WorldWideScience

Sample records for rhenium 176

  1. Rhenium

    Science.gov (United States)

    John, David A.; Seal, Robert R.; Polyak, Désirée E.; Schulz, Klaus J.; DeYoung,, John H.; Seal, Robert R.; Bradley, Dwight C.

    2017-12-19

    Rhenium is one of the rarest elements in Earth’s continental crust; its estimated average crustal abundance is less than 1 part per billion. Rhenium is a metal that has an extremely high melting point and a heat-stable crystalline structure. More than 80 percent of the rhenium consumed in the world is used in high-temperature superalloys, especially those used to make turbine blades for jet aircraft engines. Rhenium’s other major application is in platinum-rhenium catalysts used in petroleum refining.Rhenium rarely occurs as a native element or as its own sulfide mineral; most rhenium is present as a substitute for molybdenum in molybdenite. Annual world mine production of rhenium is about 50 metric tons. Nearly all primary rhenium production (that is, rhenium produced by mining rather than through recycling) is as a byproduct of copper mining, and about 80 percent of the rhenium obtained through mining is recovered from the flue dust produced during the roasting of molybdenite concentrates from porphyry copper deposits. Molybdenite in porphyry copper deposits can contain hundreds to several thousand grams per metric ton of rhenium, although the estimated rhenium grades of these deposits range from less than 0.1 gram per metric ton to about 0.6 gram per metric ton.Continental-arc porphyry copper-(molybdenum-gold) deposits supply most of the world’s rhenium production and have large inferred rhenium resources. Porphyry copper mines in Chile account for about 55 percent of the world’s mine production of rhenium; rhenium is also recovered from porphyry copper deposits in the United States, Armenia, Kazakhstan, Mexico, Peru, Russia, and Uzbekistan. Sediment-hosted strata-bound copper deposits in Kazakhstan (of the sandstone type) and in Poland (of the reduced-facies, or Kupferschiefer, type) account for most other rhenium produced by mining. These types of deposits also have large amounts of identified rhenium resources. The future supply of rhenium is likely

  2. Rhenium Re

    International Nuclear Information System (INIS)

    Busev, A.I.; Tiptsova, V.G.; Ivanov, V.M.

    1978-01-01

    The basic methods for determining rhenium in various objects are presented. The gravimetric determination of rhenium is based on a quantitative precipitation of ReO 4 - ions with tetraphenylarsonium chloride. The determination is not hindered by tungstates and molybdates. The potentiometric determination of rhenium in alloys (>=0.5% Re) is based on perrhenate ion reduction to Re(4) with the titrated solution of the Cr(2) salt. Re(7) is titrated in a hot sulfuric acid solution in the presence of KJ. The relative error of the method is 1 to 3%. The photometric determination of rhenium is performed by the rhodamide method in molybdenum-and tungsten-containing alloys and catalytically, in rocks, after it has been separated in the form of sulfide. The extraction-photometric determination of rhenium is carried out with the aid of methyl violet (analysis of a stock with a high content of Mo, W, Ta, Nb, Ti ahd Zr) and thio-oxine (the determination of Re is hindered by Au, Pt, Pd, Ru, Os, Rh, Ir). Also described are methods for differential-spectrophotometric determination of Re with the aid of thiocarbamide, as well as with the aid of dimethylglyoxime in the presence of SnCl 2 in an acid medium when Re is determined in its alloys with niobium and hafnium. It takes 2 hours to analyze the Hf-Re alloy and 3 hours to analyze the Nb-Re alloy, the standard deviation being 0.005 at 30-50% Re and 0.027 to 0.019 at 10-50% Re

  3. Spherical rhenium metal powder

    International Nuclear Information System (INIS)

    Leonhardt, T.; Moore, N.; Hamister, M.

    2001-01-01

    The development of a high-density, spherical rhenium powder (SReP) possessing excellent flow characteristics has enabled the use of advanced processing techniques for the manufacture of rhenium components. The techniques that were investigated were vacuum plasma spraying (VPS), direct-hot isostatic pressing (D-HIP), and various other traditional powder metallurgy processing methods of forming rhenium powder into near-net shaped components. The principal disadvantages of standard rhenium metal powder (RMP) for advanced consolidation applications include: poor flow characteristics; high oxygen content; and low and varying packing densities. SReP will lower costs, reduce processing times, and improve yields when manufacturing powder metallurgy rhenium components. The results of the powder characterization of spherical rhenium powder and the consolidation of the SReP are further discussed. (author)

  4. Rhenium Rocket Manufacturing Technology

    Science.gov (United States)

    1997-01-01

    The NASA Lewis Research Center's On-Board Propulsion Branch has a research and technology program to develop high-temperature (2200 C), iridium-coated rhenium rocket chamber materials for radiation-cooled rockets in satellite propulsion systems. Although successful material demonstrations have gained much industry interest, acceptance of the technology has been hindered by a lack of demonstrated joining technologies and a sparse materials property data base. To alleviate these concerns, we fabricated rhenium to C-103 alloy joints by three methods: explosive bonding, diffusion bonding, and brazing. The joints were tested by simulating their incorporation into a structure by welding and by simulating high-temperature operation. Test results show that the shear strength of the joints degrades with welding and elevated temperature operation but that it is adequate for the application. Rhenium is known to form brittle intermetallics with a number of elements, and this phenomena is suspected to cause the strength degradation. Further bonding tests with a tantalum diffusion barrier between the rhenium and C-103 is planned to prevent the formation of brittle intermetallics.

  5. Rhenium corrosion in chloride melts

    International Nuclear Information System (INIS)

    Stepanov, A.D.; Shkol'nikov, S.N.; Vetyukov, M.M.

    1989-01-01

    The results investigating rhenium corrosion in chloride melts containing sodium, potassium and chromium ions by a gravimetry potentials in argon atmosphere in a sealing quarth cell are described. Rhenium corrosion is shown to be rather considerable in melts containing CrCl 2 . The value of corrosion rate depending on temperature is determined

  6. Rhenium Nanochemistry for Catalyst Preparation

    Directory of Open Access Journals (Sweden)

    Vadim G. Kessler

    2012-08-01

    Full Text Available The review presents synthetic approaches to modern rhenium-based catalysts. Creation of an active center is considered as a process of obtaining a nanoparticle or a molecule, immobilized within a matrix of the substrate. Selective chemical routes to preparation of particles of rhenium alloys, rhenium oxides and the molecules of alkyltrioxorhenium, and their insertion into porous structure of zeolites, ordered mesoporous MCM matrices, anodic mesoporous alumina, and porous transition metal oxides are considered. Structure-property relationships are traced for these catalysts in relation to such processes as alkylation and isomerization, olefin metathesis, selective oxidation of olefins, methanol to formaldehyde conversion, etc.

  7. Work function of carburized rhenium

    International Nuclear Information System (INIS)

    Pallmer, P.G. Jr.; Gordon, R.L.; Dresser, M.J.

    1980-01-01

    Variations of the electronic work function of carburized rhenium foils containing approximately 5 at.% carbon have been observed using the contact potential difference technique. Surface work function was observed to vary between 5.25 and 4.1 eV, with the work function of pure rhenium taken as 5.0 eV. Decrease in work function has been ascribed to the formation of graphitic layers on the surface at temperatures below the temperature of saturated solubility. The high work function surface was observed with all carbon in solution and has been ascribed to the presence of amorphous carbon near the surface

  8. Rhenium-osmium geochemistry: method and applications

    International Nuclear Information System (INIS)

    Luck, J.M.

    1982-03-01

    Experimental methods for chemical separation and isotopic analysis of rhenium-osmium are described. Accurate determinations are obtained for a quantity ratio around 10 -6 -10 -7 g. Development as a geochemical tracer is examined. Study of rhenium-osmium in meteorites allows the determination of solar system chronology and age of the galaxy. Rhenium-osmium chronology in meteorites is improved and osmium isotopes are used as petrogenetic and geological tracers. Molybdenites are studied through 187 Re- 187 Os dating [fr

  9. Rhenium radioisotopes for therapeutic radiopharmaceutical development

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.; Beets, A.L.; Pinkert, J.; Kropp, J.; Lin, W.Y.; Wang, S.Y.

    2001-01-01

    Rhenium-186 and rhenium-188 represent two important radioisotopes which are of interest for a variety of therapeutic applications in oncology, nuclear medicine and interventional cardiology. Rhenium-186 is directly produced in a nuclear reactor and the 90 hour half-life allows distribution to distant sites. The relatively low specific activity of rhenium-186 produced in most reactors, however, permits use of phosphonates, but limits use for labelled peptides and antibodies. Rhenium-188 has a much shorter 16.9 hour half-life which makes distribution from direct reactor production difficult. However, rhenium-188 can be obtained carrier-free from a tungsten-188/rhenium-188 generator, which has a long useful shelf-life of several months which is cost-effective, especially for developing regions. In this paper we discuss the issues associated with the production of rhenium-186- and rhenium-188 and the development and use of various radiopharmaceuticals and devices labelled with these radioisotopes for bone pain palliation, endoradiotherapy of tumours by selective catheterization and tumour therapy using radiolabelled peptides and antibodies, radionuclide synovectomy and the new field of vascular radiation therapy. (author)

  10. Thermophysical measurements on solid and liquid rhenium

    International Nuclear Information System (INIS)

    Pottlacher, G.; Jager, H.; Neger, T.

    1986-01-01

    A fast resistive heating technique was used to measure such thermophysical data of solid and liquid rhenium as enthalpy, specific heat, thermal volume expansion, and electrical resistivity. The measurements are performed with heating rates of slightly more than 10 9 K s -1 up to states of superheated liquid rhenium (7500 K)

  11. Electrochemical behaviour of rhenium-graphite electrode

    International Nuclear Information System (INIS)

    Varypaev, V.N.; Krasikov, V.L.

    1980-01-01

    Electrochemical behaviour of combination electrode from graphite with electrodeposited thin coating of electrolytic rhenium is studied. Solution of 0.5 m NaCl+0.04 m AlCl 3 served as an electrolite. Polarization galvanostatic curves of hydrogen evolution upon electrodes with conditional rhenium thickness of 3.5 and 0.35 μm, 35 and 3.5 nm are obtained. Possibility of preparation of rhenium-graphite cathode with extremely low rhenium consume, electro-chemical properties of which are simu-lar to purely rhenium cathode is shown. Such electrode is characterized with stable in time low cathode potential of hydrogen evolution in chloride electrolyte and during cathode polarization it is not affected by corrosion

  12. Directed light fabrication of rhenium components

    Energy Technology Data Exchange (ETDEWEB)

    Milewski, J.O.; Thoma, D.J.; Lewis, G.K.

    1997-02-01

    Directed Light Fabrication (DLF) is a direct metal deposition process that fuses powder, delivered by gas into the focal zone of a high powered laser beam to form fully dense near-net shaped components. This is accomplished in one step without the use of molds, dies, forming, pressing, sintering or forging equipment. DLF is performed in a high purity inert environment free from the contaminants associated with conventional processing such as oxide and carbon pickup, lubricants, binding agents, cooling or cleaning agents. Applications using rhenium have historically been limited in part by its workability and cost. This study demonstrates the ability to fuse rhenium metal powder, using a DLF machine, into free standing rods and describes the associated parameter study. Microstructural comparisons between DLF deposited rhenium and commercial rhenium sheet product is performed. This research combined with existing DLF technology demonstrates the feasibility of forming complex rhenium, metal shapes directly from powder.

  13. Linkable thiocarbamoylbenzamidines as ligands for bioconjugation of Rhenium and Technetium; Kopplungsfaehige Thiocarbamoylbenzamidine als Liganden zur Biokonjugation von Rhenium und Technetium

    Energy Technology Data Exchange (ETDEWEB)

    Castillo Gomez, Juan Daniel

    2015-04-27

    Bioconjugation reactions with Rhenium and Technetium are of high importance for the development of novel radiopharmaceuticals for nuclear medicine. In this thesis the possibilities for bioconjugation using linkable Thiocarmbamoylbenzamidines as ligands for the complexation of Rhenium and Technetium were examined.

  14. Thiocarbonyl complexes of rhenium. Pt. 1

    International Nuclear Information System (INIS)

    Abram, U.

    1993-01-01

    Novel rhenium complexes with terminal thiocarbonyl groups have been synthesized from ReCl 3 (Me 2 PhP) 3 and sodium diethyldithiocarbamate. mer-(Diethyldithiocarbamato)tris-(dimethylphenylphosphine)(thiocarbonyl)rhenium( I), mer-[Re(CS)(Me 2 PhP) 3 (Et 2 dtc)], and tris(diethyldithiocarbamato)(thiocarbonyl)rhenium(III), [Re(CS)(Et 2 dtc) 3 ] have been studied by infrared and NMR spectroscopy, mass spectrometry and X-ray diffraction. mer-[Re(CS)(Me 2 PhP) 3 (Et 2 dtc)] crystallizes orthorhombic in the space group P na 2 1 with a=1516.1(2), b=2189.8(2) and c=1035.6(1) pm. Structure solution and refinement converged at R=0.042. The coordination geometry is a distorted octahedron. The Re-C bond length is found to be 184(2) pm. [Re(CS)(Et 2 dtc) 3 ] crystallizes monoclinic in the space group P2 1 /c with a=962.2(6), b=1744.0(2), c=1537.4(6) pm and β=96.21(1) . The final R value is 0.028. In the monomeric complex the rhenium atom is seven-coordinate with an approximate pentagonal-bipyramidal coordination sphere and a rhenium-carbon distance of 181(1) pm. (orig.)

  15. Accelerator Production and Separations for High Specific Activity Rhenium-186

    Energy Technology Data Exchange (ETDEWEB)

    Jurisson, Silvia S. [Univ. of Missouri, Columbia, MO (United States); Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2016-04-01

    Tungsten and osmium targets were evaluated for the production of high specific activity rhenium-186. Rhenium-186 has potential applications in radiotherapy for the treatment of a variety of diseases, including targeting with monoclonal antibodies and peptides. Methods were evaluated using tungsten metal, tungsten dioxide, tungsten disulfide and osmium disulfide. Separation of the rhenium-186 produced and recycling of the enriched tungsten-186 and osmium-189 enriched targets were developed.

  16. Thermal conduction and linear expansion of sintered rhenium and tungsten-rhenium alloys at a temperature up to 1000 K

    International Nuclear Information System (INIS)

    Pozdnyak, N.Z.; Belyaev, R.A.; Vavilov, Yu.V.; Vinogradov, Yu.G.; Serykh, G.M.

    1978-01-01

    Preparation technology (by powder metallurgy methods) of sintered rhenium and tungsten-rhenium VR-5, VR-10, and VR-20 alloys is described. Thermal conduction of rhenium and VR-20 alloy has been measured in the temperature range from 300 to 1000 K. The value obtained turned out to be considerably less than those published elsewhere, this testifies to the great thermal contact resistance between the material grains. Also measured is the mean linear expansion coefficient for the mentioned above materials in the same temperature range. Linear expansion increases with rhenium content increase

  17. Rhenium Mechanical Properties and Joining Technology

    Science.gov (United States)

    Reed, Brian D.; Biaglow, James A.

    1996-01-01

    Iridium-coated rhenium (Ir/Re) provides thermal margin for high performance and long life radiation cooled rockets. Two issues that have arisen in the development of flight Ir/Re engines are the sparsity of rhenium (Re) mechanical property data (particularly at high temperatures) required for engineering design, and the inability to directly electron beam weld Re chambers to C103 nozzle skirts. To address these issues, a Re mechanical property database is being established and techniques for creating Re/C103 transition joints are being investigated. This paper discusses the tensile testing results of powder metallurgy Re samples at temperatures from 1370 to 2090 C. Also discussed is the evaluation of Re/C103 transition pieces joined by both, explosive and diffusion bonding. Finally, the evaluation of full size Re transition pieces, joined by inertia welding, as well as explosive and diffusion bonding, is detailed.

  18. Electrodialysis separation of rhenium from silicon

    International Nuclear Information System (INIS)

    Prasolova, O.D.; Borisova, L.V.; Ermakov, A.N.

    1989-01-01

    A method of separation of ruthenium from silicon by electrodialysis with heterogenuos ion-exchange membranes is developed. The effeciency of purification of rhenium from silicon depending on the number of dialyzer chambers, temperature and pH value of the dialyzate is studed. It is found that an addditional fourth chamber between the middle and anolytic ones causes the purification coefficient increase 50 times. It is necessary to cool the dialyzate in order to reduce silicon migration into the anolyte and reverse diffusion of perrhenate-ion from the anolyte into the dialyzate. The optimal pH value of diaizate is 5.5-6. The method developed has been used for separating rhenium from industrial solution of lead production with complex composition

  19. Rhenium carbene complexes and their applications; Rhenium-Carben-Komplexe und ihre Anwendungen

    Energy Technology Data Exchange (ETDEWEB)

    Hille, Claudia Heidi

    2016-01-25

    New pharmaceutically suitable metal complexes play an important role in the development of diagnostic and therapeutic agents for cancer treatment. One option concerning new radiopharmaceuticals, is the application of the rhenium isotopes {sup 186}Re and {sup 188}Re. Therefore, water soluble but at the same time stable complexes, which can be synthesized straightforward, are required. In this thesis, several synthetic pathways to such rhenium complexes bearing Nheterocyclic carbenes are presented and applicability tests of literature known complexes conducted. The selected target structures based on monocarbenes turned out to be inappropriate for use in radiopharmaceutical applications, due to their long reaction times and purification issues. Additionally, sterical and electronical effects of the carbene ligands concerning complex formation have been investigated. Possibilities of functionalization at different positions on the heterocycle as well as hydrophilic wingtips - to achieve a better stability in an aqueous media - have been examined to gain information about chemical and physical properties of the resulting complexes. Furthermore, experiments regarding the coordination of various biscarbene ligands, which provides besides the stable chelatisation additionally the possibility of varying the linking bridge, to rhenium(I/V) precursors, have been performed. Dioxo-bis-(1,1{sup '}-methylene-bis(3,3{sup '}-diisopropylimidazolium-2-ylidene)) rhenium(V )-hexafluorophosphate was synthesized via a transmetalation reaction of the corresponding silver carbene with ReOCl{sub 3}(PPh{sub 3}){sub 2} and silver hexafluorophosphate. This complex provided the basis for the first radiolabeled {sup 188}Rhenium NHC complex later on. An enhancement of the kinetic and thermodynamic stability of potential rhenium biscarbene complexes based on modifications concerning the length and character of the bridging moiety between the chelating NHC rings as well as the nature of

  20. Separation of Rhenium (VII) from Tungsten (VI)

    International Nuclear Information System (INIS)

    Vucina, J.; Lukic, D.; Stoiljkovic, M.; Milosevic, M.; Orlic, M.

    2004-01-01

    Examined were the conditions for an effective separation of tungsten (VI) and rhenium (VII) on alumina if the solution of 0.20 mol dm -3 NaCl, ph=2.6 is used as the aqueous phase. Under the given experimental conditions alumina was found to be much better adsorbent for tungsten than for rhenium. The breakthrough and saturation capacities of alumina at pH=2 are 24 and 78 mg W/g Al 2 O 3 , respectively. With the increase of pH these values decrease. So, at pH=6 they are only 4 and 13 mg W/g Al 2 O 3 respectively. The elution volume for rhenium for the given column dimensions and quantity of the adsorbent is about 16 ml. These results were confirmed by the experiments of the radiological separations. Tungsten-187 remains firmly bound to the alumina. The radionuclide purity of the eluted 186'188 Re at pH=2 is very high. (authors)

  1. Near net shape of powder metallurgy rhenium parts

    International Nuclear Information System (INIS)

    Leonhardt, T.; Downs, J.

    2001-01-01

    In this paper, a description of the stages of processing necessary to produce a near-net shape (NNS) powder metallurgy (PM) rhenium component through the use of cold isostatic pressing (CIP) to form a complex shape will be explained. This method was primarily developed for the production of the 440 N and 490 N liquid apogee engine combustion chambers used in satellite positioning systems. The CIP to NNS process has been used in the manufacture and production of other rhenium aerospace components as well. Cold isostatic pressing (CIP) to a near net shape utilizing a one or two-part mandrel greatly reduces the quantity of rhenium required to produce the component, and also significantly reduces the number of secondary machining operations necessary to complete the manufacturing process. Further, the developments in near-net shape powder metallurgy rhenium manufacturing techniques have generated significant savings in the area of both time and budget. Overall, cost declined by as much as 35 % for the quantity of rhenium chambers, and manufacturing time was decreased by 30-40 %. The quantity of rhenium metal powder used to produce a rhenium chamber was reduced by approximately 70 %, with a subsequent reduction of nearly 50 % in secondary machining operation schedules. Thus, it is apparent that the overall savings provided by the production of near-net shape powder metallurgy rhenium components will be more than merely another aspect of any project involving high temperature applications, it will constitute significant benefit. (author)

  2. Determination of rhenium in molybdenite by neutron-activation analysis.

    Science.gov (United States)

    Terada, K; Yoshimura, Y; Osaki, S; Kiba, T

    1967-01-01

    A neutron-activation method is described for the determination of rhenium in molybdenite. Radiochemical separation by a carrier technique was carried out very rapidly by means of successive liquid-liquid extraction processes. The recovery of rhenium, which was determined by a spectrophotometric method, was about 93%. About 10 samples could be analysed within 6 hr in parallel runs.

  3. Rhenium: a rare metal critical in modern transportation

    Science.gov (United States)

    John, David A.

    2015-01-01

    Rhenium is a silvery-white, metallic element with an extremely high melting point (3,180 degrees Celsius) and a heat-stable crystalline structure, making it exceptionally resistant to heat and wear. Since the late 1980s, rhenium has been critical for superalloys used in turbine blades and in catalysts used to produce lead-free gasoline.

  4. Crystallochemistry of rhenium compounds with metal-metal bonds

    International Nuclear Information System (INIS)

    Koz'min, P.A.; Surazhskaya, M.D.

    1980-01-01

    A review is presented including a brief description of atomic structure of 59 coordination rhenium compounds with metal-metal bond. The most important bond lengths and valent angles are presented for each compound. The dependence of rhenium-rhenium bond length on its multiplicity is discussed and possible causes of deviations from this dependence (namely, axial ligand presence, steric repulsion of ligands) are considered. On the basis of qualitative comparison of electronegativity of ligands in dimer compounds with quarternary bond of rhenium-rhenium a supposition is made on the influence of formal charge of atomic group and summary electro-negativity of ligands on the possibility of the metal-metal bond formation

  5. Near-Net Shape Powder Metallurgy Rhenium Thruster

    Science.gov (United States)

    Leonhardt, Todd; Hamister, Mark; Carlen, Jan C.; Biaglow, James; Reed, Brian

    2001-01-01

    This paper describes the development of a method to produce a near-net shape (NNS) powder metallurgy (PM) rhenium combustion chamber of the size 445 N (100 lbf) used in a high performance liquid apogee engine. These engines are used in low earth Orbit and geostationary orbit for satellite positioning systems. The developments in near-net shape powder metallurgy rhenium combustion chambers reported in this paper will reduce manufacturing cost of the rhenium chambers by 25 percent, and reduce the manufacturing time by 30 to 40 percent. The quantity of rhenium metal powder used to produce a rhenium chamber is reduced by approximately 70 percent and the subsequent reduction in machining schedule and costs is nearly 50 percent.

  6. Electrodeposition of rhenium-tin nanowires

    International Nuclear Information System (INIS)

    Naor-Pomerantz, Adi; Eliaz, Noam; Gileadi, Eliezer

    2011-01-01

    Highlights: → Rhenium-tin nanowires were formed electrochemically, without using a template. → The nanowires consisted of a crystalline-Sn-core/amorphous-Re-shell structure. → The effects of bath composition and operating conditions were investigated. → A mechanism is suggested for the formation of the core/shell structure. → The nanowires may be attractive for a variety of applications. - Abstract: Rhenium (Re) is a refractory metal which exhibits an extraordinary combination of properties. Thus, nanowires and other nanostructures of Re-alloys may possess unique properties resulting from both Re chemistry and the nanometer scale, and become attractive for a variety of applications, such as in catalysis, photovoltaic cells, and microelectronics. Rhenium-tin coatings, consisting of nanowires with a core/shell structure, were electrodeposited on copper substrates under galvanostatic or potentiostatic conditions. The effects of bath composition and operating conditions were investigated, and the chemistry and structure of the coatings were studied by a variety of analytical tools. A Re-content as high as 77 at.% or a Faradaic efficiency as high as 46% were attained. Ranges of Sn-to-Re in the plating bath, applied current density and applied potential, within which the nanowires could be formed, were determined. A mechanism was suggested, according to which Sn nanowires were first grown on top of Sn micro-particles, and then the Sn nanowires reduced the perrhenate chemically, thus forming a core made of crystalline Sn-rich phase, and a shell made of amorphous Re-rich phase. The absence of mutual solubility of Re and Sn may be the driving force for this phase separation.

  7. Highvalent and organometallic technetium and rhenium compounds

    International Nuclear Information System (INIS)

    Oehlke, Elisabeth

    2010-01-01

    Diagnostic methods in nuclear medicine allow a detailed description of morphological organ structures and their function. The beta emitting isotope Tc-99 has optimal physical properties (140 keV gamma rays, half-life 6 h) and is therefore used for radiopharmaceuticals. The thesis is concerned with the search for new technetium complexes and their reproducible production. The (TcO3) core is of main interest. The second part of the thesis deals with organometallic technetium and rhenium complexes with carbonyl ligands and N-heterocyclic carbenes that show stability in aerobic aqueous solutions.

  8. First principles calculations of interstitial and lamellar rhenium nitrides

    Energy Technology Data Exchange (ETDEWEB)

    Soto, G., E-mail: gerardo@cnyn.unam.mx [Universidad Nacional Autonoma de Mexico, Centro de Nanociencias y Nanotecnologia, Km 107 Carretera Tijuana-Ensenada, Ensenada Baja California (Mexico); Tiznado, H.; Reyes, A.; Cruz, W. de la [Universidad Nacional Autonoma de Mexico, Centro de Nanociencias y Nanotecnologia, Km 107 Carretera Tijuana-Ensenada, Ensenada Baja California (Mexico)

    2012-02-15

    Highlights: Black-Right-Pointing-Pointer The possible structures of rhenium nitride as a function of composition are analyzed. Black-Right-Pointing-Pointer The alloying energy is favorable for rhenium nitride in lamellar arrangements. Black-Right-Pointing-Pointer The structures produced by magnetron sputtering are metastable variations. Black-Right-Pointing-Pointer The structures produced by high-pressure high-temperature are stable configurations. Black-Right-Pointing-Pointer The lamellar structures are a new category of interstitial dissolutions. - Abstract: We report here a systematic first principles study of two classes of variable-composition rhenium nitride: i, interstitial rhenium nitride as a solid solution and ii, rhenium nitride in lamellar structures. The compounds in class i are cubic and hexagonal close-packed rhenium phases, with nitrogen in the octahedral and tetrahedral interstices of the metal, and they are formed without changes to the structure, except for slight distortions of the unit cells. In the compounds in class ii, by contrast, the nitrogen inclusion provokes stacking faults in the parent metal structure. These faults create trigonal-prismatic sites where the nitrogen residence is energetically favored. This second class of compounds produces lamellar structures, where the nitrogen lamellas are inserted among multiple rhenium layers. The Re{sub 3}N and Re{sub 2}N phases produced recently by high-temperature and high-pressure synthesis belong to this class. The ratio of the nitrogen layers to the rhenium layers is given by the composition. While the first principle calculations point to higher stability for the lamellar structures as opposed to the interstitial phases, the experimental evidence presented here demonstrates that the interstitial classes are synthesizable by plasma methods. We conclude that rhenium nitrides possess polymorphism and that the two-dimensional lamellar structures might represent an emerging class of materials

  9. First principles calculations of interstitial and lamellar rhenium nitrides

    International Nuclear Information System (INIS)

    Soto, G.; Tiznado, H.; Reyes, A.; Cruz, W. de la

    2012-01-01

    Highlights: ► The possible structures of rhenium nitride as a function of composition are analyzed. ► The alloying energy is favorable for rhenium nitride in lamellar arrangements. ► The structures produced by magnetron sputtering are metastable variations. ► The structures produced by high-pressure high-temperature are stable configurations. ► The lamellar structures are a new category of interstitial dissolutions. - Abstract: We report here a systematic first principles study of two classes of variable-composition rhenium nitride: i, interstitial rhenium nitride as a solid solution and ii, rhenium nitride in lamellar structures. The compounds in class i are cubic and hexagonal close-packed rhenium phases, with nitrogen in the octahedral and tetrahedral interstices of the metal, and they are formed without changes to the structure, except for slight distortions of the unit cells. In the compounds in class ii, by contrast, the nitrogen inclusion provokes stacking faults in the parent metal structure. These faults create trigonal-prismatic sites where the nitrogen residence is energetically favored. This second class of compounds produces lamellar structures, where the nitrogen lamellas are inserted among multiple rhenium layers. The Re 3 N and Re 2 N phases produced recently by high-temperature and high-pressure synthesis belong to this class. The ratio of the nitrogen layers to the rhenium layers is given by the composition. While the first principle calculations point to higher stability for the lamellar structures as opposed to the interstitial phases, the experimental evidence presented here demonstrates that the interstitial classes are synthesizable by plasma methods. We conclude that rhenium nitrides possess polymorphism and that the two-dimensional lamellar structures might represent an emerging class of materials within binary nitride chemistry.

  10. Method of stably radiolabeling antibodies with technetium and rhenium

    International Nuclear Information System (INIS)

    Paik, C.H.; Reba, R.C.; Eckelman, W.C.

    1987-01-01

    A method is described for labeling antibodies or antibody fragments with radionuclides of technetium or rhenium to obtain stable labeling, comprising: reacting a reduced radioisotope of technetium or rhenium with an antibody or antibody fragment, or a diethylenetriaminepentaacetic acid conjugated antibody or antibody fragment, in the presence of free or carrier-bound diethylenetriaminepentaacetic acid (DTPA). The amount of DTPA is sufficient to substantially completely inhibit binding of the reduced technetium or rhenium to nonstable binding sites of the antibody or antibody fragment, or the DTPA-conjugated antibody or antibody fragment. The resultant stably labeled antibody or antibody fragment, or DTPA[conjugated antibody or antibody fragment is recovered

  11. Separation of tungsten and rhenium on alumina

    Directory of Open Access Journals (Sweden)

    MILOVAN SM. STOILJKOVIC

    2004-09-01

    Full Text Available The conditions for the efficient separation of tungsten(VI and rhenium (VII on alumina were established. The distribution coefficients Kd for tungstate and perrhenate anions, as well as the separation factors a (a = KdWO42-/Kd ReO4- were determined using hydrochloric or nitric acid as the aqueous media. A solution of sodium chloride in the pH range 2–6 was also examined. Under all the tested experimental conditions, alumina is a much better adsorbent for tungsten than for rhenium. The obtained results indicated that the best separation of these two elements is achieved when 0.01– 0.1 mol dm-3 HCl or 1.0 mol dm-3 HNO3 are used as the aqueous media. If NaCl is used as the aqueous phase, the best separation is achieved with 0.20 mol dm-3 NaCl, pH 4–6. Under these experimental conditions, the breakthrough and saturation capacities of alumina for tungsten at pH 4 are 17 and 26 mg W/g Al2O3, respectively. With increasing pH, these values decrease. Thus, at pH 6 they are only 4 and 13 mg W/g Al2O3, respectively.

