.; Ridgway, K.P.; Young, J.P.W.; van der Heijden, M.G.A.

2004-01-01

Legumes are an important plant functional group since they can form a tripartite symbiosis with nitrogen-fixing Rhizobium bacteria and phosphorus-acquiring arbuscular mycorrhizal fungi (AMF). However, not much is known about AMF community composition in legumes and their root nodules. In this study,

The Lotus japonicus ndx gene family is involved in nodule function and maintenance

DEFF Research Database (Denmark)

Grønlund, Mette; Gustafsen, Camilla; Jensen, Dorthe Bødker

2003-01-01

To elucidate the function of the ndx homeobox genes during the Rhizobium-legume symbiosis, two Lotus japonicus ndr genes were expressed in the antisense orientation under the control of the nodule-expressed promoter Psenod12 in transgenic Lotus japonicus plants. Many of the transformants obtained...

Pea-root exudates and their effect upon root-nodule bacteria

NARCIS (Netherlands)

Egeraat, van A.W.S.M.

1972-01-01

The main purpose of this investigation was to study the exudation (mechanism, sites) of various compounds by roots of pea seedlings in relation to the growth of Rhizobium leguminosarum.

Chapter 1 gives a survey of the literature pertaining to plant-root

Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory NolR

Science.gov (United States)

The symbiosis between rhizobial microbes and host plants involves the coordinated expression of multiple genes, which leads to nodule formation and nitrogen fixation. As part of the transcriptional machinery for nodulation and symbiosis across a range of Rhizobium, NolR serves as a global regulatory...

Heavy metals and soil microbes

NARCIS (Netherlands)

Giller, K.E.; Witter, E.; McGrath, S.

2009-01-01

The discovery in the early 1980s that soil microorganisms, and in particular the symbiotic bacteria Rhizobium, were highly sensitive to heavy metals initiated a new line of research. This has given us important insights into a range of topics: ecotoxicology, bioavailability of heavy metals, the role

Effects of rhizobia and plant growth promoting bacteria inoculation ...

African Journals Online (AJOL)

Plant growth promoting rhizobacteria (PGPR) stimulate plant growth by producing phytohormone which enhances the growth and physiological activities of the host plant. Recently, legume bacteria (Rhizobium spp.) have been considered as a PGPR for legume as well as non-legumes and have the potential for growth ...

Identification of Ononitol and O-methyl-scyllo-inositol in Pea Root Nodules

DEFF Research Database (Denmark)

Skøt, Leif; Egsgaard, Helge

1984-01-01

Ononitol (4-O-methyl-myo-inositol) and O-methyl-scyllo-inositol were identified in pea (Pisum sativum L.) root nodules formed by twoRhizobium leguminosarum strains. Ononitol was the major soluble carbohydrate in nodules formed by strain 1045 while O-methyl-scyllo-inositol and two unidentified com...

The cultivation of Rhizobial cells in sewage sludge and waste for the production of biological fertilizer

International Nuclear Information System (INIS)

Wongwicharn, A.; Piadang, S.

1994-01-01

The study on the growth of Rhizobium japonicum THA-7 in carriers: Peat Sludge, Filter press cake from sugar industry and the mixer compone nts of Sludge and Filter press cake. These carriers were sterilized by Gamm a radiation at 55 Kilograys. Then rhizobium suspension which grew to late log phase in Mannitol Yeast Extract broth were transfer to carriers. The initial rhizobial cells were 10 7 cfu at 50 percent moisture content. The maximum growth (10 9 cfu) was found after incubation at 30 o C for 17 days in all carriers. The rhizobial cells were stored in carriers at 4 o - 5 o C for 120 days. The amount of cells in all carriers were detected at 10 8 cfu. Maximum survival rate was in the mixture of sludge and filter press cake at the ratio of 1 : 3. Therefore, It should be used as biological fertilizer better than other carriers

Aislamiento y caracterización de cepas de rizobios aisladas de diferentes leguminosas en la región de Cascajal, Villa Clara Isolation and characterization of rhizobia strains isolated from different legumes in the Cascajal region, Villa Clara

Directory of Open Access Journals (Sweden)

Pérez Guianeya

2008-06-01

Full Text Available Se aislaron 19 cepas de rizobio a partir de los nódulos de las leguminosas Canavalia ensiformis, Stylosanthes guianensis, Centrosema molle, Pueraria phaseoloides y Macroptilium atropurpureum, con el objetivo de obtener inoculantes efectivos para dichos cultivos en suelos ácidos. Para la caracterización de los aislados bacterianos se estudiaron sus características micromorfológicas, tintoriales y culturales, así como algunas respuestas fisiológico-bioquímicas, tales como la excreción de ácido o base al medio de cultivo y el ensayo de la cetolactasa. Se hizo un ensayo de nodulación in vitro con cada una de las leguminosas para determinar la efectividad de los aislados. De acuerdo con las características culturales, la tasa de crecimiento en medio LMA y la producción de ácido o base, los aislados obtenidos pudieran pertenecer a los géneros Bradyrhizobium y Rhizobium y/o Sinorhizobium. La prueba de la cetolactasa permitió conocer que ninguno de los aislados en estudio pertenece al género Agrobacterium. El ensayo con plantas inoculadas mostró que todas las cepas aisladas fueron efectivas en la nodulación, ya que nodularon en las leguminosas probadas. Se concluye que de las cepas aisladas 11 pudieran pertenecer al género Bradyrhizobium, mientras que las ocho restantes comparten características similares con los géneros Rhizobium y/o Sinorhizobium; todos los aislados fueron efectivos en la nodulación y pueden considerarse cepas promisorias para la obtención de inoculantes para las leguminosas forrajeras en estudio.Nineteen rhizobium strains were isolated from the nodules of the legumes Canavalia ensiformis, Stylosanthes guianensis, Centrosema molle, Pueraria phaseoloides and Macroptilium atropurpureum, with the objective of obtaining effective inoculants for such crops in acid soils. For the characterization of the bacterial isolates, their micromorphological, staining and cultural characteristics were studied, as well as some

The transcriptional activator LdtR from 'Candidatus Liberibacter asiaticus' mediates osmotic stress tolerance.

Directory of Open Access Journals (Sweden)

Fernando A Pagliai

2014-04-01

Full Text Available The causal agent of Huanglongbing disease, 'Candidatus Liberibacter asiaticus', is a non-culturable, gram negative, phloem-limited α-proteobacterium. Current methods to control the spread of this disease are still limited to the removal and destruction of infected trees. In this study, we identified and characterized a regulon from 'Ca. L. asiaticus' involved in cell wall remodeling, that contains a member of the MarR family of transcriptional regulators (ldtR, and a predicted L,D-transpeptidase (ldtP. In Sinorhizobium meliloti, mutation of ldtR resulted in morphological changes (shortened rod-type phenotype and reduced tolerance to osmotic stress. A biochemical approach was taken to identify small molecules that modulate LdtR activity. The LdtR ligands identified by thermal shift assays were validated using DNA binding methods. The biological impact of LdtR inactivation by the small molecules was then examined in Sinorhizobium meliloti and Liberibacter crescens, where a shortened-rod phenotype was induced by growth in presence of the ligands. A new method was also developed to examine the effects of small molecules on the viability of 'Ca. Liberibacter asiaticus', using shoots from HLB-infected orange trees. Decreased expression of ldtRLas and ldtPLas was observed in samples taken from HLB-infected shoots after 6 h of incubation with the LdtR ligands. These results provide strong proof of concept for the use of small molecules that target LdtR, as a potential treatment option for Huanglongbing disease.

Probing nod factor perception in legumes by fluorescence microspectroscopy

NARCIS (Netherlands)

Goedhart, J.

2001-01-01

Plants of the family of legumes are capable of forming a symbiosis with Rhizobium bacteria. These Gram-negative bacteria invade the root system of a host legume and fix nitrogen in a specialized organ, the so-called root nodule. In exchange for sugars, the bacteria convert atmospheric

Effect of phosphorus limiting on phytase activity, proton efflux and ...

African Journals Online (AJOL)

This work intended to measure the nodulated-roots oxygen consumption, proton efflux and phytase activity in 2 lines of common bean (Phaseolus vulgaris) (115, 147) at 2 levels of P supply. Rooted seedlings were inoculated with Rhizobium tropici CIAT 899 in hydroaeroponic cultivation under glasshouse. Phosphorus was ...

Les jachères de légumineuses arborescentes : sources potentielles ...

African Journals Online (AJOL)

SARAH

30 sept. 2014 ... sources potentielles de bois énergie et de service en. Côte d'Ivoire. GNAHOUA .... bactéries du genre Rhizobium, ce qui leur confère une relative autonomie ..... fondamentales et rôle dans l'aménagement des écosystèmes ...

Growth promotion and protection against Orobanche foetida of ...

African Journals Online (AJOL)

Fetid broomrape (Orobanche foetida Poir.) is a chlorophyll lacking holoparasite that subsists on the roots of plants and causes significant damage to the culture of leguminous plants particularly chickpea (Cicer aerietinum L.). The investigation was done about potential of Rhizobium strains for biological control of O. foetida ...

A review on non-stereospecific haloalkanoic acid dehalogenases ...

African Journals Online (AJOL)

Haloalkanoic acid dehalogenases remove halides from organic haloacids and have potential as bioremediation agents. DehE from Rhizobium sp. RC1, DehI from Pseudomonas putida PP3 and D,LDEX 113 from Pseudomonas sp. 113 are non-stereospecific dehalogenases that invert the configurations of D- and L- ...

Effects of titanium dioxide nanoparticles on red clover and its rhizobial symbiont

NARCIS (Netherlands)

Moll, Janine; Okupnik, Annette; Gogos, Alexander; Knauer, Katja; Bucheli, Thomas D.; Van Der Heijden, Marcel G A; Widmer, Franco

2016-01-01

Titanium dioxide nanoparticles (TiO2 NPs) are in consideration to be used in plant protection products. Before these products can be placed on the market, ecotoxicological tests have to be performed. In this study, the nitrogen fixing bacterium Rhizobium trifolii and red clover were exposed to two

Author Details

African Journals Online (AJOL)

Vermicompost application as affected by Rhizobium inoculation on nodulation and yield of Faba bean (Vicia Faba L.) Abstract PDF · Vol 28, No 1 (2018) - Articles Effect of inoculating Bradyrhizobium on phosphorus use efficiency and nutrient uptake of soybean in calcareous soil, central Rift Valley, Ethiopia Abstract PDF.

Regulation of Long-Chain N-Acyl-Homoserine Lactones in Agrobacterium vitis

OpenAIRE

Hao, Guixia; Burr, Thomas J.

2006-01-01

Homologs of quorum-sensing luxR and luxI regulatory genes, avsR and avsI, were identified in Agrobacterium vitis strain F2/5. Compared to other LuxI proteins from related species, the deduced AvsI shows the greatest identity to SinI (71%) from Sinorhizobium meliloti Rm1021. AvsR possesses characteristic autoinducer binding and helix-turn-helix DNA binding domains and shares a high level of identity with SinR (38%) from Rm1021. Site-directed mutagenesis of avsR and avsI was performed, and both...

Assessment of multi-strain PGPRs biofertilization as compared to ...

African Journals Online (AJOL)

Sids 1, grown in clayey soil to inoculation with plant-growth promoting rhizobacteria (PGPRs) such as cyanobacteria spp; Serratia sp; Rhizobium leguminosarum bv. viciae and Bacillus polymyxa either solely or in combinations in comparison to mineral N-fertilization, Full N-dose; 75 Kg N/fed. Results revealed the superiority ...

The Effects of Biological Fertilizers, Chemical Fertilizers and Manure Application on Some Qualitative Characteristics of Vicia villosa Roth Forage under Greenhouse Condition

Directory of Open Access Journals (Sweden)

R Kamaei

2017-03-01

Full Text Available Introduction Fertilizer management plays an important role in successful crop production. The biological fertilizers have been suggested not only to elimination or significant reduction of chemical fertilizer dependency but also increase of soil fertility and improvement of crop yield and quality. Materials and Methods This experiment was conducted in a completely randomized design with three replications at the Research Greenhouse of Ferdowsi University of Mashhad. The experimental treatments included 1- mycorrhizae arbuscular (Glomus mosseae, 2- mycorrhizae arbuscular (Glomus mosseae + vermicompost (M+V, 3- mycorrhizae + nitroxein (included bacteria Azospirillum sp. and Azotobacter sp. (M+N, 4- mycorrhizae arbuscular + Rhizobium (R. legominuzarum (M+R, 5-mycorrhizae arbuscular + NPK Chemical fertilizer (40-40-20 (M+NPK and 6- Control (without fertilizer, C. In bio-fertilizer treatments, seeds were inoculated by mycorrhizae and Rhizobium immediately before planting, according the standard conditions and company recommendations. Chemical fertilizer and vermicompost were applied directly into the soil. The first irrigation was done immediately after planting and an additional irrigation was also done 4 days after planting to improve the seedling emergence. Subsequent irrigations were conducted at 10-days interval. Forage samples were collected at stage of 10% open bud. The samples were oven-dried in 70°C for 48 h and then weighed before being ground to pass through a 1-mm sieve. Both chemical analysis and in vitro digestibility assessments were performed in triplicate. Crud protein (CP, Ash, neutral detergent fiber (NDF and acid detergent fiber (ADF content of forages were measured by standard methods. An in vitro gas production method was conducted to determine the dry matter (DM and organic matter (OM digestibility. All data were subjected to ANOVA using the GLM procedure of SAS (SAS 9.1 and means were compared by using LSD-test at 5

C:\\Users\\HP Pro 2000\\Desktop\\FOSSOU K. R..xps

African Journals Online (AJOL)

HP Pro 2000

La diversité génétique a été étudiée par PCR-RFLP du gène codant l'ARNr 16S des bactéries. ... genetic diversity of rhizobia nodulating a pigeon pea field in Yamoussoukro (Center Ivory Coast). One ..... growing cowpea Rhizobium strain with.

Twenty-one genome sequences from Pseudomonas species and 19 genome sequences from diverse bacteria isolated from the rhizosphere and endosphere of Populus deltoides.

Science.gov (United States)

Brown, Steven D; Utturkar, Sagar M; Klingeman, Dawn M; Johnson, Courtney M; Martin, Stanton L; Land, Miriam L; Lu, Tse-Yuan S; Schadt, Christopher W; Doktycz, Mitchel J; Pelletier, Dale A

2012-11-01

To aid in the investigation of the Populus deltoides microbiome, we generated draft genome sequences for 21 Pseudomonas strains and 19 other diverse bacteria isolated from Populus deltoides roots. Genome sequences for isolates similar to Acidovorax, Bradyrhizobium, Brevibacillus, Caulobacter, Chryseobacterium, Flavobacterium, Herbaspirillum, Novosphingobium, Pantoea, Phyllobacterium, Polaromonas, Rhizobium, Sphingobium, and Variovorax were generated.

Number and Effectiveness of Pea Rhizobia in Danish Soils

DEFF Research Database (Denmark)

Engvild, K.C.

1989-01-01

Most of 44 Danish soils tested contain between 1000 and 10 000 pea rhizobia (Rhizobium leguminosarum biovar viceae) per gram. Pea rhizobia were not detected in acid moor and forest soils. Only one case of failed nodulation in peas in the field has been noted, in spots in a reclaimed sandy heath m...

Response of Arbuscular mycorrhizal fungi and Rhizobium ...

African Journals Online (AJOL)

Michael Horsfall

2Department of Botany, A.V.C. College (Autonomous), Mannampandal-609 305,. Mayiladuthurai, Tamil ... moisture zone for continuous water absorption and translocating ... sampling on 15th, 30th, and 45th day after sowing and estimation of ...

Persistence of Rhizobium Inoculants originating from Leucaena ...

African Journals Online (AJOL)

TonukariJ

8.0 x 104 and 9.0 x 104 rhizobia/g of soil were recovered respectively in spite of the 10-year fallow period. Biomass ... isotope subplots (6 m2) containing the 4 central trees, .... water and rain water enhanced motility of rhizobial cells from L.

Preliminary characterization of Rhizobium strains isolated from ...

African Journals Online (AJOL)

SERVER

2008-03-18

Mar 18, 2008 ... residues for animal feed and helps to maintain soil fertility through .... A loopful of agar slopes of the strains assayed for vitamin production was ... B12 Assay Medium, amended with 2 mmol l-1 Ca-pantothenate, biotin and ...

Bio fertilization of Cereal and Legume Crops for Increasing Soil available P Uptake Using Nuclear Technique

International Nuclear Information System (INIS)

Soliman, S.; El-Gandour, E. A.; El Gala, A. M.; Ishac, Y. Z.

2004-01-01

Application of N and P in uncommon sources such as N 2 -fixers and AM fungi considered as an important source to save money and reduce pollution. In this concern, two pot experiments were carried out in sandy soils, to study the role of these neutral organisms in increasing the fertility of sandy soil. Wheat and faba bean were used. Seeds of wheat or faba bean were inoculated with Azotobacter or Rhizobium and planted in soils inoculated with and without AM fungi. A 20 mg P/kg soil in the form of single super phosphate (15.5 % P 2 O 5 ) or rock-P (26.6% P 2 O 5 ) were applied in the first experiment while KH 2 PO 4 was added in the second one. Dry weight, spore number, root infection, total and specific P were also determined. Maximum shoot growth were gained when either, wheat or faba bean inoculated with mycorrhizae and N2-fixers relative to the control. it was reached to 54 and 73%, respectively. Phosphorus uptake for shoots of both wheat and faba bean had been significantly increased upon inoculating with AM and/or Azotobacter or Rhizobium. Addition of fertilizer P help to identify the P uptake from soil or fertilizer. Mycorrhizal plants induced significant increase in Pdff by about 39 and 27% over inoculated with Azotobacter for wheat and Rhizobium for faba bean and it reached to 95 and 79% when inoculated with combined inoculation. This may be due to AM fungi absorb more available P than do nonmycorrhizal roots. FUE was increased from about 5 to 10% for wheat; 6 to 19% for faba bean. It can be concluded that, bio fertilizers can increase crop production and soil fertility. Rock-P might be recommended as a source of P fertilizer to be applied with AM fungi. (Authors)

AcEST: DK956784 [AcEST

Lifescience Database Archive (English)

Full Text Available tolB OS=Rhizobium leguminosarum bv.... 38 0.042 sp|A8F168|TOLB_RICM5 Protein tolB OS=Rickettsia massiliae (s...PDGARVSFES 309 >sp|A8F168|TOLB_RICM5 Protein tolB OS=Rickettsia massiliae (strain Mtu5) GN=tolB PE=3 SV=1 Le

Browse Title Index

African Journals Online (AJOL)

Items 101 - 106 of 106 ... Vol 27, No 2 (2017), Vermicompost application as affected by Rhizobium inoculation on nodulation and yield of Faba bean (Vicia Faba L.) Abstract PDF. Anteneh Argaw, Abere Mnalku. Vol 27, No 2 (2017), Vulnerability of smallholder farmers to climate change in the central rift valley of Ethiopia: a ...