  12. 46 CFR 176.802 - Hull.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Hull. 176.802 Section 176.802 Shipping COAST GUARD... CERTIFICATION Material Inspections § 176.802 Hull. (a) At each initial and subsequent inspection for... ready for inspections of the hull structure and its appurtenances, including the following: (1...

  13. 21 CFR 211.176 - Penicillin contamination.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Penicillin contamination. 211.176 Section 211.176 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Laboratory Controls § 211.176...

  14. 49 CFR 176.162 - Security.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Security. 176.162 Section 176.162 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION... Class 1 (Explosive) Materials Precautions During Loading and Unloading § 176.162 Security. A responsible...

  15. 49 CFR 176.24 - Shipping papers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Shipping papers. 176.24 Section 176.24... Requirements § 176.24 Shipping papers. (a) A person may not accept a hazardous material for transportation or transport a hazardous material by vessel unless that person has received a shipping paper prepared in...

  16. 49 CFR 176.120 - Lightning protection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Lightning protection. 176.120 Section 176.120 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Requirements for Class 1 (Explosive) Materials Stowage § 176.120 Lightning protection. A lightning conductor...

  17. 46 CFR 176.814 - Steering systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Steering systems. 176.814 Section 176.814 Shipping COAST...) INSPECTION AND CERTIFICATION Material Inspections § 176.814 Steering systems. At each initial and subsequent inspection for certification the owner or managing operator shall be prepared to test the steering systems of...

  18. 49 CFR 176.715 - Contamination control.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Contamination control. 176.715 Section 176.715... Requirements for Radioactive Materials § 176.715 Contamination control. Each hold, compartment, or deck area... the removable (non-fixed) radioactive surface contamination is not greater than the limits prescribed...

  19. 46 CFR 176.810 - Fire protection.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire protection. 176.810 Section 176.810 Shipping COAST...) INSPECTION AND CERTIFICATION Material Inspections § 176.810 Fire protection. (a) At each initial and... and have the vessel ready for inspection of its fire protection equipment, including the following: (1...

  20. 46 CFR 160.176-9 - Construction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Construction. 160.176-9 Section 160.176-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Inflatable Lifejackets § 160.176-9 Construction. (a) General...

  1. 46 CFR 160.176-11 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 160.176-11 Section 160.176-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Inflatable Lifejackets § 160.176-11 Performance. (a) General...

  2. 176Lu: Cosmic clock or stellar thermometer

    International Nuclear Information System (INIS)

    Ward, R.A.; Beer, H.; Kaeppeler, F.; Wisshak, K.

    1980-12-01

    We quantitatively examine the various experimental and theoretical aspects of the stellar synthesis of the long-lived ground state of 176 Lu (3.6 x 10 10 y). We discuss the various regimes of stellar temperature and free-neutron density in which either: (i) the internal electromagnetic couplings between 176 Lusup(o) and 176 Lusup(m) (3.68 hours) are sufficiently slow that they may be treated as separate nuclei, or (ii) the internal couplings are rapidly able to establish thermal equilibrium between 176 Lusup(o) and 176 Lusup(m). (orig.)

  3. Development of industrial hydrogenating catalyst on rhenium base

    International Nuclear Information System (INIS)

    Chistyakova, G.A.; Bat', I.I.; Rebrova, V.V.

    1975-01-01

    Processes for forming rhenium catalysts on carbon carrier and their catalytic properties in nitrobenzene (NB) reduction were studied. Application of an ammonia preparation to the carbon surface produced impregnated carbon saturated at room temperature with a water solution of the ammonia preparation, taken in a volume equal to the volumetric capacity of the carbon. With one impregnation, 2% rhenium was taken up. Catalysts containing more than 5% rhenium were obtained by impregnating the carbon with heating and use of more concentrated solutions. Catalysts made in this way and dried at 100 0 C had the composition Re 2 OH/carbon/. The most active catalysts were those reduced at 200-250 0 C; higher temperatures, up to 300-500 0 C, decreased the activity. Study of the catalytic properties of the rhenium catalysts in a liquid phase reduction of NB showed that the specific activity of rhenium depends only slightly on the content of the active component in the catalyst and is close to the specific activity of palladium and considerably exceeds that of nickel. Study of the effect of the NB concentration and hydrogen pressure on the activity and stability of the 5% rhenium catalyst indicated that with NB concentrations from 50 to 10% the process takes place at an essentially constant rate; the order of the reaction was close to zero with an apparent activation energy of about 7000 cal/mole. At pressures of 15-200 atm the yield with the 5% catalyst was proportional to the hydrogen pressure. A big advantage of the rhenium catalysts in the reduction of NB is their high selectivity. With a higher activity than palladium and nickel catalysts, 5% rhenium catalyst produces a high operating capacity in a wide range of contact charges, which has considerable significance for industrial use in contact apparatus of the column type. Comparison of the costs of rhenium catalysts and granular carbon carrier with those of nickel, platinum, and palladium showed that 5% rhenium catalyst can

  4. Neutron activation determination of rhenium in shales shales and molybdenites

    International Nuclear Information System (INIS)

    Zajtsev, E.I.; Radinovich, B.S.

    1977-01-01

    Described is the technique for neutron activation determination of rhenium in shales and molybdenites with its radiochemical extraction separation by methyl-ethyl ketone. The sensitivity of the analysis is 5x10 -7 %. Experimental checking of the developed technique in reference to the analysis of shales and molybdenites was carried out. Estimated is the possibility of application of X-ray gamma-spectrometer to instrumental determination of rhenium in molybdenites

  5. New extraction chromatographic material for rhenium separation

    International Nuclear Information System (INIS)

    Lucanikova, M.; Czech Technical University, Prague; Kucera, J.; Czech Technical University, Prague; Sebesta, F.

    2008-01-01

    Three types of the extraction chromatographic materials, composed from Aliquat R 336 deposited in the polyacrylonitrile (PAN) beads and prepared by different procedures, were compared for extraction of rhenium. The best properties were exhibited when the solid extractant was prepared by impregnation of the ready-made PAN beads. Solid extractant prepared by direct coagulation of the beads from the suspension of Aliquat R 336 in solution of PAN in nitric acid differs only by lower capacity in dynamic conditions. Material prepared from the PAN solution in dimethylsulfoxide was the worst because Aliquat R 336 was washed out from the beads during coagulation of the polymer and the extraction capacity was low. As it is shown, the first two solid extractants are fully comparable with the commercial TEVA Resin. (author)

  6. Determination of rhenium in geologic samples of sandstone-type uranium deposit

    International Nuclear Information System (INIS)

    Li Yanan; Wang Xiuqin; Yin Jinshuang

    1997-01-01

    The thiourea colorimetry method suitable for the determination of samples with rhenium content higher than 5 μg/g is described. The method is characterized by many advantages: stability of analytical results, simplicity and cheapness of reagent, and wide range of analysed samples. The catalytic colorimetry is also applied to determine trace rhenium meeting the demand for comprehensive appraisal of prospecting and exploration, recovery and utilization of rhenium. This method can also be applied to analyse rhenium of other samples

  7. Determination of rhenium in molybdenite by X-ray fluorescence: A combined chemical-spectrometric technique.

    Science.gov (United States)

    Solt, M W; Wahlberg, J S; Myers, A T

    1969-01-01

    Rhenium in molybdenite is separated from molybdenum by distillation of rhenium heptoxide from a perchloric-sulphuric acid mixture. It is concentrated by precipitation of the sulphide and then determined by X-ray fluorescence. From 3 to 1000 microg of rhenium can be measured with a precision generally within 2%. The procedure tolerates larger amounts of molybdenum than the usual colorimetric methods.

  8. Determination of rhenium in molybdenite by X-ray fluorescence. A combined chemical-spectrometric technique

    Science.gov (United States)

    Solt, M.W.; Wahlberg, J.S.; Myers, A.T.

    1969-01-01

    Rhenium in molybdenite is separated from molybdenum by distillation of rhenium heptoxide from a perchloric-sulphuric acid mixture. It is concentrated by precipitation of the sulphide and then determined by X-ray fluorescence. From 3 to 1000 ??g of rhenium can be measured with a precision generally within 2%. The procedure tolerates larger amounts of molybdenum than the usual colorimetric methods. ?? 1969.

  9. Concentration of rhenium from dilute sodium chloride solutions

    Directory of Open Access Journals (Sweden)

    DRAGOLJUB M. LUKIC

    2008-03-01

    Full Text Available The conditions for the desorption of rhenium from the anion exchange resin Dowex 1-x8 by HNO3, HCl, H2SO4 and NaOH were determined. The solution (5.0´10-3 mol dm-3 Re in 0.15 mol dm-3 NaCl was passed through a column containing 0.10 g of the resin. The total sorbed amount of rhenium was 0.20 g/g of the resin. It was then eluted by the corresponding eluent in the concentration range up to about 3.0 mol dm-3. The highest elution efficiency and the most favourable elution profile were found with 3.0 mol dm-3 HNO3. Over 77 % of the sorbed rhenium was found in the first 5 ml of the eluate. Practically all the rhenium was recovered with 20 ml of the acid. Under the given experimental conditions, HCl and H2SO4 were less favourable while NaOH was not applicable, due to very low efficiency of rhenium elution.

  10. 27 CFR 17.6 - Signature authority.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Signature authority. 17.6... PRODUCTS General Provisions § 17.6 Signature authority. No claim, bond, tax return, or other required... other proper notification of signature authority has been filed with the TTB office where the required...

  11. A comparative study of electrochemical and optical properties of rhenium deposited on gold and platinum

    Energy Technology Data Exchange (ETDEWEB)

    Zerbino, Jorge O.; Castro Luna, Ana M.; Martins, M. E. [Consejo Nacional de Investigaciones Cientificas y Tecnicas (CONICET), Buenos Aires (Argentina). Inst. de Investigaciones Fisico-Quimicas, Teoricas y Aplicadas (INIFTA)]. E-mail: mmartins@inifta.unlp.edu.ar; Zinola, Carlos F.; Mendez, Eduardo [Universidad de la Republica, Montevideo (Uruguay). Facultad de Ciencias. Lab. de Electroquimica Fundamental

    2002-08-01

    Rhenium-containing films were grown on gold and platinum after different potentiostatic and potentiodynamic polarizations in the - 0.20 V to 0.70 V range (vs rhe) in aqueous acid perrhenate. Experimental data were obtained using cyclic voltammetry and ellipsometry, from which the thickness and optical indices of the electrodeposited rhenium layer were calculated. Metallic rhenium deposition on gold takes place at potentials within the hydrogen evolution reaction. Rhenium oxide on platinum is formed in the hydrogen adatom potential domain, whereas metallic rhenium is deposited concurrently with the hydrogen adsorption and evolution reactions on the same metal. (author)

  12. A comparative study of electrochemical and optical properties of rhenium deposited on gold and platinum

    Directory of Open Access Journals (Sweden)

    Zerbino Jorge O.

    2002-01-01

    Full Text Available Rhenium-containing films were grown on gold and platinum after different potentiostatic and potentiodynamic polarizations in the - 0.20 V to 0.70 V range (vs rhe in aqueous acid perrhenate. Experimental data were obtained using cyclic voltammetry and ellipsometry, from which the thickness and optical indices of the electrodeposited rhenium layer were calculated. Metallic rhenium deposition on gold takes place at potentials within the hydrogen evolution reaction. Rhenium oxide on platinum is formed in the hydrogen adatom potential domain, whereas metallic rhenium is deposited concurrently with the hydrogen adsorption and evolution reactions on the same metal.

  13. Monoclonal Antibodies Radiolabeling with Rhenium-188 for Radioimmunotherapy

    Science.gov (United States)

    Martini, Petra; Pasquali, Micol

    2017-01-01

    Rhenium-188, obtained from an alumina-based tungsten-188/rhenium-188 generator, is actually considered a useful candidate for labeling biomolecules such as antibodies, antibody fragments, peptides, and DNAs for radiotherapy. There is a widespread interest in the availability of labeling procedures that allow obtaining 188Re-labeled radiopharmaceuticals for various therapeutic applications, in particular for the rhenium attachment to tumor-specific monoclonal antibodies (Mo)Abs for immunotherapy. Different approaches have been developed in order to obtain 188Re-radioimmunoconjugates in high radiochemical purity starting from the generator eluted [188Re]ReO4−. The aim of this paper is to provide a short overview on 188Re-labeled (Mo)Abs, focusing in particular on the radiolabeling methods, quality control of radioimmunoconjugates, and their in vitro stability for radioimmunotherapy (RIT), with particular reference to the most important contributions published in literature in this topic. PMID:28951872

  14. Chalcogenhalide cluster rhenium- and molybdenum complexes

    International Nuclear Information System (INIS)

    Fedin, V.P.; Gubin, S.P.; Mishchenko, A.V.; Fedorov, V.E.

    1984-01-01

    The interaction of rhenium- and molybdenum chalcogenhalides with n-donor ligands (L) is studied. At heating Re 3 X 2 Hal 5 complexes up to 100 deg in DMSO in the L presence obtained are the complexes of the 1-6 composition Re 3 X 2 Hal 5 -x Lx DMSO (X=Se, Hal=Cl, L=Et 3 N(1); X=Se, Hal=Cl, L=Bipy(2); X=Se, Hal=Br, L=Et 3 N(3); X=Se, Hal=Br, L=Bipy(4); X=Te, Hal=Br, L=Et 3 N(5); X=Te, Hal=Br, L=(Me 2 NCH 2 ) 2 (6). In the course of boiling of Mo 3 S 7 Hal 4 with PPh 3 in MeCN the Mo 3 S 7 Hal 4 2PPh 3 complexes (Hal=Cl(7); Br(8)) are obtained. For 1 through 8 complexes the chemical analysis data and IR spectra are given. For 4 and 8 complexes the molecular mass is measured. A possible method of obtaining molecular trinuclear clusters from polymer clusters is discussed

  15. Rhenium-186 direct labelling HIgG

    International Nuclear Information System (INIS)

    Lungu, V.; Mihailescu, G.; Dumitrescu, G.

    2001-01-01

    The aim of this study is to develop and improve existing radiolabelling techniques of peptides and monoclonal antibodies with 186 Re for achievement of potential agents for cancer targeted radiotherapy. There were selected methods and techniques for the direct labelling of intact HIgG by studding chemical and radiochemical processes of -S-S- bridges prereduction, reduction of 186 ReO 4 - and coupling reaction of rhenium with HIgG. The -S-S- bridges prereduction of HIgG to sulfhydryls was effected using different reducing agents: ascorbic acid, 2,3 dimercaptopropanol, cysteine, active hydrogen. The prereduction reactions are controlled by masic ratios of HIgG/reduction agent, pH, temperature and time of incubation. A pH=4.5 and a 24 hours incubation time are in the advantage of the prereduction yield. The labelling with 186 Re of prereduced HIgG with ascorbic acid or active hydrogen and 37 deg. C incubation in 22 hours releases 92% radiochemical purity. (author)

  16. Epitaxial growth of rhenium with sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Seongshik [National Institute of Standards and Technology, Boulder, CO 80305 (United States) and Department of Physics, University of Illinois, Urbana, IL 61801 (United States)]. E-mail: soh@boulder.nist.gov; Hite, Dustin A. [National Institute of Standards and Technology, Boulder, CO 80305 (United States); Cicak, K. [National Institute of Standards and Technology, Boulder, CO 80305 (United States); Osborn, Kevin D. [National Institute of Standards and Technology, Boulder, CO 80305 (United States); Simmonds, Raymond W. [National Institute of Standards and Technology, Boulder, CO 80305 (United States); McDermott, Robert [University of California, Santa Barbara, CA 93106 (United States); Cooper, Ken B. [University of California, Santa Barbara, CA 93106 (United States); Steffen, Matthias [University of California, Santa Barbara, CA 93106 (United States); Martinis, John M. [University of California, Santa Barbara, CA 93106 (United States); Pappas, David P. [National Institute of Standards and Technology, Boulder, CO 80305 (United States)

    2006-02-21

    We have grown epitaxial Rhenium (Re) (0001) films on {alpha}-Al{sub 2}O{sub 3} (0001) substrates using sputter deposition in an ultra high vacuum system. We find that better epitaxy is achieved with DC rather than with RF sputtering. With DC sputtering, epitaxy is obtained with the substrate temperatures above 700 deg. C and deposition rates below 0.1 nm/s. The epitaxial Re films are typically composed of terraced hexagonal islands with screw dislocations, and island size gets larger with high temperature post-deposition annealing. The growth starts in a three dimensional mode but transforms into two dimensional mode as the film gets thicker. With a thin ({approx}2 nm) seed layer deposited at room temperature and annealed at a high temperature, the initial three dimensional growth can be suppressed. This results in larger islands when a thick film is grown at 850 deg. C on the seed layer. We also find that when a room temperature deposited Re film is annealed to higher temperatures, epitaxial features start to show up above {approx}600 deg. C, but the film tends to be disordered.

  17. Superhard Rhenium/Tungsten Diboride Solid Solutions.

    Science.gov (United States)

    Lech, Andrew T; Turner, Christopher L; Lei, Jialin; Mohammadi, Reza; Tolbert, Sarah H; Kaner, Richard B

    2016-11-02

    Rhenium diboride (ReB 2 ), containing corrugated layers of covalently bonded boron, is a superhard metallic compound with a microhardness reaching as high as 40.5 GPa (under an applied load of 0.49 N). Tungsten diboride (WB 2 ), which takes a structural hybrid between that of ReB 2 and AlB 2 , where half of the boron layers are planar (as in AlB 2 ) and half are corrugated (as in ReB 2 ), has been shown not to be superhard. Here, we demonstrate that the ReB 2 -type structure can be maintained for solid solutions of tungsten in ReB 2 with tungsten content up to a surprisingly large limit of nearly 50 atom %. The lattice parameters for the solid solutions linearly increase along both the a- and c-axes with increasing tungsten content, as evaluated by powder X-ray and neutron diffraction. From micro- and nanoindentation hardness testing, all of the compositions within the range of 0-48 atom % W are superhard, and the bulk modulus of the 48 atom % solid solution is nearly identical to that of pure ReB 2 . These results further indicate that ReB 2 -structured compounds are superhard, as has been predicted from first-principles calculations, and may warrant further studies into additional solid solutions or ternary compounds taking this structure type.

  18. Mechanistic Study of Oxygen Atom Transfer Catalyzed by Rhenium Compounds

    Energy Technology Data Exchange (ETDEWEB)

    Shan, Xiaopeng [Iowa State Univ., Ames, IA (United States)

    2003-01-01

    Two ionic and one neutral methyl(oxo)rhenium(V) compounds were synthesized and structurally characterized. They were compared in reactivity towards the ligands triphenylphosphane, pyridines, pyridine N-oxides. Assistance from Broensted bases was found on ligand displacement of ionic rhenium compounds as well as nucleophile assistance on oxidation of all compounds. From the kinetic data, crystal structures, and an analysis of the intermediates, a structural formula of PicH+3- and mechanisms of ligand displacement and oxidation were proposed.

  19. Effect of Temperature and Mole Ratio on the Synthesis Yield of Rhenium-Tetrofosmin

    Directory of Open Access Journals (Sweden)

    Widyastuti

    2015-08-01

    Full Text Available Technetium-99m (99mTc tetrofosmin is widely used in nuclear medicine as a diagnostic agent for myocardial perfusion and as a tumor imaging agent. As a parenteral preparation it requires an evaluation of its pharmacokinetics and stability in-vivo. Since 99mTc has a short half-life and is only available in very low concentrations, it is impossible to characterize its chemical properties and presence in the body. Due to this reason, only technetium-99 (T1/2 = 5 × 105 years, which is available in macro quantities, or natural rhenium can be used for this purpose. In this study rhenium-188 (188Re tetrofosmin will be synthesized and applied, because non-radioactive Re can be easily obtained. Synthesis and radiochemical purity analysis of carrier-added 188Re-tetrofosmin were carried out as a model to study the in-vivo stability of technetium-99m tetrofosmin. Rhenium-188 was used as a tracer to identify the formation of rhenium tetrofosmin. Rhenium gluconate was synthesized first prior to the formation of rhenium tetrofosmin. The quality of labeling for both rhenium gluconate and rhenium tetrofosmin was analyzed using paper- and thin-layer chromatography, respectively. Rhenium gluconate can be synthesized with high labeling yield within 1 hour, whereas rhenium tetrofosmin was synthesized both in room temperature and in an elevated temperature with various tetrofosmin-to-rhenium mole ratios.The results showed that heating at 95oC led to a higher yield of more than 90% within 30 minutes. Rhenium tetrofosmin could be produced in high radiochemical purity using an excess of tetrofosmin with mole ratio of 2000. It is concluded that rhenium tetrofosmin could be synthesized through the formation of rhenium gluconate, and a higher yield could be obtained in a shorter time by heating process.

  20. Electrocatalysis of the hydrogen evolution reaction by rhenium oxides electrodeposited by pulsed-current

    International Nuclear Information System (INIS)

    Vargas-Uscategui, Alejandro; Mosquera, Edgar; Chornik, Boris; Cifuentes, Luis

    2015-01-01

    Highlights: • Rhenium oxides were produced by means of pulsed current electrodeposition over ITO. • The electrocatalytic behavior of rhenium oxides electrodeposited over ITO was studied. • Electrodeposited rhenium oxides showed electrocatalytic behavior increasing the rate of the hydrogen evolution reaction. • The electrocatalysis behavior was explained considering the relative abundance of Re species on the surface of the electrodeposited material. - Abstract: Rhenium oxides are materials of interest for applications in the catalysis of reactions such as those occurring in fuel cells and photoelectrochemical cells. This research work was devoted to the production of rhenium oxide by means of pulsed current electrodeposition for the electrocatalysis of the hydrogen evolution reaction (HER). Rhenium oxides were electrodeposited over a transparent conductive oxide substrate (Indium Tin-doped Oxide – ITO) in an alkaline aqueous electrolyte. The electrodeposition process allowed the production of rhenium oxides islands (200–600 nm) with the presence of three oxidized rhenium species: Re"I"V associated to ReO_2, Re"V"I associated to ReO_3 and Re"V"I"I associated to H(ReO_4)H_2O. Electrodeposited rhenium oxides showed electrocatalytic behavior over the HER and an increase of one order of magnitude of the exchange current density was observed compared to the reaction taking place on the bare substrate. The electrocatalytic behavior varied with the morphology and relative abundance of oxidized rhenium species in the electrodeposits. Finally, two mechanisms of electrocatalysis were proposed to explain experimental results.

  1. Extraction of rhenium(VII) by phosphorylated podands

    International Nuclear Information System (INIS)

    Turanov, A.N.; Karandashev, V.K.; Baulin, V.E.

    2006-01-01

    Interphase distribution of ReO 4 - between aqueous solutions of H 2 SO 4 and solutions of phosphoryl-containing podands in organic solvents is studied. Stoichiometry of the complexes extracted is determined. Effect of extractant structure and nature of organic solvent on efficiency of rhenium extraction into organic phase is determined [ru

  2. Rhenium 188 labelling of peptide conjugates

    International Nuclear Information System (INIS)

    Melendez-Alafort, Laura

    2001-01-01

    Many human tumours express high levels, of somatostatin receptors. In order to make possible a radiotherapeutic treatment of this kind for tumour a series of somatostatin analogues that can tightly chelate beta emitting isotopes have been developed in recent years. The work carried out for this thesis has been aimed towards development of a new therapeutic radiopharmaceutical for treatment of somatostatin receptor positive tumours. The first chapters describe work with technetium-99m to establish the labelling and analytical conditions for a somatostatin analogue, [Tyr 3 ]-octreotide (TOC), as a precursor to undertaking labelling studies with the beta emitter rhenium-188. 6-Hydrazinopyridine-3-carboxylic acid (HYNIC) was conjugated to TOC and labelled with 99m using different coligands. Then the stability, receptor binding and biodistribution of each complex were assessed. 99m Tc-HYNIC-TOC using EDDA as coligand showed the best characteristics, and was superior for tumour imaging in humans than the commercially available 111 In-DTPA-octreotide. The conditions for labelling the HYNIC-TOC conjugate with 188 Re were then optimised using tricine as a co-ligand. A labelling yield of ∼80% was achieved. After purification however, the stability of the complex was low. The use of other coligand systems which had proved useful for 99m Tc labelling was explored, but yields were very poor. Other chelators such as diethylenetriamine pentaacetic acid (DTPA), dimercaptosuccinic acid (DMSA) and mercaptoacetyltriglycine (MAG 3 ) were studied as potential co-ligand agents to label the HYNIC-TOC conjugate with 188 Re but, again low yields of the labelled peptide complexes were achieved. A novel 188 Re-HYNIC complex was prepared in high yields using N-N-disubstituted dithiocarbamates as coligands. However to date, the specific activities achieved with this system are relatively low. The use of the [ 99m Tc(CO) 3 (H 2 O) 3 ] complex to label the HYNIC-TOC conjugate was investigated

  3. The kinetics of anodic dissolution of rhenium in aqueous electrolyte solutions

    International Nuclear Information System (INIS)

    Atanasyants, A.G.; Kornienko, V.A.

    1986-01-01

    The kinetics of anodic rhenium dissolution was investigated by means of potentiodynamic and potentiostatic polarization curves recorded at temperature from 293 to 333 K in different media (NaOH, KOH, NaCl, NaBr, HCl, H 2 SO 4 ) using the rotating disc technique. It is shown that the kinetics of anodic rhenium dissolution and effective activation energy depend not only on the composition and pH value of the solutions but also on the structure of the dissolving rhenium surface. The investigation of the anodic behaviour of the rhenium monocrystal revealed the existence of anisotropy of the monocrystal electrochemical properties. The experimental results point to an important role of adsorption processes in anodic rhenium dissolution. Rhenium dissolution proceeds with formation of intermediate surface adsorption complexes between the metal and the components of the solution

  4. Determination of rhenium in ores of complex composition by the kinetic method

    Energy Technology Data Exchange (ETDEWEB)

    Pavlova, L G; Gurkina, T V [Kazakhskij Gosudarstvennyj Univ., Alma-Ata (USSR); Tsentral' naya Lab. Yuzhno-Kazakhstanskogo Geologicheskogo Upravleniya, Alma-Ata (USSR))

    1979-09-01

    The kinetic rhenium determination method is proposed based on rhenium catalytic effect in the reaction of malachite green with thiourea. The accompanying elements, excluding molybdenum, do not interfere with the rhenium determination at their concentration of up to 0.1 M. The interfering influence of molybdenum can be eliminated by addition of tartaric acid to the solution up to the concentration of 0.1 M. This enables to determine rhenium in presence of 1000-fold quantity of molybdenum. The method is applicable for the analysis of complex copper-zinc sulphide ores.

  5. Treatment of liver cancer with Rhenium-188 Lipiodol: Colombian experience

    International Nuclear Information System (INIS)

    Bernal, P.; Osorio, M.; Mendoza, M.; Esguerra, R.; Ucros, G.; Gutierrez, C.; Velez, O.; Cerquera, A.M.; Padhy, A.K.

    2002-01-01

    Aim:Trans-arterial Radio-conjugate therapy plays an important role in the palliative treatment of inoperable liver cancer. It also helps in reduction of the tumor to an operable state from an inoperable one. As a part of an IAEA sponsored coordinated research project, a new radiopharmaceutical, Rhenium-188 Lipiodol has been developed. The aim of this study was to establish the safety of the radiopharmaceutical and to find out the efficacy of treatment. Materials and Methods: Eight patients suffering from various forms of liver cancer (Hepatocellular carcinoma-4, Metastases from carcinoma of colon-3 and Carcinoid- 1) were treated with Rhenium -188 Lipiodol. Seven out of the eight patients were classified as ECOG- 1 and one as ECOG- 3. Labelling of Rhenium-188 with Lipiodol was carried out according to a protocol developed under the CRP and standardized in our service. Rhenium-188 Lipiodol was administered through the trans-arterial route by either selective (75%) or ultra selective (25%) hepatic arteriography. Administered therapeutic doses ranged between 170 MBq and 4181 MBq. Dosimetric evaluations were made using the IAEA developed dosimetry spreadsheet. All patients were followed up (1-5 months, average = 2 months) after treatment by clinical examination, liver function tests, haematological examinations and CT scans of liver to determine the size of hepatic tumor. Results: Rhenium-188 Lipiodol treatment was well tolerated by all patients. No immediate systemic complications were noted in any of the patients within 72 hrs. following therapy. Only two patients had mild rise in temperature in the immediate post-therapy period, which subsided subsequently. One patient who was classified as Child B and ECOG 3, developed encephalopathy on the seventh day after treatment. He died of hepatic failure. Another one present depressive syndrome, didn't accept food and died Follow-up CT scans in all the surviving (6/8) patients revealed significant reduction of the tumours

  6. 49 CFR 176.133 - Magazine stowage Type C.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Magazine stowage Type C. 176.133 Section 176.133... Requirements for Class 1 (Explosive) Materials Stowage § 176.133 Magazine stowage Type C. The construction requirements for magazine stowage type C are the same as for a closed cargo transport unit in § 176.63(e). In...

  7. THERMIONIC EMISSION ENHANCEMENT FROM CESIUM COATED RHENIUM IN ELECTRIC FIELDS

    Energy Technology Data Exchange (ETDEWEB)

    de Steese, J. G.; Zollweg, R. J.

    1963-04-15

    The plasma-anode technique was used to observe anomalously high thermionic emission from a rhenium surface with small cesium coverage, where the work function of the composite surface is greater than the ionization potential of cesium. Data suggest that emission enhancement is caused by increased cesium coverage because of cesiumion trapping near the emitter surface under the influence of an ion-rich sheath. (auth)

  8. Molecular Engineering of Technetium and Rhenium Based Radiopharmaceuticals

    International Nuclear Information System (INIS)

    Zubieta, J.

    2003-01-01

    The research was based on the observation that despite the extraordinarily rich coordination chemistry of technetium and rhenium and several notable successes in reagent design, the extensive investigations by numerous research groups on a variety of N 2 S 2 and N 3 S donor type ligands and on HYNIC have revealed that the chemistries of these ligands with Tc and Re are rather complex, giving rise to considerable difficulties in the development of reliable procedures for the development of radiopharmaceutical reagents

  9. 46 CFR 160.176-23 - Marking.

    Science.gov (United States)

    2010-10-01

    ... of the vessel. (2) The type of vessel. (3) Specific purpose or limitation approved by the Coast Guard...: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Inflatable Lifejackets § 160.176-23 Marking. (a) General. Each inflatable lifejacket must be marked with the information required by this section. Each marking must be...

  10. Manufacture and properties of molybdenum-rhenium alloys

    International Nuclear Information System (INIS)

    Fischer, B.; Freund, D.