A novel type of DNA-binding protein interacts with a conserved sequence in an early nodulin ENOD12 promoter.

NARCIS (Netherlands)

Christiansen, H.; Hansen, A.C.; Vijn, I.; Pallisgaard, N.; Larsen, K.; Yang, W.C.; Bisseling, T.; Marcker, K.A.; Jensen, E.O.

1996-01-01

The pea genes PsENOD12A and PsENOD12B are expressed in the root hairs shortly after infection with the nitrogen-fixing bacterium Rhizobium leguminosarum bv. viciae or after application of purified Nod factors. A 199 bp promoter fragment of the PsENOD12B gene contains sufficient information for Nod

Twenty-One Genome Sequences from Pseudomonas Species and 19 Genome Sequences from Diverse Bacteria Isolated from the Rhizosphere and Endosphere of Populus deltoides

Energy Technology Data Exchange (ETDEWEB)

Brown, Steven D [ORNL; Utturkar, Sagar M [ORNL; Klingeman, Dawn Marie [ORNL; Johnson, Courtney M [ORNL; Martin, Stanton [ORNL; Land, Miriam L [ORNL; Lu, Tse-Yuan [ORNL; Schadt, Christopher Warren [ORNL; Doktycz, Mitchel John [ORNL; Pelletier, Dale A [ORNL

2012-01-01

To aid in the investigation of the Populus deltoides microbiome we generated draft genome sequences for twenty one Pseudomonas and twenty one other diverse bacteria isolated from Populus deltoides roots. Genome sequences for isolates similar to Acidovorax, Bradyrhizobium, Brevibacillus, Burkholderia, Caulobacter, Chryseobacterium, Flavobacterium, Herbaspirillum, Novosphingobium, Pantoea, Phyllobacterium, Polaromonas, Rhizobium, Sphingobium and Variovorax were generated.

effect of exogenous application of rhizopine on lucerne root nodulation

African Journals Online (AJOL)

BSN

Calvert, H. E., Pence, M. K., Pierce, M., Malik, N. S. A., and Bauer, W. D. ( 1984). Anatomical analysis of the development and distribution of Rhizobium infection in soybean roots. Canadian Journal of Botany 62:2375-2384. Cardenas, L., Vidali, L., Domsnguez, J., Pirez, H., Sanchez, F., Helper, P.K. and. Quinto, C. (1998).

Diverse bacteria isolated from microtherm oil-production water.

Science.gov (United States)

Sun, Ji-Quan; Xu, Lian; Zhang, Zhao; Li, Yan; Tang, Yue-Qin; Wu, Xiao-Lei

2014-02-01

In total, 435 pure bacterial strains were isolated from microtherm oil-production water from the Karamay Oilfield, Xinjiang, China, by using four media: oil-production water medium (Cai medium), oil-production water supplemented with mineral salt medium (CW medium), oil-production water supplemented with yeast extract medium (CY medium), and blood agar medium (X medium). The bacterial isolates were affiliated with 61 phylogenetic groups that belong to 32 genera in the phyla Actinobacteria, Firmicutes, and Proteobacteria. Except for the Rhizobium, Dietzia, and Pseudomonas strains that were isolated using all the four media, using different media led to the isolation of bacteria with different functions. Similarly, nonheme diiron alkane monooxygenase genes (alkB/alkM) also clustered according to the isolation medium. Among the bacterial strains, more than 24 % of the isolates could use n-hexadecane as the sole carbon source for growth. For the first time, the alkane-degrading ability and alkB/alkM were detected in Rhizobium, Rhodobacter, Trichococcus, Micrococcus, Enterococcus, and Bavariicoccus strains, and the alkM gene was detected in Firmicutes strains.

Role of bioinoculants and organic fertilizers in fodder production and quality of leguminous tree species.

Science.gov (United States)

Mishra, Seema; Sharma, Satyawati; Vasudevan, Padma

2011-01-01

The comparative effect of dual inoculation of native N fixer (Rhizobium) and AM fungi consortia with different organic fertilizers (vermicompost and farm yard manure) on fodder production and quality of two leguminous tree species (Leucaena leucocephala (Lam) de. Wit. and Sesbania sesban (L.) Merr.) in silvopastoral system and their impact on the fodder production of un-inoculated Panicum maximum Jacq. under cut and carry system. After three years of plantation maximum tree survival was in L. leucocephala in all the treatments in comparison to S. sesban while fodder production was more in S. sesban for initial two years and in third year it accelerated in L. leucocephala. Dual inoculation with vermicompost significantly improved fodder production, fodder quality and rhizosphere microflora in L. leucocephala but in S. sesban dual inoculation was at par with single inoculation of N fixer, AM fungi and control (without inoculation). The grass production was higher with L. leucocephala for two years while in third year it was more with S. sesban. The association of Rhizobium with AM fungi in L. leucocephala was better than in S. sesban.

Symbiotic effectiveness and phylogeny of rhizobia isolated from faba bean (Vicia faba L.) in Sichuan hilly areas, China.

Science.gov (United States)

Xu, Kai Wei; Zou, Lan; Penttinen, Petri; Wang, Ke; Heng, Nan Nan; Zhang, Xiao Ping; Chen, Qiang; Zhao, Ke; Chen, Yuan Xue

2015-10-01

A total of 54 rhizobial strains were isolated from faba bean root nodules in 21 counties of Sichuan hilly areas in China, and their symbiotic effectiveness, genetic diversity and phylogeny were assessed. Only six strains increased the shoot dry mass of the host plant significantly (P ≤ 0.05). Based on the cluster analysis of combined 16S rDNA and intergenic spacer region (IGS) PCR-RFLP, the strains were divided into 31 genotypes in 11 groups, indicating a high degree of genetic diversity among the strains. The sequence analysis of three housekeeping genes (atpD, glnII and recA) and 16S rDNA indicated that the strains represented two R. leguminosarum, two Rhizobium spp., R. mesosinicum, Agrobacterium sp. and A. tumefaciens. The strains representing four Rhizobium species were divided into two distinct nodC and nifH genotypes. However, the phylogeny of housekeeping genes and symbiotic genes was not congruent, implying that the strains had been shaped by vertical evolution of the housekeeping genes and lateral evolution of the symbiotic genes. Copyright © 2015 Elsevier GmbH. All rights reserved.

Twists and turns: my career path and concerns about the future.

Science.gov (United States)

Ausubel, Frederick M

2014-10-01

THE Genetics Society of America's Thomas Hunt Morgan Medal is awarded to an individual GSA member for lifetime achievement in the field of genetics. The 2014 recipient is Frederick Ausubel, whose 40-year career has centered on host-microbe interactions and host innate immunity. He is widely recognized as a key scientist responsible for establishing the modern postrecombinant DNA field of host-microbe interactions using simple nonvertebrate hosts. He has used genetic approaches to conduct pioneering work that spawned six related areas of research: the evolution and regulation of Rhizobium genes involved in symbiotic nitrogen fixation; the regulation of Rhizobium genes by two-component regulatory systems involving histidine kinases; the establishment of Arabidopsis thaliana as a worldwide model system; the identification of a large family of plant disease resistance genes; the identification of so-called multi-host bacterial pathogens; and the demonstration that Caenorhabditis elegans has an evolutionarily conserved innate immune system that shares features of both plant and mammalian immunity. Copyright © 2014 by the Genetics Society of America.

Breeding food and forge legumes for enhancement of nitrogen fixation: a review

International Nuclear Information System (INIS)

Ali, A.; Hussain, S.; Qamar, I.A.; Khan, B.R.

2000-01-01

Nitrogen fixation in legume - root nodules requires the functioning of genes present in the Rhizobia that induce nodule-formation. The plant produces the nodules and the energy required for respiration. Genes in both Rhizobium and the plant are responsible for the efficient use of photosynthesis for N/sub 2/ fixation and assimilation of nitrogen. Genes from Rhizobium and legume hosts that are involved in the symbiosis are being identified, isolated and cloned, to facilitate the manipulation of either partner. The amounts of nitrogen fixed by grain-legumes vary appreciably, between and within, species and are also influenced by environment. With few exceptions, most legumes fix insufficient N/sub 2/ to support substantial seed-yields. Deficits between required N and the combined amounts provide by soil and fertilizer help in estimating the improvements in N/sub 2/ fixation which is possible through breeding. Since the symbiosis is a complex process, heritability of traits is weak, and most methods which estimate fixation are destructive, a breeding method that allows selection of replicated families rather than single plants is preferred. (author)

Bacterial PerO Permeases Transport Sulfate and Related Oxyanions.

Science.gov (United States)

Hoffmann, Marie-Christine; Pfänder, Yvonne; Tintel, Marc; Masepohl, Bernd

2017-07-15

Rhodobacter capsulatus synthesizes the high-affinity ABC transporters CysTWA and ModABC to specifically import the chemically related oxyanions sulfate and molybdate, respectively. In addition, R. capsulatus has the low-affinity permease PerO acting as a general oxyanion transporter, whose elimination increases tolerance to molybdate and tungstate. Although PerO-like permeases are widespread in bacteria, their function has not been examined in any other species to date. Here, we present evidence that PerO permeases from the alphaproteobacteria Agrobacterium tumefaciens , Dinoroseobacter shibae , Rhodobacter sphaeroides , and Sinorhizobium meliloti and the gammaproteobacterium Pseudomonas stutzeri functionally substitute for R. capsulatus PerO in sulfate uptake and sulfate-dependent growth, as shown by assimilation of radioactively labeled sulfate and heterologous complementation. Disruption of perO genes in A. tumefaciens , R. sphaeroides , and S. meliloti increased tolerance to tungstate and, in the case of R. sphaeroides , to molybdate, suggesting that heterometal oxyanions are common substrates of PerO permeases. This study supports the view that bacterial PerO permeases typically transport sulfate and related oxyanions and, hence, form a functionally conserved permease family. IMPORTANCE Despite the widespread distribution of PerO-like permeases in bacteria, our knowledge about PerO function until now was limited to one species, Rhodobacter capsulatus In this study, we showed that PerO proteins from diverse bacteria are functionally similar to the R. capsulatus prototype, suggesting that PerO permeases form a conserved family whose members transport sulfate and related oxyanions. Copyright © 2017 American Society for Microbiology.

2388-IJBCS-Article-Haro Hadou

African Journals Online (AJOL)

hp

Acacia senegal (L.) Willd ; Prosopis chilensis Stunz. et Bauhinia rufescens. Lam.. Geo-Eco-Trop, 33: 115-124. Megueni C, Awono ET, Ndjouenkeu R. 2011. Effet simultané de la dilution et de la combinaison du Rhizobium et des mycorhizes sur la production foliaire et les propriétés physico-chimiques des jeunes feuilles de ...

A 200 bp region of the pea ENOD12 promoter is sufficient for nodule-specific and nod factor induced expression

DEFF Research Database (Denmark)

Vijn, I; Christiansen, H; Lauridsen, P

1995-01-01

ENOD12 is one of the first nodulin genes expressed upon inoculation with Rhizobium and also purified Nod factors are able to induce ENOD12 expression. The ENOD12 gene family in pea (Pisum sativum) has two members. A cDNA clone representing PsENOD12A [26] and a PsENOD12B genomic clone [7] have been...

Phylogenetic analysis of 23S rRNA gene sequences of some ...

African Journals Online (AJOL)

... glycol plus control. All isolates exhibited good drought-tolerant efficiencies at 10% PEG. While most of the isolates could not tolerate up to 20% PEG, isolates of Rlv6, Rlv9, Rlv12 and Rlv13 tolerated up to 20% PEG. Keywords: Rhizobium leguminosarum, 23S rRNA gene, phylogenetic tree, diversity and drought tolerance ...

Stable symbiotic nitrogen fixation under water-deficit field conditions by a stress-tolerant alfalfa microsymbiont and its complete genome sequence.

Science.gov (United States)

Jozefkowicz, Cintia; Brambilla, Silvina; Frare, Romina; Stritzler, Margarita; Piccinetti, Carlos; Puente, Mariana; Berini, Carolina Andrea; Pérez, Pedro Reyes; Soto, Gabriela; Ayub, Nicolás

2017-12-10

We here characterized the stress-tolerant alfalfa microsymbiont Sinorhizobium meliloti B401. B401-treated plants showed high nitrogen fixation rates under humid and semiarid environments. The production of glycine betaine in isolated bacteroids positively correlated with low precipitation levels, suggesting that this compound acts as a critical osmoprotectant under field conditions. Genome analysis revealed that strain B401 contains alternative pathways for the biosynthesis and uptake of glycine betaine and its precursors. Such genomic information will offer substantial insight into the environmental physiology of this biotechnologically valuable nitrogen-fixing bacterium. Copyright © 2017 Elsevier B.V. All rights reserved.

Molecular aspects of the nitrogen fixing system in pea root nodules

International Nuclear Information System (INIS)

Bisseling, T.

1980-01-01

The author considers symbiotic nitrogen fixation of Pisum sativum and Rhizobium leguminosarum. Some general aspects of nodule formation and the regulation of the proteins nitrogenase and leghemoglobin (Lb) have been studied. Synthesis of these proteins was studied by 35 SO 4 labelling of intact pea plants. The sequence of appearance of the proteins was determined with specific radioimmunoassays for each protein. (Auth.)

Gamma-ray sterilization of peat carriers for the production of legume seed inoculants (better production of soya bean)

International Nuclear Information System (INIS)

Vojinovic, Z.; Milicic, B.; Radak, B.

1983-01-01

In the present work the first Yugoslav experiments on the application of gamma radiation for the sterilization of peat in the production of inoculants for soya bean production are summarised and briefly discussed. A radiation dose of 50 kGy was used. The growth and survival of the soya bean nodule bacteria, Rhizobium japonicum, in the sterilized peat is shown. (U.K.)

32P uptake and translocation in chickpea (Cicer arietinum L.) inoculated with vesicular-arbuscular mycorrhiza

International Nuclear Information System (INIS)

Chaturvedi, C.; Singh, Renu

1990-01-01

32 P uptake in chickpea (Cicer arietinum L.) cultivars L-550 and C-235 as affected by vesicualr-arbuscular mycorrhiza (G. caledonicum) and Rhizobium was investigated in P deficient soils. Test plants coinoculated with the above two symbionts exhibited higher 32 P uptake than inoculated with either symbiont alone. Uninoculated plants showed minimum level of 32 P uptake. (author). 1 tab., 7 refs

An antimicrobial peptide essential for bacterial survival in the nitrogen-fixing symbiosis.

Science.gov (United States)

Kim, Minsoo; Chen, Yuhui; Xi, Jiejun; Waters, Christopher; Chen, Rujin; Wang, Dong

2015-12-08

In the nitrogen-fixing symbiosis between legume hosts and rhizobia, the bacteria are engulfed by a plant cell membrane to become intracellular organelles. In the model legume Medicago truncatula, internalization and differentiation of Sinorhizobium (also known as Ensifer) meliloti is a prerequisite for nitrogen fixation. The host mechanisms that ensure the long-term survival of differentiating intracellular bacteria (bacteroids) in this unusual association are unclear. The M. truncatula defective nitrogen fixation4 (dnf4) mutant is unable to form a productive symbiosis, even though late symbiotic marker genes are expressed in mutant nodules. We discovered that in the dnf4 mutant, bacteroids can apparently differentiate, but they fail to persist within host cells in the process. We found that the DNF4 gene encodes NCR211, a member of the family of nodule-specific cysteine-rich (NCR) peptides. The phenotype of dnf4 suggests that NCR211 acts to promote the intracellular survival of differentiating bacteroids. The greatest expression of DNF4 was observed in the nodule interzone II-III, where bacteroids undergo differentiation. A translational fusion of DNF4 with GFP localizes to the peribacteroid space, and synthetic NCR211 prevents free-living S. meliloti from forming colonies, in contrast to mock controls, suggesting that DNF4 may interact with bacteroids directly or indirectly for its function. Our findings indicate that a successful symbiosis requires host effectors that not only induce bacterial differentiation, but also that maintain intracellular bacteroids during the host-symbiont interaction. The discovery of NCR211 peptides that maintain bacterial survival inside host cells has important implications for improving legume crops.

Biological treatment to bean seeds before sowing them.

Directory of Open Access Journals (Sweden)

Silvano Edel Castro Mayo

2013-09-01

Full Text Available Even in some bibliography about the bean cultivation is recommended the use of Rhizobium which association with the cultivation is very advantageous for the fixation of the atmospheric nitrogen, as well as the employment of the antagonistic mushroom Trichoderma spp., for the control of fungous illnesses of the floor and knowing that the cultivation has its fertilization demands and of the plagues control and illnesses that are in definitive the causes that limit the yields of the cultivation, these practices are not used. We proceeded to the disinfection of bean seeds with the resulting solution of the laundry of 1Kg of Trichoderma harzianum of the stock A-34 with 2 liters of water and the mixture of this fluid with 1 Kg of Rhizobium, more a package (134 grams of Gaucho PS 70 for 45.35 kg (100 pounds of t seed. The disinfection of the seed was made by hand, 12 hour before sowing them and the results were very encouraging, so much in the delay of days in appearing the illnesses and the plagues and its low attack intensity as the increase of the yields with relationship to the not treated seed.

Bacterial communities in ancient permafrost profiles of Svalbard, Arctic.