    2001-01-01

    It is necessary to measure strength and creep behavior to guarantee the safe and reliable usage of refractory alloys at extremely high temperatures. In the literature there is very little information available about the properties of Mo-Re alloys at temperatures higher than 1000 C. A special test facility has been designed and built for stress-rupture testing at very high temperatures (up to 3000 C) of refractory metals and alloys in inert atmospheres. - The stress-rupture strength as well as the creep behavior of molybdenum-rhenium alloys with rhenium contents between 41 and 51 wt.% have been determined at temperatures ranging from 1200 to 2000 C, and rupture times of up to 10 hours using this facility. Previous measurements of stress-rupture strength and creep behavior of pure rhenium have been compared with the measurement results of Mo-Re alloys. - The discussion of the values measured is based on metallographic test results and scanning electron microscopy (SEM) images of Mo-Re alloy samples after stress-rupture testing. (orig.) [de

  11. Effect of rhenium addition on tungsten fuzz formation in helium plasmas

    NARCIS (Netherlands)

    Khan, A.; De Temmerman, G.; Morgan, T. W.; M. B. Ward,

    2016-01-01

    The effect of the addition of rhenium to tungsten on the formation of a nanostructure referred to as ‘fuzz’ when exposed to helium plasmas at fusion relevant ion fluxes was investigated in the Magnum and Pilot PSI devices at the FOM Institute DIFFER. The effect rhenium had on fuzz growth was seen to

  12. Synthesis and study of rhenium (5) complexes with benzimidazole and rubeanic acid

    International Nuclear Information System (INIS)

    Basitova, S.M.; Yurina, R.D.; Kotegov, K.V.; Amindzhanov, A.A.

    1986-01-01

    Mixed rhenium (5) oxohalide complex compounds with benzimidazole and rubeanic acid are synthesized. Composition of the compounds obtained is established by IR spectroscpy thermal and chemical analyses. It is shown that rhenium (5) chloride compound stability to pyrolysis is rather lower than that of the corresponding bromide derivatives

  13. Synthesis and study of rhenium (5) complexes with benzimidazole and rubeanic acid

    Energy Technology Data Exchange (ETDEWEB)

    Basitova, S M; Yurina, R D; Kotegov, K V; Amindzhanov, A A

    1986-01-01

    Mixed rhenium (5) oxohalide complex compounds with benzimidazole and rubeanic acid are synthesized. Composition of the compounds obtained is established by IR spectroscpy thermal and chemical analyses. It is shown that rhenium (5) chloride compound stability to pyrolysis is rather lower than that of the corresponding bromide derivatives.

  14. Effect of rhenium addition on tungsten fuzz formation in helium plasmas

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Aneeqa, E-mail: aneeqa.khan-3@postgrad.manchester.ac.uk [School of Mechanical, Aerospace and Civil Engineering, The University of Manchester, M13 9PL (United Kingdom); De Temmerman, Gregory [ITER Organization, Route de Vinon-sur-Verdon, CS 90 046 - 13067 St Paul Lez Durance Cedex (France); Morgan, Thomas W. [FOM Institute DIFFER – Dutch Institute for Fundamental Energy Research, Partner in the Trilateral Euregio Cluster, Eindhoven (Netherlands); Ward, Michael B. [Institute for Materials Research, School of Chemical Process Engineering, University of Leeds, Leeds, LS2 9JT (United Kingdom)

    2016-06-15

    The effect of the addition of rhenium to tungsten on the formation of a nanostructure referred to as ‘fuzz’ when exposed to helium plasmas at fusion relevant ion fluxes was investigated in the Magnum and Pilot PSI devices at the FOM Institute DIFFER. The effect rhenium had on fuzz growth was seen to be dependent on time, temperature and flux. Initial fuzz growth was seen to be highly dependent on grain orientation, with rhenium having little effect. Once the fuzz was fully developed, the effect of grain orientation disappeared and the rhenium had an inhibiting effect on growth. This could be beneficial for inhibiting fuzz growth in a future fusion reactor, where transmutation of tungsten to rhenium is expected. It also appears that erosion or annealing of the fuzz is limiting growth of fuzz at higher temperatures in the range of ∼1340 °C.

  15. Effect of rhenium addition on tungsten fuzz formation in helium plasmas

    International Nuclear Information System (INIS)

    Khan, Aneeqa; De Temmerman, Gregory; Morgan, Thomas W.; Ward, Michael B.

    2016-01-01

    The effect of the addition of rhenium to tungsten on the formation of a nanostructure referred to as ‘fuzz’ when exposed to helium plasmas at fusion relevant ion fluxes was investigated in the Magnum and Pilot PSI devices at the FOM Institute DIFFER. The effect rhenium had on fuzz growth was seen to be dependent on time, temperature and flux. Initial fuzz growth was seen to be highly dependent on grain orientation, with rhenium having little effect. Once the fuzz was fully developed, the effect of grain orientation disappeared and the rhenium had an inhibiting effect on growth. This could be beneficial for inhibiting fuzz growth in a future fusion reactor, where transmutation of tungsten to rhenium is expected. It also appears that erosion or annealing of the fuzz is limiting growth of fuzz at higher temperatures in the range of ∼1340 °C.

  16. 27 CFR 20.176 - Packaging by a dealer.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Packaging by a dealer. 20.176 Section 20.176 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... and Users of Specially Denatured Spirits Operations by Dealers § 20.176 Packaging by a dealer. A...

  17. 21 CFR 176.320 - Sodium nitrate-urea complex.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium nitrate-urea complex. 176.320 Section 176... Substances for Use Only as Components of Paper and Paperboard § 176.320 Sodium nitrate-urea complex. Sodium nitrate-urea complex may be safely used as a component of articles intended for use in producing...

  18. 46 CFR 176.812 - Pressure vessels and boilers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Pressure vessels and boilers. 176.812 Section 176.812... TONS) INSPECTION AND CERTIFICATION Material Inspections § 176.812 Pressure vessels and boilers. (a.... (b) Periodic inspection and testing requirements for boilers are contained in § 61.05 in subchapter F...

  19. 46 CFR 176.655 - Hull examination reports.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Hull examination reports. 176.655 Section 176.655... TONS) INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 176.655 Hull examination reports. (a) If you use only divers for the underwater survey portion of the Alternative Hull Examination (AHE...

  20. 49 CFR 176.130 - Magazine stowage Type A.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Magazine stowage Type A. 176.130 Section 176.130... Requirements for Class 1 (Explosive) Materials Stowage § 176.130 Magazine stowage Type A. (a) In addition to protecting the Class 1 (explosive) materials and preventing unauthorized access, magazine stowage type A...

  1. 46 CFR 176.910 - Passenger Ship Safety Certificate.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Passenger Ship Safety Certificate. 176.910 Section 176... 100 GROSS TONS) INSPECTION AND CERTIFICATION International Convention for Safety of Life at Sea, 1974, as Amended (SOLAS) § 176.910 Passenger Ship Safety Certificate. (a) A vessel, which carries more than...

  2. 46 CFR 176.675 - Extension of examination intervals.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Extension of examination intervals. 176.675 Section 176... 100 GROSS TONS) INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 176.675 Extension of examination intervals. The intervals between drydock examinations and internal structural examinations...

  3. 13 CFR 120.176 - Compliance with other laws.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Compliance with other laws. 120.176 Section 120.176 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Policies Applying to All Business Loans Requirements Imposed Under Other Laws and Orders § 120.176...

  4. 9 CFR 381.176 - Place of maintenance of records.

    Science.gov (United States)

    2010-01-01

    ....176 Section 381.176 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF....176 Place of maintenance of records. Every person engaged in any business described in § 381.175(a) shall maintain the records required by § 381.175 at the place of business where such business is...

  5. 46 CFR 160.176-21 - User manuals.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false User manuals. 160.176-21 Section 160.176-21 Shipping...: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Inflatable Lifejackets § 160.176-21 User manuals. (a) The manufacturer must develop a user's manual for each model of inflatable lifejacket. The content of the manual...

  6. 21 CFR 176.350 - Tamarind seed kernel powder.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Tamarind seed kernel powder. 176.350 Section 176... Substances for Use Only as Components of Paper and Paperboard § 176.350 Tamarind seed kernel powder. Tamarind seed kernel powder may be safely used as a component of articles intended for use in producing...

  7. 49 CFR 176.96 - Materials of construction.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Materials of construction. 176.96 Section 176.96 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Requirements for Barges § 176.96 Materials of construction. Barges used to transport hazardous materials must...

  8. Rhenium(V) complexes with sulfur-containing amino acids

    International Nuclear Information System (INIS)

    Gagieva, S.Ch.; Tautieva, M.A.; Tsaloev, A.T.; Galimov, Yu.B.; Gagieva, L.Ch.; Belyaeva, T.N.

    2007-01-01

    Rhenium(V) complexes with 2-amino-4-(methylthio)butanoic acid (methionine, Met) and 2-amino-3-sulfopropionic acid (cysteine, Cys) have been synthesized. Depending on the initial reagent ratio, the resulting complexes contain one or two ligand molecules. On heating the compounds with one amino acid molecule, two hydrogen halide molecules are removed at 128-132 deg C to form a molecular complex. The composition, structure, and thermal stability of the complexes have been studied by elemental analysis, conductometry, IR spectroscopy, NMR, and mass spectrometry [ru

  9. Synthesis and physicochemical characterization of rhenium (V) complexes with bisbenzoylthiosemicarbazones

    International Nuclear Information System (INIS)

    Gagieva, S.Ch.; Gutnova, N.A.; Tsaloev, A.T.; Khubulov, A.B.; Arutyunyants, A.A.; Galimov, Yu.B.

    2003-01-01

    Rhenium (V) complexing with mono- and bis-benzoylthiosemicarbazones is studied in dependence on hydrohalic acids concentration changes. It is determined that in media with high concentration of hydrohalic acids (6 mol/l HCl, 7 mol/l HBr) in dependence on reaction conditions stable complexes with bi- and tridentate coordination of thiosemicarbazone are formed. In the case of hydrohalic acid concentration decreasing stable binuclear and oxohydroxycomplexes are formed. Composition and structure of the compounds obtained are determined by the methods of element analysis, IR spectroscopy, conductometry. Thermal investigations of the compounds obtained are done [ru

  10. Cermets based on rhenium and rare earth element oxides

    International Nuclear Information System (INIS)

    Varfolomeev, M.B.; Velichko, A.V.; Zajtseva, L.L.; Shishkov, N.V.

    1977-01-01

    The reduction of perrhenates of rare earth elements and of yttrium by hydrogen and the subsequent sintering have yielded cermets based on rhenium and rare earth element oxides inherent in which are more disperse and homogeneous structures than those of the ''molecular'' rare earth element-Tc cermets. The dispersity of cermets increases in the rare earth elements series from La to Lu. The microhardness of the Re phase in cermets is 490 kgf/mm 2 ; the total microhardness of a cermet is substantially higher

  11. Liquid kit for preparation of {sup 188}rhenium-etidronate

    Energy Technology Data Exchange (ETDEWEB)

    Marczewski, Barbara; Dias, Carla Roberta; Moraes, Vanessa; Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Centro de Radiofarmacia]. E-mail: baszot@gmail.com

    2005-10-15

    The aim of this study was the preparation of a liquid kit for radiolabeling of {sup 188} Re-HEDP (hydroxyethylidene diphosphonate). {sup 188} Re was obtained from alumina based {sup 188} W/{sup 188} Re generators. This paper reports the efficacy of a cold kit stored for more than two weeks, determined by the dependence of the radiolabeling yields of {sup 188} Re-HEDP on the incubation time, reducing agent concentration, the effects of concentration of ligand, the p H of the reaction and the temperature. The cold kits showed a good stability when carrie-free rhenium-188 was added in the reaction mixture. (author)

  12. Liquid kit for preparation of 188rhenium-etidronate

    International Nuclear Information System (INIS)

    Marczewski, Barbara; Dias, Carla Roberta; Moraes, Vanessa; Osso Junior, Joao Alberto

    2005-01-01

    The aim of this study was the preparation of a liquid kit for radiolabeling of 188 Re-HEDP (hydroxyethylidene diphosphonate). 188 Re was obtained from alumina based 188 W/ 188 Re generators. This paper reports the efficacy of a cold kit stored for more than two weeks, determined by the dependence of the radiolabeling yields of 188 Re-HEDP on the incubation time, reducing agent concentration, the effects of concentration of ligand, the p H of the reaction and the temperature. The cold kits showed a good stability when carrie-free rhenium-188 was added in the reaction mixture. (author)

  13. Rhenium(V) complexing with benzimidazole in acidic media

    International Nuclear Information System (INIS)

    Zakaeva, R.Sh.; Gagieva, S.Ch.; Kaloev, N.I.; Bukov, N.N.; Panyushkin, V.T.

    2003-01-01

    Coordination compounds of rhenium(V) with 1H-benzimidazole (L) separated from acid media: (HL) 2 [ReOX 5 ](H 2 O) n and [ReOL x X y (H 2 O) z ](H 2 O) n (HL and L - protonated and deprotonated forms of benzimidazole; X = Cl - , Br - ) were studied by the methods of IR spectroscopy, 1 H NMR spectroscopy and thermal gravimetric analysis. Methods of ligand coordination in the complexes are discussed on the basis of data obtained [ru

  14. Clustering of transmutation elements tantalum, rhenium and osmium in tungsten in a fusion environment

    Science.gov (United States)

    You, Yu-Wei; Kong, Xiang-Shan; Wu, Xuebang; Liu, C. S.; Fang, Q. F.; Chen, J. L.; Luo, G.-N.

    2017-08-01

    The formation of transmutation solute-rich precipitates has been reported to seriously degrade the mechanical properties of tungsten in a fusion environment. However, the underlying mechanisms controlling the formation of the precipitates are still unknown. In this study, first-principles calculations are therefore performed to systemically determine the stable structures and binding energies of solute clusters in tungsten consisting of tantalum, rhenium and osmium atoms as well as irradiation-induced vacancies. These clusters are known to act as precursors for the formation of precipitates. We find that osmium can easily segregate to form clusters even in defect-free tungsten alloys, whereas extremely high tantalum and rhenium concentrations are required for the formation of clusters. Vacancies greatly facilitate the clustering of rhenium and osmium, while tantalum is an exception. The binding energies of vacancy-osmium clusters are found to be much higher than those of vacancy-tantalum and vacancy-rhenium clusters. Osmium is observed to strongly promote the formation of vacancy-rhenium clusters, while tantalum can suppress the formation of vacancy-rhenium and vacancy-osmium clusters. The local strain and electronic structure are analyzed to reveal the underlying mechanisms governing the cluster formation. Employing the law of mass action, we predict the evolution of the relative concentration of vacancy-rhenium clusters. This work presents a microscopic picture describing the nucleation and growth of solute clusters in tungsten alloys in a fusion reactor environment, and thereby explains recent experimental phenomena.

  15. Use of cluster rhenium substances with alkyl ligands for inhibition of the Guerin carcinoma Growth

    Directory of Open Access Journals (Sweden)

    O. S. Voronkova

    2007-04-01

    Full Text Available Quantity and quality of erythrocytes, blood haemoglobin concentration, glucose levels in the erythrocytes and plasma, content of TBA-active products in blood plasma of rats were studied during development of the Guerin carcinoma, introduction of cis-platinum and cluster rhenium substances with organic ligands. It was shown that rhenium substances had essential antioxidant effects and changed the dynamic of tumour growth. The conclusion on perspectiveness of further investigations of rhenium substances with cluster fragment and organic ligands in experiments in vivo with changed redox-status of an organism was drawn.

  16. Reductive coupling of carbon monoxide in a rhenium carbonyl complex with pendant Lewis acids.

    Science.gov (United States)

    Miller, Alexander J M; Labinger, Jay A; Bercaw, John E

    2008-09-10

    Phosphinoborane ligands impart unique reactivity to a rhenium carbonyl cation relative to simple phosphine complexes. Addition of either triethylborohydride or a platinum hydride (that can be formed from H2) forms a rhenium boroxycarbene. This carbene, which crystallizes as a dimer, disproportionates over a period of days to afford the starting cation and a structurally unprecedented boroxy(boroxymethyl)carbene, in which a new C-C bond has been formed between two reduced CO ligands. This product of C-C bond formation can be independently synthesized by addition of 2 equiv of hydride to the rhenium carbonyl cation.

  17. Ambient aging of rhenium filaments used in thermal ionization mass spectrometry: Growth of oxo-rhenium crystallites and anti-aging strategies

    Directory of Open Access Journals (Sweden)

    Joseph M. Mannion

    2017-01-01

    Full Text Available Degassing is a common preparation technique for rhenium filaments used for thermal ionization mass spectrometric analysis of actinides, including plutonium. Although optimization studies regarding degassing conditions have been reported, little work has been done to characterize filament aging after degassing. In this study, the effects of filament aging after degassing were explored to determine a “shelf-life” for degassed rhenium filaments, and methods to limit filament aging were investigated. Zone-refined rhenium filaments were degassed by resistance heating under high vacuum before exposure to ambient atmosphere for up to 2 months. After degassing the nucleation and preferential growth of oxo-rhenium crystallites on the surface of polycrystalline rhenium filaments was observed by atomic force microscopy and scanning electron microscopy (SEM. Compositional analysis of the crystallites was conducted using SEM-Raman spectroscopy and SEM energy dispersive X-ray spectroscopy, and grain orientation at the metal surface was investigated by electron back-scatter diffraction mapping. Spectra collected by SEM-Raman suggest crystallites are composed primarily of perrhenic acid. The relative extent of growth and crystallite morphology were found to be grain dependent and affected by the dissolution of carbon into filaments during annealing (often referred to as carbonization or carburization. Crystallites were observed to nucleate in region specific modes and grow over time through transfer of material from the surface. Factors most likely to affect the rates of crystallite growth include rhenium substrate properties such as grain size, orientation, levels of dissolved carbon, and relative abundance of defect sites; as well as environmental factors such as length of exposure to oxygen and relative humidity. Thin (∼180 nm hydrophobic films of poly(vinylbenzyl chloride were found to slow the growth of oxo-rhenium crystallites on the filament

  18. Nipponium, the element ascribable to rhenium from the modern chemical viewpoint

    Energy Technology Data Exchange (ETDEWEB)

    Yoshihara, H.K. [Japan Isotope Data Inst., Sendai (Japan)

    1997-11-01

    Though the discovery of nipponium by Ogawa in 1908 was judged to be false and his work was forgotten for many years, the new element he believed to have found should be ascribed to rhenium (z = 75) by the following reasons: (1) the spectral line of 4882 A agrees well with the present data of rhenium, (2) recalculation of the atomic weight of the element supports the value in the neighbourhood of 185 which is very close to the present value 186.2 of rhenium, and (3) rhenium is actually present in Japanese molybdenite he studied. Therefore, it is concluded that his discovery of the `new` element was correct, but assignment of z = 43 was wrong. (orig.)

  19. Development of unified X-ray fluorescent analysis to determine rhenium content in multicomponent oxide compositions

    International Nuclear Information System (INIS)

    Drobot, D.V.; Belyaev, A.V.; Kutvitskij, V.A.; Rysev, A.P.

    1999-01-01

    A procedure to prepare rhenium-containing glass-like specimens on the basis of bismuth and boron oxides is proposed. The glasses produced are studied by X-ray fluorescent analysis and routine spectrometric thiocyanate analysis. The results make it possible to determine rhenium in oxide mixtures in the range of its content 0.01 - 10% with S r = 0.03 [ru

  20. Determination of rhenium (7) trace amounts by spectrophotometric titration in medium of mixed solvents

    International Nuclear Information System (INIS)

    Kuznetsov, V.V.; Samorukova, O.L.

    1978-01-01

    The method has been proposed of determining rhenium (7) microamounts by spectrophotometric titration in the medium water-dimethyl-sulphoxide with the reagent nitrochromazo. The method is based on the formation of ionic pairs K + ReO 4 - in water-organic solvents. The results of rhenium determination are satisfactory in a wide concentration range up to 0.3 mkg in 15 ml which makes the method proposed close in sensitivity to photometric methods and much better in reproducibility

  1. Reductive Coupling of Carbon Monoxide in a Rhenium Carbonyl Complex with Pendant Lewis Acids

    OpenAIRE

    Miller, Alexander J. M.; Labinger, Jay A.; Bercaw, John E.

    2008-01-01

    Phosphinoborane ligands impart unique reactivity to a rhenium carbonyl cation relative to simple phosphine complexes. Addition of either triethylborohydride or a platinum hydride (that can be formed from H2) forms a rhenium boroxycarbene. This carbene, which crystallizes as a dimer, disproportionates over a period of days to afford the starting cation and a structurally unprecedented boroxy(boroxymethyl)carbene, in which a new C−C bond has been formed between two reduced CO ligands. This prod...

  2. Alkene-glycol interconversion with technetium and rhenium oxo complexes

    International Nuclear Information System (INIS)

    Pearlstein, R.M.; Davison, Alan

    1988-01-01

    The trioxotechnetium(VII) complexes TcO 3 Cl(AA) (AA = phen, bpy, 5-NO 2 -phen, 3,4,7,8-Me 4 -phen) cleanly oxidize olefins (C 2 R 4 ) in solution at 22 0 C, forming in high yields the corresponding oxotechnetium(V) diolate complexes, TcOCl(OCR 2 CR 2 O)(AA). The complexes have been characterized by 1 H NMR, IR, elemental analysis, and fast atom bombardment mass spectrometry. The free diols isolated by hydrolysis of these diolate complexes with HCl were shown by capillary gas chromatography to represent syn addition of the two hydroxyl groups across the double bond. The related rhenium complex, ReOCl(OCH 2 CH 2 O)(phen) undergoes the reverse reaction when thermalized, releasing ethylene and producing ReO 3 Cl(phen). (author)

  3. Catalytic transformation of functionalized carboxylic acids using multifunctional rhenium complexes.

    Science.gov (United States)

    Naruto, Masayuki; Agrawal, Santosh; Toda, Katsuaki; Saito, Susumu

    2017-06-13

    Carboxylic acids (CAs) are one of the most ubiquitous and important chemical feedstocks available from biorenewable resources, CO 2 , and the petrochemical industry. Unfortunately, chemoselective catalytic transformations of CH n CO 2 H (n = 1-3) groups into other functionalities remain a significant challenge. Herein, we report rhenium V complexes as extremely effective precatalysts for this purpose. Compared to previously reported heterogeneous and homogeneous catalysts derived from high- or low-valent metals, the present method involves a α-C-H bond functionalization, a hydrogenation, and a hydrogenolysis, which affords functionalized alcohols with a wide substrate scope and high chemoselectivity under relatively mild reaction conditions. The results represent an important step toward a paradigm shift from 'low-valent' to 'high-valent' metal complexes by exploring a new portfolio of selective functional group transformations of highly oxygenated organic substrates, as well as toward the exploitation of CAs as a valuable biorenewable feedstock.

  4. Convenient synthesis of bis(alkoxy)rhenium(VII) complexes

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Z.; Al-Ajlouni, A.M.; Espenson, J.H. [Iowa State Univ., Ames, IA (United States)

    1996-02-28

    The study of high-oxidation-state organorhenium compounds has been a field of continuing activity, thanks to the success of methylrhenium trioxide (CH{sub 3}ReO{sub 3} or MTO) in catalytic processes. This catalyst is effective in oxidations, olefin metathesis, the olefination of aldehydes, and the preparation of other compounds with three-membered rings. The syntheses of some rhenium compounds derived form MTO have been reported. Epoxide formation is a key reaction, and it bears directly on these findings reported here. Re(VII) complexes containing a chelated bis(diolate) ligand can be synthesized by refluxing MTO with 2,3-dimethyl-2,3-diol. Here, the authors report a more convenient method for this preparation. A different series of related compounds consists of chelated bis(diolates) of the Cp*Re-oxo series, Cp*ReO-(diolate).

  5. Endocavitary treatment of craniopharyngioma cysts by 186-rhenium. Traitement endocavitaire par le rhenium 186 des kystes de craniopharyngiomes

    Energy Technology Data Exchange (ETDEWEB)

    Berenger, N.; Lebtahi, R.; Piketty, M.L.; Merienne, L.; Turak, B.; Bok, R.; Askienazy, S. (Hopital Sainte-Anne, 75 - Paris (France)); Munari, C. (Centre Hospitalier Universitaire, 38 - Grenoble (France))

    1993-01-01

    Forty-three patients with craniopharyngioma cysts were treated by intracystic injection of 186-rhenium. Leakage of colloid isotope into the CSF spaces during the ''test'' or ''therapeutic'' injection was detected by scintigraphic follow-up (15 cases/58 intracystic injections). In fact the physical characteristics of [sup 186]Re are well adapted to the requirements of treatment and, with the gamma emission, also allows early detection of leakage, avoiding irradiation of neighbouring structures. Follow-up studies revealed that craniopharyngioma cysts were effectively treated, with cessation of fluid formation, progressive shrinkage of the cysts leading to total disappearance in 14 cases (10-156 months, mean 52.5) and a considerable decrease in 13 cases (5-53 months, mean 23).

  6. 46 CFR 160.176-4 - Incorporation by reference.

    Science.gov (United States)

    2010-10-01

    .... 751a, Stitches, Seams, and Stitching, January 25, 1965—160.176-9 Military Specifications Naval... Documents, U.S. Government Printing Office, Washington, DC 20402 Special Pub. 440, Color: Universal Language and Dictionary of Names; “The Universal Color Language” and “The Color Names Dictionary”, 1976—160.176...

  7. 21 CFR 169.176 - Concentrated vanilla extract.

    Science.gov (United States)

    2010-04-01

    ... content of ethyl alcohol is not less than 35 percent by volume. (b) The specified name of the food is... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Concentrated vanilla extract. 169.176 Section 169.176 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...

  8. 32 CFR 176.45 - Disposal of buildings and property.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Disposal of buildings and property. 176.45... HOMELESS ASSISTANCE § 176.45 Disposal of buildings and property. (a) Puglic benefit transfer screening. Not... shall dispose of buildings and property in accordance with the record of decision or other decision...

  9. 46 CFR 154.176 - Longitudinal contiguous hull structure.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Longitudinal contiguous hull structure. 154.176 Section... Equipment Hull Structure § 154.176 Longitudinal contiguous hull structure. (a) The longitudinal contiguous hull structure of a vessel having cargo containment systems without secondary barriers must meet the...

  10. 21 CFR 176.260 - Pulp from reclaimed fiber.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Pulp from reclaimed fiber. 176.260 Section 176.260 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: PAPER AND PAPERBOARD COMPONENTS Substances...

  11. 46 CFR 176.700 - Permission for repairs and alterations.

    Science.gov (United States)

    2010-10-01

    ... repair or replacement, other than replacement in kind, of electrical wiring, fuel lines, tanks, boilers... 46 Shipping 7 2010-10-01 2010-10-01 false Permission for repairs and alterations. 176.700 Section... (UNDER 100 GROSS TONS) INSPECTION AND CERTIFICATION Repairs and Alterations § 176.700 Permission for...

  12. 49 CFR 176.160 - Protection against weather.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Protection against weather. 176.160 Section 176.160 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS... Protection against weather. Any person loading or unloading packages containing Class 1 (explosive) materials...

  13. 46 CFR 176.635 - Preliminary examination requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Preliminary examination requirements. 176.635 Section... (UNDER 100 GROSS TONS) INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 176.635 Preliminary examination requirements. (a) If you exclusively use divers to examine the underwater hull plating, you must...

  14. 49 CFR 176.4 - Port security and safety regulations.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Port security and safety regulations. 176.4... SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS CARRIAGE BY VESSEL General § 176.4 Port security and safety regulations. (a) Each carrier, master, agent, and charterer of a...

  15. Determination coefficient distribution rhenium and tungsten using method extraction with solvent methyl ethyl ketone

    International Nuclear Information System (INIS)

    Riftanio Natapratama Hidayat; Maria Christina Prihatiningsih; Duyeh Setiawan

    2015-01-01

    Determination of the distribution coefficient (K d ) of the rhenium and tungsten conducted for the purpose of knowing the value of K d of the two elements. K d value determination is applied to the process of separation rhenium-188 from target of tungsten-188 for the purposes purification of radioisotopes that are made to meet the radionuclide and radiochemical purity. The K d value determination using solvent extraction with methyl ethyl ketone (MEK). Prior to the determination of K d values, determined beforehand the optimum conditions of extraction process based on the effect of agitation time, the volume of MEK, and the pH of the solution. Confirmation the results of the extraction was conducted using UV-Vis spectrophotometer with a complexing KSCN under acidic conditions and reductant SnCl 2 . The results showed that the optimum condition extraction process to feed each of 10 ppm is when the agitation for 10 minutes, the volume of MEK in 20 ml, and the pH below 5. Obtained the maximum recovery of rhenium are drawn to the organic phase as much as 9.545 ppm. However, the condition of the extraction process does not affect the migration of tungsten to the organic phase. Then the maximum K d values obtained at 2.7566 rhenium and tungsten maximum K d is 0.0873. Optimum conditions of extraction process can be further tested on radioactive rhenium and tungsten as an alternative to the separation of radioisotopes. (author)

  16. New leads for fragment-based design of rhenium/technetium radiopharmaceutical agents.

    Science.gov (United States)

    Brink, Alice; Helliwell, John R

    2017-05-01

    Multiple possibilities for the coordination of fac -[Re(CO) 3 (H 2 O) 3 ] + to a protein have been determined and include binding to Asp, Glu, Arg and His amino-acid residues as well as to the C-terminal carboxylate in the vicinity of Leu and Pro. The large number of rhenium metal complex binding sites that have been identified on specific residues thereby allow increased target identification for the design of future radiopharmaceuticals. The core experimental concept involved the use of state-of-art tuneable synchrotron radiation at the Diamond Light Source to optimize the rhenium anomalous dispersion signal to a large value ( f '' of 12.1 electrons) at its L I absorption edge with a selected X-ray wavelength of 0.9763 Å. At the Cu  K α X-ray wavelength (1.5418 Å) the f '' for rhenium is 5.9 electrons. The expected peak-height increase owing to the optimization of the Re f '' was therefore 2.1. This X-ray wavelength tuning methodology thereby showed the lower occupancy rhenium binding sites as well as the occupancies of the higher occupancy rhenium binding sites.

  17. New leads for fragment-based design of rhenium/technetium radiopharmaceutical agents

    Directory of Open Access Journals (Sweden)

    Alice Brink

    2017-05-01

    Full Text Available Multiple possibilities for the coordination of fac-[Re(CO3(H2O3]+ to a protein have been determined and include binding to Asp, Glu, Arg and His amino-acid residues as well as to the C-terminal carboxylate in the vicinity of Leu and Pro. The large number of rhenium metal complex binding sites that have been identified on specific residues thereby allow increased target identification for the design of future radiopharmaceuticals. The core experimental concept involved the use of state-of-art tuneable synchrotron radiation at the Diamond Light Source to optimize the rhenium anomalous dispersion signal to a large value (f′′ of 12.1 electrons at its LI absorption edge with a selected X-ray wavelength of 0.9763 Å. At the Cu Kα X-ray wavelength (1.5418 Å the f′′ for rhenium is 5.9 electrons. The expected peak-height increase owing to the optimization of the Re f′′ was therefore 2.1. This X-ray wavelength tuning methodology thereby showed the lower occupancy rhenium binding sites as well as the occupancies of the higher occupancy rhenium binding sites.