Science.gov (United States)

Singh, Purnima; Singh, Shiv M; Singh, Ram N; Naik, Simantini; Roy, Utpal; Srivastava, Alok; Bölter, Manfred

2017-12-01

Permafrost soils are unique habitats in polar environment and are of great ecological relevance. The present study focuses on the characterization of bacterial communities from permafrost profiles of Svalbard, Arctic. Counts of culturable bacteria range from 1.50 × 10 3 to 2.22 × 10 5 CFU g -1 , total bacterial numbers range from 1.14 × 10 5 to 5.52 × 10 5 cells g -1 soil. Bacterial isolates are identified through 16S rRNA gene sequencing. Arthrobacter and Pseudomonas are the most dominant genera, and A. sulfonivorans, A. bergeri, P. mandelii, and P. jessenii as the dominant species. Other species belong to genera Acinetobacter, Bacillus, Enterobacter, Nesterenkonia, Psychrobacter, Rhizobium, Rhodococcus, Sphingobacterium, Sphingopyxis, Stenotrophomonas, and Virgibacillus. To the best of our knowledge, genera Acinetobacter, Enterobacter, Nesterenkonia, Psychrobacter, Rhizobium, Sphingobacterium, Sphingopyxis, Stenotrophomonas, and Virgibacillus are the first northernmost records from Arctic permafrost. The present study fills the knowledge gap of culturable bacterial communities and their chronological characterization from permafrost soils of Ny-Ålesund (79°N), Arctic. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Diversity and characterization of ramie-degumming strains

Directory of Open Access Journals (Sweden)

Shengwen Duan

2012-04-01

Full Text Available Ramie (Boehmeria nivea and Boehmeria tenacissima is a widely used fiber crop. Traditional water retting or chemical boiling method performed in order to extract ramie fiber seriously pollute the environment and severely damage the fiber, so biological method is the general trend of the fiber-extracting industry. Some strains (687, involving 26 genera and 43 species, were collected from the three samples, which produce hydrolyzed circles in the selective culture medium in order to detect the degumming effect and to compare the enzyme activity. Among these strains, 13 of them did not produce cellulase and had a ramie decreasing weight rate above 25 %, which were regarded as efficient ramie-degumming strains named from R1 to R13. R1 to R13 belonged to Amycolata autotrobutylicun, Bacillus subtilis, Clostridium acetobutylicum, Bacillus subtilis, Rhizobium leguminosarum, Bacteroides finegoldii, Streptomyces lividans, Bacillus amyloliquefaciens, Clostridium acetobutylicum, Pseudomonas brassicacearum, Bacillus pumilus, Bacillus licheniformis, Pectobacterium wasabiae respectively. Bacteroides sp., Rhizobium sp. and Pseudomonas sp. were firstly reported to be used in ramie-degumming. At the same time, the pectinase was the key enzyme in the ramie-degumming process.

Plant growth-promoting Methylobacterium induces defense responses in groundnut (Arachis hypogaea L.) compared with rot pathogens.

Science.gov (United States)

Madhaiyan, M; Suresh Reddy, B V; Anandham, R; Senthilkumar, M; Poonguzhali, S; Sundaram, S P; Sa, Tongmin

2006-10-01

This study, framed in two different phases, studied the plant-growth promotion and the induction of systemic resistance in groundnut by Methylobacterium. Seed imbibition with Methylobacterium sp. increased germination by 19.5% compared with controls. Combined inoculation of Methylobacterium sp. with Rhizobium sp. also significantly increased plant growth, nodulation, and yield attributes in groundnut compared with individual inoculation of Rhizobium sp. Methylobacterium sp. challenge-inoculated with Aspergillus niger/Sclerotium rolfsii in groundnut significantly enhanced germination percentage and seedling vigour and showed increased phenylalanine ammonia lyase (PAL), beta-1,3-glucanase, and peroxidase (PO) activities. Under pot-culture conditions, in Methylobacterium sp. seed-treated groundnut plants challenge-inoculated with A. niger/S. rolfsii through foliar sprays on day 30, the activities of enzymes PO, PAL, and beta-1,3-glucanase increased constantly from 24 to 72 hours, after which decreased activity was noted. Five isozymes of polyphenol oxidase and PO could be detected in Methylobacterium-treated plants challenged with A. niger/S. rolfsii. Induced systemic resistance activity in groundnut against rot pathogens in response to methylotrophic bacteria suggests the possibility that pink-pigmented facultative methylotrophic bacteria might be used as a means of biologic disease control.

Maize response to inoculation with strains of plant growth-promoting bactéria

Directory of Open Access Journals (Sweden)

Janaína Dartora

Full Text Available ABSTRACT The aim of this study was to evaluate the response of maize to inoculation with strains of plant growth-promoting bacteria (PGPB in two cultivation years. The experiment was set in a randomized block design with four replicates in two cultivation years (2012/13 and 2013/14. The treatments consisted of PGPB inoculation: control (without N and without inoculation; 30 kg of N ha-1 at sowing (N1; 160 kg of N ha-1 (N1 + 130 kg of N ha-1 as top-dressing; N1 + A. brasilense, Ab-V5; N1 + A. brasilense, HM053; N1 + Azospirillum sp. L26; N1 + Azospirillum sp. L27; N1 + Enhydrobacter sp. 4331; N1 + Rhizobium sp. 8121. Basal stem diameter, plant height, leaf area, shoot dry matter and yield were evaluated. The strain of Rhizobium sp. 8121and the isolate Azospirillum sp. L26 associated with 30 kg of N ha-1 at sowing promoted yields equivalent to that of the N fertilization of 160 kg ha-1, demonstrating the potential to be used in the inoculation of maize seeds.

TOL plasmid transfer during bacterial conjugation in vitro and rhizoremediation of oil compounds in vivo

International Nuclear Information System (INIS)

Jussila, Minna M.; Zhao, Ji; Suominen, Leena; Lindstroem, Kristina

2007-01-01

Molecular profiling methods for horizontal transfer of aromatics-degrading plasmids were developed and applied during rhizoremediation in vivo and conjugations in vitro. pWW0 was conjugated from Pseudomonas to Rhizobium. The xylE gene was detected both in Rhizobium galegae bv. officinalis and bv. orientalis, but it was neither stably maintained in orientalis nor functional in officinalis. TOL plasmids were a major group of catabolic plasmids among the bacterial strains isolated from the oil-contaminated rhizosphere of Galega orientalis. A new finding was that some Pseudomonas migulae and Pseudomonas oryzihabitans strains harbored a TOL plasmid with both pWW0- and pDK1-type xylE gene. P. oryzihabitans 29 had received the archetypal TOL plasmid pWW0 from Pseudomonas putida PaW85. As an application for environmental biotechnology, the biodegradation potential of oil-polluted soil and the success of bioremediation could be estimated by monitoring changes not only in the type and amount but also in transfer of degradation plasmids. - Horizontal transfer of degradation plasmids in the oil-contaminated rhizosphere reveals the dynamic nature of the intrinsic biodegradation potential

Integrated effects of reduction dose of nitrogen fertilizer and mode of biofertilizer application on soil health under mung bean cropping system

Directory of Open Access Journals (Sweden)

Naba Kumar Mondal

2014-12-01

Full Text Available To study the integrated effects of reduced dose of chemical fertilizer with different methods and times of application of Rhizobium biofertilizer on soil health and fertility under mung bean (Vigna radiata cropping, field experiments were carried out during three years (2009, 2010, and 2011 in West Bengal, India, in randomized block design. In the first year, varietal screening of mung bean under recommended dose of chemical fertilizer (20:40:20 were performed with five available varieties adapted to local climate. Reduced nitrogen fertilizer doses (20%, 30%, 40%, 50%, and 60% and the recommended dose, as well as the Rhizobium biofertilizer application (basal, soil, and spray, were done, and data were recorded for pH, electrical conductivity, organic carbon, total nitrogen, total phosphorus, total potassium, and bacterial population of soil, both before sowing and after harvesting. The results indicated significant improvement in the soil quality with gradual buildup of soil macronutrient status after harvesting of crop. Application of biofertilizer has contributed significantly towards higher soil organic matter, nitrogen, phosphorus, and potassium. The use of biofertilizer significantly improved soil bacterial population count in the soil thereby increasing the soil health.

A common genomic framework for a diverse assembly of plasmids in the symbiotic nitrogen fixing bacteria.

Directory of Open Access Journals (Sweden)

Lisa C Crossman

2008-07-01

Full Text Available This work centres on the genomic comparisons of two closely-related nitrogen-fixing symbiotic bacteria, Rhizobium leguminosarum biovar viciae 3841 and Rhizobium etli CFN42. These strains maintain a stable genomic core that is also common to other rhizobia species plus a very variable and significant accessory component. The chromosomes are highly syntenic, whereas plasmids are related by fewer syntenic blocks and have mosaic structures. The pairs of plasmids p42f-pRL12, p42e-pRL11 and p42b-pRL9 as well large parts of p42c with pRL10 are shown to be similar, whereas the symbiotic plasmids (p42d and pRL10 are structurally unrelated and seem to follow distinct evolutionary paths. Even though purifying selection is acting on the whole genome, the accessory component is evolving more rapidly. This component is constituted largely for proteins for transport of diverse metabolites and elements of external origin. The present analysis allows us to conclude that a heterogeneous and quickly diversifying group of plasmids co-exists in a common genomic framework.

Methods for the Isolation of Genes Encoding Novel PHA Metabolism Enzymes from Complex Microbial Communities.

Science.gov (United States)

Cheng, Jiujun; Nordeste, Ricardo; Trainer, Maria A; Charles, Trevor C

2017-01-01

Development of different PHAs as alternatives to petrochemically derived plastics can be facilitated by mining metagenomic libraries for diverse PHA cycle genes that might be useful for synthesis of bio-plastics. The specific phenotypes associated with mutations of the PHA synthesis pathway genes in Sinorhizobium meliloti and Pseudomonas putida, allows the use of powerful selection and screening tools to identify complementing novel PHA synthesis genes. Identification of novel genes through their function rather than sequence facilitates the functional proteins that may otherwise have been excluded through sequence-only screening methodology. We present here methods that we have developed for the isolation of clones expressing novel PHA metabolism genes from metagenomic libraries.

Methods for the isolation of genes encoding novel PHB cycle enzymes from complex microbial communities.

Science.gov (United States)

Nordeste, Ricardo F; Trainer, Maria A; Charles, Trevor C

2010-01-01

Development of different PHAs as alternatives to petrochemically derived plastics can be facilitated by mining metagenomic libraries for diverse PHA cycle genes that might be useful for synthesis of bioplastics. The specific phenotypes associated with mutations of the PHA synthesis pathway genes in Sinorhizobium meliloti allows for the use of powerful selection and screening tools to identify complementing novel PHA synthesis genes. Identification of novel genes through their function rather than sequence facilitates finding functional proteins that may otherwise have been excluded through sequence-only screening methodology. We present here methods that we have developed for the isolation of clones expressing novel PHA metabolism genes from metagenomic libraries.

Effects of phosphate solubilizing microorganisms and Rhizobium sp ...

African Journals Online (AJOL)

STORAGESEVER

2009-08-04

Aug 4, 2009 ... nematode Meloidogyne incognita (Kofoid and White). Chitwood and .... Meloidogyne incognita was collected from chickpea field soil identi- fied with the help perineal pattern ..... japonicum on soybean. Phytopathology, 60: ...

Co-inoculation with Glomus intraradices and Rhizobium tropici ...

African Journals Online (AJOL)

dell

2012-07-19

Jul 19, 2012 ... Beans play an important role in the enhancement of the level of nourishment ..... quantities of P to the plants from remote zones (Jansa et al., 2003). Also, the .... metabolic monitoring (NMR), and molecular analyses with in-situ ...

Effects of rhizobium inoculation, sulfur and phosphorus applications ...

African Journals Online (AJOL)

SERVER

2008-03-18

Mar 18, 2008 ... Key words: Chickpea, phosphorus, sulfur, yield, nutrient uptake. ... Fertilizer P was applied in bands 3 cm below rows sown to chick pea. Chick pea ... water. Plant grains and shoot were dried for 48 h at 70°C and were ground.

Effects of phosphate solubilizing microorganisms and Rhizobium sp ...

African Journals Online (AJOL)

STORAGESEVER

2009-08-04

Aug 4, 2009 ... position due to its nutritive values (17-23% protein) in large vegetarian .... Macrophomina phaseolina was isolated from infected chickpea root samples ... inoculated into each pot around the pea seedling. Another PSM,.

Vermicompost Application as Affected by Rhizobium Inoculation on ...

African Journals Online (AJOL)

Administrator

organic carbon (C) content of the soil was 1.96% determined as per Walkley and Black. (1934) ..... greenhouse gas emissions in tropical North Queensland, Australia. ... organic and inorganic fertilizers on soil microbial community structure and.

Fermentation Tecniques and Applications of Bacterial Cellulose: a Review Técnicas de fermentación y aplicaciones de la celulosa bacteriana: una revisión

OpenAIRE

Luz Dary Carreño Pineda; Luis Alfonso Caicedo Mesa; Carlos Arturo Martínez Riascos

2012-01-01

Bacterial cellulose is a polymer obtained by fermentation with microorganismsfrom Acetobacter, Rhizobium, Agrobacterium and Sarcina genera. Amongthem, Acetobacter xylinum is the most efficient specie. This polymer hasthe same chemical composition of plant cellulose, but its conformation andphysicochemical properties are different, making it attractive for several applications, especially in the areas of food, separation processes, catalysis andhealth, due to its biocompatibility. However, the ma...

The Effectiveness of Biofertilizer on Plant Growth Soyb Ea N “Edam Am E” (Glycin Max)

OpenAIRE

Sudiarti, Diah

2017-01-01

This study aimed at determining the effectiveness of biofertilizer with different concentrations on plant growth of soybean “edamame” (glycin max). Biofertilizer in this study consists of microbial consortia (lactobacillus, pseudomonas, bacillus, saccharomyces, rhizobium, azotobacter, azospirillum, and cellulomonas). The treatment consists of 3 biofertilizer concentrations (25%, 50%, dan 75%), as well as the negative control and positive control (100% chemical fertilizer equivalent 5g/plant)....

Contribución de Vigna unguiculata L. a la sustentabilidad de sistemas de cultivo de caña de azúcar

Directory of Open Access Journals (Sweden)

Oscar Eduardo Sanclemente Reyes

2015-12-01

Full Text Available  Con el objetivo de evaluar la contribución del abono verde (AV Vigna unguiculata L., a la producción sostenible de caña de azúcar (CA Saccharum officinarum L. Var. CC 85-92 en un Vertisol del Valle del Cauca (Colombia, se usó diseño experimental en bloques completos al azar y cinco repeticiones. Los tratamientos fueron: (C Control- soca de CA, (AV1 siembra 1X1 AV- CA, (AV2 siembra 2X1 AV- CA, (AV1+R siembra 1X1 AV inoculada con Rhizobium sp.- CA, y (AV2+R siembra 2X1 AV inoculada con Rhizobium sp.- CA. Se evaluó el aporte de biomasa del AV, la biomasa de arvenses asociadas y la humedad del suelo, durante el mes dos. En maduración de CA (mes once se evaluó la concentración de sólidos y sacarosa en tallos. En cosecha de CA (mes trece se evaluaron las toneladas de caña por hectárea (TCH, el rendimiento y las toneladas de azúcar por hectárea (TAH, como efecto de los tratamientos. Se observó que el inóculo Rhizobium sp., no tuvo efectos aparentes, por baja especificidad simbiótica con el AV. El AV2, registró aporte significativo (p<0.05 de materia seca (14.5 t ha-1 incidiendo en reducción de arvenses y retención de humedad (161 m3 ha-1, frente al C. El AV1 registró productividad en TCH (131.5 t ha-1 y TAH (15.5 t ha-1, significativamente (p<0.05 altas con respecto a los demás tratamientos. Estos resultados muestran las bondades del uso de sistemas intercalados AV- caña de azúcar, sobre la economía y sustentabilidad del sector.

Tolerância de rizóbios de diferentes procedências ao zinco, cobre e cádmio Tolerance of rhizobia genera from different origins to zinc, copper and cadmium

Directory of Open Access Journals (Sweden)

Alexandre Matsuda

2002-03-01

Full Text Available Sessenta estirpes/isolados dos gêneros Bradyrhizobium, Rhizobium, Sinorhizobium, Mesorhizobium e Azorhizobium, procedentes de diferentes locais (Mata Atlântica, Amazônia, culturas agrícolas e experimentos com metais pesados e de espécies hospedeiras pertencentes às subfamílias Papilionoideae, Mimosoideae e Caesalpinoideae, foram avaliadas quanto à tolerância a Zn, Cu e Cd em meio YMA modificado pela adição de tampões biológicos (HEPES e MES e suplementados com Cu (0 a 60 mg L-1, Cd (0 a 60 mg L-1 e Zn (0 a 1.000 mg L-1. Mediante padrões de crescimento atribuídos às culturas nas diferentes concentrações dos metais, avaliaram-se as concentrações máximas toleradas e as doses tóxicas destes metais para redução de crescimento em 25% (DT25 e 50% (DT50. Não houve influência da procedência na concentração máxima de metal tolerada. A ordem de sensibilidade aos metais, considerando-se as concentrações máximas toleradas, foi Azorhizobium > Rhizobium = Mesorhizobium = Sinorhizobium > Bradyrhizobium. A DT25 e a DT50 foram úteis para diferenciarem estirpes/isolados de um mesmo gênero, que atingiram a mesma concentração máxima tolerada a Zn, Cu e Cd. A ordem de toxicidade dos metais estudados foi Cu > Cd > Zn.Sixty strains/isolates of the genera Bradyrhizobium, Rhizobium, Sinorhizobium, Mesorhizobium and Azorhizobium, isolated from different hosts (legume subfamilies: Papilionoideae, Mimosoideae and Caesalpinoideae and location (Atlantic Forest, Amazon region, crop plantings and heavy metal experiments, were evaluated for Zn, Cu and Cd tolerance in YMA medium modified by the addition of biological buffers (HEPES and MES and supplemented with Cu (0 to 60 mg L-1, Cd (0 to 60 mg L-1, and Zn (0 to 1,000 mg L-1sulphates. Growth standards were applied to evaluate rhizobia cultures growth at different metal concentrations, allowing evaluation of highest tolerated concentrations of Zn, Cu, and Cd and the toxic doses

The Influence of Seed-borne N in 15N Isotope Dilution Studies with Legumes The Influence of Seed-borne N in 15N Isotope Dilution Studies with Legumes

DEFF Research Database (Denmark)

Jensen, Erik Steen; Andersen, A. J.; Thomsen, J. D.

1985-01-01

The distriution of seed-borne N in shoot and root of pea and field bean was studied using three methods: 1) determination of the N content in shoot and root of plants grown in sand culture without other N sources. 2) 15N isotope dilution in plants grown in Rhizobium-free medium supplied with 15N-...... of corrections for seed-borne N in studies of nitrogen fixation in legumes is discussed....

A Proteomic View on the Role of Legume Symbiotic Interactions

Science.gov (United States)

Larrainzar, Estíbaliz; Wienkoop, Stefanie

2017-01-01

Legume plants are key elements in sustainable agriculture and represent a significant source of plant-based protein for humans and animal feed worldwide. One specific feature of the family is the ability to establish nitrogen-fixing symbiosis with Rhizobium bacteria. Additionally, like most vascular flowering plants, legumes are able to form a mutualistic endosymbiosis with arbuscular mycorrhizal (AM) fungi. These beneficial associations can enhance the plant resistance to biotic and abiotic stresses. Understanding how symbiotic interactions influence and increase plant stress tolerance are relevant questions toward maintaining crop yield and food safety in the scope of climate change. Proteomics offers numerous tools for the identification of proteins involved in such responses, allowing the study of sub-cellular localization and turnover regulation, as well as the discovery of post-translational modifications (PTMs). The current work reviews the progress made during the last decades in the field of proteomics applied to the study of the legume-Rhizobium and -AM symbioses, and highlights their influence on the plant responses to pathogens and abiotic stresses. We further discuss future perspectives and new experimental approaches that are likely to have a significant impact on the field including peptidomics, mass spectrometric imaging, and quantitative proteomics. PMID:28769967

A novel three-dimensional carbonized PANI1600@CNTs network for enhanced enzymatic biofuel cell.