  18. Influence of cold rolling and strain rate on plastic response of powder metallurgy and chemical vapor deposition rhenium

    International Nuclear Information System (INIS)

    Koeppel, B.J.; Subhash, G.

    1999-01-01

    The plastic response of two kinds of rhenium processed via powder metallurgy (PM) and chemical vapor deposition (CVD) were investigated under uniaxial compression over a range of strain rates. The PM rhenium, further cold rolled to 50 and 80 pct of the original thickness, was also investigated to assess the influence of cold work on the plastic behavior. A strong basal texture was detected in all the preceding materials as a result of processing and cold work. Both CVD and PM rhenium exhibited an increase in yield strength and flow stress with increasing strain rate. In PM rhenium, cold work resulted in an increase in hardness and yield strength and a decrease in the work hardening rate. The deformed microstructures revealed extensive twinning in CVD rhenium. At large strains, inhomogeneous deformation mode in the form of classical cup and cone fracture was noticed

  19. Influence of nano-cluster compounds of rhenium drugs on the activity of liver enzymes in a tumor model

    Directory of Open Access Journals (Sweden)

    J. V. Suponko

    2010-06-01

    Full Text Available Enzymes’ level in rat’s hepatocytes under Guerin's carcinoma T8 development as well as after injection of rhenium compounds and cis-platin has been studied. It has been determined that the decrease of enzymatic activity to the level of the animals of control group was observed at the simultaneous injection of cis-platin and cluster rhenium compounds in nanoliposomal and water-soluble forms. That confirms possible hepatoprotective properties of the rhenium compounds. It has been shown that hepatoprotective properties of rhenium cluster compounds mostly don’t depend on the form of their injection and are detected regardless of anticancer properties. Rhenium-platinum system with β-alanine ligand in aqueous solution, has been found. Its injection is accompanied by the hepatoprotective effect.

  20. Lymph node scintigraphy with sup(99m)Tc-rhenium colloid

    International Nuclear Information System (INIS)

    Mitsuhata, Naoki; Suyama, Bunzo; Matsumura, Yosuke; Ohmori, Hiroyuki

    1981-01-01

    Lymph node scintigraphy with sup(99m)Tc-rhenium colloid in evaluation of nodal involvement by urological malignancy were performed on twelve cases (4 bladder cancer, 3 prostatic cancer, 2 penile cancer and 3 testicular tumor). These cases had been examined the extent of disease on the basis of findings at pedal lymphangiography, urography, computed tomography or laparotomy. sup(99m)Tc-rhenium colloid in a volume of 0.2 ml (2 mCi) was injected into the first interdigital webs of each foot without local anesthesia. In one case of penile cancer radioactive colloid was directly injected into the glans penis and prepuce including tumor area. Our clinical experience reported here reveals that lymph node scintigraphy with sup(99m)Tc-rhenium colloid can provide a useful method of investigating the lymphatic system. This technique is reproducible and can be performed in poor risk patients or pediatric patients readily and safely. (author)

  1. A study of scandia and rhenium doped tungsten matrix dispenser cathode

    Science.gov (United States)

    Wang, Jinshu; Li, Lili; Liu, Wei; Wang, Yanchun; Zhao, Lei; Zhou, Meiling

    2007-10-01

    Scandia and rhenium doped tungsten powders were prepared by solid-liquid doping combined with two-step reduction method. The experimental results show that scandia was distributed evenly on the surface of tungsten particles. The addition of scandia and rhenium could decrease the particle size of doped tungsten, for example, the tungsten powders doped with Sc 2O 3 and Re had the average size of about 50 nm in diameter. By using this kind of powder, scandia and rhenium doped tungsten matrix with the sub-micrometer sized tungsten grains was obtained. This kind of matrix exhibited good anti-bombardment insensitivity at high temperature. The emission property result showed that high space charge limited current densities of more than 60 A/cm 2 at 900 °C could be obtained for this cathode. A Ba-Sc-O multilayer about 100 nm in thickness formed at the surface of cathode after activation led to the high emission property.

  2. Noncontact surface tension and viscosity measurements of rhenium in the liquid and undercooled states

    International Nuclear Information System (INIS)

    Ishikawa, Takehiko; Paradis, Paul-Francois; Yoda, Shinichi

    2004-01-01

    Surface tension and viscosity of liquid rhenium, which have hardly been measured due to the extremely high melting temperature of rhenium, were measured using an electrostatic levitation method combined with the oscillation drop technique. Sample position instability problems caused by the photon pressure of the heating lasers and by sample evaporation were solved by modifying the electrodes design. Good sample stability allowed the measurements of the surface tension and the viscosity over wide temperature ranges including the undercooled states. Over the 2800-3600 K interval, the surface tension of rhenium was measured as σ(T)=2.71x10 3 -0.23(T-T m ), where T m is the melting temperature, 3453 K. At T m , the datum agrees well with the literature values. Similarly, on the same temperature range, the viscosity was determined as η(T)=0.08 exp[1.33x10 5 /(RT)] (mPa s)

  3. Effect of rhenium irradiations on the mechanical properties of tungsten for nuclear fusion applications

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Aneeqa, E-mail: aneeqa.khan-3@postgrad.manchester.ac.uk [School of Mechanical, Aerospace and Civil Engineering, The University of Manchester, M13 9PL (United Kingdom); Elliman, Robert; Corr, Cormac [Research School of Physics and Engineering, The Australian National University, Canberra, ACT 2601 (Australia); Lim, Joven J.H.; Forrest, Andrew [School of Materials, The University of Manchester, M13 9PL (United Kingdom); Mummery, Paul [School of Mechanical, Aerospace and Civil Engineering, The University of Manchester, M13 9PL (United Kingdom); Evans, Llion M. [Culham Centre for Fusion Energy, Culham Science Centre, Abingdon, Oxon, OX14 3DB (United Kingdom)

    2016-08-15

    As-received and annealed tungsten samples were irradiated at a temperature of 400 °C with Re and W ions to peak concentrations of 1600 appm (atomic parts per million) and damage levels of 40 dpa (displacements per atom). Mechanical properties were investigated using nanoindentation, and the orientation and depth dependence of irradiation damage was investigated using Electron Back Scatter Diffraction (EBSD). Following irradiation there was a 13% increase in hardness in the as received sheet and a 23% increase in the annealed material for both tungsten and rhenium irradiation. The difference between the tungsten and rhenium irradiated samples was negligible, suggesting that for the concentrations and damage levels employed, the presence of rhenium does not have a significant effect on the hardening mechanism. Energy dependent EBSD of annealed samples provided information about the depth distribution of the radiation damage in individual tungsten grains and confirmed that the radiation damage is orientation dependant.

  4. High-temperature extraction of rhenium from sulfuric acid solutions with trialkylamines

    International Nuclear Information System (INIS)

    Gladyhev, V.P.; Andreeva, N.N.; Kim, E.M.; Kovaleva, S.V.

    1985-01-01

    This paper attempts to determine the possibility of conducting high-temperature extraction of rhenium from sulfuric acid solutions with trialkylamines (TAA) using higher hydrocarbon-paraffin mixtures as the diluent of the extraction system. Substitution of kerosene by paraffin in the extraction system would permit decreasing the danger of fire and explosions during he extraction process. In extracting rhenium from industrial solutions with a melt of higher paraffins containing TAA and alcohols, the extraction system can be continously heated in heat exchangers through which washing sulfuric acid passes and then goes to the extractor. This permits utilizing the heat and decreases the temperature of the solutions for extraction to the optimum temperatures. Extraction of rhenium with a melt of trioctylamine in paraffin obeys the same mechanisms as high-temperature extraction of ruthenium (IV) by amines in kerosene and aromatic hydrocarbons

  5. Absorption behavior of technetium and rhenium through plant roots

    International Nuclear Information System (INIS)

    Tagami, K.; Uchida, S.

    2004-01-01

    The absorption behavior of technetium (Tc) and rhenium (Re) through plant roots was studied using nutrient solution culture. Radish samples, grown in culture solutions for 20-30 days in a green house, were transferred into plastic vessels containing nutrient solutions contaminated with multi-tracer solutions including Tc-95m and Re-183. The plant samples were grown individually for 1-7 days under laboratory conditions. The activities of radionuclides in nutrient solutions and oven-dried plant parts (roots, fleshy roots and leaves) were measured with Ge detecting systems. The concentrations of Tc-95m and Re-183 in the nutrient solutions after harvesting the plants were almost the same as those in the initial solution. Possibly, the radionuclides were taken up with water through plant roots. The distributions of Tc and Re in the plants showed no differences, thus, soluble Tc and Re absorption by plant samples were the same. It is suggested that Re could be used as a geochemical tracer of Tc in the soil environment. (author)

  6. Rhenium Dichalcogenides: Layered Semiconductors with Two Vertical Orientations.

    Science.gov (United States)

    Hart, Lewis; Dale, Sara; Hoye, Sarah; Webb, James L; Wolverson, Daniel

    2016-02-10

    The rhenium and technetium diselenides and disulfides are van der Waals layered semiconductors in some respects similar to more well-known transition metal dichalcogenides (TMD) such as molybdenum sulfide. However, their symmetry is lower, consisting only of an inversion center, so that turning a layer upside-down (that is, applying a C2 rotation about an in-plane axis) is not a symmetry operation, but reverses the sign of the angle between the two nonequivalent in-plane crystallographic axes. A given layer thus can be placed on a substrate in two symmetrically nonequivalent (but energetically similar) ways. This has consequences for the exploitation of the anisotropic properties of these materials in TMD heterostructures and is expected to lead to a new source of domain structure in large-area layer growth. We produced few-layer ReS2 and ReSe2 samples with controlled "up" or "down" orientations by micromechanical cleavage and we show how polarized Raman microscopy can be used to distinguish these two orientations, thus establishing Raman as an essential tool for the characterization of large-area layers.

  7. Polymer Photovoltaic Cells with Rhenium Oxide as Anode Interlayer.

    Science.gov (United States)

    Wei, Jinyu; Bai, Dongdong; Yang, Liying

    2015-01-01

    The effect of a new transition metal oxide, rhenium oxide (ReO3), on the performance of polymer solar cells based on regioregular poly(3-hexylthiophene) (P3HT) and methanofullerene [6,6]-phenyl C61-butyric acid methyl ester (PCBM) blend as buffer layer was investigated. The effect of the thickness of ReO3 layer on electrical characteristics of the polymer solar cells was studied. It is found that insertion of ReO3 interfacial layer results in the decreased performance for P3HT: PCBM based solar cells. In order to further explore the mechanism of the decreasing of the open-circuit voltage (Voc), the X-ray photoelectron spectroscopy (XPS) is used to investigate the ReO3 oxidation states. Kelvin Probe method showed that the work function of the ReO3 is estimated to be 5.13eV after thermal evaporation. The results indicated the fact that a portion of ReO3 decomposed during thermal evaporation process, resulting in the formation of a buffer layer with a lower work function. As a consequence, a higher energy barrier was generated between the ITO and the active layer.

  8. A tungsten-rhenium interatomic potential for point defect studies

    Science.gov (United States)

    Setyawan, Wahyu; Gao, Ning; Kurtz, Richard J.

    2018-05-01

    A tungsten-rhenium (W-Re) classical interatomic potential is developed within the embedded atom method interaction framework. A force-matching method is employed to fit the potential to ab initio forces, energies, and stresses. Simulated annealing is combined with the conjugate gradient technique to search for an optimum potential from over 1000 initial trial sets. The potential is designed for studying point defects in W-Re systems. It gives good predictions of the formation energies of Re defects in W and the binding energies of W self-interstitial clusters with Re. The potential is further evaluated for describing the formation energy of structures in the σ and χ intermetallic phases. The predicted convex-hulls of formation energy are in excellent agreement with ab initio data. In pure Re, the potential can reproduce the formation energies of vacancies and self-interstitial defects sufficiently accurately and gives the correct ground state self-interstitial configuration. Furthermore, by including liquid structures in the fit, the potential yields a Re melting temperature (3130 K) that is close to the experimental value (3459 K).

  9. Structure and x-ray density of electrochemically deposited rhenium films

    International Nuclear Information System (INIS)

    Petrovich, V.A.; Fedenkov, A.L.; Shepurev, S.Yu.

    1988-01-01

    The electrodeposition of rhenium was carried out at a constant cathode-current density and room temperature. The backing was grade KEF-0.02 single-crystal silicon. The absorption coefficient μ of the film was determined for the K α radiation of the copper line. The investigation enabled us to conclude that electrochemically deposited rhenium films can be used as a material for the masking coatings of x-ray patterns, since the absorption coefficients of the x-ray radiation of the resultant films are superior to the similar parameters of traditionally employed materials, and surpass these materials in terms of corrosion resistance and simplicity of production

  10. Influence of ligand structure on anticancer and antioxidant properties of rhenium cluster compounds

    Directory of Open Access Journals (Sweden)

    I. V. Leus

    2009-11-01

    Full Text Available Under the model growth of T8 Guerin’s carcinoma in rats we studied the anticancer activity of the system rhenium-platinum, which includes cis-dicarboxylates of rhenium (III with different alkyl ligands, erythrocytes number and its morphological structure, erythrocytic stability, blood haemoglobin concentration, catalase activity and concentration of TBA-active products in the rats blood plasma. The renium-platinum system had considerable antioxidat effect and prevented the growth of tumour, that was maximal for a compound with the pivalate ligand.

  11. 46 CFR 176.702 - Installation tests and inspections.

    Science.gov (United States)

    2010-10-01

    ..., machinery, fuel tank, or pressure vessel is installed aboard a vessel after completion of the initial... 100 GROSS TONS) INSPECTION AND CERTIFICATION Repairs and Alterations § 176.702 Installation tests and...

  12. Analysis of extreme ultraviolet spectra from laser produced rhenium plasmas

    Science.gov (United States)

    Wu, Tao; Higashiguchi, Takeshi; Li, Bowen; Suzuki, Yuhei; Arai, Goki; Dinh, Thanh-Hung; Dunne, Padraig; O'Reilly, Fergal; Sokell, Emma; Liu, Luning; O'Sullivan, Gerry

    2015-08-01

    Extreme ultraviolet spectra of highly-charged rhenium ions were observed in the 1-7 nm region using two Nd:YAG lasers with pulse lengths of 150 ps and 10 ns, respectively, operating at a number of laser power densities. The maximum focused peak power density was 2.6 × 1014 W cm-2 for the former and 5.5 × 1012 W cm-2 for the latter. The Cowan suite of atomic structure codes and unresolved transition array (UTA) approach were used to calculate and interpret the emission properties of the different spectra obtained. The results show that n = 4-n = 4 and n = 4-n = 5 UTAs lead to two intense quasi-continuous emission bands in the 4.3-6.3 nm and 1.5-4.3 nm spectral regions. As a result of the different ion stage distributions in the plasmas induced by ps and ns laser irradiation the 1.5-4.3 nm UTA peak moves to shorter wavelength in the ps laser produced plasma spectra. For the ns spectrum, the most populated ion stage during the lifetime of this plasma that could be identified from the n = 4-n = 5 transitions was Re23+ while for the ps plasma the presence of significantly higher stages was demonstrated. For the n = 4-n = 4 4p64dN-4p54dN+1 + 4p64dN-14f transitions, the 4d-4f transitions contribute mainly in the most intense 4.7-5.5 nm region while the 4p-4d subgroup gives rise to a weaker feature in the 4.3-4.7 nm region. A number of previously unidentified spectral features produced by n = 4-n = 5 transitions in the spectra of Re XVI to Re XXXIX are identified.

  13. Studies of the structures of rhenium complexes with sulphur-containing amino acids: cysteine and homocysteine

    International Nuclear Information System (INIS)

    Arkowska, A.; Wojciechowski, W.

    1979-01-01

    Two rhenium compounds have been synthesized: compound 1 with cysteine HS-CH 2 -CH-NH 2 -COOH and compound 2 with homocysteine HS-CH 2 -CH 2 -CH-NH 2 -COOH. On the basis of spectroscopic measurements (IR, far IR, Raman, VIS and UV spectra) and magnetic susceptibility measurements their probable electronic and molecular structures have been determined. (author)

  14. Femtosecond Fluorescence and Intersystem Crossing in Rhenium(I) Carbonyl-Bipyridine Complexes

    Czech Academy of Sciences Publication Activity Database

    Cannizzo, A.; Blanco-Rodríguez, A. M.; Nahhas, A. E.; Šebera, Jakub; Záliš, Stanislav; Vlček, Antonín; Chergui, M.

    2008-01-01

    Roč. 130, č. 28 (2008), s. 8967-8974 ISSN 0002-7863 R&D Projects: GA MŠk 1P05OC068 Institutional research plan: CEZ:AV0Z40400503 Keywords : rhenium(I) * carbonyl-bipyridine * intersystem crossing Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 8.091, year: 2008

  15. Synthesis, reactivity, and properties of N-fused porphyrin rhenium(I) tricarbonyl complexes.

    Science.gov (United States)

    Toganoh, Motoki; Ikeda, Shinya; Furuta, Hiroyuki

    2007-11-12

    The thermal reactions of N-fused tetraarylporphyrins or N-confused tetraarylporphyrins with Re2(CO)10 gave the rhenium(I) tricarbonyl complexes bearing N-fused porphyrinato ligands (4) in moderate to good yields. The rhenium complexes 4 are characterized by mass, IR, 1H, and 13C NMR spectroscopy, and the structures of tetraphenylporphynato complex 4a and its nitro derivative 15 are determined by X-ray single crystal analysis. The rhenium complexes 4 show excellent stability against heat, light, acids, bases, and oxidants. The aromatic substitution reactions of 4 proceed without a loss of the center metal to give the nitro (15), formyl (16), benzoyl (17), and cyano derivatives (19), regioselectively. In the electrochemical measurements for 4, one reversible oxidation wave and two reversible reduction waves are observed. Their redox potentials imply narrow HOMO-LUMO band gaps of 4 and are consistent with their electronic absorption spectra, in which the absorption edges exceed 1000 nm. Theoretical study reveals that the HOMO and LUMO of the rhenium complexes are exclusively composed of the N-fused porphyrin skeleton. Protonation of 4 takes place at the 21-position regioselectively, reflecting the high coefficient of the C21 atom in the HOMO orbital. The skeletal rearrangement reaction from N-confused porphyrin Re(I) complex (8) to N-fused porphyrin Re(I) complex (4) is suggested from the mechanistic study as well as DFT calculations.

  16. Rhenium solubility in borosilicate nuclear waste glass: implications for the processing and immobilization of technetium-99.

    Science.gov (United States)

    McCloy, John S; Riley, Brian J; Goel, Ashutosh; Liezers, Martin; Schweiger, Michael J; Rodriguez, Carmen P; Hrma, Pavel; Kim, Dong-Sang; Lukens, Wayne W; Kruger, Albert A

    2012-11-20

    The immobilization of technetium-99 ((99)Tc) in a suitable host matrix has proven to be a challenging task for researchers in the nuclear waste community around the world. In this context, the present work reports on the solubility and retention of rhenium, a nonradioactive surrogate for (99)Tc, in a sodium borosilicate glass. Glasses containing target Re concentrations from 0 to 10,000 ppm [by mass, added as KReO(4) (Re(7+))] were synthesized in vacuum-sealed quartz ampules to minimize the loss of Re from volatilization during melting at 1000 °C. The rhenium was found as Re(7+) in all of the glasses as observed by X-ray absorption near-edge structure. The solubility of Re in borosilicate glasses was determined to be ~3000 ppm (by mass) using inductively coupled plasma optical emission spectroscopy. At higher rhenium concentrations, additional rhenium was retained in the glasses as crystalline inclusions of alkali perrhenates detected with X-ray diffraction. Since (99)Tc concentrations in a glass waste form are predicted to be wastes, assuming Tc as Tc(7+) and similarities between Re(7+) and Tc(7+) behavior in this glass system.

  17. THE SYNTHESIS OF BIOCONJUGATE BASED ON RHENIUM(I CARBONYL COMPLEX FOR VISUALIZATION OF PATHOLOGICAL PROCESS

    Directory of Open Access Journals (Sweden)

    K. O. Piletska

    2017-03-01

    Full Text Available Tricarbonyl rhenium(I complexes have a great potential like biomarkers. It is caused their biological stability, low toxicity, large Stokes shifts, and long luminescence lifetimes. Rhenium tricarbonyl complexes fac-[Re(CO3(N^N], where N^N is a ligand with low π* orbitals are excellent candidates as imaging dyes. The method of obtaining potential biomarkers based on tricarbonyl rhenium(I complex with a 4-methyl-2,2’-bipyridine-4’-carboxylate by the addition of biomolecules by peptide synthesis was developed. The new complex [Re(CO3MebpyCOOHBr] was synthesized, composition and structure of which were established by mass spectrometry, IR and NMR spectroscopy. A selective attachment of receptor peptide enkephalin to complex [Re(CO3(MebpyCOOHBr] was performed. The formation of a new compound and its structure has been confirmed by HPLC and mass spectral analysis. The method which has been developed allows to connect various peptides to rhenium(I complex in the solution.

  18. Submersion criticality safety of tungsten-rhenium urania cermet fuel for space propulsion and power applications

    Energy Technology Data Exchange (ETDEWEB)

    Craft, A.E., E-mail: aaron.craft@inl.gov [Center for Space Nuclear Research (CSNR), INL, Idaho Falls, ID (United States); O’Brien, R.C., E-mail: Robert.OBrien@inl.gov [Center for Space Nuclear Research (CSNR), INL, Idaho Falls, ID (United States); Howe, S.D., E-mail: Steven.Howe@inl.gov [Center for Space Nuclear Research (CSNR), INL, Idaho Falls, ID (United States); King, J.C., E-mail: kingjc@mines.edu [Nuclear Science and Engineering Program, Metallurgical and Materials Engineering Department, Colorado School of Mines, Golden, CO 80401 (United States)

    2014-07-01

    Highlights: • Criticality safety studies consider a generic space nuclear reactor in reentry scenarios. • Describes the submersion criticality behavior for a reactor fueled with a tungsten cermet fuel. • Study considers effects of varying fuel content, geometry, and other conditions. - Abstract: Nuclear thermal rockets are the preferred propulsion technology for a manned mission to Mars, and tungsten–uranium oxide cermet fuels could provide significant performance and cost advantages for nuclear thermal rockets. A nuclear reactor intended for use in space must remain subcritical before and during launch, and must remain subcritical in launch abort scenarios where the reactor falls back to Earth and becomes submerged in terrestrial materials (including seawater, wet sand, or dry sand). Submersion increases reflection of neutrons and also thermalizes the neutron spectrum, which typically increases the reactivity of the core. This effect is typically very significant for compact, fast-spectrum reactors. This paper provides a submersion criticality safety analysis for a representative tungsten/uranium oxide fueled reactor with a range of fuel compositions. Each submersion case considers both the rhenium content in the matrix alloy and the uranium oxide volume fraction in the cermet. The inclusion of rhenium significantly improves the submersion criticality safety of the reactor. While increased uranium oxide content increases the reactivity of the core, it does not significantly affect the submersion behavior of the reactor. There is no significant difference in submersion behavior between reactors with rhenium distributed within the cermet matrix and reactors with a rhenium clad in the coolant channels. The combination of the flooding of the coolant channels in submersion scenarios and the presence of a significant amount of spectral shift absorbers (i.e. high rhenium concentration) further decreases reactivity for short reactor cores compared to longer cores.

  19. Tungsten-rhenium composite tube fabricated by CVD for application in 18000C high thermal efficiency fuel processing furnace

    International Nuclear Information System (INIS)

    Svedberg, R.C.; Bowen, W.W.; Buckman, R.W. Jr.

    1980-04-01

    Chemical Vapor Deposit (CVD) rhenium was selected as the muffle material for an 1800 0 C high thermal efficiency fuel processing furnace. The muffle is exposed to high vacuum on the heater/insulation/instrumentation side and to a flowing argon-8 V/0 hydrogen gas mixture at one atmosphere pressure on the load volume side. During operation, the muffle cycles from room temperature to 1800 0 C and back to room temperature once every 24 hours. Operational life is dependent on resistance to thermal fatigue during the high temperature exposure. For a prototypical furnace, the muffle is approximately 13 cm I.D. and 40 cm in length. A small (about one-half size) rhenium closed end tube overcoated with tungsten was used to evaluate the concept. The fabrication and testing of the composite tungsten-rhenium tube and prototypic rhenium muffle is described

  20. Effect of octanols structure on their extraction ability as regards to rhenium(VII) in sulfuric acid solutions

    International Nuclear Information System (INIS)

    Kasikov, A.G.; Petrova, A.M.

    2007-01-01

    It is established that extraction ability of octanols as regards to rhenium(VII) and sulfuric acid depends on the structure of alcohol, but if in passage from octanol-1 to octanol-3 as regard to rhenium(VII) it rises, then for H 2 SO 4 it falls. Dependence of the distribution function of rhenium from the concentration of the acid has maximums at 4-7 mol l 1- that the most distinctly it becomes apparent for secondary alcohols. Decreasing the extraction ability of octyl alcohols with the growth of H 2 SO 4 concentration more than 7 mol l 1- is connected with the change of extractant composition and forms of rhenium(VII) being in the solution [ru

  1. Residency of rhenium and osmium in a heavy crude oil

    Science.gov (United States)

    DiMarzio, Jenna M.; Georgiev, Svetoslav V.; Stein, Holly J.; Hannah, Judith L.

    2018-01-01

    Rhenium-osmium (Re-Os) isotope geochemistry is an emerging tool for the study of oil formation and migration processes, and a new technology for petroleum exploration. Little is known, however, about the residency of Re and Os within asphaltene and maltene sub-fractions of crude oil. This information is crucial for understanding the 187Re-187Os radiometric clock held in petroleum systems and for interpreting geochronology for key processes such as oil formation, migration, and biodegradation. In this study, a heavy crude oil was separated into soluble (maltene, MALT) and insoluble (asphaltene, ASPH) fractions using n-heptane as the asphaltene-precipitating agent. The asphaltenes were separated sequentially into sub-fractions using two different solvent pairs (heptane-dichloromethane and acetone-toluene), and the bulk maltenes were separated into saturate, aromatic, and resin (SAR) fractions using open column chromatography. Each asphaltene and maltene sub-fraction was analyzed for Re and Os. The asphaltene sub-fractions and the bulk ASPH, MALT, and crude oil were analyzed for a suite of trace metals by ICP-MS. Our results show that Re and Os concentrations co-vary between the asphaltene sub-fractions, and that both elements are found mostly in the more polar and aromatic sub-fractions. Significant Re and Os are also present in the aromatic and resin fractions of the maltenes. However, each asphaltene and maltene sub-fraction has a distinct isotopic composition, and sub-fractions are not isochronous. This suggests that asphaltene sub-fractionation separates Re-Os complexes to the point where the isotopic integrity of the geochronometer is compromised. The mobility of individual Re and Os isotopes and the decoupling possibilities between radiogenic 187Os produced from 187Re remain elusive, but their recognition in this study is a critical first step. Re and Os correlate strongly with Mo and Cd in the asphaltene sub-fractions, suggesting that these metals occupy

  2. Trinuclear rhenium(III) halide clusters with carboxylate ligands

    Science.gov (United States)

    Dougan, Jeffrey Steven

    Four mono(carboxylato)trirhenium complexes and three bis(carboxylato)trirhenium complexes have been synthesized and characterized, principally by mass spectrometry, with supporting evidence from X-ray diffraction. These compounds represent the first trinuclear rhenium carboxylate complexes. The reactions generally proceed readily under comparatively mild conditions. Mass spectrometry has again proved its usefulness as a technique in the field of metal cluster chemistry, having provided the initial identification of the products of the reactions studied. These compounds provide a further base to which future mass spectra of metal cluster compounds can be compared. Re-examination of a reaction reported by Taha and Wilkinson has also cast considerable doubt onto the validity of a conversion widely reported in the literature that transforms (Re3Cl9) x into [Re2(O2CCH3)4Cl 2]. We believe that the literature result is a consequence of the purity of the metal precursor, and suggest that the starting material in the earlier work may have contained ReCl4 or ReCl5. The importance of mass spectrometry in the characterization of the new compounds synthesized in this project has led to a thorough study of calculated isotopic distributions. The information gathered suggests that for isotopically simple molecules, the choice of algorithm for computing an isotopic distribution is unimportant. However, it is important to compute the mass spectrum of an isotopically complex molecule using an algorithm that can, if desired, show the underlying isotopic fine structure of a peak of interest. In the last chapter of this thesis, the results of a project in chemistry education research are presented. Predicting the success of students in general chemistry has long been of interest to the chemistry education community, and several factors have been identified as contributing factors. An off-hand comment by a student inspired an examination of whether continuity with the same instructor for

  3. Testing of electroformed deposited iridium/powder metallurgy rhenium rockets

    Science.gov (United States)

    Reed, Brian D.; Dickerson, Robert

    1996-01-01

    High-temperature, oxidation-resistant chamber materials offer the thermal margin for high performance and extended lifetimes for radiation-cooled rockets. Rhenium (Re) coated with iridium (Ir) allow hours of operation at 2200 C on Earth-storable propellants. One process for manufacturing Ir/Re rocket chambers is the fabrication of Re substrates by powder metallurgy (PM) and the application of Ir coatings by using electroformed deposition (ED). ED Ir coatings, however, have been found to be porous and poorly adherent. The integrity of ED Ir coatings could be improved by densification after the electroforming process. This report summarizes the testing of two 22-N, ED Ir/PM Re rocket chambers that were subjected to post-deposition treatments in an effort to densify the Ir coating. One chamber was vacuum annealed, while the other chamber was subjected to hot isostatic pressure (HIP). The chambers were tested on gaseous oxygen/gaseous hydrogen propellants, at mixture ratios that simulated the oxidizing environments of Earth-storable propellants. ne annealed ED Ir/PM Re chamber was tested for a total of 24 firings and 4.58 hr at a mixture ratio of 4.2. After only 9 firings, the annealed ED Ir coating began to blister and spall upstream of the throat. The blistering and spalling were similar to what had been experienced with unannealed, as-deposited ED Ir coatings. The HIP ED Ir/PM Re chamber was tested for a total of 91 firings and 11.45 hr at mixture ratios of 3.2 and 4.2. The HIP ED Ir coating remained adherent to the Re substrate throughout testing; there were no visible signs of coating degradation. Metallography revealed, however, thinning of the HIP Ir coating and occasional pores in the Re layer upstream of the throat. Pinholes in the Ir coating may have provided a path for oxidation of the Re substrate at these locations. The HIP ED Ir coating proved to be more effective than vacuum annealed and as-deposited ED Ir. Further densification is still required to

  4. Analysis of extreme ultraviolet spectra from laser produced rhenium plasmas

    International Nuclear Information System (INIS)

    Wu, Tao; Dunne, Padraig; O’Reilly, Fergal; Sokell, Emma; Liu, Luning; O’Sullivan, Gerry; Higashiguchi, Takeshi; Suzuki, Yuhei; Arai, Goki; Dinh, Thanh-Hung; Li, Bowen

    2015-01-01

    Extreme ultraviolet spectra of highly-charged rhenium ions were observed in the 1–7 nm region using two Nd:YAG lasers with pulse lengths of 150 ps and 10 ns, respectively, operating at a number of laser power densities. The maximum focused peak power density was 2.6 × 10 14 W cm −2 for the former and 5.5 × 10 12 W cm −2 for the latter. The Cowan suite of atomic structure codes and unresolved transition array (UTA) approach were used to calculate and interpret the emission properties of the different spectra obtained. The results show that n = 4-n = 4 and n = 4-n = 5 UTAs lead to two intense quasi-continuous emission bands in the 4.3–6.3 nm and 1.5–4.3 nm spectral regions. As a result of the different ion stage distributions in the plasmas induced by ps and ns laser irradiation the 1.5–4.3 nm UTA peak moves to shorter wavelength in the ps laser produced plasma spectra. For the ns spectrum, the most populated ion stage during the lifetime of this plasma that could be identified from the n = 4-n = 5 transitions was Re 23+ while for the ps plasma the presence of significantly higher stages was demonstrated. For the n = 4-n = 4 4p 6 4d N -4p 5 4d N+1  + 4p 6 4d N−1 4f transitions, the 4d-4f transitions contribute mainly in the most intense 4.7–5.5 nm region while the 4p-4d subgroup gives rise to a weaker feature in the 4.3–4.7 nm region. A number of previously unidentified spectral features produced by n = 4-n = 5 transitions in the spectra of Re XVI to Re XXXIX are identified. (paper)

  5. Study on the application of crown ether for neutron activation analysis of rubidium and rhenium in rock samples

    International Nuclear Information System (INIS)

    Wang Xiaolin; Fu Yibei; Liu Yinong; Xiong Zonghua; Hao Fanhua

    1996-01-01

    The extraction behaviour of rubidium and rhenium with 18-crown-6 (18C6) and benzo-15-crown-5 (B15C5) in nitrobenzene from picric acid or potassium hydroxide solution are studied and methods for separation and determination are developed. The molar ratio of 18C6 to Rb and B15C5 to Re in the extracted species is probably 2:1. Rubidium and rhenium in rock samples are satisfactorily determined by neutron activation method

  6. Study of the electrodeposition of rhenium thin films by electrochemical quartz microbalance and X-ray photoelectron spectroscopy

    International Nuclear Information System (INIS)

    Schrebler, R.; Cury, P.; Suarez, C.; Munoz, E.; Vera, F.; Cordova, R.; Gomez, H.; Ramos-Barrado, J.R.; Leinen, D.; Dalchiele, E.A.