Science.gov (United States)

Kang, Zepeng; Jiao, Kailong; Cheng, Jin; Peng, Ruiyun; Jiao, Shuqiang; Hu, Zongqian

2018-03-15

A novel three-dimensional (3D) carbon composite of PANI 1600 @CNTs with rhizobium-like structure is prepared by in-situ polymerization of aniline monomers around and along the functionalized carbon nanotubes (CNTs) and then carbonized at 1600°C for enzymatic biofuel cells (EBFCs). The SEM and TEM images clearly show that the carbonized PANI grew seamlessly on the surface of CNTs and presented the rhizobium-like structure. The carbonized PANI acts like conductive "glue" and connects the adjacent tubes together, which can assemble the CNTs into a 3D network. The PANI 1600 @CNTs composite modified glassy carbon electrodes based on glucose oxidase (GOx) and laccase (Lac) exhibit high electrochemical performance. A glucose//O 2 EBFC constitutes of the fabricated anode and cathode performs a maximum power density of 1.12mWcm -2 at 0.45V. Furthermore, three of the fabricated EBFCs in series are able to lightening up a yellow light-emitting diode (LED) whose turn-on voltage is about at 1.8V. This work may be helpful for exploiting novel substrates by carbonizing the composites of conducting polymer with nano materials at high-temperature for immobilization of enzymes in the EBFCs or biosensor fields. Copyright © 2017 Elsevier B.V. All rights reserved.

Rhizobial Nodulation Factors Stimulate Mycorrhizal Colonization of Nodulating and Nonnodulating Soybeans.

Science.gov (United States)

Xie, Z. P.; Staehelin, C.; Vierheilig, H.; Wiemken, A.; Jabbouri, S.; Broughton, W. J.; Vogeli-Lange, R.; Boller, T.

1995-08-01

Legumes form tripartite symbiotic associations with noduleinducing rhizobia and vesicular-arbuscular mycorrhizal fungi. Co-inoculation of soybean (Glycine max [L.] Merr.) roots with Bradyrhizobium japonicum 61-A-101 considerably enhanced colonization by the mycorrhizal fungus Glomus mosseae. A similar stimulatory effect on mycorrhizal colonization was also observed in nonnodulating soybean mutants when inoculated with Bradyrhizobium japonicum and in wild-type soybean plants when inoculated with ineffective rhizobial strains, indicating that a functional rhizobial symbiosis is not necessary for enhanced mycorrhiza formation. Inoculation with the mutant Rhizobium sp. NGR[delta]nodABC, unable to produce nodulation (Nod) factors, did not show any effect on mycorrhiza. Highly purified Nod factors also increased the degree of mycorrhizal colonization. Nod factors from Rhizobium sp. NGR234 differed in their potential to promote fungal colonization. The acetylated factor NodNGR-V (MeFuc, Ac), added at concentrations as low as 10-9 M, was active, whereas the sulfated factor, NodNGR-V (MeFuc, S), was inactive. Several soybean flavonoids known to accumulate in response to the acetylated Nod factor showed a similar promoting effect on mycorrhiza. These results suggest that plant flavonoids mediate the Nod factor-induced stimulation of mycorrhizal colonization in soybean roots.

Effect of saline water on growth, yield and N2 fixation by faba bean and lentil plants using nitrogen-15

International Nuclear Information System (INIS)

Gadalla, A.M.; Galal, Y.G.M.; Elakel, E.A.; Ismail, H.; Hamdy, A.

2003-01-01

This work had been carried out under greenhouse conditions through joint research project between international agronomic mediterranean (IAM, Bari), italy and soils and water dept., Egyptian atomic energy authority. The aim of this dy was to assess the effect of saline water irrigation on growth, yield and nitrogen fixation (% Ndfa) by faba bean and lentil plants inoculated with selected rhizobium strains. Four saline irrigation water levels (fresh water, 3.6 and ds/m) were used. 20 kg N/ha as ammonium sulfate contained 10% N-15 atom excess was applied for quantification of biological N-fixation N-portions derived from fertilizer (Ndff). Results showed that high levels of salinity negatively affected seed yield and N accumulated in tissue of faba bean. Similar trend was noticed with dry matter of lentil while shoot-N was increased at 6 and 9 ds/m. Both leguminous crops were mainly dependent on N 2 fixation as an important source of nitrogen nutrition. Under adverse conditions salinity, the plants gained some of their N requirements from the other two N sources (Ndff and Ndfs). Application of the suitable Rhizobium bacteria strains could be beneficial for both the plant growth and soil fertility via N 2 fixation

Construction and simulation of the Bradyrhizobium diazoefficiens USDA110 metabolic network: a comparison between free-living and symbiotic states.

Science.gov (United States)

Yang, Yi; Hu, Xiao-Pan; Ma, Bin-Guang

2017-02-28

Bradyrhizobium diazoefficiens is a rhizobium able to convert atmospheric nitrogen into ammonium by establishing mutualistic symbiosis with soybean. It has been recognized as an important parent strain for microbial agents and is widely applied in agricultural and environmental fields. In order to study the metabolic properties of symbiotic nitrogen fixation and the differences between a free-living cell and a symbiotic bacteroid, a genome-scale metabolic network of B. diazoefficiens USDA110 was constructed and analyzed. The metabolic network, iYY1101, contains 1031 reactions, 661 metabolites, and 1101 genes in total. Metabolic models reflecting free-living and symbiotic states were determined by defining the corresponding objective functions and substrate input sets, and were further constrained by high-throughput transcriptomic and proteomic data. Constraint-based flux analysis was used to compare the metabolic capacities and the effects on the metabolic targets of genes and reactions between the two physiological states. The results showed that a free-living rhizobium possesses a steady state flux distribution for sustaining a complex supply of biomass precursors while a symbiotic bacteroid maintains a relatively condensed one adapted to nitrogen-fixation. Our metabolic models may serve as a promising platform for better understanding the symbiotic nitrogen fixation of this species.

Manganese toxicity effects on nodulation and nitrogen fixation of beans (Phaseolus vulgaris L. ), in acid soils

Energy Technology Data Exchange (ETDEWEB)

Doebereiner, J

1966-02-01

Three greenhouse experiments were conducted to study manganese toxicity effects on the nitrogen fixing symbiosis of beans (Phaseolus vulgaris). Addition of 40 ppm of manganese to two acid soils affected nodulation and nitrogen fixation. Dependent on the Rhizobion strain either nodule numbers or efficiency in nitrogen fixation were reduced; the efficiency of one Rhizobium-host combination was more affected than another. Under less severe conditions of manganese toxicity, reduction of nodule numbers or of efficiency in nitrogen fixation could be compensated by an increase of nodule size. In the absence of manganese toxicity nodulation and nitrogen fixation of beans were abundant in a soil with pH 4.4. Naturally occurring manganese toxicity in a gray hydromorphic soil was eliminated by liming. The total nitrogen content of bean plants which were dependent on symbiotic nitrogen fixation decreased linearly with the logarithm of the manganese concentration in the plants. This did not happen when the plants were grown with mineral nitrogen. The role of manganese toxicity in the well known sensitivity to acid soil conditions of certain legumes and the importance of selection of manganese tolerant Rhizobium strains for the inoculation of beans in acid tropical soils, are discussed. 25 references, 1 figure, 6 tables.

Co-invading symbiotic mutualists of Medicago polymorpha retain high ancestral diversity and contain diverse accessory genomes.

Science.gov (United States)

Porter, Stephanie S; Faber-Hammond, Joshua J; Friesen, Maren L

2018-01-01

Exotic, invasive plants and animals can wreak havoc on ecosystems by displacing natives and altering environmental conditions. However, much less is known about the identities or evolutionary dynamics of the symbiotic microbes that accompany invasive species. Most leguminous plants rely upon symbiotic rhizobium bacteria to fix nitrogen and are incapable of colonizing areas devoid of compatible rhizobia. We compare the genomes of symbiotic rhizobia in a portion of the legume's invaded range with those of the rhizobium symbionts from across the legume's native range. We show that in an area of California the legume Medicago polymorpha has invaded, its Ensifer medicae symbionts: (i) exhibit genome-wide patterns of relatedness that together with historical evidence support host-symbiont co-invasion from Europe into California, (ii) exhibit population genomic patterns consistent with the introduction of the majority of deep diversity from the native range, rather than a genetic bottleneck during colonization of California and (iii) harbor a large set of accessory genes uniquely enriched in binding functions, which could play a role in habitat invasion. Examining microbial symbiont genome dynamics during biological invasions is critical for assessing host-symbiont co-invasions whereby microbial symbiont range expansion underlies plant and animal invasions. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Preservation of rhizobia by lyophilization with trehalose Preservação de rizóbio por liofilização com trealose

Directory of Open Access Journals (Sweden)

Pedro Antonio Arraes Pereira

2002-06-01

Full Text Available The objective of this study was to determine if trehalose can effectively enhance the viability and storage lifetime of Rhizobium tropici and Rhizobium etli after lyophilization as compared to the traditional protective combination of sucrose and peptone. Two strains of bean-nodulating rhizobia were effectively preserved in the lyophilized state by 100 mM trehalose, and survived for at least 12 days, even when stored under non-ideal conditions. Trehalose provided better protection than the sucrose/peptone combination. When protective excipients were introduced inside the cells, strain CFN 42 was more sensitive to the type of additive used than strain CIAT 899, probably because CIAT 899 produces beta (1-2 glucan, which may have a protective effect. beta (1-2 glucan combined with sucrose protected better than trehalose against leakage from freeze-dried liposomes, but by itself it had no protective capability. There was a high level of unfrozen water associated with the hydrated glucan, in addition to a thermal event at approximately 70ºC, corresponding to an observed gel-sol transition in the glucan. These findings may shed light on the mechanism by which the glucan contributes to the protection of dried cells and liposomes, and may lead to further improvements in rhizobial inoculants.O objetivo deste estudo foi determinar se a trealose pode aumentar a viabilidade e o tempo de preservação de estirpes de Rhizobium tropici e Rhizobium etli após a liofilização, comparada com a proteção proporcionada pela combinação tradicional de sacarose e peptona. Duas estirpes de rizóbio para feijão foram preservadas liofilizadas com 100 mM de trealose e sobreviveram por pelo menos 12 dias, mesmo quando armazenadas sob condições não-ideais. A trealose proporcionou uma proteção superior à combinação de sacarose peptona. Quando agentes protetores foram introduzidos dentro da célula, a estirpe CFN 42 foi mais sensível em relação ao tipo de

Inherent Soil Fertility as Affected by Rhizobium Inoculation and ...

African Journals Online (AJOL)

else

biomass yield at Babillae, Fedis, Haramaya and Hirna sites was 3648.1 kg ha-1 ... from the soil and the high sensitivity of common bean-rhizobia symbiosis to soil ...... Pakistan. Biol. Fertil. Soils 12:107-111. Buttery BR, SJ Park and WI Findlay.

Diversity of Rhizobium-Phaseolus vulgaris symbiosis: Overview and perspectives

International Nuclear Information System (INIS)

Martinez-Romero, Esperanza

2001-01-01

Common bean (Phaseolus vulgaris) has become a cosmopolitan crop, but was originally domesticated in the Americas and has been grown in Latin America for several thousand years. Consequently an enormous diversity of bean nodulating bacteria have developed and in the centers of origin the predominant species in bean nodules is R. etli. In some areas of Latin America, inoculation, which normally promotes nodulation and nitrogen fixation is hampered by the prevalence of native strains. Many other species in addition to R. etli have been found in bean nodules in regions where bean has been introduced. Some of these species such as R. leguminosarum bv. phaseoli, R. gallicum bv. phaseoli and R. giardinii bv. phaseoli might have arisen by acquiring the phaseoli plasmid from R. etli. Others, like R. trap id, are well adapted to acid soils and high temperatures and are good inoculants for bean under these conditions. The large number of rhizobia species capable of nodulating bean supports that bean is a promiscuous host and a diversity of bean-rhizobia interactions exists. Large ranges of dinitrogen fixing capabilities have been documented among bean cultivars and commercial beans have the lowest values among legume crops. Knowledge on bean symbiosis is still incipient but could help to improve bean biological nitrogen fixation. (author)

Solubilisation of inorganic phosphates by inoculant strains from tropical legumes

Directory of Open Access Journals (Sweden)

Leandro Marciano Marra

2011-10-01

Full Text Available Microbial solubilisation of low soluble inorganic phosphates is an important process contributing for the phosphorus available to plants in tropical soils. This study evaluates the ability of inoculant strains for tropical legumes to solubilise inorganic phosphates of low solubility that are found in tropical soils. Seven strains of Leguminosae nodulating bacteria (LNB were compared with one another and with a non-nodulating positive control, Burkholderia cepacia (LMG 1222T. Four of the strains are used as inoculants for cowpeas (Vigna unguiculata (Bradyrhizobium sp. UFLA 03-84; Bradyrhizobium elkani INPA 03-11B and Bradyrhizobium japonicum BR3267 or for common beans (Phaseolus vulgaris (Rhizobium tropici CIAT 899T. Rhizobium etli UFLA 02-100 and Rhizobium leguminosarum 316C10a are also efficient nodulators of beans and Cupriavidus taiwanensis LMG 19424T nodulates on Mimosa pudica. Two experiments, with solid and liquid media, were performed to determine whether the strains were able to solubilise CaHPO4, Al(H2PO43 or FePO4.2H2O. On solid GELP medium none of the strains dissolved FePO4.2H2O, but LMG 1222, UFLA 03-84 and CIAT 899 solubilised CaHPO4 particularly well. These strains, along with LMG 19424 and BR 3267, were also able to increase the solubility of Al(H2PO43. In liquid GELP medium, LMG 1222 solubilised all phosphate sources, but no legume nodulating strain could increase the solubility of Al(H2PO43. The strains CIAT 899 and UFLA 02-100 were the only legume nodulating bacteria able to solubilise the other phosphate sources in liquid media, dissolving both CaHPO4 and FePO4.2H2O. There was a negative correlation between the pH of the culture medium and the concentration of soluble phosphate when the phosphorus source was CaHPO4 or FePO4.2H2O. The contribution of these strains to increasing the phosphorus nutrition of legumes and non-legume plant species should be investigated further by in vivo experiments.

Attempt at estimating the rate of symbiotic fixation of nitrogen in the Lupine by natural isotopic tracing (/sup 15/N)

Energy Technology Data Exchange (ETDEWEB)

Amarger, Noelle [INRA Centre de Recherches de Dijon, 21 (France). Lab. de Microbiologie des Sols; Mariotti, Andre; Mariotti, Francoise [Paris-6 Univ., 75 (France)

1977-06-06

The rate of nitrogen fixation by a Rhizobium-Leguminous plant pair has been determined by natural isotopic tracing (/sup 15/N). After determining the isotopic fractionation coefficients between atmospheric nitrogen and plant nitrogen on the one hand (epsilon=-0.9) and nitrogen of the substrate and plant nitrogen on the other hand (epsilon=-1.1), the rate of nitrogen fixation by way of mixed nutrition cultures was calculated. The method is more accurate than standard methods.

Symbiotic Activity of Pea (Pisum sativum) after Application of Nod Factors under Field Conditions

OpenAIRE

Siczek, Anna; Lipiec, Jerzy; Wielbo, Jerzy; Kidaj, Dominika; Szarlip, Paweł

2014-01-01

Growth and symbiotic activity of legumes are mediated by Nod factors (LCO, lipo-chitooligosaccharides). To assess the effects of application of Nod factors on symbiotic activity and yield of pea, a two-year field experiment was conducted on a Haplic Luvisol developed from loess. Nod factors were isolated from Rhizobium leguminosarum bv. viciae strain GR09. Pea seeds were treated with the Nod factors (10−11 M) or water (control) before planting. Symbiotic activity was evaluated by measurement...

Symbiotic efficiency and genetic characteristics of Bradyrhizobium sp. strain UFSM LA 1.3 isolated from Lupinus albescens (H. et Arn)

OpenAIRE

Stroschein, Marcos Roberto Dobler; Eltz, Flávio Luiz Foletto; Antoniolli, Zaida Inês; Lupatini, Manoeli; Vargas, Luciano Kaiser; Giongo, Adriana; Pontelli, Mateus Padoin

2010-01-01

Legume species belonging to the genus Lupinus are annual herb plants. The majority of them are indigenous to the Americas. They are known for nitrogen-fixing symbioses with soil bacteria collectively called rhizobia. The aim of this study was to characterize a rhizobium strain isolated from Lupinus albescens using phenotypic, symbiotic and molecular approaches. Strain UFSM LA 1.3 was tested in vitro according to several parameters: colony size, color and growing rate; acid or alkaline reactio...

Symbiotic efficiency and genetic characteristics of Bradyrhizobium sp. strain UFSM LA 1.3 isolated from Lupinus albescens (H. et Arn) Eficiência simbiótica e características genéticas da estirpe UFSM LA 1.3 de Bradyrhizobium sp. isolado de Lupinus albescens (H. et Arn)

OpenAIRE

Marcos Roberto Dobler Stroschein; Flávio Luiz Foletto Eltz; Zaida Inês Antoniolli; Manoeli Lupatini; Luciano Kaiser Vargas; Adriana Giongo; Mateus Padoin Pontelli

2010-01-01

Legume species belonging to the genus Lupinus are annual herb plants. The majority of them are indigenous to the Americas. They are known for nitrogen-fixing symbioses with soil bacteria collectively called rhizobia. The aim of this study was to characterize a rhizobium strain isolated from Lupinus albescens using phenotypic, symbiotic and molecular approaches. Strain UFSM LA 1.3 was tested in vitro according to several parameters: colony size, color and growing rate; acid or alkaline reactio...