    2005-01-01

    Rhenium thin films were prepared by electrodeposition from an aqueous solution containing 0.1 M Na 2 SO 4 +H 2 SO 4 , pH 2 in presence of y mM HReO 4 . As substrates polycrystalline gold (y=0.75 mM HReO 4 ) and monocrystalline n-Si(100) (y=40 mM HReO 4 ) were used. The electrochemical growth of rhenium was studied by cyclic voltammetry and electrochemical quartz microbalance on gold electrodes. The results found in the potential region before the hydrogen evolution reaction (her) showed that ReO 3 , ReO 2 and Re 2 O 3 with different hydration grades can be formed. In the potential region where the her is occurring, either on gold or n-Si(100) the electrodeposition of metallic rhenium takes place. On both substrates, rhenium films were formed by electrolysis at constant potential and X-ray photoelectron spectroscopy technique was used to characterise these deposits. It was concluded that the electrodeposited films were of metallic rhenium and only the uppermost atomic layer contained rhenium oxide species

  7. 27 CFR 24.176 - Crushing and fermentation.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Crushing and fermentation..., DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Wine § 24.176 Crushing and fermentation. (a) Natural... fermentation but the density of the juice may not be reduced below 22 degrees Brix. However, if the juice is...

  8. 46 CFR 199.176 - Markings on lifesaving appliances.

    Science.gov (United States)

    2010-10-01

    ... ARRANGEMENTS LIFESAVING SYSTEMS FOR CERTAIN INSPECTED VESSELS Requirements for All Vessels § 199.176 Markings on lifesaving appliances. (a) Lifeboats and rescue boats. Each lifeboat and rescue boat must be plainly marked as follows: (1) Each side of each lifeboat and rescue boat bow must be marked in block...

  9. Experimental half-life determination of 176Lu

    International Nuclear Information System (INIS)

    Kossert, Karsten; Jörg, Gerhard; Gostomski, Christoph Lierse v.

    2013-01-01

    The half-life of the naturally occurring long-lived rare earth isotope 176 Lu was determined by a combination of highly sophisticated experimental procedures in order to further improve the reliability and the precision of literature data. The amount of lutetium in the samples was determined by inductively coupled plasma optical emission spectrometry (ICP-OES) using a NIST reference standard. The isotopic ratio N( 176 Lu)/N(Lu) in the samples was measured by means of inductively coupled plasma high resolution mass spectrometry (ICP-HRMS). The activity divided by the mass of Lu was determined by applying liquid scintillation (LS) counting. The LS counting efficiency of the beta/gamma emitter 176 Lu was determined with the CIEMAT/NIST efficiency tracing technique with low uncertainty. The influences of colour quenching and background effects are discussed in this paper. The half-life was found to be 3.640(35)×10 10 y. The result is in good agreement with other evaluations and the relative standard uncertainty of 0.95% is among the lowest of previously published data. - Highlights: • The half-life of 176 Lu was determined by ICP-OES, ICP-HRMS and LSC. • The LSC efficiency was determined with the CIEMAT/NIST method. • The half-life was found to be 3.640(35)×10 10 y

  10. 46 CFR 176.816 - Miscellaneous systems and equipment.

    Science.gov (United States)

    2010-10-01

    ... 100 GROSS TONS) INSPECTION AND CERTIFICATION Material Inspections § 176.816 Miscellaneous systems and equipment. At each initial and subsequent inspection for certification the owner or managing operator shall be prepared to test and make available for inspection all items in the ship's outfit, such as ground...

  11. 28 CFR 35.176 - Alternative means of dispute resolution.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Alternative means of dispute resolution... DISABILITY IN STATE AND LOCAL GOVERNMENT SERVICES Compliance Procedures § 35.176 Alternative means of dispute resolution. Where appropriate and to the extent authorized by law, the use of alternative means of dispute...

  12. The process development of laser surface modification of commercially pure titanium (Grade 2) with rhenium

    Science.gov (United States)

    Kobiela, K.; Smolina, I.; Dziedzic, R.; Szymczyk, P.; Kurzynowski, T.; Chlebus, E.

    2016-12-01

    The paper presents the results of the process development of laser surface modification of commercially pure titanium with rhenium. The criterion of the successful/optimal process is the repetitive geometry of the surface, characterized by predictable and repetitive chemical composition over its entire surface as well as special mechanical properties (hardness and wear resistance). The analysis of surface geometry concluded measurements of laser penetration depth and heat affected zone (HAZ), the width of a single track as well as width of a clad. The diode laser installed on the industrial robot carried out the laser treatment. This solution made possible the continuous supply of powder to the substrate during the process. The aim of an investigation is find out the possibility of improving the tribological characteristics of the surface due to the rhenium alloying. The verification of the surface properties (tribological) concluded geometry measurements, microstructure observation, hardness tests and evaluation of wear resistance.

  13. Tungsten - rhenium alloys wire: overview of thermomechanical processing and properties data

    International Nuclear Information System (INIS)

    Bryskin, B.

    2001-01-01

    The scope of this study encompasses the compositional modifications of the tungsten-rhenium dual system (W-3/5 Re up to W-27 Re) as well as some of the tungsten-molybdenum-rhenium ternary system. The alloys of interest are considered with a specific representation of powder metallurgy route based on doped or undoped tungsten vs. vacuum melted materials. This paper constitutes an in-depth review of structural and mechanical properties and systematic compilation of challenges necessary to provide the quality consistency of severely drawn filaments. The issue of thermomechanical processing trends is addressed as an important part of W-Re fabrication technology to achieve further improvement in design properties of rod and wire. (author)

  14. Effect of deformation and annealing on mechanical properties of nickel-rhenium alloys

    International Nuclear Information System (INIS)

    Mashkova, V.M.

    1978-01-01

    Studied have been the mechanical properties of nickel-rhenium alloys, depending on the extent of deformation and heat treatment leading to softening. The mechanical properties of the alloys have been estimated by the results of the tensile tests of wire samples. The softening of the alloy at different temperatures is judged about by the variation in hardness. The results of the study indicate that the most abrupt reduction in the hardness of the cold-hardened metal occurs at 900-1,000 deg C and the hold-time of 1 min. Increase in the hold-time at such temperature almost does not reduce the hardness. It is established that in order to soften nickel-rhenium alloys in the process of the cold-deformation at brief annealings in the air the hold-time should not exceed 5 min at 800-900 deg C

  15. Nanograined Net-Shaped Fabrication of Rhenium Components by EB-PVD

    International Nuclear Information System (INIS)

    Singh, Jogender; Wolfe, Douglas E.

    2004-01-01

    Cost-effective net-shaped forming components have brought considerable interest into DoD, NASA and DoE. Electron beam physical vapor deposition (EB-PVD) offers flexibility in forming net-shaped components with tailored microstructure and chemistry. High purity rhenium (Re) components including rhenium-coated graphite balls, Re- plates and tubes have been successfully manufactured by EB-PVD. EB-PVD Re components exhibited sub-micron and nano-sized grains with high hardness and strength as compared to CVD. It is estimated that the cost of Re components manufactured by EB-PVD would be less than the current CVD and powder-HIP Technologies

  16. Rhenium (5) and molybdenum (5) complexes with 4',4''(5'')-ditretbutyldibenzo-24-crown-8

    International Nuclear Information System (INIS)

    Ashurova, N.Kh.; Yakubov, K.G.; Basitova, S.M.; Tashmukhamedova, A.K.; Sajfullina, N.Zh.

    1989-01-01

    Rhenium and molybdenum complexes in +5 oxidation degree with 4',4''(5'')-ditretbutyldibenzo-24-crown-8 (L) are synthesized with 75-95 % yield. Composition and structure of compounds produced are investigated using element analysis, conductometry, IR spectroscopy, thermogravimetry methods. Oxidation degree of complexer metal is determined. It is ascertained that the compound composition corresponds to the MOLX 3 formula, where M-Re, Mo; X-Cl - , Br -

  17. Complexes of technetium, rhenium, and rhodium with sexidentate Schiff-base ligands

    International Nuclear Information System (INIS)

    Hunter, G.; Kilcullen, N.

    1989-01-01

    The monocationic technetium (IV) and rhenium (IV) complexes with the sexidentate Schiff-base ligands tris[2-(2'-hydroxybenzylideneethyl)]amine and its substituted derivatives have been prepared and their electrochemical properties studied. The variable-temperature 90.6 MHz 13 C-{ 1 H} n.m.r. spectrum of the rhodium (III) complex of tris[2-(2-hydroxy-5'-isopropylbenzylideneethyl)-amine] has been observed, indicating fluxionality at temperatures above 218 K. (author)

  18. Analysis of the Nuclear Structure of Rhenium-186 Using Neutron-Induced Reactions

    Science.gov (United States)

    2015-03-26

    5 1.5 Methods ... radioisotope power source for use on the battlefield. 1 Re-Os Cosmochronometer. The isotope 187Re has a half-life in its ground state of 4.35⇥ 1010 years [2...187Os in meteorites permits one to date the nucleosynthesis of rhenium and osmium by high neutron flux events such as supernovae. The Re-Os radioactive

  19. Kinetics and mechanism of nitrobenzene hydrogenation to phenylhydroxylamine in rhenium thiocomplexes solutions

    International Nuclear Information System (INIS)

    Korenyako, G.I.; Belousov, V.M.

    1985-01-01

    A study was made on kinetics of nitrobenzene hydrogenation to phenylhydroxylamine in dimethylformamide solutions of rhenium thiocomplexes. The mechanism of hydrogenation was suggested. Formation of hydride catalyst complex represents the first stage of the process. Kinetic equation derived on the basis of suggested mechanism corresponds satisfactorily with experimental results. Thermodynamic parameters of separate process stages calculated on the basis of equilibrium constant values testify as well to the benefit of suggested mechanism

  20. The Influence of Cobalt and Rhenium on the Behaviour of MCrAlY Coatings

    OpenAIRE

    Täck, Ulrike

    2009-01-01

    Superalloys are widely applied as materials for components in the hot section of gas turbines. As superalloys have a limited oxidation life, the application of a coating is vital. The most commonly applied coatings in stationary gas turbines are MCrAlY coatings. Since the turbine components are exposed to high cyclic thermal stresses, MCrAlY coatings must also show a high thermal fatigue resistance. In this thesis, the effect of Cobalt and Rhenium on microstructure, oxidation and thermal fati...

  1. Formamidine sulfinic acid as reducing agent in technetium-99m rhenium sulfide labelling

    Energy Technology Data Exchange (ETDEWEB)

    Neves, M; Patricio, L [Laboratorio Nacional de Engenharia e Technologia Industrial, Sacavem (Portugal). Dept. de Radioisotopes; Ferronha, H [Laboratorio Nacional de Investigacao Veterinaria, Lisboa (Portugal)

    1989-08-01

    Labelling kinetic studies, radiochemical characterization and particle size evaluation of {sup 99m}Tc rhenium sulfide colloid using formamidine sulfinic acid as reducing agent are described. Comparison with the same colloid which makes use of Sn-sodium pyrophosphate complex as reducing agent showed higher labelling yields, simplification of labelling procedure and a longer shelf life when formamidine sulfinic acid was used. (author) 15 refs.; 7 figs.

  2. Chromatographic separation of rhenium in alumina-methanol/sulfuric acid system

    International Nuclear Information System (INIS)

    Oguma, Koichi

    1983-01-01

    The adsorption behavior of a number of metals on alumina was surveyed in a methanol-(0.005 -- 0.5) M H 2 SO 4 (3 : 1 v/v) developing solvent by thin-layer chromatography. Over the acid concentration range tested, Re(VII) does not favor the alumina phase to any great extent while the most other metals are strongly adsorbed on alumina. These findings allowed to establish a column chromatographic technique for selective separation of rhenium in a methanol-0.05 M H 2 SO 4 (3 : 1 v/v) eluent. The separation technique thus established was applied to molybdenite analysis for rhenium. About 100-mg powdered sample containing ca. 100 ppm rhenium was decomposed with HNO 3 and then evaporated nearly to dryness. The residue was dissolved in NH 4 OH and the excess NH 4 OH was expelled by evaporation to dryness. The residue was dissolved in 2.5-ml 0.5 M H 2 SO 4 and 10-ml water, the insoluble materials filtered off, and the filtrate diluted to exactly 25 ml with water. A 10-ml aliquot of this solution was mixed with 30-ml methanol and the mixture was passed through a column (diameter 15 mm, bed height 30 mm) containing 5 g of alumina. The column was then washed with 20 ml of a methanol-0.05 M H 2 SO 4 (3 : 1 v/v) mixture. Rhenium was recovered from the loaded solution and the subsequent washings, and was determined spectrophotometrically with Methylene Blue as a chromogenic reagent. The values obtained from four samples of molybdenite are in good agreement with those obtained by neutron activation analysis. The relative standard deviation (n = 4; calculated from the range) was between 2.0 and 5.2 %. (author)

  3. A Study on the Trapping Characteristics of Rhenium Oxide Using Ca(OH){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Tae-Kyo; Eun, Hee-Chul; Choi, Jung-Hoon; Lee, Ki-Rak; Han, Seung-Youb; Park, Hwan-Seo [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2017-01-15

    The objective of this study was to obtain basic data for trapping gaseous technetium (Tc) oxide generated from the voloxidation process in spent nuclear fuel pyroprocessing. Rhenium (Re) and Ca(OH){sub 2} were used as surrogates for the technetium and a trapping material, respectively. The trapping characteristics of rhenium oxide were investigated with changing temperatures and molar ratios of calcium (Ca) over rhenium, and the thermal behaviors of the trapping products were observed. The products following after the trapping test were identified as Ca(ReO{sub 4}){sub 2} and Ca{sub 5}Re{sub 2}O{sub 12}. The conversion to Ca{sub 5}Re{sub 2}O{sub 12} was preferred with increasing temperatures, and the trapping products were completely converted into Ca5Re2O12 under conditions exceeding 800 ℃, or when maintained at 750 ℃ for 4 hr. The trapping efficiency at a molar ratio of 2.5 (Ca:Re=5:2) was significantly superior to that at the molar ratio of 2.

  4. Characterization of rhenium compounds obtained by electrochemical synthesis after aging process

    Energy Technology Data Exchange (ETDEWEB)

    Vargas-Uscategui, Alejandro, E-mail: avargasuscat@ing.uchile.cl [Departamento de Ingeniería de Minas, Facultad de Ciencias Físicas y Matemáticas, Universidad de Chile, Tupper Av. 2069, Santiago (Chile); Mosquera, Edgar [Laboratorio de Materiales a Nanoescala, Departamento de Ciencia de los Materiales, Facultad de Ciencias Físicas y Matemáticas, Universidad de Chile, Tupper Av. 2069, Santiago (Chile); López-Encarnación, Juan M. [Department of Mathematics-Physics and Department of Chemistry, University of Puerto Rico at Cayey, 205 Ave. Antonio R. Barceló, Cayey, PR 00736, USA. (Puerto Rico); Chornik, Boris [Departamento de Física, Facultad de Ciencias Físicas y Matemáticas, Universidad de Chile, Blanco Encalada Av. 2008, Santiago (Chile); Katiyar, Ram S. [Department of Physics and Institute for Functional Nanomaterials, University of Puerto Rico San Juan, San Juan, PR 00931-3343 (United States); Cifuentes, Luis [Departamento de Ingeniería de Minas, Facultad de Ciencias Físicas y Matemáticas, Universidad de Chile, Tupper Av. 2069, Santiago (Chile)

    2014-12-15

    The proper identification of the molecular nature of the aged rhenium compound obtained by means of electrodeposition from an alkaline aqueous electrolyte was determined. Chemical, structural and vibrational experimental characterization of the aged Re compound showed agreement with quantum-computations, thereby allowing the unambiguous identification of the Re compound as H(ReO{sub 4})H{sub 2}O. - Graphical abstract: Rhenium oxides were electrodeposited on a copper surface and after environmental aging was formed the H(ReO{sub 4})H{sub 2}O compound. The characterization of the synthesized material was made through the comparison of experimental evidence with quantum mechanical computations carried out by means of density functional theory (DFT). - Highlights: • Aged rhenium compound obtained by means of electrodeposition was studied. • The study was made by combining experimental and DFT-computational information. • The aged electrodeposited material is consistent with the H(ReO{sub 4})H{sub 2}O compound.

  5. A Study on the Trapping Characteristics of Rhenium Oxide Using Ca(OH)_2

    International Nuclear Information System (INIS)

    Lee, Tae-Kyo; Eun, Hee-Chul; Choi, Jung-Hoon; Lee, Ki-Rak; Han, Seung-Youb; Park, Hwan-Seo

    2017-01-01

    The objective of this study was to obtain basic data for trapping gaseous technetium (Tc) oxide generated from the voloxidation process in spent nuclear fuel pyroprocessing. Rhenium (Re) and Ca(OH)_2 were used as surrogates for the technetium and a trapping material, respectively. The trapping characteristics of rhenium oxide were investigated with changing temperatures and molar ratios of calcium (Ca) over rhenium, and the thermal behaviors of the trapping products were observed. The products following after the trapping test were identified as Ca(ReO_4)_2 and Ca_5Re_2O_1_2. The conversion to Ca_5Re_2O_1_2 was preferred with increasing temperatures, and the trapping products were completely converted into Ca5Re2O12 under conditions exceeding 800 ℃, or when maintained at 750 ℃ for 4 hr. The trapping efficiency at a molar ratio of 2.5 (Ca:Re=5:2) was significantly superior to that at the molar ratio of 2.

  6. Diverse roles of hydrogen in rhenium carbonyl chemistry: hydrides, dihydrogen complexes, and a formyl derivative.

    Science.gov (United States)

    Li, Nan; Xie, Yaoming; King, R Bruce; Schaefer, Henry F

    2010-11-04

    Rhenium carbonyl hydride chemistry dates back to the 1959 synthesis of HRe(CO)₅ by Hieber and Braun. The binuclear H₂Re₂(CO)₈ was subsequently synthesized as a stable compound with a central Re₂(μ-H)₂ unit analogous to the B₂(μ-H)₂ unit in diborane. The complete series of HRe(CO)(n) (n = 5, 4, 3) and H₂Re₂(CO)(n) (n = 9, 8, 7, 6) derivatives have now been investigated by density functional theory. In contrast to the corresponding manganese derivatives, all of the triplet rhenium structures are found to lie at relatively high energies compared with the corresponding singlet structures consistent with the higher ligand field splitting of rhenium relative to manganese. The lowest energy HRe(CO)₅ structure is the expected octahedral structure. Low-energy structures for HRe(CO)(n) (n = 4, 3) are singlet structures derived from the octahedral HRe(CO)₅ structure by removal of one or two carbonyl groups. For H₂Re₂(CO)₉ a structure HRe₂(CO)₉(μ-H), with one terminal and one bridging hydrogen atom, lies within 3 kcal/mol of the structure Re₂(CO)₉(η²-H₂), similar to that of Re₂(CO)₁₀. For H₂Re₂(CO)(n) (n = 8, 7, 6) the only low-energy structures are doubly bridged singlet Re₂(μ-H)₂(CO)(n) structures. Higher energy dihydrogen complex structures are also found.

  7. Evaluation of oxide dispersion strengthened (ODS) molybdenum and molybdenum-rhenium alloys

    International Nuclear Information System (INIS)

    Mueller, A.J.; Bianco, R.; Buckman, R.W. Jr.

    1999-01-01

    Oxide dispersion strengthened (ODS) molybdenum alloys being developed for high temperature applications possess excellent high temperature strength and creep resistance. In addition they exhibit a ductile-to-brittle transition temperature (DBIT) in the worked and stress-relieved condition under longitudinal tensile load well below room temperature. However, in the recrystallized condition, the DBTT maybe near or above room temperature, depending on the volume fraction of oxide dispersion and the amount of prior work. Dilute rhenium additions (7 and 14 wt.%) to ODS molybdenum were evaluated to determine their effect on low temperature ductility. The addition of 7 wt.% rhenium to the ODS molybdenum did not significantly enhance the mechanical properties. However, the addition of 14 wt.% rhenium to the ODS molybdenum resulted in a DBTT well below room temperature in both the stress-relieved and recrystallized condition. Additionally, the tensile strength of ODS Mo-14Re is greater than the base ODS molybdenum at 1,000 to 1,250 C

  8. Gemini spectroscopy of the outer disk star cluster BH176

    Science.gov (United States)

    Sharina, M. E.; Donzelli, C. J.; Davoust, E.; Shimansky, V. V.; Charbonnel, C.

    2014-10-01

    Context. BH176 is an old metal-rich star cluster. It is spatially and kinematically consistent with belonging to the Monoceros Ring. It is larger in size and more distant from the Galactic plane than typical open clusters, and it does not belong to the Galactic bulge. Aims: Our aim is to determine the origin of this unique object by accurately determining its distance, metallicity, and age. The best way to reach this goal is to combine spectroscopic and photometric methods. Methods: We present medium-resolution observations of red clump and red giant branch stars in BH176 obtained with the Gemini South Multi-Object Spectrograph. We derive radial velocities, metallicities, effective temperatures, and surface gravities of the observed stars and use these parameters to distinguish member stars from field objects. Results: We determine the following parameters for BH176: Vh = 0 ± 15 km s-1, [Fe/H] = -0.1 ± 0.1, age 7 ± 0.5 Gyr, E(V - I) = 0.79 ± 0.03, distance 15.2 ± 0.2 kpc, α-element abundance [α/Fe] ~ 0.25 dex (the mean of [Mg/Fe], and [Ca/Fe]). Conclusions: BH176 is a member of old Galactic open clusters that presumably belong to the thick disk. It may have originated as a massive star cluster after the encounter of the forming thin disk with a high-velocity gas cloud or as a satellite dwarf galaxy. Appendix A is available in electronic form at http://www.aanda.org

  9. Electrodeposition of rhenium from chloride melts: Electrochemical nature, structure and applied aspects

    Directory of Open Access Journals (Sweden)

    Vinogradov-Zhabrov O.N.

    2003-01-01

    Full Text Available Processes involved in the electrodeposition of rhenium from chloride melts have been studied over the temperature interval from 680 to 970 0C at a cathodic current density of 5 to 250 mA/cm2. It has been found that rhenium is deposited in the form of continuous layers. In addition to that the growth of deposits as separate single-crystal needles has also been noticed. Continuous layers had axial growth textures. The crystallographic direction of the textures is due to electrolysis conditions, such as concentration of oxygen-containing impurities, temperature, melt composition and cathodic current density. When the concentration of oxygen-containing impurities in the melt decreased, electrolysis temperature increased, the average radius of the supporting electrolyte cations became smaller, or cathodic current density diminished, the direction of the growth textures was changing as follows: (1010 →(1120 →(101L →(0001 →(0001needles. The microhardness of the deposits in this series is 900 to 250 kg/mm2. The growth of deposits on textured rhenium substrates and single crystals having different orientations, including bent substrates, was studied. It has been found that the epitaxial growth is virtually unlimited in depth if the orientation of the substrate coincides with the growth texture under given conditions. If the substrate orientation deviated from the growth texture, the epitaxial growth was nearly absent. Kinetic parameters were measured using the galvanostatic method. The exchange current density was determined over the interval of (0.01-0.1 A/cm2 depending on the concentration of oxygen-containing impurities, cation composition, type of the surface and its condition. The parameter α⋅Z, which was estimated by two methods, was equal to 2.1-3.1. The diffusion coefficient of rhenium ions has been found to be 2.8 ⋅10 −5 cm2/s at 790 0C and 3.5 ⋅10 −5 cm2/s at 840 0C. Galvanoplastic production of rhenium products, such as

  10. 49 CFR 176.99 - Permit requirements for certain hazardous materials.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Permit requirements for certain hazardous materials. 176.99 Section 176.99 Transportation Other Regulations Relating to Transportation PIPELINE AND... CARRIAGE BY VESSEL Special Requirements for Barges § 176.99 Permit requirements for certain hazardous...

  11. 49 CFR 176.194 - Stowage of Class 1 (explosive) materials on magazine vessels.

    Science.gov (United States)

    2010-10-01

    ... magazine vessels. 176.194 Section 176.194 Transportation Other Regulations Relating to Transportation... REGULATIONS CARRIAGE BY VESSEL Detailed Requirements for Class 1 (Explosive) Materials Magazine Vessels § 176.194 Stowage of Class 1 (explosive) materials on magazine vessels. (a) General. The requirements of...

  12. 40 CFR 81.176 - San Luis Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false San Luis Intrastate Air Quality Control Region. 81.176 Section 81.176 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Quality Control Regions § 81.176 San Luis Intrastate Air Quality Control Region. The San Luis Intrastate...

  13. Therapeutic applications of Rhenium-188 in nuclear medicine and oncology - Current status and expected future perspectives

    International Nuclear Information System (INIS)

    Knapp, F. F. Jr.

    2005-01-01

    Full text: The increasing use of unsealed radioactive targeting agents for cancer treatment requires the routine availability of cost-effective radioisotopes. Rhenium-188 (Re-188; half-life 16.9 hours) is a high-energy beta-emitter (E max 2.12 MeV), readily available no- max carrier-added from the alumina-based tungsten-188 (half-life 69 days)/rhenium-188 generator system. Rhenium-188 also emits a 155 keV (15%) gamma photon, permitting gamma camera imaging for biodistribution and dosimetry evaluation. The versatile chemistry of rhenium allows attachment to a wide variety of targeting molecules for Re-188 applications in nuclear oncology for both palliative metastatic treatment and targeted tumor therapy - radionuclide synovectomy, and coronary restenosis therapy. The long parent half-life and consistent performance provide an indefinite generator shelf-life of several months with high Re-188 elution yields (75-85 %) and consistently low W-188 parent breakthrough ( -6 ). Simple post-elution concentration methods have been developed which provide very high specific volume solution of Re-188 for radiolabeling (> 700 mCi/mL saline/1 Ci generator). Over 60 physician-sponsored clinical trials are currently in progress worldwide with applications in nuclear medicine, nuclear oncology and interventional cardiology. A variety of Re-188-labeled therapeutic radiopharmaceuticals and devices are being developed for clinical trials currently in progress for treatment of both benign and metastatic oncological disorders. Palliation of metastatic bone pain with Re-188-HEDP - prepared from a simple 'kit' - has been demonstrated as a cost-effective alternative to similar agents. Recent studies have in fact demonstrated the enhancement of progression-free interval and survival time by repeated Re-188-HEDP injections to patients with metastatic disease from prostate cancer. The use of the Re-188-labeled antiNCA95 (CD66) antibody in conjunction with external beam irradiation is an

  14. Fabrication and use of zircaloy/tantalum-sheathed cladding thermocouples and molybdenum/rhenium-sheathed fuel centerline thermocouples

    International Nuclear Information System (INIS)

    Wilkins, S.C.; Sepold, L.K.

    1985-01-01

    The thermocouples described in this report are zircaloy/tantalum-sheathed and molybdenum/rhenium alloy-sheathed instruments intended for fuel rod cladding and fuel centerline temperature measurements, respectively. Both types incorporate beryllium oxide insulation and tungsten/rhenium alloy thermoelements. These thermocouples, operated at temperatures of 2000 0 C and above, were developed for use in the internationally sponsored Severe Fuel Damage test series in the Power Burst Facility. The fabrication steps for both thermocouple types are described in detail. A laser-welding attachment technique for the cladding-type thermocouple is presented, and experience with alternate materials for cladding and fuel therocouples is discussed

  15. Lattice strains in gold and rhenium under nonhydrostatic compression to 37 GPa

    International Nuclear Information System (INIS)

    Duffy, Thomas S.; Shen, Guoyin; Heinz, Dion L.; Shu, Jinfu; Ma, Yanzhang; Mao, Ho-Kwang; Hemley, Russell J.; Singh, Anil K.

    1999-01-01

    Using energy-dispersive x-ray diffraction techniques together with the theory describing lattice strains under nonhydrostatic compression, the behavior of a layered sample of gold and rhenium has been studied at pressures of 14-37 GPa. For gold, the uniaxial stress component t is consistent with earlier studies and can be described by t=0.06+0.015P where P is the pressure in GPa. The estimated single-crystal elastic moduli are in reasonable agreement with trends based on extrapolated low-pressure data. The degree of elastic anisotropy increases as α, the parameter which characterizes stress-strain continuity across grain boundaries, is reduced from 1.0 to 0.5. For rhenium, the apparent equation of state has been shown to be strongly influenced by nonhydrostatic compression, as evidenced by its dependence on the angle ψ between the diffracting plane normal and the stress axis. The bulk modulus obtained by inversion of nonhydrostatic compression data can differ by nearly a factor of 2 at angles of 0 degree sign and 90 degree sign . On the other hand, by a proper choice of ψ, d spacings corresponding to quasihydrostatic compression can be obtained from data obtained under highly nonhydrostatic conditions. The uniaxial stress in rhenium over the pressure range from 14-37 GPa can be described by t=2.5+0.09P. The large discrepancy between x-ray elastic moduli and ultrasonic data and theoretical calculations indicates that additional factors such as texturing or orientation dependence of t need to be incorporated to more fully describe the strain distribution in hexagonal-close-packed metals. (c) 1999 The American Physical Society

  16. Thermal decomposition of rhenium (5) complexes with 1,2,4-triazole

    International Nuclear Information System (INIS)

    Amindzhanov, A.A.; Gagieva, S.Ch.; Kotegov, K.V.

    1991-01-01

    Processes of thermal decomposition of rhenium (5) complexes with 1,2,4-triazole were studied. Thermolysis products were identified on the basis of data of the element analysis, IR spectra, conductometry and other methods. It is ascertained that at the first stage of thermolysis of hydroxyl-containing monomer complexes removal of water molecules occurs, and at the second one - dimerization process with formation of Re-O-Re group. It is shown that the nature of halide ion practically does not affect the temperature of the start of intensive thermal decomposition of the complexes

  17. Rhenium(5) and molybdenum(5) complexes with 4',4(5)-divaleryldibenzo-18-crown-6

    International Nuclear Information System (INIS)

    Ashurova, N.Kh.; Yakubov, K.G.; Tashmukhamedova, A.K.; Basitova, S.M.

    1993-01-01

    Methods for synthesizing oxohalide complexes of rhenium and molybdenum with +5 oxidation degree with 4',4 (5) -divaleryldibenzo-18-crown-6 were developed. Content and composition of prepared compounds were investigated by the methods of element analysis, crystal optics, conductometry, IR spectroscopy in the near and far regions, thermogravimetry. Oxidation degree of the complex-forming metal was determined. It was established that composition of the compounds coressponded to the general formula MOLX · H 2 O, where M - Re, Mo; L -4',4 (5) -divaleryldibenzo-18-crown-6; X -Cl - , Br -

  18. Broad Detection Range Rhenium Diselenide Photodetector Enhanced by (3-Aminopropyl)Triethoxysilane and Triphenylphosphine Treatment.

    Science.gov (United States)

    Jo, Seo-Hyeon; Park, Hyung-Youl; Kang, Dong-Ho; Shim, Jaewoo; Jeon, Jaeho; Choi, Seunghyuk; Kim, Minwoo; Park, Yongkook; Lee, Jaehyeong; Song, Young Jae; Lee, Sungjoo; Park, Jin-Hong

    2016-08-01

    The effects of triphenylphosphine and (3-aminopropyl)triethoxysilane on a rhenium diselenide (ReSe2 ) photodetector are systematically studied by comparing with conventional MoS2 devices. This study demonstrates a very high performance ReSe2 photodetector with high photoresponsivity (1.18 × 10(6) A W(-1) ), fast photoswitching speed (rising/decaying time: 58/263 ms), and broad photodetection range (possible above 1064 nm). © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Fate of rhenium in the environment as a chemical analogue of technetium

    International Nuclear Information System (INIS)

    Tagami, Keiko; Uchida, Shigeo

    2007-01-01

    Concentrations of rhenium, a chemical analogue of Tc, were measured in various environmental samples by ICP-MS to obtain information values on long-lived 99 Tc mobility in the environment. From the results, it was assumed that Re was removed from the rock and soil by water due to weathering and transport to the sea through rivers. The element would be retained in seawater for a long time, i.e., 2 x 10 5 to 7.5 x 10 5 y. The reservoirs of Re in the sea would be seaweeds, and anoxic and suboxic sediments, especially slightly below the water-sediment interface. (author)

  20. Synthesis, molecular structure and magnetic properties of a rhenium(IV) compound with catechol

    Science.gov (United States)

    Cuevas, A.; Geis, L.; Pintos, V.; Chiozzone, R.; Sanchíz, J.; Hummert, M.; Schumann, H.; Kremer, C.

    2009-03-01

    A novel Re(IV) complex containing catechol as ligand has been prepared and characterized. The crystal structure of (HNEt 3)(NBu 4)[ReCl 4(cat)]·H 2cat was determined. The rhenium ion presents a distorted octahedral geometry, being bonded to a bidentate catecholate group and four chloride anions. The magnetic properties of the complex were studied, a /2 D/ (the energy gap between ±3/2 and ±1/2 Kramers doublets) value of 190(10) cm -1. This is the largest /2 D/ value reported for Re(IV) up to now.

  1. The analysis of mechanism of rhenium-coated tools' wear-resistance rising

    Directory of Open Access Journals (Sweden)

    Daniel Petrosyan

    2017-06-01

    Full Text Available It is proposed to obtain wear-resistant layers on the hard-alloy materials by thermochemical treatment. In the different field of production – mechanical engineering, metallurgy and military technologies, with machine parts demanding high wearproof and corrosion-proof machinery parts on the surfaces of syntheses of diamonds, with metal surface thermal-diffusion with rhenium, to receive diffusion wearing layers for the first time. A method for thermochemical treatment of hard alloy plates has been investigated, allowing to raise the wear-resistance of cutting and mining tools.

  2. Development of a radiochemical neutron activation analysis procedure for determination of rhenium in biological and environmental samples at ultratrace level

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Byrne, A. R.; Mizera, Jiří; Lučaníková, M.; Řanda, Zdeněk

    2006-01-01

    Roč. 269, č. 2 (2006), s. 251-257 ISSN 0236-5731 R&D Projects: GA ČR(CZ) GA203/04/0943 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiochemical neutron activation analysis * rhenium * biological and environmental samples Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006

  3. Effect of operational parameters and internal recycle on rhenium solvent extraction from leach liquors using a mixer-settler

    Directory of Open Access Journals (Sweden)

    Mostafa Hosseinzadeh

    2014-06-01

    Full Text Available The extraction of rhenium from molybdenite roasting dust leach solution was performed using a mixer-settler extractor by tributyl phosphate (TBP diluted in kerosene as the extractant. In the single-stage extraction experiments, effect of the aqueous to organic phase ratios, Qa/Qo, and the number of extraction stages, N, on the rhenium extraction was studied. It was found that using the phase ratio of 1:1 in a two-stage extraction, 87.5% depletion of rhenium was obtained. The comparison of experimental results with the continuous co-current extraction showed a good agreement. The effect of internal recycle of organic phase was investigated in the phase ratio of 1:1 by changing the flow rate ratio of recycle-to-fresh organic phase, Qro/Qfo. The optimum performance was achieved in the phase ratio, Qro/Qfo, equal to 3:7. It was found that improvement in the performance of the mixer-settler for the rhenium-TBP system can be obtained in the phase ratio of 1:1when Qro/Qfo = 3:7.

  4. Separation of Rhenium from Lead-Rich Molybdenite Concentrate via Hydrochloric Acid Leaching Followed by Oxidative Roasting

    Directory of Open Access Journals (Sweden)

    Guanghui Li

    2016-11-01

    Full Text Available Lead-rich molybdenite is a typical rhenium-bearing molybdenum resource in China, which has not been efficiently utilized due to its high contents of lead and gangue minerals. In this study, hydrochloric acid was used for preliminarily removing lead and calcite from a lead-rich molybdenite concentrate. Oxidative roasting-ammonia leaching was then carried out for separation of rhenium and extraction of molybdenum. The hydrochloric acid leaching experiments revealed that 93.6% Pb and 97.4% Ca were removed when the leaching was performed at 95 °C for 10 min with HCl concentration of 8 wt. % and liquid-solid ratio of 5 (mL/g. The results of direct oxidative roasting indicated that 89.3% rhenium was volatilized from the raw concentrate after roasting at 600 °C for 120 min in air. In contrast, the rhenium volatilization was enhanced distinctly to 98.0% after the acid-leached concentrate (leaching residue was roasted at 550 °C for 100 min. By the subsequent ammonia leaching, 91.5% molybdenum was leached out from the calcine produced from oxidative roasting of the acid-leached concentrate, while only 79.3% Mo was leached from the calcine produced by roasting molybdenite concentrate without pretreatment.

  5. Rhenium-catalyzed dehydrogenative olefination of C(sp(3))-H bonds with hypervalent iodine(III) reagents.

    Science.gov (United States)

    Gu, Haidong; Wang, Congyang

    2015-06-07

    A dehydrogenative olefination of C(sp(3))-H bonds is disclosed here, by merging rhenium catalysis with an alanine-derived hypervalent iodine(III) reagent. Thus, cyclic and acyclic ethers, toluene derivatives, cycloalkanes, and nitriles are all successfully alkenylated in a regio- and stereoselective manner.

  6. Oxidation of iridium coating on rhenium coated graphite at elevated temperature in stagnated air

    International Nuclear Information System (INIS)

    Huang, Yongle; Bai, Shuxin; Zhang, Hong; Ye, Yicong

    2015-01-01

    Highlights: • Continuous and dense Ir coatings were prepared on graphite by electrodepostion. • The purification of the as-prepared Ir coating was higher than about 99.98%. • The Ir/Re/C specimen kept integrity without significant failures after oxidation. • The average oxidation rate of the Ir coating was about 0.219 mg/(cm 2 min). • Penetrating holes at gains boundaries resulted in the failure of the Ir coating. - Abstract: Continuous and dense iridium coatings were prepared on the rhenium coated graphite specimens by electrodeposition. The iridium/rhenium coated graphite (Ir/Re/C) specimens were oxidized at elevated temperatures in stagnated air for 3600 s. The purification of the as-prepared Ir coating was higher than about 99.98% with the main impurity elements Si, Al, Fe and Ru. After oxidation, the Ir/Re/C specimens kept integrity without significant failures and the average oxidation rate was about 0.219 mg/(cm 2 min). Pores were found at the grain boundaries and concentrated to penetrating holes with the growth of Ir grains, which resulted in disastrous failures of the Ir coating

  7. Oxidation of iridium coating on rhenium coated graphite at elevated temperature in stagnated air

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Yongle; Bai, Shuxin, E-mail: NUDT_MSE_501@163.com; Zhang, Hong; Ye, Yicong

    2015-02-15

    Highlights: • Continuous and dense Ir coatings were prepared on graphite by electrodepostion. • The purification of the as-prepared Ir coating was higher than about 99.98%. • The Ir/Re/C specimen kept integrity without significant failures after oxidation. • The average oxidation rate of the Ir coating was about 0.219 mg/(cm{sup 2} min). • Penetrating holes at gains boundaries resulted in the failure of the Ir coating. - Abstract: Continuous and dense iridium coatings were prepared on the rhenium coated graphite specimens by electrodeposition. The iridium/rhenium coated graphite (Ir/Re/C) specimens were oxidized at elevated temperatures in stagnated air for 3600 s. The purification of the as-prepared Ir coating was higher than about 99.98% with the main impurity elements Si, Al, Fe and Ru. After oxidation, the Ir/Re/C specimens kept integrity without significant failures and the average oxidation rate was about 0.219 mg/(cm{sup 2} min). Pores were found at the grain boundaries and concentrated to penetrating holes with the growth of Ir grains, which resulted in disastrous failures of the Ir coating.

  8. Neutron activation determination of rhenium in mineral raw materials of complex composition

    International Nuclear Information System (INIS)

    Shiryaeva, M.B.; Lyubimova, L.N.; Salmin, Yu.P.; Ryumina, K.N.; Tatarkin, M.A.

    1984-01-01

    The method of neutron-activation rhenium determination in mineral raw material of complex composition is developed, according to which easily hydrolized elements: scandium, iron, lanthanum, ytterbium, protactinium, hafnium and partially ruthenium and osmium are isolated in the form of hydroxides after smelting of a sample, which has been previously irradiated in nuclear reactor (thermal neutron flux 1.2x10 13 n/cm 2 xs for 22 hr) with sodium peroxide and leaching of the melt by water. To separate Re from other interfering elements extraction of perrhenate-ion by methylethylketone from alkali solution is used. Interfering effect of gold is eliminated by its extraction with TBP 30% solution in toluence or benzene from 1 M HNO 3 . Activity of rhenium preparations, singled out from samples of comparison, is measured, using multichannel γ-spectrometer with Ge(Li)-coaxial detector of high resolution (approximately 2.0-2.2 keV over the line 122 keV 5+ Co). Relative standard deviation in Re content range 5x10 -7 -5x10 -2 % does not exceed 0.3

  9. Effect of the method for rhenium neptasulfide preparation on its catalytic properties in hydrogenation of nitrobenzene and m-nitrobenzoic acid

    International Nuclear Information System (INIS)

    Pal'chevskaya, T.A.; Bogutskaya, L.V.; Belousov, V.M.

    1988-01-01

    The effect of conditions of rhenium heptasulfide synthesis by thiosulfate method on its physicochemical and catalytic properties during hydrogenation of nitrobenzene and m-nitrobenzoic acid has been studied. It is shown that the maximum yield of m-aminobenzoic acid can be attained on insoluble sulfide rhenium contacts, containing excessive amount of sulfur (3.5 %). Under certain conditions of catalyst synthesis particles of Re 2 S 7 soluble in dimethylformamide are formed, which possess selectivity towards amine

  10. Monte Carlo criticality analysis of simple geometries containing tungsten-rhenium alloys engrained with uranium dioxide and uranium mononitride

    International Nuclear Information System (INIS)

    Webb, Jonathan A.; Charit, Indrajit

    2011-01-01

    Highlights: → The addition of rhenium to the tungsten matrix within W-UO 2 and W-UN CERMET materials can help reduce the risk of submersion criticality accidents while increasing the strength and ductility of tungsten based nuclear fuel elements. → The addition of rhenium up to 30 at.% to simple geometries containing W-UO 2 mixtures can increase the critical mass by 65 kg. → The addition of rhenium up to 30 at.% to simple geometries containing W-UN mixtures can increase the critical mass by 22 kg. → The addition of rhenium by up to 30 at.% to simple geometries containing W-UO 2 mixtures can reduce the change in reactivity change due to water submersion by $5.07. → The addition of rhenium by up to 30 at.% to simple geometries containing W-UN mixtures can reduce the change in reactivity due to water submersion by $3.24. - Abstract: The critical mass and dimensions of simple geometries containing highly enriched uranium dioxide (UO 2 ) and uranium mononitride (UN) encapsulated in tungsten-rhenium alloys are determined using MCNP5 criticality calculations. Spheres as well as cylinders with length to radius ratios of 1.82 are computationally built to consist of 60 vol.% fuel and 40 vol.% metal matrix. Within the geometries, the uranium is enriched to 93 wt.% uranium-235 and the rhenium content within the metal alloy was modeled over the range of 0-30 at.%. The spheres containing UO 2 were determined to have a critical radius of 18.29-19.11 cm and a critical mass ranging from 366 kg to 424 kg. The cylinders containing UO 2 were found to have a critical radius ranging from 17.07 cm to 17.84 cm with a corresponding critical mass of 406-471 kg. Spheres engrained with UN were determined to have a critical radius ranging from 14.82 cm to 15.19 cm and a critical mass between 222 kg and 242 kg. Cylinders which were engrained with UN were determined to have a critical radius ranging from 13.81 cm to 14.15 cm and a corresponding critical mass of 245-267 kg. The critical

  11. Chronic subdural hematoma: epidemiological and prognostic analysis of 176 cases

    Directory of Open Access Journals (Sweden)

    JAMIL FARHAT NETO

    Full Text Available Objective : To characterize patients with chronic subdural hematoma undergoing surgery and to identify prognostic indicators. Methods : We conducted a retrospective analysis of patients diagnosed with chronic subdural hematoma (CSDH undergoing surgical treatment. We analyzed: age, period from trauma to diagnostic imaging, pre and postoperative Glasgow coma scale, type of surgery, associated comorbidities, use of postoperative drainage and outpatient treatment. Results : The sample consisted of 176 patients, 126 male and 50 female patients (ratio 2.5 : 1, ages ranged from six months to 97 years, with an average of 59.3 years. CSDH was caused by trauma in 52% of patients, with the time from trauma to imaging averaging 25.05 days; 37.7% were hypertensive patients and 20% had a neurological disease. Eighty-five (48.3% patients were elderly and altered consciousness was present in 63% of cases. Of the 91 (51.7% non-elderly patients, 44% presented with headache, altered consciousness occurred in 40% and motor abnormalities in 27.5%. The CSDH was located on the right in 41%, left in 43% and bilaterally in 16% of patients. Conclusion : the change of consciousness was the most common clinical alteration in the elderly and headache in non-elderly. The most associated comorbidity was the arterial hypertension and the most frequent cause, head trauma. The trepanation with two oriffices associated with a closed drainage system was the most used operating, with high efficacy and low complication rate.

  12. Dipole compensation of the 176 MHz MYRRHA RFQ

    Energy Technology Data Exchange (ETDEWEB)

    Kuempel, Klaus; Podlech, Holger; Lenz, Christoph; Petry, Nils [IAP, University of Frankfurt, Frankfurt am Main (Germany); Bechtold, Alexander [NTG Neue Technologien GmbH und Co.KG, Gelnhausen (Germany); Zhang, Chuan [GSI Helmholtzzentrum, Darmstadt (Germany)

    2016-07-01

    The MYRRHA (Multi-purpose hYbrid Research Reactor for High-tech Applications) Project is planned as an accelerator driven system (ADS) for the transmutation of long-living radioactive waste. For this project a cw 4-rod-RFQ with 176 MHz and a total length of about 4 m is required. It is supposed to accelerate protons from 30 keV up to 1.5 MeV*. One of the main tasks during the development of the RFQ is the very high reliability of the accelerator to limit the thermal stress inside the reactor. Another challenge was to compensate the dipole component of the MYRRHA-RFQ which is due to the design principle of 4-rod-RFQs. This dipole component is responsible for shifting the ideal beam axis from the geometrical center of the quadrupole downwards. Design studies with CST MICROWAVE STUDIO have shown that the dipole component can be almost completely compensated by widening the stems alternately so that the current paths of the lower electrodes are increased.

  13. Hot rocket plume experiment - Survey and conceptual design. [of rhenium-iridium bipropellants

    Science.gov (United States)

    Millard, Jerry M.; Luan, Taylor W.; Dowdy, Mack W.

    1992-01-01

    Attention is given to a space-borne engine plume experiment study to fly an experiment which will both verify and quantify the reduced contamination from advanced rhenium-iridium earth-storable bipropellant rockets (hot rockets) and provide a correlation between high-fidelity, in-space measurements and theoretical plume and surface contamination models. The experiment conceptual design is based on survey results from plume and contamination technologists throughout the U.S. With respect to shuttle use, cursory investigations validate Hitchhiker availability and adaptability, adequate remote manipulator system (RMS) articulation and dynamic capability, acceptable RMS attachment capability, adequate power and telemetry capability, and adequate flight altitude and attitude/orbital capability.

  14. Hydrodeoxygenation of vicinal OH groups over heterogeneous rhenium catalyst promoted by palladium and ceria support.

    Science.gov (United States)

    Ota, Nobuhiko; Tamura, Masazumi; Nakagawa, Yoshinao; Okumura, Kazu; Tomishige, Keiichi

    2015-02-02

    Heterogeneous ReOx-Pd/CeO2 catalyst showed excellent performance for simultaneous hydrodeoxygenation of vicinal OH groups. High yield (>99%), turnover frequency (300 h(-1)), and turnover number (10,000) are achieved in the reaction of 1,4-anhydroerythritol to tetrahydrofuran. This catalyst can be applied to sugar alcohols, and mono-alcohols and diols are obtained in high yields (≥85%) from substrates with even and odd numbers of OH groups, respectively. The high catalytic performance of ReOx-Pd/CeO2 can be assigned to rhenium species with +4 or +5 valence state, and the formation of this species is promoted by H2/Pd and the ceria support. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. 188Rhenium-HEDP in the Treatment of Pain in Bone Metastases

    International Nuclear Information System (INIS)

    Gaudiano, J.; Savio, E.; Robles, A.; Muniz, S.; Leon, A.; Verdera, S.; Martinez, G.; Hermida, J.C.; Knapp, F.F. Jr.

    1999-01-01

    Systemic use of radiopharmaceuticals is a recognized alternative method for the treatment of pain in patients with multiple bone metastasis. A new option, 188 Re-HEDP is proposed, using generator-obtained 188 Rhenium (β energy = 2.1 MeV, γ energy = 155 keV, half-life = 16.9 hours). After establishing parameters of biodistribution, dosimetry and image acquisition in mice, rats and rabbits, Phase I and II studies were conducted on 12 patients with multiple metastasis from carcinomas, with pain surpassing other analgesic options. More than 50% pain relief was found in 91% of the patients, with total relief during a variable period in 41% of them allowing opiate and other analgesic drugs to be decreased or withdrawn, and showing a lower bone marrow contribution to total absorbed dose than that reported for other similar radiopharmaceuticals. Further study of this option is recommended in order to determine higher dose protocols without toxic bone marrow reaction possibilities

  16. Determination of rhenium in biological and environmental samples by radiochemical neutron activation analysis

    International Nuclear Information System (INIS)

    Kucera, J.; Mizera, J.; Randa, Z.; Byrne, A.R.; Lucanikova, M.

    2006-01-01

    Radiochemical neutron activation procedures using liquid-liquid extraction with tetraphenylarsonium chloride in chloroform from 1 M HCl and solid extraction with ALIQUAT 336 incorporated in a polyacrylonitrile binding matrix from 0.1 M HCl were developed for accurate determination of rhenium in biological and environmental samples at the sub-ng.g -1 level. Concentrations of Re in the range of 0.1 to 2.4 ng.g -1 were determined in several botanical reference materials (RM), while in a RM of road dust a value of approx. 10 ng.g -1 was found. Significantly elevated values of Re, up to 90 ng.g -1 , were found in seaweed (brown algae). Results for Re in the brown algae Fucus vesiculosus in which elevated 99 Tc values had previously been determined suggest possible competition between Re and Tc in the accumulation process. (author)

  17. Click-to-Chelate: Development of Technetium and Rhenium-Tricarbonyl Labeled Radiopharmaceuticals

    Directory of Open Access Journals (Sweden)

    Thomas L. Mindt

    2013-03-01

    Full Text Available The Click-to-Chelate approach is a highly efficient strategy for the radiolabeling of molecules of medicinal interest with technetium and rhenium-tricarbonyl cores. Reaction of azide-functionalized molecules with alkyne prochelators by the Cu(I-catalyzed azide-alkyne cycloaddition (CuAAC; click reaction enables the simultaneous synthesis and conjugation of tridentate chelating systems for the stable complexation of the radiometals. In many cases, the functionalization of (biomolecules with the ligand system and radiolabeling can be achieved by convenient one-pot procedures. Since its first report in 2006, Click-to-Chelate has been applied to the development of numerous novel radiotracers with promising potential for translation into the clinic. This review summarizes the use of the Click-to-Chelate approach in radiopharmaceutical sciences and provides a perspective for future applications.

  18. Mechanical properties of tungsten following rhenium ion and helium plasma exposure

    Directory of Open Access Journals (Sweden)

    C.S. Corr

    2017-08-01

    Full Text Available Mechanical properties of Tungsten (W samples irradiated with 2 MeV Rhenium (Re ions and helium (He plasma were investigated using nanoindentation. It was found that there was an increase in hardness for all samples following separate irradiation with both Re ion and He plasma. A slight increase in hardness was obtained for combined exposures. A comparable increase in hardness was observed for a pure He plasma with a sample temperature of 473 K and 1273 K. Optical interferometry was employed to compare surface modification of the samples. Grazing incidence small angle x-ray scattering confirmed He nano-bubble formation of approximately 1 nm diameter in the higher temperature sample, which was not observed with samples at the lower temperatures.

  19. Tracing oxidative weathering from the Andes to the lowland Amazon Basin using dissoved rhenium

    Science.gov (United States)

    Dellinger, M.; Hilton, R. G.; West, A. J.; Torres, M.; Burton, K. W.; Clark, K. E.; Baronas, J. J.

    2016-12-01

    Over long timescales (>105 yrs), the abundance of carbon dioxide (CO2) in the atmosphere is determined by the balance of the major carbon sources and sinks. Among the major carbon sources, the oxidation of organic carbon contained within sedimentary rocks ("petrogenic" carbon, or OCpetro) is thought to result in CO2 emission of similar magnitude to that released by volcanism. Rhenium (Re) has been proposed as a proxy for tracing OCpetro oxidation. Here we investigate the source, behavior and flux of dissolved and particulate rhenium (Re) in the Madre de Dios watershed (a major Andean tributary of the Amazon River) and the lowlands, aiming to characterize the behavior of Re in river water and quantify the flux of CO2 released by OCpetro oxidation. Measured Re concentrations in Andean rivers range from 0.07 to 1.55 ppt. In the Andes, Re concentration do not change significantly with water discharge, whereas in the lowlands, Re concentration decrease at high water discharge. Mass balance calculation show that more than 70% of the dissolved Re is sourced from the oxidation of OCpetro the Andes-floodplain system. We calculate dissolved Re flux over a hydrological year to estimate the rates of oxidative weathering, and the associated CO2 release from OCpetro. Rates are high in the Andean headwaters, consistent with estimates from other mountain rivers with similar rates of physical erosion. We find evidence that a significant amount of additional oxidation (Re flux) happens during floodplain transport. These results have important implications for improving our understanding of the source and processes controlling Re in rivers, and allowing us to quantify long-term OCpetro cycling in large river basins.

  20. Rhenium and technetium complexes with phenylbis(2-pyridyl)phosphine and tris(2-pyridyl)phosphine

    Energy Technology Data Exchange (ETDEWEB)

    Saucedo A, S. A. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Calle Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico); Hagenbach, A.; Abram, U., E-mail: ssaucedo@uaz.edu.m [Institut fur Chemie und Biochemie, Freie Universitat Berlin, Fabeckstr. 34-36, D-14195, Berlin (Germany)

    2010-10-15

    Reactions of common technetium and rhenium precursors with 2-pyridyl phosphines produce novel, air stable tricarbonyl and oxo complexes. (NEt{sub 4}){sub 2}[Re(CO){sub 3}Br{sub 3}] or (NEt{sub 4}){sub 2}[Tc(CO){sub 3}Cl{sub 3}] react with phenylbis(2-pyridyl)phosphine (PPhpy{sub 2}) or tris(2-pyridyl)phosphine (Ppy{sub 3}) under formation of neutral tricarbonyl complexes of the composition [M(CO){sub 3}X(L)] (M = Re, X = Br; M = Tc, X = Cl, L = PPhpy{sub 2} or Ppy{sub 3}), where the ligands coordinate only with two for their nitrogen atoms. Removal of the bromo ligands from (NEt{sub 4}){sub 2}[Re(CO){sub 3}(Br){sub 3}] with AgNO{sub 3}, to force a tripodal coordination, and the subsequent reaction with the Ppy{sub 3} results in the formation of the complex [Re(CO){sub 3}(NO{sub 3})(Ppy{sub 3}{sup -}N,N{sup '})] with a monodentate coordinated nitrato ligand. (NBu{sub 4})[ReOCl{sub 4}] reacts with PPhpy{sub 2} to give the asymmetric, oxo-bridged rhenium (V) dimer (NBu{sub 4})[Re{sub 2}O{sub 2}Cl{sub 5}({mu}-PPhpy{sub 2}{sup -}P,N,N,N{sup '})({mu}-O)], while a similar reaction with (ReOCl{sub 3}(PPh{sub 3}){sub 2}] in boiling Thf results in reduction of the metal and gives (ReCl{sub 3}(OPPhpy{sub 2})(PPh{sub 3})]. The products have been characterized spectroscopically and by X-ray structure analyses. (Author)

  1. Rhenium-188: Availability from the W-188/Re-188 Generator and Status of Current Applications

    International Nuclear Information System (INIS)

    Pillai, M.R.A.; Dash, A.; Knapp, Russ F. Jr.

    2012-01-01

    Rhenium-188 is one of the most readily available generator derived and useful radionuclides for therapy emitting β-particles (2.12 MeV, 71.1% and 1.965 MeV, 25.6%) and imageable gammas (155 KeV, 15.1%). The 188W/188Re generator is an ideal source for the long term (4-6 months) continuous availability of no carrier added (nca) 188Re suitable for the preparation of radiopharmaceuticals for radionuclide therapy. The challenges associated with the double neutron capture route of production of the parent 188W radionuclide have been a major impediment in the progress of application of 188Re. Tungsten-188 of adequate specific activity can be prepared only in 2-3 of the high flux reactors operating in the World. Several useful technologies have been developed for the preparation of clinical grade 188W/188Re generator. Since the specific activity of 188W used in the generator is relatively low (<5 Ci/g), the eluted 188ReO4- can have low radioactive concentration often insufficient for radiopharmaceutical preparation. However, several efficient post elution concentration techniques have been developed that yield clinically useful 188ReO4-. Rhenium-188 has been used for the preparation of therapeutic radiopharmaceuticals for the management of diseases such as bone metastasis, rheumatoid arthritis and primary cancers. Several early phase clinical studies using radiopharmaceuticals based on 188Re-labeled phosphonates, antibodies, peptides, lipiodol and particulates have been reported. This article reviews the availability, and use of188Re including a discussion of why broader use of 188Re has not progressed as ecpected as a popular radionuclide for therapy.

  2. Rhenium Alloys as Ductile Substrates for Diamond Thin-Film Electrodes.

    Science.gov (United States)

    Halpern, Jeffrey M; Martin, Heidi B

    2014-02-01

    Molybdenum-rhenium (Mo/Re) and tungsten-rhenium (W/Re) alloys were investigated as substrates for thin-film, polycrystalline boron-doped diamond electrodes. Traditional, carbide-forming metal substrates adhere strongly to diamond but lose their ductility during exposure to the high-temperature (1000°C) diamond, chemical vapor deposition environment. Boron-doped semi-metallic diamond was selectively deposited for up to 20 hours on one end of Mo/Re (47.5/52.5 wt.%) and W/Re (75/25 wt.%) alloy wires. Conformal diamond films on the alloys displayed grain sizes and Raman signatures similar to films grown on tungsten; in all cases, the morphology and Raman spectra were consistent with well-faceted, microcrystalline diamond with minimal sp 2 carbon content. Cyclic voltammograms of dopamine in phosphate-buffered saline (PBS) showed the wide window and low baseline current of high-quality diamond electrodes. In addition, the films showed consistently well-defined, dopamine electrochemical redox activity. The Mo/Re substrate regions that were uncoated but still exposed to the diamond-growth environment remained substantially more flexible than tungsten in a bend-to-fracture rotation test, bending to the test maximum of 90° and not fracturing. The W/Re substrates fractured after a 27° bend, and the tungsten fractured after a 21° bend. Brittle, transgranular cleavage fracture surfaces were observed for tungsten and W/Re. A tension-induced fracture of the Mo/Re after the prior bend test showed a dimple fracture with a visible ductile core. Overall, the Mo/Re and W/Re alloys were suitable substrates for diamond growth. The Mo/Re alloy remained significantly more ductile than traditional tungsten substrates after diamond growth, and thus may be an attractive metal substrate for more ductile, thin-film diamond electrodes.