Population of bacteria from soil in Tudu-Aog village, Passi district, Bolaang Mongondow, North Sulawesi

Directory of Open Access Journals (Sweden)

RIANI HARDININGSIH

2004-01-01

Full Text Available An experiment was conducted in order to know the population of bacteria from soil in Tudu-Aog village, Passi district, Bolaang Mongondow, North Sulawesi, the purpose of the research was to study the population of bacteria from soil. Fourthy six soil samples were taken from two location, namelyTudu-Aog village and Bugis mountain. Isolation was done by dilution methods on YEMA medium (for Rhizobium bacteria, Winogradsky’s (for Azotobacter bacteria, Pycosvkaya (for Phosphat Solubilizing Bacteria, and selective Difco Pseudomonas (for Pseudomonas bacteria. Incubation at room temperature (27-280C until 15 days, and the enumeration with plate count method. The highest enumeration of Rhizobium bacteria with plant rhizosphere of Alocasia esculenta (27x105 CFU/g soil, Theobroma cacao (29x105 CFU/g soil,and Euphorbia paniculata (26x105 CFU/g soil, Azotobacter bacteria with plant rhizosphere of Lycopersicum esculantum (38x105 CFU/g soil, Eugenia aromaticum (43x105 CFU/g soil, Andropogon sp. (34x105 CFU/g soil, Phosphat Solubilizing bacteria with plant rhizosphere of Sechium edule (27x105 CFU/g soil, Cinnamomum sp. (48x105 CFU/g soil, Cyathea sp. (72x105 CFU/g soil, and Pseudomonas bacteria with plant rhizosphere of Oryza sativa (18x105 CFU/g soil, Vanilla sp. (12x105 CFU/g soil, dan Saurauia sp.(19x105 CFU/g soil.

Recombination and horizontal transfer of nodulation and ACC deaminase (acdS) genes within Alpha- and Betaproteobacteria nodulating legumes of the Cape Fynbos biome.

Science.gov (United States)

Lemaire, Benny; Van Cauwenberghe, Jannick; Chimphango, Samson; Stirton, Charles; Honnay, Olivier; Smets, Erik; Muasya, A Muthama

2015-11-01

The goal of this work is to study the evolution and the degree of horizontal gene transfer (HGT) within rhizobial genera of both Alphaproteobacteria (Mesorhizobium, Rhizobium) and Betaproteobacteria (Burkholderia), originating from South African Fynbos legumes. By using a phylogenetic approach and comparing multiple chromosomal and symbiosis genes, we revealed conclusive evidence of high degrees of horizontal transfer of nodulation genes among closely related species of both groups of rhizobia, but also among species with distant genetic backgrounds (Rhizobium and Mesorhizobium), underscoring the importance of lateral transfer of symbiosis traits as an important evolutionary force among rhizobia of the Cape Fynbos biome. The extensive exchange of symbiosis genes in the Fynbos is in contrast with a lack of significant events of HGT among Burkholderia symbionts from the South American Cerrado and Caatinga biome. Furthermore, homologous recombination among selected housekeeping genes had a substantial impact on sequence evolution within Burkholderia and Mesorhizobium. Finally, phylogenetic analyses of the non-symbiosis acdS gene in Mesorhizobium, a gene often located on symbiosis islands, revealed distinct relationships compared to the chromosomal and symbiosis genes, suggesting a different evolutionary history and independent events of gene transfer. The observed events of HGT and incongruence between different genes necessitate caution in interpreting topologies from individual data types. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

The ability of rhizobacteria to solubilize phosphate and synthesize of indoleacetic acid in cowpea

Directory of Open Access Journals (Sweden)

Weslany Silva Rocha

2018-01-01

Full Text Available The Cerrado comprises a vast ecoregion in central Brazil where plants show both growth and nitrogen fixation deficiencies due to low soil fertility. Farmers may overcome such problem using species of microorganisms capable of improving soil fertility such as the Rhizobia bacteria. This work aimed to assess the ability of phosphate solubilization and synthesis of indoleacetic acid (IAA of Rhizobium isolates obtained from Cerrado soils in the state of Tocantins, Brazil, evaluating their symbiotic efficiency in cowpea (Vigna unguiculata L. Walp. plants. We used a total of 32 isolates (or strains of Rhizobium and a reference species of Bradyrhizobium. The capacity of phosphate solubilization and synthesis of IAA was evaluated in vitro, while the symbiotic function of rhizobia isolates and the effect on cowpea biomass was assessed in a greenhouse. Only eight strains were able to solubilize calcium phosphate, while all isolates produced IAA. The rhizobia inoculation caused a significant increase in biomass and nodulation of cowpea. The isolates UFT R122 and UFT R124 stood out with the highest values for the studied parameters, showing rises above 33% of relative efficiency in comparison to the treatment with nitrogen fertilization. By associating the results of phosphate solubilization capacity, IAA synthesis, symbiotic ability, and nodulation, we conclude that the isolates that showed good performance are potential inoculants for cowpea in Cerrado soils.

Improvement of vitamin B-6 production by gamma radiation in bacterial isolates from soil sample

International Nuclear Information System (INIS)

Trongpanich, Yanee; Anutrakunchai, Chitchanok; Piadang, Nattayana

2006-09-01

A vitamin B-6 producing bacterium, Rhizobium sp. 6.1C1 was isolated from soil and produced vitamin B-6 (mainly pyridoxamine) 0.27 mg per liter. Rhizobium sp. 6.1C1 is mesophile bacterium which was not able to grow at over 4 0C. The objective of this study was to improve vitamin B-6 production in high temperature by gamma radiation. The result showed that 677 mutant isolates which were obtained from irradiation dose 0.8 and 1 kGy, were able to grow at 5 0C. Only 4 isolates (08-361, 10-3, 10-94 and 10-98) showed high amount of vitamin B-6 per mg protein. From the results of optimum temperature and initial pH of medium showed high amount of vitamin B-6 per mg protein. From the results of optimum temperature and initial pH of medium showed that isolate 08-361 showed higher amount of vitamin b-6 than wild type. However, this value of vitamin B-6 from this mutant was lower than that when screening. Forms of produced vitamin B-6 from mutant were identified by HPLC. The result showed produced vitamin B-6 were PM and PMP, similar with wild type. Effect of gamma radiation stability of mutant is further study.

Isotopes in biological dinitrogen fixation

Energy Technology Data Exchange (ETDEWEB)

1978-10-01

Nineteen papers were presented at the conference. Some topics discussed are as follows: biochemistry and genetics of dinitrogen fixation; genetics of the Rhizobium-legume symbiosis and of the nitrogen-fixing bacteria; studies on nonsymbiotic dinitrogen fixation in grass-bacteria associations and blue--green algae; use of /sup 15/N and /sup 13/N for the assay of dinitrogen fixation; effects of management practices on dinitrogen fixation; economy of C and N in nitrogen-fixing legumes; and survey of international and national programs on dinitrogen fixation. (HLW)

Morphological and genetic characterisation of some lima bean (phaseolus lunatus l.) cultivars and their nodulating rhizobia

International Nuclear Information System (INIS)

Kole, E.T.M.

2014-07-01

mean nodule number, and mean effective nodules, mean fresh nodule weight and mean fresh shoot weight. Molecular diversity studies indicated that primers RPOI and RP04 were effective in differentiating Rhizobium strains compared to the primer ERIC (1 and 2). Cluster analysis identified two major groups of Rhizobium strains at the similarity level of 49%. Inter-cultivar genetic studies identified similarities and differences within and between the lima bean cultivars with respect to nodule bacteria isolates. Possible isolates also existed among the Rhizobium isolates both within and between cultivars. (author)

Endophytic and epiphytic hydrocarbon-utilizing bacteria associated with root nodules of legumes

International Nuclear Information System (INIS)

Dashti, N.; Khanafer, M.; Radwan, S.S.

2005-01-01

During their withdrawal from Kuwait in 1991, the Iraqi forces damaged and set fire to approximately 700 oil wells. Oil gushed from the wells for a period of 7 months, resulting in oil lakes which covered about 50 square km of the Kuwaiti desert and posing an environmental problem. Most of the crude oil has been pumped out, leaving the lake bottoms polluted with oil to depths reaching 20 to 25 cm. The oily areas have been mediated through indigenous hydrocarbon-utilizing microorganisms, but recovery is slow. Rhizospheres of crop plants, including legumes, are rich in oil-utilizing bacteria. Cultivation of broad beans in oily desert samples has enhanced oil biodegradation. This paper discussed the evidence that rhizobium strains inside the nodules on roots of broad beans are active in hydrocarbon utilization, and that the nodules are also colonized on their entire surfaces with oil-utilizing bacteria. Nodule-associated hydrocarbon utilizers appear to contribute together with rhizospheric hydrocarbon utilizers to the phytoremediation of oily soil. Broad beans were removed from soil and their root surfaces were sterilized to eliminate rhizospheric microorganisms. Plants with intact nodules were tested for their potential of attenuating to crude oil in water. Plants were divided into 2 groups: control plants in which all nodules were removed; and experimental plants which were used directly without further treatment. To isolate rhizobium from inside the nodules, fresh nodules were washed, sterilized and homogenized in sterile water. Bacterial strains were tested for their hydrocarbon utilization potential by streaking cell suspensions on the surface of sterile inorganic mediums containing 1 per cent of crude oil or of individual pure aliphatic and aromatic test hydrocarbons. All bacterial isolates were tested for growth on a solid Ashbery's nitrogen free medium. Results indicated that hydrocarbons were more efficiently eliminated from water supporting disinfected

Rhizobium as a crop enhancer and biofertilizer for increased cereal ...

African Journals Online (AJOL)

OHWESIRI IBUJE

2010-09-13

Sep 13, 2010 ... INTRODUCTION. The United Nations Food and Agriculture Organization ... new insights into recent development of rhizobia-cereal interaction. .... which caused changes in root morphology and physiology that resulted in .... Andrews M, James EK, Cummings SP, Zavalin AA, Vinogradova LV,. McKenzie BA ...

Distribution and population dynamics of Rhizobium sp. introduced into soil

NARCIS (Netherlands)

Postma, J.

1989-01-01

In this thesis the population dynamics of bacteria introduced into soil was studied. In the introduction, the existence of microhabitats favourable for the survival of indigenous bacteria is discussed. Knowledge about the distribution of introduced bacteria over

Associações Rhizobium - Leguminosas no Estado de Rondõnia

OpenAIRE

Magalhães,Fátima M. M.; Silva,Marlene F. da

1987-01-01

Verificou-se a ocorrência de nodulação em mudas e/ou individuos adultos de 54 es-pécies da familia Leguminosae em áreas de floresta intacta e áreas perturbadas,no Estado de Rondônia. Das espécies observadas: Acácia polyphyllaÁ. DC., Amburana acreana(Ducke) A. C. Smith, Babieria pinnata(Pers.) Baill., Bauhinia acreanaHarms., BauhiniulongicuspÍ4 Spr. ex Benth., Cassia fastuosaWilld., Dalbergia inundataBenth., Derris ama zonicaKiiiip, Hymenaea reticulataDucke, Machaerium inundaium(Mart. ex Benth...

Signals exchanged between legumes and Rhizobium: agricultural uses and perspectives

International Nuclear Information System (INIS)

Broughton, William J.; Perret, Xavier; Staehelin, Christian; Zhang Feng

2001-01-01

Legumes and rhizobia exchange at least three different, but sometimes complementary sets of signals. Amongst the variety of substances normally and continuously secreted into the rhizosphere by plants are phenolic compounds. Flavonoid components of these mixtures are especially active in inducing rhizobial nodulation genes. Many nodgenes exist. Some (e.g., nodD) serve as regulators of transcription, but most code for enzymes involved in the synthesis of a family of lipo-chito-oligosaccharides (LCOs) called Nod-factors. Nod-factors possess hormone-like properties, are key determinants in nodulation, and allow rhizobia to enter the plant. As Nod-factors also stimulate the synthesis and release of flavonoids from legume roots, the response to inoculation is amplified. Once the bacteria enter the plant, other sets of signals are exchanged between the symbionts. These include extra-cellular polysaccharides (EPSs) as well as proteins externalised via type-three secretion systems. These carbohydrates/proteins may be active in invasion of the root. At the time of writing, only flavonoids and Nodfactors have been chemically synthesised and of these only the former are available in large quantities. Field trials in North America show that seed application of flavonoids stimulates nodulation and nitrogen fixation in soybeans grown at low soil temperatures. The biological basis to these responses is discussed. (author)

Nitrogen fixation in trees - 1

Energy Technology Data Exchange (ETDEWEB)

Dobereiner, J.; Gauthier, D.L.; Diem, H.G.; Dommergues, Y.R.; Bonetti, R.; Oliveira, L.A.; Magalhaes, F.M.M.; Faria, S.M. de; Franco, A.A.; Menandro, M.S.

1984-01-01

Six papers are presented from the symposium. Dobereiner, J.; Nodulation and nitrogen fixation in leguminous trees, 83-90, (15 ref.), reviews studies on Brazilian species. Gauthier, D.L., Diem, H.G., Dommergues, Y.R., Tropical and subtropical actinorhizal plants, 119-136, (Refs. 50), reports on studies on Casuarinaceae. Bonetti, R., Oliveira, L.A., Magalhaes, F.M.M.; Rhizobium populations and occurrence of VA mycorrhizae in plantations of forest trees, 137-142, (Refs. 15), studies Amazonia stands of Cedrelinga catenaeformis, Calophyllum brasiliense, Dipteryx odorata, D. potiphylla, Carapa guianensis, Goupia glabra, Tabebuia serratifolia, Clarisia racemosa, Pithecellobium racemosum, Vouacapoua pallidior, Eperua bijuga, and Diplotropis species. Nodulation was observed in Cedrelinga catenaeformis and V. pallidior. Faria, S.M. de, Franco, A.A., Menandro, M.S., Jesus, R.M. de, Baitello, J.B.; Aguiar, O.T. de, Doebereiner, J; survey of nodulation in leguminous tree species native to southeastern Brazil, 143-153, (Refs. 7), reports on 119 species, with first reports of nodulation in the genera Bowdichia, Poecilanthe, Melanoxylon, Moldenhaurea (Moldenhawera), and Pseudosamanea. Gaiad, S., Carpanezzi, A.A.; Occurrence of Rhizobium in Leguminosae of silvicultural interest for south Brazil, 155-158, (Refs. 2). Nodulation is reported in Mimosa scabrella, Acacia mearnsii, A. longifolia various trinervis, Enterolobium contortisiliquum, and Erythrina falcata. Magalhaes, L.M.S., Blum, W.E.H., Nodulation and growth of Cedrelinga catanaeformis in experimental stands in the Manaus region - Amazonas, 159-164, (Refs. 5). Results indicate that C. catenaeformis can be used in degraded areas of very low soil fertility.

TOLERÂNCIA DE RIZÓBIO DE FEIJÃO-CAUPI À SALINIDADE E À TEMPERATURA EM CONDIÇÃO IN VITRO

Directory of Open Access Journals (Sweden)

Gustavo Ribeiro Xavier

2007-01-01

Full Text Available The selection of rhizobium strains tolerant to salinity and temperature stress, typically of semi-arid regions, enhances the chance for introducing and establishing the air nitrogen fixing bacteria and cowpea association successfully, resulting in grain yield increases. Effects of factors, such as tolerance to different NaCl concentrations (1%, 2% and 3% and two levels of high temperature (39º C and 42º C. were studied on seventy-six rhizobium strains isolated from cowpea root nodules in order to identify the relation to the origin region and their growth habit in YEM solid culture medium. In general, it was observed that bacteria from the "Sertão" region were more tolerant to high temperatures. On the other hand, results for the salinity study showed that as the salt concentration increased, the percentage of tolerant strains decreased. About 40% of the strains were able to grow in a culture medium with 1% of NaCl. At 2% of NaCl concentration, 17% of the total strains could grow and, from this amount, 15% came from the "Sertão" region and 24% from "Zona da Mata" region. At 3% NaCl concentration, only 12% of the strains were able to grow. From the 76 strains, around 10% were tolerant to high temperatures and to the NaCl levels used, one of them from the "Agreste" region, four from the "Sertão" region and 2 from the "Zona da Mata" region".

A symbiosis-dedicated SYNTAXIN OF PLANTS 13II isoform controls the formation of a stable host-microbe interface in symbiosis.

Science.gov (United States)

Huisman, Rik; Hontelez, Jan; Mysore, Kirankumar S; Wen, Jiangqi; Bisseling, Ton; Limpens, Erik

2016-09-01

Arbuscular mycorrhizal (AM) fungi and rhizobium bacteria are accommodated in specialized membrane compartments that form a host-microbe interface. To better understand how these interfaces are made, we studied the regulation of exocytosis during interface formation. We used a phylogenetic approach to identify target soluble N-ethylmaleimide-sensitive factor-attachment protein receptors (t-SNAREs) that are dedicated to symbiosis and used cell-specific expression analysis together with protein localization to identify t-SNAREs that are present on the host-microbe interface in Medicago truncatula. We investigated the role of these t-SNAREs during the formation of a host-microbe interface. We showed that multiple syntaxins are present on the peri-arbuscular membrane. From these, we identified SYNTAXIN OF PLANTS 13II (SYP13II) as a t-SNARE that is essential for the formation of a stable symbiotic interface in both AM and rhizobium symbiosis. In most dicot plants, the SYP13II transcript is alternatively spliced, resulting in two isoforms, SYP13IIα and SYP13IIβ. These splice-forms differentially mark functional and degrading arbuscule branches. Our results show that vesicle traffic to the symbiotic interface is specialized and required for its maintenance. Alternative splicing of SYP13II allows plants to replace a t-SNARE involved in traffic to the plasma membrane with a t-SNARE that is more stringent in its localization to functional arbuscules. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.

Octadecanoides como reguladores de la defensa de las plantas

OpenAIRE

G. Camarena Gutiérrez

2002-01-01

En años recientes muchas moléculas lipoides muy potentes han sido identificadas, comprenden compuestos lipofílicos no derivados de lípidos como los brasinoesteroides triterpenoides, otros que parcialmente son de origen lipídico como los lipo-oligosacáridos, factores de nodulación de especies de Rhizobium que pueden tener parientes endógenos en las plantas, y un tercer grupo, los octadecanoides, cuyas estructuras son derivadas de ácidos grasos vegetales. Las señales mediadas por lípid...

AVRUPA KAHVERENGİ TAVŞANI (Lepus europaeus Pallas,1778)’NIN DIŞKISINDA BULUNAN BAKTERİ TÜRLERİ

OpenAIRE

Özen, Ahmet Selçuk; Ercan Barış, Zeynep Maide; Yılmaz, Ayhan

2018-01-01

Bu çalışma, Avrupa Kahverengi tavşanının (Lepuseuropaeus) dışkısında bulunan bakteri türlerinin tespitine dayanmaktadır.Dışkıların laboratuvar analizi iki farklı periyotta gerçekleştirilmiştir.Sonuçta, Gram positifler (+) olarak Kocuira rosea, Aerococcus viridans,Staphylococcus warneri, Staphylococcus saprophyticus ile Bacillus cereus veGram negatif (-) olarak Rhizobium radiobacter, Klebsiella pneumoniae,Klebsiella oxytoca ve Echerichia coli olarak toplam dokuz bakteri türü tespit edilmiştir....