  3. 19 CFR 176.22 - Deletion of protest or entry number.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Deletion of protest or entry number. 176.22... Facts § 176.22 Deletion of protest or entry number. If any protest number or entry number is to be... authorized official making and approving the deletion. [T.D. 70-181, 35 FR 13433, Aug. 22, 1970] ...

  4. 40 CFR 265.176 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 265.176 Section 265.176 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

  5. 40 CFR 264.176 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 264.176 Section 264.176 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE...

  6. 31 CFR 363.176 - May a converted savings bond be pledged or used as collateral?

    Science.gov (United States)

    2010-07-01

    ... pledged or used as collateral? 363.176 Section 363.176 Money and Finance: Treasury Regulations Relating to... a converted savings bond be pledged or used as collateral? A converted savings bond may not be pledged or used as collateral for the performance of an obligation. ...

  7. 2 CFR 176.90 - Non-application to acquisitions covered under international agreements.

    Science.gov (United States)

    2010-01-01

    ... are: (1) The World Trade Organization Government Procurement Agreement (Aruba, Austria, Belgium... under international agreements. 176.90 Section 176.90 Grants and Agreements OFFICE OF MANAGEMENT AND...-application to acquisitions covered under international agreements. Acquisitions covered by international...

  8. 49 CFR 176.410 - Division 1.5 materials, ammonium nitrate and ammonium nitrate mixtures.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Division 1.5 materials, ammonium nitrate and ammonium nitrate mixtures. 176.410 Section 176.410 Transportation Other Regulations Relating to... nitrate and ammonium nitrate mixtures. (a) This section prescribes requirements to be observed with...

  9. Nuclear high-spin data for A = 174, 176 and 184

    Energy Technology Data Exchange (ETDEWEB)

    Junde, Huo [Jilin Univ. (China). Dept. of Physics

    1996-06-01

    Nuclear high-spin data are important in the frontier areas of nuclear structure physics. The information on A = 174, 176 and 184 mass chains from various reaction experiments together with their adopted high-spin levels and gamma transition properties are presented and discussed. High-spin data for A = 174, 176 and 184 mass chains were evaluated in 1995.

  10. 49 CFR 176.54 - Repairs involving welding, burning, and power-actuated tools and appliances.

    Science.gov (United States)

    2010-10-01

    ...-actuated tools and appliances. 176.54 Section 176.54 Transportation Other Regulations Relating to..., burning, and power-actuated tools and appliances. (a) Except as provided in paragraph (b) of this section, repairs or work involving welding or burning, or the use of power-actuated tools or appliances which may...

  11. sup(99m)Tc-sulfur-rhenium-colloid and 111In-indiumcitrate in the bone marrow scintigraphy

    International Nuclear Information System (INIS)

    Glaubitt, D.; Haberland, K.; Knoch, K.; Fejer, F.L.; Zachariah, S.; Staedtische Krankenanstalten Krefeld

    1975-01-01

    Bone marrow scintigraphy using 111 In-Indium-citrate and sup(99m)Tc-sulfur rhenium colloid was compared with each other in 6 male and 3 female patients. Our results in all patients were in favour of 111 In-citrate which caused a better delineation of morphological details than sup(99m)Tc-sulfur rhenium colloid did. In the first days after intravenous administration of 111 In-citrate, radioindium accumulated markedly in the pudendal region, this finding being more distinct in male patients than in female ones. On account of these results a considerable radiation dose has to be assumed in bone marrow scintigraphy using 111 In-citrate as long as the absorbed dose from 111 In has not been estimated under consideration of the radioindium accumulation in the pudendal region. 111 In-citrate should be applied in bone marrow scanning only exceptionally and sup(99m)Tc-sulfur rhenium colloid be preferred in the routine diagnostics of bone marrow. (orig.) [de

  12. Influence of the acid and basic properties of rhenium oxide supported on alumina catalyst on the catalytic performance in olefin metathesis; Influence des proprietes acido-basiques de l`oxyde de rhenium supporte sur les performances catalytiques en metathese des olefines

    Energy Technology Data Exchange (ETDEWEB)

    Nahama, F.

    1996-11-30

    The aim of this work is to study the influence of the acid-basic properties of rhenium oxide supported on alumina catalyst on the catalytic performance in olefin metathesis. The literature data indicate that the environment of the active site does possess acid properties. However, the nature of the acid sites is still matter of debate. Concerning the Re O{sub x} - Al{sub 2}O{sub 3} interactions, we have shown that perrhenate ions are electrostatically absorbed on alumina. The uptake of rhenium is favoured at acidic pH (below 4), and the absorbed rhenium is in equilibrium with rhenium in solution. The results of rhenium extraction by water strongly suggest that the surface compounds of the calcined Re{sub 2}O{sub 7}/Al{sub 2}O{sub 3} materials is aluminium perrhenate. Characterization of surface acidity of the catalyst by infrared spectroscopy reveals that the initiation of the metathesis reaction is governed essentially by Lewis acidity. This strongly supports the role of Lewis acidity, which is exalted by the increase of the rhenium content and the calcination temperature. Finally, we point out by ammonia adsorption-thermodesorption a band at 1320 cm{sup -1} characteristic of the Lewis acidity of aluminium perrhenate. This result is a second indication of the presence of aluminium perrhenate on the Re{sub 2}O{sub 7}/Al{sub 2}O{sub 3} catalyst surface. (author)

  13. 49 CFR 17.6 - What procedures apply to the selection of programs and activities under these regulations?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What procedures apply to the selection of programs and activities under these regulations? 17.6 Section 17.6 Transportation Office of the Secretary of Transportation INTERGOVERNMENTAL REVIEW OF DEPARTMENT OF TRANSPORTATION PROGRAMS AND ACTIVITIES § 17.6 What...

  14. Natural radioactive nuclides 138La and 176Lu in rare earth ore samples

    International Nuclear Information System (INIS)

    Zhang Weiping; Shen Jianfeng; Lu Zhaolun; Jiang Rangrong

    1993-01-01

    The contents of 1 '3 8 La and 176 Lu in some rare earth mines have been measured with a HPGE γ spectrometer. The measurements show that the contents of 138 La and 176 Lu in one rare earth mine are remarkably different from those in the other and they do not display a proportional relation, and that the contents of 40 K in this mine are very low

  15. Use of a new tandem cation/anion exchange system with clinical-scale generators provides high specific volume solutions of technetium-99m and rhenium-188

    International Nuclear Information System (INIS)

    Knapp, F.R. Jr.; Beets, A.L.; Mirzadeh, S.; Guhlke, S.; Univ. of Bonn

    1998-03-01

    In this paper the authors describe the first application of a simple and inexpensive post elution tandem cation-anion exchange column system which is based on generator elution with salts of weak acids such as ammonium acetate instead of saline solution to provide very high specific volume solutions of technetium-99m and rhenium-188 from clinical scale molybdenum-99/technetium-99m generator prepared from low specific activity (n,y) molybdenum-99, and tungsten-188/rhenium-188 generators, respectively. Initial passage of the bolus through a strong cation exchange cartridge converts the ammonium acetate to acetic acid which is essentially not ionized at the acidic pH, allowing specific subsequent amine type (QMA SepPak trademark) anion exchange cartridge column trapping of the microscopic levels of the pertechnetate or perrhenate. Subsequent elution of the anion cartridge with a small volume ( 500 mCi/mL) from the alumina-based tungsten-188/rhenium-188 generator

  16. Intracellular distribution and stability of a luminescent rhenium(I) tricarbonyl tetrazolato complex using epifluorescence microscopy in conjunction with X-ray fluorescence imaging

    International Nuclear Information System (INIS)

    Wedding, Jason L.; Harris, Hugh H.; Bader, Christie A.; Plush, Sally E.; Mak, Rachel

    2016-01-01

    Optical fluorescence microscopy was used in conjunction with X-ray fluorescence microscopy to monitor the stability and intracellular distribution of the luminescent rhenium(I) complex fac-[Re(CO) 3 (phen)L], where phen = 1,10-phenathroline and L = 5-(4-iodophenyl)tetrazolato, in 22Rv1 cells. The rhenium complex showed no signs of ancillary ligand dissociation, a conclusion based on data obtained via X-ray fluorescence imaging aligning iodine and rhenium distributions. A diffuse reticular localisation was detected for the complex, in the nuclear/perinuclear region of cells, by either optical or X-ray fluorescence techniques. Furthermore, X-ray fluorescence also showed that the Re-I complex disrupted the homeostasis of some biologically relevant elements, such as chlorine, potassium and zinc.

  17. Studies of technetium chemistry. Pt.8. The regularities of the bond length and configuration of rhenium and technetium complexes in crystals

    International Nuclear Information System (INIS)

    Liu Guozheng; Liu Boli

    1995-01-01

    Some bond length regularities in MO 6 , MO-4, MX 5 α and MX 4 αβ moieties of technetium and rhenium compounds are summarized and rationalized by cavity model. The chemical properties of technetium and rhenium are so similar that their corresponding complexes have almost the same configuration and M-X bond lengths when they are in cavity-controlled state. Technetium and Rhenium combine preferably with N, O, F, S, Cl and Br when they are in higher oxidation states (>3), but preferably with P, Se etc. when they are in lower oxidation states ( 4 αβ is approximately constant; (2) the average M-X bond length of MX 6 varies moderately with the oxidation state of M; (3) the bond length of M-X trans to M-α in MX 5 α has a linear relationship with the angle

  18. 188Rhenium-HEDP in the treatment of pain in bone metastases

    International Nuclear Information System (INIS)

    Gaudiano, J.; Martinez, G.; Hermida, J.C.; Savio, E.; Verdera, S.; Robles, A.; Muniz, S.; Leon, A.; Knapp, F.F.

    2001-01-01

    Systemic use of radiopharmaceuticals is a recognised alternative method for the treatment of pain in patients with multiple bone metastases. A new option, 188 Re-HEDP is proposed, using generator-obtained 188 Rhenium (β energy = 2.1 MeV, γ energy = 155 keV, half-life = 16.9 hours). After establishing parameters of biodistribution, dosimetry and image acquisition in mice, rats and rabbits, Phase I and II studies were conducted on 12 patients with multiple metastases from carcinomas, with pain surpassing other analgesic options. More than 50% pain relief was found in 91% of the patients, with total relief during a variable period in 41% of them allowing opiate and other analgesic drugs to be decreased or withdrawn, and showing a lower bone marrow contribution to total absorbed dose than that reported for other similar radiopharmaceuticals. Further study of this option is recommended in order to determine higher dose protocols without toxic bone marrow reaction possibilities. (author)

  19. Phosphorene/rhenium disulfide heterojunction-based negative differential resistance device for multi-valued logic

    Science.gov (United States)

    Shim, Jaewoo; Oh, Seyong; Kang, Dong-Ho; Jo, Seo-Hyeon; Ali, Muhammad Hasnain; Choi, Woo-Young; Heo, Keun; Jeon, Jaeho; Lee, Sungjoo; Kim, Minwoo; Song, Young Jae; Park, Jin-Hong

    2016-11-01

    Recently, negative differential resistance devices have attracted considerable attention due to their folded current-voltage characteristic, which presents multiple threshold voltage values. Because of this remarkable property, studies associated with the negative differential resistance devices have been explored for realizing multi-valued logic applications. Here we demonstrate a negative differential resistance device based on a phosphorene/rhenium disulfide (BP/ReS2) heterojunction that is formed by type-III broken-gap band alignment, showing high peak-to-valley current ratio values of 4.2 and 6.9 at room temperature and 180 K, respectively. Also, the carrier transport mechanism of the BP/ReS2 negative differential resistance device is investigated in detail by analysing the tunnelling and diffusion currents at various temperatures with the proposed analytic negative differential resistance device model. Finally, we demonstrate a ternary inverter as a multi-valued logic application. This study of a two-dimensional material heterojunction is a step forward toward future multi-valued logic device research.

  20. Phosphorene/rhenium disulfide heterojunction-based negative differential resistance device for multi-valued logic

    Science.gov (United States)

    Shim, Jaewoo; Oh, Seyong; Kang, Dong-Ho; Jo, Seo-Hyeon; Ali, Muhammad Hasnain; Choi, Woo-Young; Heo, Keun; Jeon, Jaeho; Lee, Sungjoo; Kim, Minwoo; Song, Young Jae; Park, Jin-Hong

    2016-01-01

    Recently, negative differential resistance devices have attracted considerable attention due to their folded current–voltage characteristic, which presents multiple threshold voltage values. Because of this remarkable property, studies associated with the negative differential resistance devices have been explored for realizing multi-valued logic applications. Here we demonstrate a negative differential resistance device based on a phosphorene/rhenium disulfide (BP/ReS2) heterojunction that is formed by type-III broken-gap band alignment, showing high peak-to-valley current ratio values of 4.2 and 6.9 at room temperature and 180 K, respectively. Also, the carrier transport mechanism of the BP/ReS2 negative differential resistance device is investigated in detail by analysing the tunnelling and diffusion currents at various temperatures with the proposed analytic negative differential resistance device model. Finally, we demonstrate a ternary inverter as a multi-valued logic application. This study of a two-dimensional material heterojunction is a step forward toward future multi-valued logic device research. PMID:27819264

  1. 3.3.1. Synthesis, Spectroscopy and Structural Analysis of Technetium and Rhenium Nitrosyl Complexes

    Directory of Open Access Journals (Sweden)

    Terrence\tNicholson*,\tEsther\tChunb, Ashfaq\tMahmood,\tPeter\tMueller,\tAlan\tDavisona\tand\tAlun\tG.\tJones

    2015-11-01

    Full Text Available Here we report an overview of our synthetic, spectroscopic and structural studies of technetium and rhenium nitrosyl complexes. We review the results from various notes and short papers reported over the past 15 years and discuss their significance in terms of radiopharmaceutical design.A single new complex is reported, the ReI-NO complex [ReICl2(NO(py-N(Et-py], in which the tridentate ligand di-(2-picolyl(N-ethylamine, (py-N(Et-py, is coordinated in a meridional manner. This complex was synthesized from the reaction of the ReI-nitrosyl complex ReCl2(NO(NCMe3] and the neutral tri-amine ligand py-N(Et-py in methylene chloride under argon. The bright red species was isolated chromatographically and recrystallized from CH2Cl2/MeOH under diethylether.A review of literature values for nitrosyl complexes with various ligands bound to the coordination sitetrans- to the nitrosyl group shows only minor variations in the M-N-O bond angle.

  2. Safety and Efficacy of 188-Rhenium-Labeled Antibody to Melanin in Patients with Metastatic Melanoma

    Directory of Open Access Journals (Sweden)

    M. Klein

    2013-01-01

    Full Text Available There is a need for effective “broad spectrum” therapies for metastatic melanoma which would be suitable for all patients. The objectives of Phase Ia/Ib studies were to evaluate the safety, pharmacokinetics, dosimetry, and antitumor activity of 188Re-6D2, a 188-Rhenium-labeled antibody to melanin. Stage IIIC/IV metastatic melanoma (MM patients who failed standard therapies were enrolled in both studies. In Phase Ia, 10 mCi 188Re-6D2 were given while unlabeled antibody preload was escalated. In Phase Ib, the dose of 188Re-6D2 was escalated to 54 mCi. SPECT/CT revealed 188Re-6D2 uptake in melanoma metastases. The mean effective half-life of 188Re-6D2 was 12.4 h. Transient HAMA was observed in 9 patients. Six patients met the RECIST criteria for stable disease at 6 weeks. Two patients had durable disease stabilization for 14 weeks and one for 22 weeks. Median overall survival was 13 months with no dose-limiting toxicities. The data demonstrate that 188Re-6D2 was well tolerated, localized in melanoma metastases, and had antitumor activity, thus warranting its further investigation in patients with metastatic melanoma.

  3. Laser-induced breakdown spectroscopy measurement of a small fraction of rhenium in bulk tungsten

    Science.gov (United States)

    Nishijima, D.; Ueda, Y.; Doerner, R. P.; Baldwin, M. J.; Ibano, K.

    2018-03-01

    Laser-induced breakdown spectroscopy (LIBS) of bulk rhenium (Re) and tungsten (W)-Re alloy has been performed using a Q-switched Nd:YAG laser (wavelength = 1064 nm, pulse width ∼4-6 ns, laser energy = 115 mJ). It is found that the electron temperature, Te, of laser-induced Re plasma is lower than that of W plasma, and that Te of W-Re plasma is in between Re and W plasmas. This indicates that material properties affect Te in a laser-induced plasma. For analysis of W-3.3%Re alloy, only the strongest visible Re I 488.9 nm line is found to be used because of the strong enough intensity without contamination with W lines. Using the calibration-free LIBS method, the atomic fraction of Re, cRe, is evaluated as a function of the ambient Ar gas pressure, PAr. At PAr 10 Torr due to spectral overlapping of the Re I 488.9 nm line by an Ar II 488.9 nm line.

  4. Bone marrow adsorbed dose of rhenium-186-HEDP and the relationship with decreased platelet counts

    International Nuclear Information System (INIS)

    Klerk, J.M.H. de; Dieren, E.B. van; Schip, A.D. van het

    1996-01-01

    Rhenium-186(Sn)-1,1-hydroxyethylidene diphosphonate ( 186 Re-HEDP) has been used for palliation of metastatic bone pain. The purpose of this study was to find a relationship between the bone marrow absorbed dose and the toxicity, expressed as the percentage decrease in the peripheral blood platelet count. The bone marrow absorbed dose was calculated according to the MIRD model using data obtained from ten treatments of patients suffering from metastatic prostate cancer; noninvasive and pharmacokinetic method were used. The bone marrow doses were related to toxicity using the pharmacodynamic sigmoid E max model. The mean bone marrow absorbed doses using the noninvasive and pharmacokinetic methods were in a close range to each other (1.07 mGy/MBq and 1.02 mGy/MBq, respectively). There was a good relationship between the toxicity and the bone marrow absorbed dose (r = 0.80). Furthermore, the EDrm 50 (i.e., the bone marrow absorbed dose producing a 50% platelet decrease) to bone marrow for 186 Re-HEDP was on the order of 2 Gy. Although the function of normal bone marrow is affected by metastases in patients with metastatic bone disease, the MIRD model can be used to relate toxicity to the bone marrow absorbed dose after a therapeutic dosage of 186 Re-HEDP. 33 refs., 1 fig., 1 tab

  5. SPS Fabrication of Tungsten-Rhenium Alloys in Support of NTR Fuels Development

    International Nuclear Information System (INIS)

    Webb, Jonathan A.; Charit, Indrajit; Sparks, Cory; Butt, Darryl P.; Frary, Megan; Carroll, Mark

    2011-01-01

    Tungsten metal slugs were fabricated via Spark Plasma Sintering (SPS) of powdered metals at temperatures ranging from 1575 K to 1975 K and hold times of 5 minutes to 30 minutes, using powders with an average diameter of 7.8 ?m. Sintered tungsten specimens were found to have relative densities ranging from 83 % to 94 % of the theoretical density for tungsten. Consolidated specimens were also tested for their Vickers Hardness Number (VHN), which was fitted as a function of relative density; the fully consolidated VHN was extrapolated to be 381.45 kg/mm2. Concurrently, tungsten and rhenium powders with average respective diameters of 0.5 ?m and 13.3 ?m were pre-processed either by High-Energy-Ball-Milling (HEBM) or by homogeneous mixing to yield W-25at.%Re mixtures. The powder batches were sintered at temperatures of 1975 K and 2175 K for hold times ranging from 0 minutes to 60 minutes yielding relative densities ranging from 94% to 97%. The combination of HEBM and sintering showed a significant decrease in the inter-metallic phases compared to that of the homogenous mixing and sintering.

  6. Sorption of technetium and its analogue rhenium on bentonite material under aerobic conditions

    International Nuclear Information System (INIS)

    Koudelkova, M.; Vinsova, H.; Konirova, R.; Ernestova, M.; Jedinakova-Krizova, V.; Tereesha, M.

    2003-01-01

    The uptake of technetium on bentonite materials has been studied from the point of view of characterization of long-term radioactive elements behavior in nuclear waste repository. Bentonite R (locality Rokle, Czech Republic) and two types of model groundwater (granitic and bentonite) were selected for the sorption experiments. The aim of our research has been to find out the conditions suitable for the technetium sorption on selected bentonite under oxidizing condition. The sorption experiments with Tc-99 on bentonite have been carried out by batch method. The influence of the addition of different materials (e.g. activated carbon, graphite, Fe 2+ ) with bentonite, the effect of solid: aqueous phase ratio and a pH value on the percentage of technetium uptake and on the K d values were tested. Perrhenate was selected as an analogue of pertechnetate in non-active experiments of capillary electrophoresis (CE) and isotachophoresis (ITP). The percentage of rhenium sorbed on bentonite material was determined from the decrease of perrhenate peak area (CE) and from the shortening of the ITP zone corresponding to perrhenate. Both electromigration methods provided comparable results. The results obtained in this study with non-active material were compared to those of technetium acquired by radiometry and polarography. The 8 days kinetics of the perrhenate and pertechnetate sorption on bentonite was described mathematically with a tendency to predict long-term behavior of studied systems. (authors)

  7. Prototype commercial electrooxidation cell for the recovery of molybdenum and rhenium from molybdenite concentrates

    International Nuclear Information System (INIS)

    Scheiner, B.J.; Pool, D.L.; Lindstrom, R.E.; McCleland, G.E.

    1979-01-01

    As part of the goal to maximize minerals and metals recovery from primary domestic resources, design factors associated with minimizing current leakage in bipolar cell configurations were studied as a means of improving the efficiency of bipolar electrooxidation cells. Initial studies that were conducted in a small bipolar cell operating at 140 to 145 volts and 15.4 A indicated how design factors could be employed to minimize current leakage around adjacent electrodes during cell operation. Based on these results, a 40-electrode, 108-kVA prototype of an industrial-sized cell was constructed and tested for extracting metal values from offgrade molybdenite concentrates. The feasibility of recovering molybdenum and rhenium from the oxidized pulp also was determined. Feed to the process sequence consisted of flotation concentrates containing 16 to 35% Mo as molybdenite and 6 to 15% Cu. Electrooxidation in the prototype cell results in 84 to 97% Mo and Re extraction with a corresponding energy consumption of 9 to 13 kWh/lb Mo extracted

  8. {sup 188}Rhenium-HEDP in the Treatment of Pain in Bone Metastases

    Energy Technology Data Exchange (ETDEWEB)

    Gaudiano, J.; Savio, E.; Robles, A.; Muniz, S.; Leon, A.; Verdera, S.; Martinez, G.; Hermida, J.C.; Knapp, F.F., Jr.

    1999-01-18

    Systemic use of radiopharmaceuticals is a recognized alternative method for the treatment of pain in patients with multiple bone metastasis. A new option, {sup 188}Re-HEDP is proposed, using generator-obtained {sup 188}Rhenium ({beta} energy = 2.1 MeV, {gamma} energy = 155 keV, half-life = 16.9 hours). After establishing parameters of biodistribution, dosimetry and image acquisition in mice, rats and rabbits, Phase I and II studies were conducted on 12 patients with multiple metastasis from carcinomas, with pain surpassing other analgesic options. More than 50% pain relief was found in 91% of the patients, with total relief during a variable period in 41% of them allowing opiate and other analgesic drugs to be decreased or withdrawn, and showing a lower bone marrow contribution to total absorbed dose than that reported for other similar radiopharmaceuticals. Further study of this option is recommended in order to determine higher dose protocols without toxic bone marrow reaction possibilities.

  9. Significance of changes of levels of plasma proBNP1-76 in patients with chronic pulmonary heart disease

    International Nuclear Information System (INIS)

    Li Guizhong; Xu Hua; Cao Jun; Jiang Wei; Pang Yongzheng; Tang Chaoshu

    2003-01-01

    Objective: To investigate the significance of the changes levels of plasma proBNP 1-76 in patients with COPD and chronic pulmonary heart disease. Methods: Plasma proBNP 1-76 levels were determined with radioimmunoassay in patients with CHPD (n=23), COPD (n=24) and 32 controls. Results: The concentrations of plasma proBNP 1-76 in patients with chronic obstructive pulmonary disease were significantly increased (vs controls, p 1-76 (r=0.541, p 1-76 , right inferior pulmonary artery diameter, right ventricle out flow tract diameter and right ventricle anterior wall thickness in patients with chronic pulmonary heart disease were increased significantly (vs COPD patients and controls, p 1-76 (r=0.477, p 1-76 is an early marker of right ventricular hypertrophy and right ventricular dysfunction, measurement of which is useful in the management of patients with chronic pulmonary heart disease in daily practice

  10. Elementary steps of the catalytic oxidation of CO in a gas phase in the presence of rhenium cations with carbonyl and oxygen ligands: a comparison with heterogeneous catalysis

    International Nuclear Information System (INIS)

    Goncharov, V.B.; Fialko, E.F.; Shejnin, D.Eh.; Kikhtenko, A.V.

    1997-01-01

    Reactivity in a gaseous phase o rhenium (Re + ) and rhenium monocarbonyl (ReCO + ) in the reaction of CO oxidation in oxygen-containing reagents (NO, O 2 , H 2 O) is studied through the method of the ionic cyclotron resonance. It is shown that presence of carbonyl ligand essentially influences the ion reactivity. The effective channel of the metal monocarbonyl ions oxidation through molecular oxygen is found. Accounting for this stage makes of possible to explain the low-temperature activity of a number of oxide catalyzer Mo, W in the reaction of CO oxidation by molecular oxygen

  11. High-resolution metallic magnetic calorimeters for β-spectroscopy on 187rhenium and position resolved X-ray spectroscopy

    International Nuclear Information System (INIS)

    Porst, Jan-Patrick

    2011-01-01

    This thesis describes the development of metallic magnetic calorimeters (MMCs) for high resolution spectroscopy. MMCs are energy dispersive particle detectors based on the calorimetric principle which are typically operated at temperatures below 100 mK. The detectors make use of a paramagnetic temperature sensor to transform the temperature rise upon the absorption of a particle in the detector into a measurable magnetic flux change in a dc-SQUID. The application of MMCs for neutrino mass measurements and their advantages with respect to other approaches are discussed. In view of this application the development of an MMC optimized for β-endpoint spectroscopy on 187 rhenium is presented. A fully micro-fabricated X-ray detector is characterized and performs close to design values. Furthermore, a new technique to more efficiently couple rhenium absorbers mechanically and thermally to the sensor was developed and successfully tested. By employing a metallic contact, signal rise times faster than 5 μs could be observed with superconducting rhenium absorbers. In addition to the single pixel detectors, an alternative approach of reading out multiple pixels was developed in this work, too. Here, the individual absorbers have a different thermal coupling to only one temperature sensor resulting in a distribution of different pulse shapes. Straightforward position discrimination by means of rise time analysis is demonstrated for a four pixel MMC and a thermal model of the detector is provided. Unprecedented so far, an energy resolution of less than ΔE FWHM <5 eV for 5.9 keV X-rays was achieved across all absorbers. (orig.)

  12. Thermal transformations of oxohalide complexes of rhenium(5) and molybdenum(5) with diazo-18-crown-6 in solid phase

    International Nuclear Information System (INIS)

    Ashurova, N.Kh.; Yakubov, K.G.

    1992-01-01

    Methods for synthesis and separation in solid state of the rhenium(5) and molybdenum(5) onium complexes with diaza-18-crown-6(L), the content of which according to the data of elementary analysis, IRS in the close and remote areas, thermogravimetry, conductometry and potentiometry corresponds to the (H 2 L)[EOX 5 ], where E = Re, Mo; X = Cl - , Br - . Thermotransformation of onium compounds is studied by methods of thermal methods (TG-DTG-DTA combined study). Their avility to be affected by solid-phase dehydrohalogenization, e.i. anderson regrouping. The thermolysis products, corresponding to the general formula (EOLX 3 ), are separated and studied

  13. Synthesis, characterization, and photophysical properties of a thiophene-functionalized bis(pyrazolyl) pyridine (BPP) tricarbonyl rhenium(I) complex.

    Science.gov (United States)

    Lytwak, Lauren A; Stanley, Julie M; Mejía, Michelle L; Holliday, Bradley J

    2010-09-07

    A bromo tricarbonyl rhenium(I) complex with a thiophene-functionalized bis(pyrazolyl) pyridine ligand (L), ReBr(L)(CO)(3) (1), has been synthesized and characterized by variable temperature and COSY 2-D (1)H NMR spectroscopy, single-crystal X-ray diffraction, and photophysical methods. Complex 1 is highly luminescent in both solution and solid-state, consistent with phosphorescence from an emissive (3)MLCT excited state with an additional contribution from a LC (3)(pi-->pi*) transition. The single-crystal X-ray diffraction structure of the title ligand is also reported.

  14. Evaluation of a new component used for isotopic lymphography: colloidal rhenium sulfide sup(99m)Tc labelled

    International Nuclear Information System (INIS)

    Pecking, A.; Le Mercier, N.; Gobin, R.; Bardy, A.; Najean, Y.

    1978-01-01

    We have studied for lymphatic scintigraphy a new radiopharmaceutical, sup(99m)Tc-labelled rhenium sulfocolloid. This preliminary study includes 20 adults patients with lymphomas and lymphoedemas. The principal advantage of this drug is its absence of toxicity and local pain, so that a rapid sub-cutaneous injection without local anesthesia is made possible. Good results have been obtained, as well in morphological studies of para-aortic and mammary lymph nodes as for kinetic studies of lymphatic flow in lymphoedemas. No liver and spleen uptake of radio-isotope was observed after foot injection [fr

  15. Search for the return of activity in active asteroid 176P/LINEAR

    Energy Technology Data Exchange (ETDEWEB)

    Hsieh, Henry H. [Institute for Astronomy and Astrophysics, Academia Sinica, No. 1, Sec. 4, Roosevelt Road, Taipei 10617, Taiwan (China); Denneau, Larry; Jedicke, Robert; Kaluna, Heather M.; Keane, Jacqueline V.; Kleyna, Jan; MacLennan, Eric M.; Meech, Karen J.; Riesen, Timm; Schunova, Eva; Urban, Laurie; Vereš, Peter; Wainscoat, Richard J. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Fitzsimmons, Alan; Lacerda, Pedro [Astrophysics Research Centre, Queens University Belfast, Belfast BT7 1NN (United Kingdom); Hainaut, Olivier R. [European Southern Observatory, Karl-Schwarzschild-Straße 2, D-85748 Garching bei München (Germany); Ishiguro, Masateru [Department of Physics and Astronomy, Seoul National University, 599 Gwanak-ro, Gwanak, Seoul 151-742 (Korea, Republic of); Moskovitz, Nick A. [Department of Earth, Atmospheric and Planetary Sciences, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139 (United States); Snodgrass, Colin [Max-Planck-Institut für Sonnensystemforschung, Max-Planck-Str. 2, D-37191 Katlenburg-Lindau (Germany); Trujillo, Chadwick A., E-mail: hhsieh@asiaa.sinica.edu.tw [Gemini Observatory, Northern Operations Center, 670 North Aohoku Place, Hilo, HI 96720 (United States); and others

    2014-04-01

    We present the results of a search for the reactivation of active asteroid 176P/LINEAR during its 2011 perihelion passage using deep optical observations obtained before, during, and after that perihelion passage. Deep composite images of 176P constructed from data obtained between 2011 June and 2011 December show no visible signs of activity, while photometric measurements of the object during this period also show no significant brightness enhancements similar to that observed for 176P between 2005 November and 2005 December when it was previously observed to be active. An azimuthal search for dust emission likewise reveals no evidence for directed emission (i.e., a tail, as was previously observed for 176P), while a one-dimensional surface brightness profile analysis shows no indication of a spherically symmetric coma at any time in 2011. We conclude that 176P did not in fact exhibit activity in 2011, at least not on the level on which it exhibited activity in 2005, and suggest that this could be due to the devolatization or mantling of the active site responsible for its activity in 2005.