Técnicas de fermentación y aplicaciones de la celulosa bacteriana: una revisión

OpenAIRE

Carreño Pineda, Luz Dary; Caicedo Mesa, Luis Alfonso; Martínez Riascos, Carlos Arturo

2012-01-01

La celulosa bacteriana es un polímero obtenido por fermentación con microrganismos de los géneros Acetobacter, Rhizobium, Agrobacterium y Sarcina, de las cuales la especie más eficiente es la Acetobacter Xylinum. Este polímero presenta la misma estructura química de la celulosa de origen vegetal, pero difiere en su conformación y propiedades fisicoquímicas, lo que lo hace atractivo para diversas aplicaciones, especialmente en las áreas de alimentos, procesos de separación, catálisis y en medi...

Expression of a complete soybean leghemoglobin gene in root nodules of transgenic Lotus corniculatus

DEFF Research Database (Denmark)

Stougaard, J; Petersen, T E; Marcker, K A

1987-01-01

The complete soybean leghemoglobin lbc(3) gene was transferred into the legume Lotus corniculatus using an Agrobacterium rhizogenes vector system. Organ-specific expression of the soybean gene was observed in root nodules formed on regenerated transgenic plants after infection with Rhizobium loti....... The primary transcript was processed in the same way as in soybean nodules and the resulting mRNA was translated into Lbc(3) protein. Quantitative determination of the Lbc(3) protein in nodules of transgenic plants indicated that the steady-state level of the soybean protein is comparable...

The characteristics and diversity of indigenous rhizobia that nodulate selected indigenous multipurpose leguminous trees and shrubs in three soils of Ghana

International Nuclear Information System (INIS)

Boakye, Emmanuel Yaw

2013-03-01

Trees in general and leguminous trees in particular form an integral part of the traditional farming systems in Ghana. Compared to other plants, leguminous trees have the advantage that, they are generally capable of growing better on N-deficient soils due to their ability to convert unavailable atmospheric N_2 into plant utilizable N. However, several factors including the abundance and effectiveness of the specific rhizobial partner, the available N and P in soil, are among the important factors that severely affect how much N_2 can be fixed in these trees. This study was thus conducted to assess the abundance and characteristics of the rhizobia that nodulate 18 selected indigenous tree legumes grown in three representative soils of Ghana and to ascertain important soil nutrient constraints that affect their nodulation, nitrogen fixation and growth. The three soils belonged to the Hatso, Toje and Alajo local series (equivalent to Haplic lixisol, Rhodic lixisol and Calcic vertisol, respectively). The 200 Rhizobium isolates obtained from nodules of these tree legumes were found to be highly diverse and varied in their abilities to nodulate legumes other than the host plants from which they were isolated. The isolates were further characterized culturally, metabolically, phenotypically and for their effectiveness in fixing atmospheric nitrogen. Of the 10 multi-purpose shrubs and tree species belonging to the subfamily Mimosoideae examined as much as 70% of them formed nodules in the three soils, whiles only 20% and 10% of the tree legumes that formed nodules belong to Papilionoideae and Caesalpinoideae sub-families respectively. As to the Rhizobium isolates from these shrubs and tree species, those obtained from Pithecelobium spp and Melletia thonningi appeared to be highly specific, nodulating only their respective homologous hosts, while those from Acacia mangium, Albizia lebbek and Acacia auricloformis appeared to be slightly promiscuous, and moderately

In vitro effects of copper nanoparticles on plant pathogens, beneficial microbes and crop plants

Energy Technology Data Exchange (ETDEWEB)

Banik, S.; Pérez-de-Luque, A.

2017-07-01

Copper-based chemicals are effectively used as antimicrobials in agriculture. However, with respect to its nanoparticulate form there has been limited number of studies. In this investigation, in vitro tests on effect of copper nanoparticles (CuNPs) against plant pathogenic fungi, oomycete, bacteria, beneficial microbes Trichoderma harzianum and Rhizobium spp., and wheat seeds were conducted. Integration of CuNPs with non-nano copper like copper oxychloride (CoC) at 50 mg/L concentration each recorded 76% growth inhibition of the oomycete Phytophthora cinnamomi in vitro compared to the control. CuNPs also showed synergistic inhibitory effect with CoC on mycelial growth and sporulation of A. alternata. Pseudomonas syringae was inhibited at 200 mg/L of CuNPs. CuNPs were not significantly biocidal against Rhizobium spp. and Trichoderma harzianum compared to CoC. Evaluation of the effect of CuNP on wheat revealed that rate of germination of wheat seeds was higher in presence of CuNPs and CoC compared to control. Germination vigor index, root length, shoot dry weight and seed metabolic efficiency of wheat were negatively affected. At low concentration, CuNPs promoted the growth of the plant pathogenic fungi Botrytis fabae, Fusarium oxysporum f.sp. ciceris, F.oxysporum f.sp. melonis, Alternaria alternate and P. syringae, and sporulation of T. harzianum. Synergistic effect of CuNPs and CoC in inhibiting P. cinnamomi offers a possibility of developing new fungicide formulation for better control of the oomycetes. Non-biocidal effect of CuNPs against beneficial microbes indicates its potential use in the agri-ecosystem.

Improvement of Chickpea Growth and Biological N Fixation under Water Salinity Stress

International Nuclear Information System (INIS)

Gadalla, A. M.; Galal, Y. G. M.; Hamdy, A.

2004-01-01

This work had been carried out under greenhouse conditions of IAM-Bari, aimed at evaluating the effects of water and soil salinity on growth, yield and nitrogen fixation by chickpea plants inoculated with selected Rhizobium strains. Isotope dilution approach ( 15 N) was applied for quantification of biological N fixation and portions derived from fertilizer and soil (Ndff and Ndfs, respectively). Number of pods was decreased gradually with increasing water salinity levels. High levels of salinity negatively affected shoot, root dry matter, seed yield and N accumulated in shoots and roots. A slight difference in seed N was noticed between fresh water and 9 dS/m treatments. Nitrogen derived from fertilizer by shoots was slightly increased with 3, 6 and 9 dS/m treatments, while they were notably higher than the fresh water control. More than 80% and 70% of N accumulated in shoots and seeds, respectively were derived from fixation. Portions of N 2 -fixed in shoots was decreased with the level of 3 dS/m as compared to the fresh water, then tended to increase with both 6 and 9 dS/m treatments. Stability of %Ndfa with increasing salinity was noticed with seeds-N. Soil-N came next as a fraction of nitrogen demand, where it increased with increasing water salinity levels. Under adverse conditions of salinity, the plants offered some of their N requirements from the other two N sources. Application of the suitable Rhizobium bacteria strains could be profits for both of the plant growth and soil fertility via N 2 fixation. (Authors)

In vitro effects of copper nanoparticles on plant pathogens, beneficial microbes and crop plants

International Nuclear Information System (INIS)

Banik, S.; Pérez-de-Luque, A.

2017-01-01

Copper-based chemicals are effectively used as antimicrobials in agriculture. However, with respect to its nanoparticulate form there has been limited number of studies. In this investigation, in vitro tests on effect of copper nanoparticles (CuNPs) against plant pathogenic fungi, oomycete, bacteria, beneficial microbes Trichoderma harzianum and Rhizobium spp., and wheat seeds were conducted. Integration of CuNPs with non-nano copper like copper oxychloride (CoC) at 50 mg/L concentration each recorded 76% growth inhibition of the oomycete Phytophthora cinnamomi in vitro compared to the control. CuNPs also showed synergistic inhibitory effect with CoC on mycelial growth and sporulation of A. alternata. Pseudomonas syringae was inhibited at 200 mg/L of CuNPs. CuNPs were not significantly biocidal against Rhizobium spp. and Trichoderma harzianum compared to CoC. Evaluation of the effect of CuNP on wheat revealed that rate of germination of wheat seeds was higher in presence of CuNPs and CoC compared to control. Germination vigor index, root length, shoot dry weight and seed metabolic efficiency of wheat were negatively affected. At low concentration, CuNPs promoted the growth of the plant pathogenic fungi Botrytis fabae, Fusarium oxysporum f.sp. ciceris, F.oxysporum f.sp. melonis, Alternaria alternate and P. syringae, and sporulation of T. harzianum. Synergistic effect of CuNPs and CoC in inhibiting P. cinnamomi offers a possibility of developing new fungicide formulation for better control of the oomycetes. Non-biocidal effect of CuNPs against beneficial microbes indicates its potential use in the agri-ecosystem.

Characterization of rhizobial isolates nodulating Millettia pinnata in India.

Science.gov (United States)

Rasul, Abdul; Amalraj, E Leo Daniel; Praveen Kumar, G; Grover, Minakshi; Venkateswarlu, B

2012-11-01

Millettia pinnata (Synonym Pongamia pinnata) is a viable source of oil for the mushrooming biofuel industry, source for agroforestry, urban landscaping, and the bio-amelioration of degraded lands. It also helps in maintaining soil fertility through symbiotic nitrogen fixation. However, not much work is reported on classification and characterization of the rhizobia associated with this plant. In the present study, an attempt was made to isolate rhizobial strains nodulating Millettia from soils collected from southern regions of India. The isolates were characterized using numerical taxonomy, 16S rRNA gene sequencing, and cross nodulation ability. The results showed high phenotypic and genetic diversity among the rhizobia symbiotic with Millattia pinnata. The isolates formed five clusters at similarity level of 0.82 based on the results of numerical taxonomy. Results on 16S rRNA gene sequence analysis revealed that most microsymbionts of M. pinnata belonged to Rhizobium and Bradyrhizobium, which are closely related to Rhizobium sp., B. elkanii and B. yuanmingense. Among these isolates, some isolates could grow in a pH range of 4.0-10.0, some could tolerate a high salt concentration (3% NaCl) and could grow at a maximum temperature between 35 and 45 °C. M. pinnata formed nodules with diverse rhizobia in Indian soils. These results offered the first systematic information about the microsymbionts of M. pinnata grown in the soils from southern part of India. © 2012 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

The abundance and diversity of legume-nodulating rhizobia in 28-year-old plantations of tropical, subtropical, and exotic tree species: a case study from the Forest Reserve of Bandia, Senegal.

Science.gov (United States)

Sene, Godar; Thiao, Mansour; Samba-Mbaye, Ramatoulaye; Khasa, Damase; Kane, Aboubacry; Mbaye, Mame Samba; Beaulieu, Marie-Ève; Manga, Anicet; Sylla, Samba Ndao

2013-01-01

Several fast-growing and multipurpose tree species have been widely used in West Africa to both reverse the tendency of land degradation and restore soil productivity. Although beneficial effects have been reported on soil stabilization, there still remains a lack of information about their impact on soil microorganisms. Our investigation has been carried out in exotic and native tree plantations of 28 years and aimed to survey and compare the abundance and genetic diversity of natural legume-nodulating rhizobia (LNR). The study of LNR is supported by the phylogenetic analysis which clustered the isolates into three genera: Bradyrhizobium, Mesorhizobium, and Sinorhizobium. The results showed close positive correlations between the sizes of LNR populations estimated both in the dry and rainy seasons and the presence of legume tree hosts. There were significant increases in Rhizobium spp. population densities in response to planting with Acacia spp., and high genetic diversities and richness of genotypes were fittest in these tree plantations. This suggests that enrichment of soil Rhizobium spp. populations is host specific. The results indicated also that species of genera Mesorhizobium and Sinorhizobium were lacking in plantations of non-host species. By contrast, there was a widespread distribution of Bradyrhizobium spp. strains across the tree plantations, with no evident specialization in regard to plantation type. Finally, the study provides information about the LNR communities associated with a range of old tree plantations and some aspects of their relationships to soil factors, which may facilitate the management of man-made forest systems that target ecosystem rehabilitation and preservation of soil biota.

Co-inoculation with rhizobia and AMF inhibited soybean red crown rot: from field study to plant defense-related gene expression analysis.

Directory of Open Access Journals (Sweden)

Xiang Gao

Full Text Available Soybean red crown rot is a major soil-borne disease all over the world, which severely affects soybean production. Efficient and sustainable methods are strongly desired to control the soil-borne diseases.We firstly investigated the disease incidence and index of soybean red crown rot under different phosphorus (P additions in field and found that the natural inoculation of rhizobia and arbuscular mycorrhizal fungi (AMF could affect soybean red crown rot, particularly without P addition. Further studies in sand culture experiments showed that inoculation with rhizobia or AMF significantly decreased severity and incidence of soybean red crown rot, especially for co-inoculation with rhizobia and AMF at low P. The root colony forming unit (CFU decreased over 50% when inoculated by rhizobia and/or AMF at low P. However, P addition only enhanced CFU when inoculated with AMF. Furthermore, root exudates of soybean inoculated with rhizobia and/or AMF significantly inhibited pathogen growth and reproduction. Quantitative RT-PCR results indicated that the transcripts of the most tested pathogen defense-related (PR genes in roots were significantly increased by rhizobium and/or AMF inoculation. Among them, PR2, PR3, PR4 and PR10 reached the highest level with co-inoculation of rhizobium and AMF.Our results indicated that inoculation with rhizobia and AMF could directly inhibit pathogen growth and reproduction, and activate the plant overall defense system through increasing PR gene expressions. Combined with optimal P fertilization, inoculation with rhizobia and AMF could be considered as an efficient method to control soybean red crown rot in acid soils.

In-situ Monitoring of Plant-microbe Communication to Understand the Influence of Soil Properties on Symbiotic Biological Nitrogen Fixation

Science.gov (United States)

Webster, T.; Del Valle, I.; Cheng, H. Y.; Silberg, J. J.; Masiello, C. A.; Lehmann, J.

2016-12-01

Plant-microbe signaling is important for many symbiotic and pathogenic interactions. While this signaling often occurs in soils, very little research has evaluated the role that the soil mineral and organic matter matrix plays in plant-microbe communication. One hurdle to these studies is the lack of simple tools for evaluating how soil mineral phases and organic matter influence the availability of plant-produced flavonoids that initiate the symbiosis between nitrogen-fixing bacteria and legumes. Because of their range of hydrophobic and electrostatic properties, flavonoids represent an informative class of signaling molecules. In this presentation, we will describe studies examining the bioavailable concentrations of flavonoids in soils using traditional techniques, such as high-pressure liquid chromatography and fluorescent microbial biosensors. Additionally, we will describe our progress developing a Rhizobium leguminosarum reporter that can be deployed into soils to report on flavonoid levels. This new microbial reporter is designed so that Rhizobium only generates a volatile gas signal when it encounters a defined concentration of flavonoids. By monitoring the output of this biosensor using gas chromatography-mass spectrometry during real time during soil incubations, we are working to establish the impact of soil organic matter, pH, and mineral phases on the reception of these signaling molecules. We expect that the findings from these studies will be useful for recommending soil management strategies that can enhance the communication between legumes and nitrogen fixing bacteria. This research highlights the importance of studying the role of soil as a mediator of plant-microbe communication.

Informe científico de investigador: Balatti, Pedro Alberto (2012)

OpenAIRE

Balatti, Pedro Alberto

2012-01-01

Se analizó la diversidad genética existente en los rizobios de crecimiento rápido que nodulan la soja. Por medio de la reacción en cadena de la polimerasa y con diversos primers se generaron marcadores ERIC, REP y RAPD. Además, se amplificó el RNA de 16S el que restringión con endonucleasas. Por medio de estos marcadores se estableció, entre los representantes de Sinorhizobium fredii aislados de la China y Vietnam y Rhizobium sp. NGR234, la diversidad genética existente entre ellos. Además se...

Dicty_cDB: Contig-U16358-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 01389_2365( CP001389 |pid:none) Rhizobium sp. NGR234, complete ... 90 1e-33 AM494972_195( AM494972 |pid:none) Leishmania braziliensi...81( CT005272 |pid:none) Leishmania major strain Friedlin... 94 2e-33 AP009152_1947( AP009152 |pid:none) Kocu...1053_2521( CP001053 |pid:none) Burkholderia phytofirmans PsJN ... 245 e-100 BA000011_1082( BA000011 |pid:none) Thermoplasma volcani...baalenii PYR-1... 228 6e-94 CP000325_2196( CP000325 |pid:none) Mycobacterium ulcerans... ... 140 2e-49 CP000557_1254( CP000557 |pid:none) Geobacillus thermodenitrificans

Structure, biosynthesis and function of unusual lipids A from nodule-inducing and N2-fixing bacteria.

Science.gov (United States)

Choma, Adam; Komaniecka, Iwona; Zebracki, Kamil

2017-02-01

This review focuses on the chemistry and structures of (Brady)rhizobium lipids A, indispensable parts of lipopolysaccharides. These lipids contain unusual (ω-1) hydroxylated very long chain fatty acids, which are synthesized by a very limited group of bacteria, besides rhizobia. The significance and requirement of the very long chain fatty acids for outer membrane stability as well as the genetics of the synthesis pathway are discussed. The biological role of these fatty acids for bacterial life in extremely different environments (soil and intracellular space within nodules) is also considered. Copyright © 2016 Elsevier B.V. All rights reserved.

Probiotic activities of Rhizobium laguerreae on growth and quality of spinach

Czech Academy of Sciences Publication Activity Database

Jimenez-Gomez, A.; Flores-Felix, J.D.; García-Fraile, Paula; Mateos, P.F.; Menéndez, E.; Velazquez, E.; Rivas, R.

2018-01-01

Roč. 8, JAN 10 (2018), č. článku 295. ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : ZEA-MAYS L. * PROMOTING RHIZOBACTERIA * MEDITERRANEAN DIET Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

Genetic and Molecular Mechanisms Underlying Symbiotic Specificity in Legume-Rhizobium Interactions.

Science.gov (United States)

Wang, Qi; Liu, Jinge; Zhu, Hongyan

2018-01-01

Legumes are able to form a symbiotic relationship with nitrogen-fixing soil bacteria called rhizobia. The result of this symbiosis is to form nodules on the plant root, within which the bacteria can convert atmospheric nitrogen into ammonia that can be used by the plant. Establishment of a successful symbiosis requires the two symbiotic partners to be compatible with each other throughout the process of symbiotic development. However, incompatibility frequently occurs, such that a bacterial strain is unable to nodulate a particular host plant or forms nodules that are incapable of fixing nitrogen. Genetic and molecular mechanisms that regulate symbiotic specificity are diverse, involving a wide range of host and bacterial genes/signals with various modes of action. In this review, we will provide an update on our current knowledge of how the recognition specificity has evolved in the context of symbiosis signaling and plant immunity.

Legume-rhizobium symbiotic promiscuity and effectiveness do not affect plant invasiveness.

Science.gov (United States)

Keet, Jan-Hendrik; Ellis, Allan G; Hui, Cang; Le Roux, Johannes J

2017-06-01

The ability to fix atmospheric nitrogen is thought to play an important role in the invasion success of legumes. Interactions between legumes and nitrogen-fixing bacteria (rhizobia) span a continuum of specialization, and promiscuous legumes are thought to have higher chances of forming effective symbioses in novel ranges. Using Australian Acacia species in South Africa, it was hypothesized that widespread and highly invasive species will be more generalist in their rhizobial symbiotic requirements and more effective in fixing atmospheric nitrogen compared with localized and less invasive species. To test these hypotheses, eight localized and 11 widespread acacias were examined using next-generation sequencing data for the nodulation gene, nodC , to compare the identity, species richness, diversity and compositional similarity of rhizobia associated with these acacias. Stable isotope analysis was also used to determine levels of nitrogen obtained from the atmosphere via symbiotic nitrogen fixation. No differences were found in richness, diversity and community composition between localized and widespread acacias. Similarly, widespread and localized acacias did not differ in their ability to fix atmospheric nitrogen. However, for some species by site comparisons, significant differences in δ15N isotopic signatures were found, indicating differential symbiotic effectiveness between these species at specific localities. Overall, the results support recent findings that root nodule rhizobial diversity and community composition do not differ between acacias that vary in their invasiveness. Differential invasiveness of acacias in South Africa is probably linked to attributes such as differences in propagule pressure, reasons for (e.g. forestry vs. ornamental) and extent of, plantings in the country. © The Author 2017. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com

Antibiotics Resistance in Rhizobium: Type, Process, Mechanism and Benefit for Agriculture.

Science.gov (United States)

Naamala, Judith; Jaiswal, Sanjay K; Dakora, Felix D

2016-06-01

The use of high-quality rhizobial inoculants on agricultural legumes has contributed substantially to the N economy of farming systems through inputs from biological nitrogen fixation (BNF). Large populations of symbiotically effective rhizobia should be available in the rhizosphere for symbiotic BNF with host plants. The rhizobial populations should also be able to compete and infect host plants. However, the rhizosphere comprises large populations of different microorganisms. Some of these microorganisms naturally produce antibiotics which are lethal to susceptible rhizobial populations in the soil. Therefore, intrinsic resistance to antibiotics is a desirable trait for the rhizobial population. It increases the rhizobia's chances of growth, multiplication and persistence in the soil. With a large population of rhizobia in the soil, infectivity of host plants and the subsequent BNF efficiency can be guaranteed. This review, therefore, puts together findings by various researchers on antibiotic resistance in bacteria with the main emphasis on rhizobia. It describes the different modes of action of different antibiotics, the types of antibiotic resistance exhibited by rhizobia, the mechanisms of acquisition of antibiotic resistance in rhizobia and the levels of tolerance of different rhizobial species to different antibiotics.

The Role of Plant Innate Immunity in the Legume-Rhizobium Symbiosis.

Science.gov (United States)

Cao, Yangrong; Halane, Morgan K; Gassmann, Walter; Stacey, Gary

2017-04-28

A classic view of the evolution of mutualism is that it derives from a pathogenic relationship that attenuated over time to a situation in which both partners can benefit. If this is the case for rhizobia, then one might uncover features of the symbiosis that reflect this earlier pathogenic state. For example, as with plant pathogens, it is now generally assumed that rhizobia actively suppress the host immune response to allow infection and symbiosis establishment. Likewise, the host has retained mechanisms to control the nutrient supply to the symbionts and the number of nodules so that they do not become too burdensome. The open question is whether such events are strictly ancillary to the central symbiotic nodulation factor signaling pathway or are essential for rhizobial host infection. Subsequent to these early infection events, plant immune responses can also be induced inside nodules and likely play a role in, for example, nodule senescence. Thus, a balanced regulation of innate immunity is likely required throughout rhizobial infection, symbiotic establishment, and maintenance. In this review, we discuss the significance of plant immune responses in the regulation of symbiotic associations with rhizobia, as well as rhizobial evasion of the host immune system.

Rhizobium-legume symbiosis shares an exocytotic pathway required for arbuscle formation

NARCIS (Netherlands)

Ivanov, S.; Fedorova, E.E.; Limpens, E.H.M.; Mita, De S.; Genre, A.; Bonfante, P.; Bisseling, T.

2012-01-01

Endosymbiotic interactions are characterized by the formation of specialized membrane compartments, by the host in which the microbes are hosted, in an intracellular manner. Two well-studied examples, which are of major agricultural and ecological importance, are the widespread arbuscular

Colorimetric Detection of Some Highly Hydrophobic Flavonoids Using Polydiacetylene Liposomes Containing Pentacosa-10,12-diynoyl Succinoglycan Monomers

Science.gov (United States)

Yun, Deokgyu; Jeong, Daham; Cho, Eunae; Jung, Seunho

2015-01-01

Flavonoids are a group of plant secondary metabolites including polyphenolic molecules, and they are well known for antioxidant, anti-allergic, anti-inflammatory and anti-viral propertied. In general, flavonoids are detected with various non-colorimetric detection methods such as column liquid chromatography, thin-layer chromatography, and electrochemical analysis. For the first time, we developed a straightforward colorimetric detection system allowing recognition of some highly hydrophobic flavonoids such as alpha-naphthoflavone and beta-naphthoflavone, visually using 10,12-pentacosadiynoic acid (PCDA) derivatized with succinoglycan monomers isolated from Sinorhizobium meliloti. Besides changes in visible spectrum, we also demonstrate fluorescence changes using our detection system in the presence of those flavonoids. The succinoglycan monomers attached to PCDA molecules may function as an unstructured molecular capturer for some highly hydrophobic flavonoids by hydrophobic interactions, and transmit their molecular interactions as a color change throughout the PCDA liposome. PMID:26600071

Characterization of arsenite-oxidizing bacteria isolated from arsenic-contaminated groundwater of West Bengal.

Science.gov (United States)

Paul, Dhiraj; Poddar, Soumya; Sar, Pinaki

2014-01-01

Nine arsenic (As)-resistant bacterial strains isolated from As-rich groundwater samples of West Bengal were characterized to elucidate their potential in geomicrobial transformation and bioremediation aspects. The 16S rRNA gene-based phylogenetic analysis revealed that the strains were affiliated with genera Actinobacteria, Microbacterium, Pseudomonas and Rhizobium. The strains exhibited high resistance to As [Minimum inhibitory concentration (MIC) ≥ 10 mM As(3+) and MIC ≥ 450 mM As(5+)] and other heavy metals, e.g., Cu(2+), Cr(2+), Ni(2+), etc. (MIC ≥ 2 mM) as well as As transformation (As(3+) oxidation and As(5+) reduction) capabilities. Their ability to utilize diverse carbon source(s) including hydrocarbons and different alternative electron acceptor(s) (As(5+), SO4(2-), S2O3(2-), etc.) during anaerobic growth was noted. Growth at wide range of pH, temperature and salinity, production of siderophore and biofilm were observed. Together with these, growth pattern and transformation kinetics indicated a high As(3+) oxidation activity of the isolates Rhizobium sp. CAS934i, Microbacterium sp. CAS905i and Pseudomonas sp. CAS912i. A positive relation between high As(3+) resistance and As(3+) oxidation and the supportive role of As(3+) in bacterial growth was noted. The results highlighted As(3+) oxidation process and metabolic repertory of strains indigenous to contaminated groundwater and indicates their potential in As(3+) detoxification. Thus, such metabolically well equipped bacterial strains with highest As(3+) oxidation activities may be used for bioremediation of As contaminated water and effluents in the near future.

Tripartite symbiosis of Sophora tomentosa, rhizobia and arbuscular mycorhizal fungi.

Science.gov (United States)

Toma, Maíra Akemi; Soares de Carvalho, Teotonio; Azarias Guimarães, Amanda; Martins da Costa, Elaine; Savana da Silva, Jacqueline; de Souza Moreira, Fatima Maria

Sophora tomentosa is a pantropical legume species with potential for recovery of areas degraded by salinization, and for stabilization of sand dunes. However, few studies on this species have been carried out, and none regarding its symbiotic relationship with beneficial soil microorganisms. Therefore, this study aimed to evaluate the diversity of nitrogen-fixing bacteria isolated from nodules of Sophora tomentosa, and to analyze the occurrence of colonization of arbuscular mycorrhizal fungi on the roots of this legume in seafront soil. Thus, seeds, root nodules, and soil from the rhizosphere of Sophora tomentosa were collected. From the soil samples, trap cultures with this species were established to extract spores and to evaluate arbuscular mycorhizal fungi colonization in legume roots, as well as to capture rhizobia. Rhizobia strains were isolated from nodules collected in the field or from the trap cultures. Representative isolates of the groups obtained in the similarity dendrogram, based on phenotypic characteristics, had their 16S rRNA genes sequenced. The legume species showed nodules with indeterminate growth, and reddish color, distributed throughout the root. Fifty-one strains of these nodules were isolated, of which 21 were classified in the genus Bacillus, Brevibacillus, Paenibacillus, Rhizobium and especially Sinorhizobium. Strains closely related to Sinorhizobium adhaerens were the predominant bacteria in nodules. The other genera found, with the exception of Rhizobium, are probably endophytic bacteria in the nodules. Arbuscular mycorrhizal fungi was observed colonizing the roots, but arbuscular mycorhizal fungi spores were not found in the trap cultures. Therefore Sophora tomentosa is associated with both arbuscular mycorhizal fungi and nodulating nitrogen-fixing bacteria. Copyright © 2017 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.

Selection and characterization of coal mine autochthonous rhizobia for the inoculation of herbaceous legumes.

Science.gov (United States)

Hernández, Anabel González; de Moura, Ginaini Doin; Binati, Renato Leal; Nascimento, Francisco Xavier Inês; Londoño, Diana Morales; Mamede, Ana Carolina Peixoto; da Silva, Emanuela Pille; de Armas, Rafael Dutra; Giachini, Admir José; Rossi, Márcio José; Soares, Cláudio Roberto Fonsêca Sousa

2017-09-01

Coal open pit mining in the South of Santa Catarina state (Brazil) was inappropriately developed, affecting approximately 6.700 ha. Re-vegetation is an alternative for the recovery of these areas. Furthermore, the use of herbaceous legumes inoculated with nitrogen fixing bacteria is motivated due to the difficulty implementing a vegetation cover in these areas, mainly due to low nutrient availability. Therefore, the aim of this work was to evaluate, among 16 autochthonous rhizobia isolated from the coal mining areas, those with the greatest potential to increase growth of the herbaceous legumes Vicia sativa and Calopogonium mucunoides. Tests were conducted in greenhouse containing 17 inoculation treatments (16 autochthonous rhizobia + Brazilian recommended strain for each plant species), plus two treatments without inoculation (with and without mineral nitrogen). After 60 days, nodulation, growth, N uptake, and symbiotic efficiency were evaluated. Isolates characterization was assessed by the production of indole acetic acid, ACC deaminase, siderophores, and inorganic phosphate solubilization. The classification of the isolates was performed by 16 S rDNA gene sequencing. Only isolates UFSC-M4 and UFSC-M8 were able to nodulate C. mucunoides. Among rhizobia capable of nodulating V. sativa, only UFSC-M8 was considered efficient. It was found the presence of more than one growth-promoting attributes in the same organism, and isolate UFSC-M8 presented all of them. Isolates were classified as belonging to Rhizobium, Burkholderia and Curtobacterium. The results suggest the inoculation of Vicia sativa with strain UFSC-M8, classified as Rhizobium sp., as a promising alternative for the revegetation of coal mining degraded areas.

Symbiotic capability of calopo rhizobia from an agrisoil with different crops in Pernambuco

Directory of Open Access Journals (Sweden)

Altanys Silva Calheiros

2013-08-01

Full Text Available Biological nitrogen fixation by rhizobium-legume symbiosis represents one of the most important nitrogen sources for plants and depends strongly on the symbiotic efficiency of the rhizobium strain. This study evaluated the symbiotic capacity of rhizobial isolates from calopo (CALOPOGONIUM MUCUNOIDES taken from an agrisoil under BRACHIARIA DECUMBENS pasture, sabiá (MIMOSA CAESALPINIIFOLIA plantations and Atlantic Forest areas of the Dry Forest Zone of Pernambuco. A total of 1,575 isolates were obtained from 398 groups. A single random isolate of each group was authenticated, in randomized blocks with two replications. Each plant was inoculated with 1 mL of a bacterial broth, containing an estimated population of 10(8 rhizobial cells mL-1. Forty-five days after inoculation, the plants were harvested, separated into shoots, roots and nodules, oven-dried to constant mass, and weighed. Next, the symbiotic capability was tested with 1.5 kg of an autoclaved sand:vermiculite (1:1 mixture in polyethylene bags. The treatments consisted of 122 authenticated isolates, selected based on the shoot dry matter, five uninoculated controls (treated with 0, 50, 100, 150, or 200 kg ha-1 N and a control inoculated with SEMIA 6152 (=BR1602, a strain of BRADYRHIZOBIUM JAPONICUM The test was performed as described above. The shoot dry matter of the plants inoculated with the most effective isolates did not differ from that of plants treated with 150 kg ha-1 N. Shoot dry matter was positively correlated with all other variables. The proportion of effective isolates was highest among isolates from SABIÁ forests. There was great variation in nodule dry weight, as well as in N contents and total N.

Burkholderia sp. induces functional nodules on the South African invasive legume Dipogon lignosus (Phaseoleae) in New Zealand soils.

Science.gov (United States)

Liu, Wendy Y Y; Ridgway, Hayley J; James, Trevor K; James, Euan K; Chen, Wen-Ming; Sprent, Janet I; Young, J Peter W; Andrews, Mitchell

2014-10-01

The South African invasive legume Dipogon lignosus (Phaseoleae) produces nodules with both determinate and indeterminate characteristics in New Zealand (NZ) soils. Ten bacterial isolates produced functional nodules on D. lignosus. The 16S ribosomal RNA (rRNA) gene sequences identified one isolate as Bradyrhizobium sp., one isolate as Rhizobium sp. and eight isolates as Burkholderia sp. The Bradyrhizobium sp. and Rhizobium sp. 16S rRNA sequences were identical to those of strains previously isolated from crop plants and may have originated from inocula used on crops. Both 16S rRNA and DNA recombinase A (recA) gene sequences placed the eight Burkholderia isolates separate from previously described Burkholderia rhizobial species. However, the isolates showed a very close relationship to Burkholderia rhizobial strains isolated from South African plants with respect to their nitrogenase iron protein (nifH), N-acyltransferase nodulation protein A (nodA) and N-acetylglucosaminyl transferase nodulation protein C (nodC) gene sequences. Gene sequences and enterobacterial repetitive intergenic consensus (ERIC) PCR and repetitive element palindromic PCR (rep-PCR) banding patterns indicated that the eight Burkholderia isolates separated into five clones of one strain and three of another. One strain was tested and shown to produce functional nodules on a range of South African plants previously reported to be nodulated by Burkholderia tuberum STM678(T) which was isolated from the Cape Region. Thus, evidence is strong that the Burkholderia strains isolated here originated in South Africa and were somehow transported with the plants from their native habitat to NZ. It is possible that the strains are of a new species capable of nodulating legumes.

A PROPOSITO DE UN ENSAYO CON ABONOS (cal y harina de huesos EN ALFALFAl (Medicago sativa

Directory of Open Access Journals (Sweden)

Isidoro Mogilner

1960-01-01

Full Text Available En este trabajo, los autores estudian el efecto que sobre el rendimiento de la alfalfa (Medicago sativa produce la incorporación de diferentes dosis de cal y harina de huesos, en un suelo pobre de P y Ca; de una textura pesada con alto contenido de arcilla en todos los horizontes, de un pH ácido (5.1 a 6.2 y que es característico de la zona donde fué hecha la experiencia.Se han obtenido resultados referentes a la influencia de la inoculación de la semilla con Rhizobium y el agregado de cal y harina de huesos sobre los rendimientos.

Caracterização de rizóbios isolados de Jacatupé cultivado em solo salino no Estado de Pernanbuco, Brasil Characterization of isolated rhizobia from Pachyrhyzus erosus L. cultivated in saline soil of the State of Pernambuco, Brazil

Directory of Open Access Journals (Sweden)

Ana Dolores Santiago de Freitas

2007-01-01

Full Text Available Pesquisas sobre a biodiversidade microbiológica de solos salinos envolvem a busca por genótipos tolerantes a esse tipo de estresse ambiental. Dados genotípicos correlacionados às características morfológicas, fisiológicas e bioquímicas de bactérias fornecem informações importantes para sua identificação e agrupamento. Este trabalho objetivou caracterizar rizóbios provenientes de solos salinos, do Agreste e Sertão de Pernambuco, utilizando jacatupé (Pachyrhizus erosus L. Urban como planta-isca. Os testes foram efetuados em meio YMA e as características culturais observadas em 24 isolados foram as seguintes: mudança de pH, tempo de crescimento, transparência, forma, borda, produção de exopolissacarídeo das colônias e resistência à salinidade. Os testes moleculares utilizando análise por PCR (reação em cadeia da polimerase por meio de seqüências repetitivas de DNA amplificadas com o primer BOX envolveram 13 isolados. Os resultados revelaram alta diversidade fenotípica e genotípica entre os isolados nativos. As características culturais e genéticas desses isolados foram comparados com 19 estirpes de referência. Os isolados NFB746 e NFB747 tiveram alta semelhança entre si e também com as estirpes Rhizobium sp. NGR234 (BR2406 e Mesorhizobium ciceri USDA3383 (BR521. O isolado NFB742, possivelmente, era da mesma espécie de M. ciceri (BR521. Com relação ao isolado NFB741, a semelhança com as bactérias Rhizobium tropici IIA CFN299T (BR10016 e Sinorhizobium terangue USDA4894 (BR527 foi de 87%. Os demais isolados, praticamente, formaram grupos independentes quando comparados com as estirpes de referência. Os resultados foram de grande relevância para diagnosticar novas espécies de rizóbios nativos altamente tolerantes a estresses ambientais.Investigation on microbiological biodiversity in the saline soils involves searching for tolerant genotypes to this type of emvironmental stress. Genotypic data associated to

High resolution imaging of surface patterns of single bacterial cells

International Nuclear Information System (INIS)

Greif, Dominik; Wesner, Daniel; Regtmeier, Jan; Anselmetti, Dario

2010-01-01

We systematically studied the origin of surface patterns observed on single Sinorhizobium meliloti bacterial cells by comparing the complementary techniques atomic force microscopy (AFM) and scanning electron microscopy (SEM). Conditions ranged from living bacteria in liquid to fixed bacteria in high vacuum. Stepwise, we applied different sample modifications (fixation, drying, metal coating, etc.) and characterized the observed surface patterns. A detailed analysis revealed that the surface structure with wrinkled protrusions in SEM images were not generated de novo but most likely evolved from similar and naturally present structures on the surface of living bacteria. The influence of osmotic stress to the surface structure of living cells was evaluated and also the contribution of exopolysaccharide and lipopolysaccharide (LPS) by imaging two mutant strains of the bacterium under native conditions. AFM images of living bacteria in culture medium exhibited surface structures of the size of single proteins emphasizing the usefulness of AFM for high resolution cell imaging.

High-quality forage production under salinity by using a salt-tolerant AtNXH1-expressing transgenic alfalfa combined with a natural stress-resistant nitrogen-fixing bacterium.

Science.gov (United States)

Stritzler, Margarita; Elba, Pagano; Berini, Carolina; Gomez, Cristina; Ayub, Nicolás; Soto, Gabriela

2018-06-20

Alfalfa, usually known as the "Queen of Forages", is the main source of vegetable protein to meat and milk production systems worldwide. This legume is extremely rich in proteins due to its highly efficient symbiotic association with nitrogen-fixing strains. In the last years, alfalfa culture has been displaced to saline environments by other important crops, including major cereals, a fact that has reduced its biomass production and symbiotic nitrogen fixation. In this short communication, we report the high forage production and nutrient quality of alfalfa under saline conditions by alfalfa transformation with the AtNHX1 Na + /H + antiporter and inoculation with the stress-resistant nitrogen-fixing strain Sinorhizobium meliloti B401. Therefore, the incorporation of transgenic traits into salt-sensitive legumes in association with the inoculation with natural stress-resistant isolates could be a robust approach to improve the productivity and quality of these important nitrogen-fixing crops. Copyright © 2018. Published by Elsevier B.V.

Infectividad y efectividad de rizobios aislados de Suelos de la Costa Caribe Colombiana en Vigna unguiculata

Directory of Open Access Journals (Sweden)

Jonathan Alberto Mendoza Labrador

2014-07-01

Full Text Available Título en español: Infectividad y efectividad de rizobios aislados de Suelos de la Costa Caribe Colombiana  en Vigna unguiculata Título en ingles: Infectivity and effectiveness of isolated rhizobia from colombian caribbean soils in Vigna unguiculata Título corto: Infectividad y efectividad de rizobios aislados de Suelos Resumen:  Es el primer estudio en Colombia que abarca una evaluación de rizobios nativos asociados a frijol Caupí (Vigna unguiculata L. Walp. en los departamentos del Cesar y la Guajira. En esta investigación, se demostró que la utilización de  aislamientos de rizobios nativos aislados a partir de  nódulos,  mejoraron el desarrollo del frijol Caupí  (Vigna unguiculata L. Walp., siendo estas bacterias más eficientes que los tratamientos químicos y absolutos (sin inóculo ni fertilización y que las cepas inducidas mejorando además, la fijación biológica de nitrógeno y la tasa fotosintética. Como aportes del estudio, se determinó que en condiciones de invernadero la fertilización biológica fue más eficiente que la química y que, de acuerdo a los resultados obtenidos de las diferentes variables agronómicas evaluadas, esto podría influir positivamente en los rendimientos nutricionales del cultivo, base alimentaria de los sistemas ganaderos de estas regiones del país y  fuente alimenticia  de la comunidad indígena y de bajos recursos económicos.  Palabras clave Nodulación, fijación Biológica de Nitrógeno, Fertilización, Tasa Fotosintética Abstract:  This is the first study in Colombia which covers an evaluation of native rhizobium associated to the Caupí bean   (Vigna unguiculata L. Walp. in the departaments of Cesar and Guajira. In this research it was demonstrated that the use of native rhizobium isolated from nodes, improved the development of the Caupí bean (Vigna unguiculata L. Walp., being this bacteria more efficient than the chemical and absolute treatments (without inoculum and

Parallel variation in isoenzyme and nitrogen fixation markers in a Rhizobium population

DEFF Research Database (Denmark)

Engvild, K.C.; Jensen, E.S.; Skøt, L.

1990-01-01

into the same 13 different groups. The largest group was represented 7 times according to isoenzymes and 8 times according to RFLP. This fixed non-random association of plasmid and chromosomal genotypes is consistent with a clonal population structure; it indicates limited exchange of plasmids under natural...

Does plant immunity have a central role in the legume rhizobium symbiosis?

Directory of Open Access Journals (Sweden)

Katalin eToth

2015-06-01

Full Text Available Plants are exposed to many different microbes in their habitat. These microbes may be benign or pathogenic, but in some cases they are beneficial. The rhizosphere provides an especially rich palette for colonization by beneficial (associative and symbiotic microorganisms, which raises the question as to how roots can distinguish such ‘friends’ from possible ‘foes’ (i.e., pathogens. Plants possess an innate immunity system that can recognize pathogens, through an arsenal of protein receptors. These receptors include receptor-like kinases (RLK and receptor-like proteins (RLP located at the plasma membrane, as well as intracellular receptors (so called NBS-LRR proteins or R proteins that recognize molecules released by microbes into the plant cell. The key rhizobial, symbiotic signaling molecule (called Nod factor is perceived by the host legume plant using LysM-domain containing RLKs. Perception of the symbiotic Nod factor triggers signaling cascades leading to bacterial infection and accommodation of the symbiont in a newly formed root organ, the nodule, resulting in a nitrogen-fixing root nodule symbiosis (RNS. The net result of this symbiosis is the intracellular colonization of the plant with thousands of bacteria; a process that seems to occur in spite of the immune ability of plants to prevent pathogen infection. In this review, we discuss the potential of the invading rhizobial symbiont to actively avoid this innate immunity response, as well as specific examples of where the plant immune response may modulate rhizobial infection and host range.

Enhanced phytoremediation of soils contaminated with PAHs by arbuscular mycorrhiza and rhizobium.

Science.gov (United States)

Ren, Cheng-Gang; Kong, Cun-Cui; Bian, Bian; Liu, Wei; Li, Yan; Luo, Yong-Ming; Xie, Zhi-Hong

2017-09-02

Greenhouse experiment was conducted to evaluate the potential effectiveness of a legume (Sesbania cannabina), arbuscular mycorrhizal fungi (AMF) (Glomus mosseae), and rhizobia (Ensifer sp.) symbiosis for remediation of Polycyclic aromatic hydrocarbons (PAHs) in spiked soil. AMF and rhizobia had a beneficial impact on each other in the triple symbiosis. AMF and/or rhizobia significantly increased plant biomass and PAHs accumulation in plants. The highest PAHs dissipation was observed in plant + AMF + rhizobia treated soil, in which >97 and 85-87% of phenanthrene and pyrene, respectively, had been degraded, whereas 81-85 and 72-75% had been degraded in plant-treated soil. During the experiment, a relatively large amount of water-soluble phenolic compounds was detected in soils of AMF and/or rhizobia treatment. It matches well with the high microbial activity and soil enzymes activity. These results suggest that the mutual interactions in the triple symbiosis enhanced PAHs degradation via stimulating both microbial development and soil enzyme activity. The mutual interactions between rhizobia and AMF help to improve phytoremediation efficiency of PAHs by S. cannabina.

Effector-Triggered Immunity Determines Host Genotype-Specific Incompatibility in Legume-Rhizobium Symbiosis.

Science.gov (United States)

Yasuda, Michiko; Miwa, Hiroki; Masuda, Sachiko; Takebayashi, Yumiko; Sakakibara, Hitoshi; Okazaki, Shin

2016-08-01

Symbiosis between legumes and rhizobia leads to the formation of N2-fixing root nodules. In soybean, several host genes, referred to as Rj genes, control nodulation. Soybean cultivars carrying the Rj4 gene restrict nodulation by specific rhizobia such as Bradyrhizobium elkanii We previously reported that the restriction of nodulation was caused by B. elkanii possessing a functional type III secretion system (T3SS), which is known for its delivery of virulence factors by pathogenic bacteria. In the present study, we investigated the molecular basis for the T3SS-dependent nodulation restriction in Rj4 soybean. Inoculation tests revealed that soybean cultivar BARC-2 (Rj4/Rj4) restricted nodulation by B. elkanii USDA61, whereas its nearly isogenic line BARC-3 (rj4/rj4) formed nitrogen-fixing nodules with the same strain. Root-hair curling and infection threads were not observed in the roots of BARC-2 inoculated with USDA61, indicating that Rj4 blocked B. elkanii infection in the early stages. Accumulation of H2O2 and salicylic acid (SA) was observed in the roots of BARC-2 inoculated with USDA61. Transcriptome analyses revealed that inoculation of USDA61, but not its T3SS mutant in BARC-2, induced defense-related genes, including those coding for hypersensitive-induced responsive protein, which act in effector-triggered immunity (ETI) in Arabidopsis. These findings suggest that B. elkanii T3SS triggers the SA-mediated ETI-type response in Rj4 soybean, which consequently blocks symbiotic interactions. This study revealed a common molecular mechanism underlying both plant-pathogen and plant-symbiont interactions, and suggests that establishment of a root nodule symbiosis requires the evasion or suppression of plant immune responses triggered by rhizobial effectors. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Fermentation Tecniques and Applications of Bacterial Cellulose: a Review Técnicas de fermentación y aplicaciones de la celulosa bacteriana: una revisión

Directory of Open Access Journals (Sweden)

Luz Dary Carreño Pineda

2012-12-01

Full Text Available Bacterial cellulose is a polymer obtained by fermentation with microorganismsfrom Acetobacter, Rhizobium, Agrobacterium and Sarcina genera. Amongthem, Acetobacter xylinum is the most efficient specie. This polymer hasthe same chemical composition of plant cellulose, but its conformation andphysicochemical properties are different, making it attractive for several applications, especially in the areas of food, separation processes, catalysis andhealth, due to its biocompatibility. However, the main problem is the production in mass that is constrained by low yield. It is therefore necessaryto develop some alternatives. This paper presents a review about synthesis,production, properties and principal applications of bacterial cellulose, as wellas some alternatives to reduce the difficulties for process scaling.La celulosa bacteriana es un polímero obtenido por fermentación con microrganismosde los géneros Acetobacter, Rhizobium, Agrobacterium y Sarcina, delas cuales la especie más eficiente es la Acetobacter Xylinum. Este polímero presenta la misma estructura química de la celulosa de origen vegetal, pero difiereen su conformación y propiedades fisicoquímicas, lo que lo hace atractivo para diversas aplicaciones, especialmente en las áreas de alimentos, procesosde separación, catálisis y en medicina, gracias a su biocompatibilidad. Sin embargo, el principal problema es la producción a gran escala limitada por losbajos rendimientos, lo que genera la necesidad de desarrollar alternativas que permitan disminuir o eliminar las causas de esta limitación. En este artículo se hace una revisión acerca de la síntesis, producción, propiedades y principales aplicaciones de la celulosa bacteriana, así como de algunas alternativas estudiadas para disminuir los inconvenientes en el escalamiento del proceso.

Production and some properties of crude alkaline proteases of indigenous Central Amazonian rhizobia strains

Directory of Open Access Journals (Sweden)

Arlem Nascimento de Oliveira

2010-10-01

Full Text Available Two rhizobia strains isolated from soils of the Central Amazonian floodplain produced appreciable quantities of crude alkaline protease extracts with inexpensive carbon and nitrogen sources. These protease crude extracts were optimally active at pH 9.0-11.0. The optimum temperatures were 35 ºC for Rhizobium sp. strain R-986 and 55 ºC for Bradyrhizobium sp. strain R-993. Protease activities in the crude extracts were enhanced in the presence of 5 mM metal ions, such as Na+, Ca2+, Mg2+ and Mn2+. Rhizobia proteases were strongly inhibited by PMSF, a serine-protease inhibitor. The enzymes were active in the presence of surfactants (SDS and Triton X-100 and stable in oxidizing (H2O2 and reducing agents (β-mercaptoethanol, and organic solvents (acetone, hexane, methanol, 1-propanol and toluene.Duas estirpes de rizóbia isoladas de solos de várzea da Amazônia Central produziram grandes quantidades de proteases alcalinas extracelulares, usando fontes baratas de carbono e nitrogênio. Os extratos brutos de proteases foram ativos em pH 9,0-11,0. As temperaturas ótimas foram de 35 ºC para a enzima do Rhizobium R-986 e de 55 ºC para a do Bradyrhizobium R-993. As atividades proteolíticas aumentaram na presença de 5 mM dos íons Na+, Ca2+ , Mg2+ e Mn2+ . As proteases secretadas pelos rizóbios foram fortemente inibidas por PMSF, um inibidor de serina protease. As enzimas foram ativas na presença de surfactantes (SDS e Triton X-100, e estáveis na presença de agentes oxidantes (H2O2 e redutores (β-mercaptoetanol e solventes orgânicos (acetona, hexano, metanol, 1-propanol e tolueno.

Compatibilidade entre a inoculação de rizóbios e fungicidas aplicados em sementes de feijoeiro-comum

Directory of Open Access Journals (Sweden)

Maurício Rocha Kintschev

2014-12-01

Full Text Available O objetivo do presente estudo foi avaliar os efeitos do tratamento de sementes de feijoeiro com diferentes fungicidas na sobrevivência de estirpe de Rhizobium tropici (SEMIA 4077 e Rhizobium freirei (SEMIA 4080, na nodulação das plantas e na produtividade da cultura. Foram conduzidos dois ensaios em substrato esterilizado, sob condições de casa de vegetação e um ensaio no campo experimental da Embrapa Agropecuária Oeste, em Dourados, MS, num Latossolo Vermelho distroférrico típico. Os fungicidas (princípios ativos utilizados nos ensaios foram: (1 carbendazim + tiram (Produto A; (2 carbendazim + tiram (Produto B; (3 carboxin + tiram; (4 fludioxonil + metalaxil-M; (5 fludioxonil + metalaxil-M + tiabendazol; (6 fluazinam + tiofanato metílico; (7 fipronil + tiofanato metílico + piraclostrobina; (8 clorotalonil + tiofanato metílico. A sobrevivência das estirpes de R. tropici inoculadas nas sementes de feijoeiro foi afetada pela aplicação dos fungicidas, principalmente por aqueles com modo de ação de contato. Observou-se ainda, com a aplicação dos fungicidas, redução na nodulação das plantas de feijoeiro, especialmente da massa nodular, tanto nos ensaios conduzidos em substrato esterilizado, em casa de vegetação, quanto no experimento a campo, onde também observou-se redução na produtividade do feijoeiro pela aplicação da maioria dos fungicidas avaliados. Os fungicidas que mais afetaram o rendimento de grãos foram carbendazim + tiram (Produto B e carboxin + tiram. Os produtos fipronil + tiofanato metílico + piraclostrobina, fludioxonil + metalaxil-M + tiabendazol e fludioxonil + metalaxil-M não afetaram a produtividade da cultura, embora a massa seca de nódulos tenha sido reduzida em todos os ensaios.

Efeito "in vitro" de antibióticos e rizobactérias no controle de bactérias fitopatogênicas ao Eucalyptus spp. "In vitro" effect of antibiotics and rhizobacteria on the control of phytopathogenic bacteria in Eucalyptus spp.

Directory of Open Access Journals (Sweden)

Jeane de Fátima Cunha

2006-12-01

Full Text Available Doenças causadas por bactérias constituem um novo desafio à cultura do Eucalyptus spp., podendo, inclusive, limitar o uso de clones suscetíveis. O presente trabalho objetivou avaliar a eficiência de antibióticos e rizobactérias na inibição do crescimento "in vitro" de isolados de bactérias fitopatogênicas ao Eucalyptus spp. na fase de viveiro e de campo. O antibiótico sulfato de amicacina e a rizobactéria S1 (Bacillus subtillis destacaram-se quanto à inibição do crescimento do isolado fitopatogênico IP1-05 (Pseudomonas chichorii, enquanto a cefoxitina causou maior inibição dos isolados BSV16 e RVV11 (Rhizobium sp.. Os antibióticos de uso comercial na área agronômica, Mycoshield (oxitetraciclina e Agrimicina (estreptomicina e tetraciclina foram pouco efetivos. Este trabalho proporciona embasamento a alternativas para controle biológico de doenças bacterianas em mudas de Eucalyptus spp. na fase de viveiro.Diseases caused by bacteria represent a new challenge for Eucalyptus spp. and may also limit the use of susceptible clones. Our study aimed at an evaluation of the efficiency of antibiotics and rhizobacteria in inhibiting "in vitro" growth of phytopathogenic bacteria isolates in Eucalyptus spp. during the nursery stage and in the field. The antibiotic amicacine sulfate and rhizobacterium S1 (Bacillus subtilis stood out inhibiting the growth of the phytopathogenic isolate IP1-05 (Pseudomonas chichorii, whereas cefoxitin caused a greater inhibition of the isolates BSV16 and RVV11 (Rhizobium sp.. The commercial antibiotics for agricultural use Mycoshield (oxitetracycline and Agrimycin (estreptomycin and tetracycline were little effective. This study offers a base for alternatives of biological control of bacterial diseases in Eucalyptus spp. nursery seedlings.

Some long term effects on land application of sewage sludge on soil fertility

International Nuclear Information System (INIS)

McGrath, S.P.; Chaudri, A.M.; Giller, K.E.

1997-01-01

Metals may affect the growth of plants, soil microbial activity, and soil fertility in the long term. Less is known of the adverse long-term effects of metals on soil microorganisms than on crop yields, since the effects of metals added to soils in sewage sludge are difficult to assess, and few long-term experiments exist. This paper reviews evidence from controlled long-term field experiments with sewage sludges in the UK, Sweden, Germany and the USA. Adverse effects on microbial activity and populations of cyanobacteria (blue-green algae), Rhizobium leguminosarum bv. trifolii, mycorrhiza, and total microbial biomass have been detected, in some cases below the European Community's maximum allowable concentration limits for metals in sludge-treated soils. For example, N 2 -fixation by free- living heterotrophic bacteria was found to be inhibited at concentrations (mg kg -1 ) of 127 Zn, 37 Cu, 21 Ni, 3.4 Cd, 52 Cr and 71 Pb. Fixation by free-living cyanobacteria was reduced by 50% at concentrations (mg kg -1 ) of 114 Zn, 33 Cu, 17 Ni, 2.9 Cd, 80 Cr and 40 Pb. Numbers of Rhizobium Leguminosarum bv. trifolii were decreased by several orders of magnitude at metal concentrations (mg kg -1 ) of 130-200 Zn, 27-48 Cu, 11-15 Ni, and 0.8-1.0 Cd. Important factors influencing the severity of toxicity are soil texture and pH; higher pH and clay and organic C contents decrease metal toxicity considerably. The evidence presented in this review of long-term field experiments suggests that adverse effects on microbial parameters occur at modest concentrations of metals in soils. It is concluded that prevention of adverse effects on soil microbial processes, and ultimately on soil fertility, should be a factor that influences soil-protection legislation. (author)