  16. Novel Serine 176 Phosphorylation of YBX1 Activates NF-κB in Colon Cancer.

    Science.gov (United States)

    Martin, Matthew; Hua, Laiqing; Wang, Benlian; Wei, Han; Prabhu, Lakshmi; Hartley, Antja-Voy; Jiang, Guanglong; Liu, Yunlong; Lu, Tao

    2017-02-24

    Y box protein 1 (YBX1) is a well known oncoprotein that has tumor-promoting functions. YBX1 is widely considered to be an attractive therapeutic target in cancer. To develop novel therapeutics to target YBX1, it is of great importance to understand how YBX1 is finely regulated in cancer. Previously, we have shown that YBX1 could function as a tumor promoter through phosphorylation of its Ser-165 residue, leading to the activation of the NF-κB signaling pathway (1). In this study, using mass spectrometry analysis, we discovered a distinct phosphorylation site, Ser-176, on YBX1. Overexpression of the YBX1-S176A (serine-to-alanine) mutant in either HEK293 cells or colon cancer HT29 cells showed dramatically reduced NF-κB-activating ability compared with that of WT-YBX1, confirming that Ser-176 phosphorylation is critical for the activation of NF-κB by YBX1. Importantly, the mutant of Ser-176 and the previously reported Ser-165 sites regulate distinct groups of NF-κB target genes, suggesting the unique and irreplaceable function of each of these two phosphorylated serine residues. Our important findings could provide a novel cancer therapy strategy by blocking either Ser-176 or Ser-165 phosphorylation or both of YBX1 in colon cancer. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  17. Physico-chemical characterisation and biological evaluation of 188-Rhenium colloids for radiosynovectomy

    International Nuclear Information System (INIS)

    Ures, Ma Cristina; Savio, Eduardo; Malanga, Antonio; Fernández, Marcelo; Paolino, Andrea; Gaudiano, Javier

    2002-01-01

    Radiosynovectomy is a type of radiotherapy used to relieve pain and inflammation from rheumatoid arthritis. In this study, 188-Rhenium ( 188 Re) colloids were characterized by physical and biological methodologies. This was used to assess which parameters of the kit formulation would be the basis in the development of a more effective radiopharmaceutical for synovectomy. Intraarticular injection in knees of rabbits assessed cavity leakage of activity. The physical characteristics of tin (Sn) and sulphur (S) colloids were determined to assess the formulation with suitable properties. Particles were grouped in three ranges for analyzing their distribution according to their number, volume and surface. The ideal particle size range was considered to be from 2 to 10 microns. Membrane filtration and laser diffraction characterization methodologies were used. While membrane filtration could give misleading data, laser diffraction proportions more reliable results. The Sn colloid showed a better distribution of particle volume and surface than S colloid, in the 2 to 10 microns range. The 188 Re-Sn colloid was obtained with a radiochemical purity higher than 95% after 30 minutes of autoclaving. While Sn colloid kit stability was verified for 60 days, the 188 Re-Sn preparation was stable in the first 24 hrs. No significant intrabatch variability (n = 3) was detected. Biodistribution and scintigraphic studies in rabbits after intraarticular injection showed relevant activity only in knee, being 90% at 48 hours. The 188 Re-Sn colloid is easy to prepare, is stable for 24 hours and shows minimal cavity leakage after intraarticular injection into rabbit knees, suggesting this radiotherapeutical agent has suitable physical properties for evaluation for joint treatment in humans

  18. Sorption of technetium and its analogue rhenium on bentonite material under aerobic conditions

    International Nuclear Information System (INIS)

    Vinsova, H.; Koudelkova, M.; Konirova, R.; Vecernik, P.; Jedinakova-Krizova, V.

    2003-01-01

    The uptake of technetium on bentonite materials has been studied from the point of view of characterization of long-term radioactive elements behavior in nuclear waste repository. Bentonite R (locality Rokle, Czech Republic) and two types of model groundwater (granitic and bentonite) were selected for the sorption experiments. It is generally known that bentonite materials show an excellent cation-exchange capacity and, on the other hand, a poor uptake of anions. Technetium occurs under aerobic conditions in its most stable oxidation state (+VII) as pertechnetate, which makes a question of its sorption on bentonite more complex when compared with e.g. Cs + or Sr 2+ . To increase the K d values for technetium sorption on bentonite, it is necessary to carry out the experiments under anaerobic conditions in the presence of reducing agent, which is capable to lower the oxidation state of technetium which enables its successful immobilization. The aim of our research has been to find out the conditions suitable for the technetium sorption on selected bentonite under oxidizing conditions. The sorption experiments with Tc-99 on bentonite have been carried out by batch method. The influence of the addition of different materials (e.g. activated carbon, graphite, Fe 2+ , Fe) with bentonite, the effect of solid:aqueous phase ratio and a pH value on the percentage of technetium uptake and on the K d values were tested. Perrhenate was selected as an analogue of pertechnetate in non-active experiments of capillary electrophoresis (CE) and isotachophoresis (ITP). The percentage of rhenium sorbed on bentonite material was determined from the decrease of perrhenate peak area (CE) and from the shortening of the ITP zone corresponding to perrhenate. Both electromigration methods provided comparable results. The results obtained in this study with non-active material were compared to those of technetium acquired by radiometry and polarography. (authors)

  19. Photocatalytic Conversion of CO2 to CO using Rhenium Bipyridine Platforms Containing Ancillary Phenyl or BODIPY Moieties

    Science.gov (United States)

    Andrade, Gabriel A.; Pistner, Allen J.; Yap, Glenn P.A.; Lutterman, Daniel A.; Rosenthal, Joel

    2013-01-01

    Harnessing of solar energy to drive the reduction of carbon dioxide to fuels requires the development of efficient catalysts that absorb sunlight. In this work, we detail the synthesis, electrochemistry and photophysical properties of a set of homologous fac-ReI(CO)3 complexes containing either an ancillary phenyl (8) or BODIPY (12) substituent. These studies demonstrate that both the electronic properties of the rhenium center and BODIPY chromophore are maintained for these complexes. Photolysis studies demonstrate that both assemblies 8 and 12 are competent catalysts for the photochemical reduction of CO2 to CO in DMF using triethanolamine (TEOA) as a sacrificial reductant. Both compounds 8 and 12 display TOFs for photocatalytic CO production upon irradiation with light (λex ≥ 400 nm) of ~5 hr−1 with TON values of approximately 20. Although structural and photophysical measurements demonstrate that electronic coupling between the BODIPY and fac-ReI(CO)3 units is limited for complex 12, this work clearly shows that the photoactive BODIPY moiety is tolerated during catalysis and does not interfere with the observed photochemistry. When taken together, these results provide a clear roadmap for the development of advanced rhenium bipyridine complexes bearing ancillary BODIPY groups for the efficient photocatalytic reduction of CO2 using visible light. PMID:24015374

  20. [The electron microscopic observation of the effect of monoclonal antibody on the form and structure of mutans streptococci OMZ176].

    Science.gov (United States)

    Wen, L; Yue, S

    1996-01-01

    The effect of monoclonal antibody on the form and structure of Mutans Streptococci OMZ176 was studied. The result showed that a great number of Mutans Streptococci OMZ176 was agglutianated after treating with monoclonal antibody prepared by a cell wall protein antigen (molecular weight 220 kd) of Mutans Streptococci OMZ176. Bacterial cells were swollen obviously. The gap between cell wall and cytoplasmic was widened. The electronic density of cell plasm was greatly decreased.

  1. 46 CFR 176.710 - Inspection and testing prior to hot work.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Inspection and testing prior to hot work. 176.710... testing prior to hot work. (a) An inspection for flammable or combustible gases must be conducted by a... operations involving riveting, welding, burning, or other fire producing actions may be made aboard a vessel...

  2. 46 CFR 176.660 - Continued participation in the Alternative Hull Examination (AHE) Program.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Continued participation in the Alternative Hull... (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 176.660 Continued participation in the Alternative Hull Examination (AHE) Program. (a) To...

  3. 46 CFR 176.630 - The Alternative Hull Examination (AHE) Program application.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false The Alternative Hull Examination (AHE) Program... PASSENGER VESSELS (UNDER 100 GROSS TONS) INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 176.630 The Alternative Hull Examination (AHE) Program application. If your vessel meets the eligibility...

  4. 46 CFR 176.650 - Alternative Hull Examination Program options: Divers or underwater ROV.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Alternative Hull Examination Program options: Divers or...) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 176.650 Alternative Hull Examination Program options: Divers or underwater ROV. To complete the...

  5. 19 CFR 176.11 - Transmission of records to Court of International Trade.

    Science.gov (United States)

    2010-04-01

    ... SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) PROCEEDINGS IN THE COURT OF INTERNATIONAL TRADE Transmission of Records § 176.11 Transmission of records to Court of International Trade. Upon receipt of service of a summons in an action initiated in the Court of International Trade the following items shall...

  6. 30 CFR 206.176 - How do I perform accounting for comparison?

    Science.gov (United States)

    2010-07-01

    ... paragraphs (b) and (c) of this section, the actual dual accounting value, for royalty purposes, is the... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I perform accounting for comparison? 206... REVENUE MANAGEMENT PRODUCT VALUATION Indian Gas § 206.176 How do I perform accounting for comparison? (a...

  7. 49 CFR 176.93 - Vehicles having refrigerating or heating equipment.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Vehicles having refrigerating or heating equipment... Transported on Board Ferry Vessels § 176.93 Vehicles having refrigerating or heating equipment. (a) A transport vehicle fitted with refrigerating or heating equipment using a flammable liquid or Division 2.1...

  8. 49 CFR 176.76 - Transport vehicles, freight containers, and portable tanks containing hazardous materials.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Transport vehicles, freight containers, and... TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS CARRIAGE BY VESSEL General Handling and Stowage § 176.76 Transport... paragraphs (b) through (f) of this section, hazardous materials authorized to be transported by vessel may be...

  9. 49 CFR 176.170 - Transport of Class 1 (explosive) materials in freight containers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Transport of Class 1 (explosive) materials in... REGULATIONS CARRIAGE BY VESSEL Detailed Requirements for Class 1 (Explosive) Materials Cargo Transport Units and Shipborne Barges § 176.170 Transport of Class 1 (explosive) materials in freight containers. (a...

  10. 49 CFR 176.174 - Transport of Class 1 (explosive) materials in shipborne barges.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Transport of Class 1 (explosive) materials in... REGULATIONS CARRIAGE BY VESSEL Detailed Requirements for Class 1 (Explosive) Materials Cargo Transport Units and Shipborne Barges § 176.174 Transport of Class 1 (explosive) materials in shipborne barges. (a...

  11. 49 CFR 176.903 - Stowage of cotton or vegetable fibers with coal.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Stowage of cotton or vegetable fibers with coal... § 176.903 Stowage of cotton or vegetable fibers with coal. Cotton or vegetable fibers being transported on a vessel may not be stowed in the same hold with coal. They may be stowed in adjacent holds if the...

  12. 12 CFR 563.176 - Interest-rate-risk-management procedures.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Interest-rate-risk-management procedures. 563... ASSOCIATIONS-OPERATIONS Financial Management Policies § 563.176 Interest-rate-risk-management procedures... association's management of that risk. (b) The board of directors shall formerly adopt a policy for the...

  13. Evaluation of technetium-99m/rhenium labelled nucleoside analogues as potential radiotracers in oncology

    International Nuclear Information System (INIS)

    Desbouis, D.

    2007-01-01

    cell uptake in transfected cancer cells this technetium thymidine complex revealed a low internalisation of 0.03 ± 0.01%ID/(mg/mL). Under the same conditions the [ 3 H]thymidine exhibited an uptake of 1.50 ± 0.02%lD/(mg/mL). In order to gain potency and selectivity for HSV1-TK, the corresponding 5'-carboxamide 5-ethyl-2', 5'-dideoxyuridine was synthesized. The synthesis of the ligand was performed in seven steps from 2'-deoxyuridine. This ligand was then successfully labelled with the fac-M(CO) 3 -core (M = 99m Tc, Re). The rhenium complex was found to be a selective competitive inhibitor of HSV1-TK (K i = 4.56 ± 0.11 μM). Although the cellular uptake of the technetium 2'-deoxyurine complex (0.10 ± 0.01%ID/(mg/mL)) was better than its corresponding technetium thymidine complex, it is still very low compared to thymidine uptake. The second aspect of this work was to develop nucleoside derivatives labelled with technetium-99m/rhenium tricarbonyl core capable of acting as substrates for human cytosolic thymidine kinase (hTKl). hTKl is a target of choice to evaluate cell proliferation due to its overexpression in a variety of cancer cells. [ 18 F]Fluorothymidine [ 18 F]FLT), which acts as a hTKl substrate, has emerged as a very efficient PET tracer for the monitoring of cell proliferation. Our aim was to develop a SPET tracer with the same mode of action as [ 18 F]FLT. We prepared a set of technetium-99m/rhenium complexes of N3 thymidine derivatives with different overall charges (+1, 0 and -1) and variable spacer lengths. The complexes with different overall charges had the same spacer length between chelating system and thymidine moiety (two carbons spacer) while the complexes with different spacer lengths (2, 3, 5 and 10) were all neutral. These compounds were tested for their substrate activity with respect to recombinant hTKl. The phosphorylation rates of neutral and negative complexes were found to be similar, ranging between 15-16% with respect to thymidine

  14. Adsorption and Diffusion of Lithium and Sodium on Defective Rhenium Disulfide: A First Principles Study.

    Science.gov (United States)

    Mukherjee, Sankha; Banwait, Avinav; Grixti, Sean; Koratkar, Nikhil; Singh, Chandra Veer

    2018-02-14

    Single-layer rhenium disulfide (ReS 2 ) is a unique material with distinctive, anisotropic electronic, mechanical, and optical properties and has the potential to be used as an anode in alkali-metal-ion batteries. In this work, first principles calculations were performed to systematically evaluate the potential of monolayer pristine and defective ReS 2 as anodes in lithium (Li)- and sodium (Na)-ion batteries. Our calculations suggest that there are several potential adsorption sites for Li and Na on pristine ReS 2 , owing to its low-symmetry structure. Additionally, the adsorption of Li and Na over pristine ReS 2 is very strong with adsorption energies of -2.28 and -1.71 eV, respectively. Interestingly, the presence of point defects causes significantly stronger binding of the alkali-metal atoms with adsorption energies in the range -2.98 to -3.17 eV for Li and -2.66 to -2.92 eV for Na. Re single vacancy was found to be the strongest binding defect for Li adsorption, whereas S single vacancy was found to be the strongest for Na. The diffusion of these two alkali atoms over pristine ReS 2 is anisotropic, with an energy barrier of 0.33 eV for Li and 0.16 eV for Na. The energy barriers associated with escaping a double vacancy and single vacancy for Li atoms are significantly large at 0.60 eV for the double-vacancy case and 0.51 eV for the single-vacancy case. Similarly, for Na, they are 0.59 and 0.47 eV, respectively, which indicates slower migration and sluggish charging/discharging. However, the diffusion energy barrier over a Re single vacancy is found to be merely 0.42 eV for a Li atom and 0.28 eV for Na. Overall, S single and double vacancies can reduce the diffusion rate by 10 3 -10 5 times for Li and Na ions, respectively. These results suggest that monolayer ReS 2 with a Re single vacancy adsorbs Li and Na stronger than pristine ReS 2 , with negligible negotiation with the charging/discharging rate of the battery, and therefore they can be used as an anode

  15. Analysis of a rhenium-osmium solid-solution spike by inductively coupled plasma mass spectrometry

    International Nuclear Information System (INIS)

    Richardson, J.M.; Dickin, A.P.; McNutt, R.H.; McAndrew, J.I.; Beneteau, S.B.

    1989-01-01

    The rhenium-osmium decay scheme ( 187 Re → 187 Os) offers a unique opportunity to investigate the genesis of, and directly date, ultramafic rock, sulphide and platinum ore deposits. Inductively coupled plasma mass spectrometry (ICP-MS) is a viable method for Os isotopic analysis as it provides the high temperatures necessary to ionise Os. The sample can be introduced into the ICP mass spectrometer either by conventional nebulisation or by distillation using an Os ''generator''. Generator-mode analysis is superior to nebulisation because (i) the total number of counts is two orders of magnitude higher for a given sample size and (ii) Os oxidises readily to volatile OsO 4 , which has a boiling-point lower than most Re compounds, so that Os can be efficiently separated from 187 Re. The importance of Os loss during sample preparation was minimised by combining the sample powder with a powdered Re-Os isotopic spike prior to any chemical treatment. The spike is in a nickel sulphide matrix and was made by a thioacetamide co-precipitation of Os, Re and Ni followed by a fire assay. The 190 Os/ 192 Os ratio in this preparation is 51.5 ± 0.9, the 187 Os 188 Os ratio is 0.063 ± 0.006 and the 185 Re/ 187 Re ratio is 17.04 - + 0.41. These values are within the error limits quoted by the Oak Ridge National Laboratory and Techsnabexport, the suppliers of the metallic spikes. Parameters that significantly influence the Os analyses include the oxidising agent and the run temperature. The oxidising agent H 5 IO 6 is preferred to H 2 O 2 or HNO 3 as it has the highest electrode potential, provides a prolonged, consistent reaction and is more stable when stored. Chilling the sample and the H 5 IO 6 , initially retards uncontrolled OsO 4 emission. Heat applied later in the run releases OsO 4 and helps maintain a high count rate. Thus, OsO 4 can be generated in a steady, controllable and reproducible manner. (author)

  16. Rhenium-188 Lipiodol Therapy of Hepatocellular Carcinoma: Results of a multicentre-multinational study

    International Nuclear Information System (INIS)

    Padhy, A.K.; Bernal, P.; Buscombe, R.J.

    2007-01-01

    Full text: A multi-centre study was sponsored by the IAEA to assess the safety and efficacy of trans-arterial Rhenium-188 HDD Lipiodol in the treatment of inoperable Hepatocellular Carcinoma. The radioconjugate was prepared by using an HDD kit and Lipiodol. Over three years, 185 patients received at least one treatment. The dose administered was based on radiation absorbed dose to critical normal organs, calculated following a ''scout'' dose (approximately 4 mCi) of radioconjugate. The organs at greatest risk for radiation toxicity are the liver, the lung and the bone marrow. An Excel spreadsheet was used to determine maximum tolerated activity, defined as the amount of radioactivity calculated to deliver no more than 12 Gy to lungs, 30 Gy to liver, or 1.5 Gy to bone marrow. A single treatment was given to 134 patients, 42 patients received two doses, 8 received three and one patient received four treatments. The total injected activity including the scout dose during the first treatment ranged from 21 to 364 mCi (average 108 mCi). Patients were followed for at least l2 weeks after therapy. The clinical parameters evaluated included toxicity, response as determined objectively by contrast enhanced computed tomography, palliation of symptoms, overall survival, performance status (Karnofsky), and hepatic function (Child's classification). Liver function tests, serum alpha-fetoprotein (AFP) levels and complete blood counts were done at each follow-up visit. Side effects were minimal and usually presented as loss of appetite, right hypochondrial discomfort and low-grade fever. Liver function tests at 24 and 72 hours showed no significant changes and complete blood counts at 1 week, 4 weeks and 12 weeks showed no changes (no bone marrow suppression). Data on largest tumour diameter after therapy and/or tumour response as evaluated from CT scans are available for 88 patients. Complete disappearance of tumour was recorded in 3 (3%), partial response in 19 (22%), stable

  17. Solid-state thermolysis of a fac-rhenium(I) carbonyl complex with a redox non-innocent pincer ligand.

    Science.gov (United States)

    Jurca, Titel; Chen, Wen-Ching; Michel, Sheila; Korobkov, Ilia; Ong, Tiow-Gan; Richeson, Darrin S

    2013-03-25

    The development of rhenium(I) chemistry has been restricted by the limited structural and electronic variability of the common pseudo-octahedral products fac-[ReX(CO)3L2] (L2 = α-diimine). We address this constraint by first preparing the bidentate bis(imino)pyridine complexes [(2,6-{2,6-Me2C6H3N=CPh}2C5H3N)Re(CO)3X] (X = Cl 2, Br 3), which were characterized by spectroscopic and X-ray crystallographic means, and then converting these species into tridentate pincer ligand compounds, [(2,6-{2,6-Me2C6H3N=CPh}2C5H3N)Re(CO)2X] (X = Cl 4, Br 5). This transformation was performed in the solid-state by controlled heating of 2 or 3 above 200 °C in a tube furnace under a flow of nitrogen gas, giving excellent yields (≥95 %). Compounds 4 and 5 define a new coordination environment for rhenium(I) carbonyl chemistry where the metal center is supported by a planar, tridentate pincer-coordinated bis(imino)pyridine ligand. The basic photophysical features of these compounds show significant elaboration in both number and intensity of the d-π* transitions observed in the UV/Vis spec tra relative to the bidentate starting materials, and these spectra were analyzed using time-dependent DFT computations. The redox nature of the bis(imino)pyridine ligand in compounds 2 and 4 was examined by electrochemical analysis, which showed two ligand reduction events and demonstrated that the ligand reduction shifts to a more positive potential when going from bidentate 2 to tridentate 4 (+160 mV for the first reduction step and +90 mV for the second). These observations indicate an increase in electrostatic stabilization of the reduced ligand in the tridentate conformation. Elaboration on this synthetic methodology documented its generality through the preparation of the pseudo-octahedral rhenium(I) triflate complex [(2,6-{2,6-Me2C6H3N=CPh}2C5H3N)Re(CO)2OTf] (7, 93 % yield). Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Preliminary results of transarterial Rhenium-188 HDD Lipiodol in treatment of inoperable primary hepatocellular carcinoma

    International Nuclear Information System (INIS)

    Sundram, Felix

    2004-01-01

    Full text: In this paper we present our early experience with a new radio-conjugate, namely rhenium-188 HDD Lipiodol (Re-188 lipiodol). Imported radiopharmaceuticals are generally expensive, particularly for developing countries. A Tungsten (W-188-Re 188) generator obtained from ORNL (Oak Ridge National Laboratory, Tennessee, USA) allows us on-site production of a beta emitting therapeutic isotope (Re-188) for up to 6 months from a single generator. The objectives of this study were to establish the safety of trans-arterial Re-188 lipiodol in patients with inoperable HCC, and determine the adverse effects and efficacy for this radio-conjugate treatment in a multi-center study of patients with advanced HCC. A multi-center study was sponsored by the International Atomic Energy Agency (Vienna) to assess the safety and efficacy of trans-arterial Re-188 HDD conjugated lipiodol (radio-conjugate) in the treatment of patients with inoperable hepatocellular carcinoma (HCC), The radio-conjugate was prepared by using a HDD (4-hexadecyl 1-2, 9, 9-tetramethyl-4, 7-diaza-1, 10-decanethiol) kit developed in Korea, and lipiodol. Over a period of eighteen months seventy patients received at least one treatment of radio-conjugate. Some patients were re-treated if there was no evidence of disease progression. The level of radio-conjugate administered was based on radiation-absorbed dose to critical normal organs, calculated following a 'scout' dose of radio-conjugate. The organs at greatest risk for radiation toxicity are the normal liver, the lung and the bone marrow. A specially designed spreadsheet was used to determine maximum tolerated activity (MTA), defined as the amount of radioactivity calculated to deliver no more than 12 Gray (Gy) to lungs, or 30 Gy to liver, or 1.5 Gy to bone marrow. These doses have been found to be safe in multiple trials using external beam therapy and systemically administered radiopharmaceuticals. Patients were followed for at least twelve weeks

  19. 49 CFR 176.415 - Permit requirements for Division 1.5, ammonium nitrates, and certain ammonium nitrate fertilizers.

    Science.gov (United States)

    2010-10-01

    ... nitrates, and certain ammonium nitrate fertilizers. 176.415 Section 176.415 Transportation Other... requirements for Division 1.5, ammonium nitrates, and certain ammonium nitrate fertilizers. (a) Except as... Captain of the Port (COTP). (1) Ammonium nitrate UN1942, ammonium nitrate fertilizers containing more than...

  20. 49 CFR 176.108 - Supervision of Class 1 (explosive) materials during loading, unloading, handling and stowage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Supervision of Class 1 (explosive) materials during loading, unloading, handling and stowage. 176.108 Section 176.108 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS...

  1. Application of rhenium 186 radiosynovectomy in elbow diffuse pigmented villonodular synovitis: Case report with multiple joint involvement

    International Nuclear Information System (INIS)

    Koca, Go Khan; Ozsoy, Ha Kan; Atilgan, Hasan Ikbal; Demirel, Koray; Dincel, Veysel Ercan; Korkmaz, Meliha

    2012-01-01

    After surgical therapy of diffuse pigmented villonodular synovitis (DPVNS), recurrence is seen in almost half of the patients. The effectiveness of radiosynovectomy (RSV)in preventing recurrence and complaints of DPVNS is well known. Elbow involvement in DPVNS is a very rare condition; therefore, RSV in elbow hasn't been experienced widely. The aim of this case report is to show the effectiveness of RSV with rhenium 186 (Re 186)sulfide colloid. We applied Re 186 sulfide colloid to the elbow joint of DPVNS patients six weeks after arthroscopic synovectomy. As a result, the patient did not have any complaints, and our findings are compatible with residue or recurrence on magnetic resonance imaging (MRI)in sixth and twentieth month controls after administration. We concluded that Re 186 is an effective adjuvant therapy for the prevention of recurrence and complaints

  2. Development of a radiochemical neutron activation analysis procedure for determination of rhenium in biological and environmental samples at ultratrace level

    International Nuclear Information System (INIS)

    Kucera, J.; Lucanikova, M.; Czech Technical Univ., Prague

    2006-01-01

    Radiochemical neutron activation procedures using liquid-liquid extraction with tetraphenylarsonium chloride in chloroform from 1M HCl and solid extraction with ALIQUAT 336 incorporated in a polyacrylonitrile binding matrix from 0.1M HCl were developed for accurate determination of rhenium in biological and environmental samples at the sub-ng x g -1 level. Concentrations of Re in the range of 0.1 to 2.4 ng x g -1 were determined in several botanical reference materials (RM), while in a RM of road dust a value of ∼ 10 ng x g -1 was found. Significantly elevated values of Re, up to 90 ng x g -1 were found in seaweed (brown algae). Results for Re in the brown algae Fucus vesiculosus in which elevated 99 Tc values had previously been determined suggested possible competition between Re and Tc in the accumulation process. (author)

  3. Determination of rhenium traces in river water by Q-ICP-MS and HR-ICP-MS

    International Nuclear Information System (INIS)

    Uchida, S.; Tagami, K.; Saito, M.

    2003-01-01

    A simple separation method was applied to determine rhenium in river water using Q-ICP-MS and HR-ICP-MS. Re was concentrated from 420-925 ml river water using a TEVA resin minicolumn. Such extraction using a resin could separate Re from most sample matrices and trace elements. Almost 100% recovery was found throughout the method as determined with radioactive multitracers. The HR-ICP-MS was also used for the direct determination because of its low detection limit for Re (0.007 pg/ml). The Re concentration in the river water samples ranged from 0.9 to 6.5 pg/ml and the three analysis results showed good agreement with each other. (author)

  4. A Fluorine-18 Radiolabeling Method Enabled by Rhenium(I) Complexation Circumvents the Requirement of Anhydrous Conditions.

    Science.gov (United States)

    Klenner, Mitchell A; Pascali, Giancarlo; Zhang, Bo; Sia, Tiffany R; Spare, Lawson K; Krause-Heuer, Anwen M; Aldrich-Wright, Janice R; Greguric, Ivan; Guastella, Adam J; Massi, Massimiliano; Fraser, Benjamin H

    2017-05-11

    Azeotropic distillation is typically required to achieve fluorine-18 radiolabeling during the production of positron emission tomography (PET) imaging agents. However, this time-consuming process also limits fluorine-18 incorporation, due to radioactive decay of the isotope and its adsorption to the drying vessel. In addressing these limitations, the fluorine-18 radiolabeling of one model rhenium(I) complex is reported here, which is significantly improved under conditions that do not require azeotropic drying. This work could open a route towards the investigation of a simplified metal-mediated late-stage radiofluorination method, which would expand upon the accessibility of new PET and PET-optical probes. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Identification of rhenium donors and sulfur vacancy acceptors in layered MoS{sub 2} bulk samples

    Energy Technology Data Exchange (ETDEWEB)

    Brandão, F. D., E-mail: fdbrand@fisica.ufmg.br; Ribeiro, G. M.; Vaz, P. H.; González, J. C.; Krambrock, K. [Departamento de Física, Universidade Federal de Minas Gerais, CP 702, 30.123-970 Belo Horizonte, MG (Brazil)

    2016-06-21

    MoS{sub 2} monolayers, a two-dimensional (2D) direct semiconductor material with an energy gap of 1.9 eV, offer many opportunities to be explored in different electronic devices. Defects often play dominant roles in the electronic and optical properties of semiconductor devices. However, little experimental information about intrinsic and extrinsic defects or impurities is available for this 2D system, and even for macroscopic 3D samples for which MoS{sub 2} shows an indirect bandgap of 1.3 eV. In this work, we evaluate the nature of impurities with unpaired spins using electron paramagnetic resonance (EPR) in different geological macroscopic samples. Regarding the fact that monolayers are mostly obtained from natural crystals, we expect that the majority of impurities found in macroscopic samples are also randomly present in MoS{sub 2} monolayers. By EPR at low temperatures, rhenium donors and sulfur vacancy acceptors are identified as the main impurities in bulk MoS{sub 2} with a corresponding donor concentration of about 10{sup 8–12} defects/cm{sup 2} for MoS{sub 2} monolayer. Electrical transport experiments as a function of temperature are in good agreement with the EPR results, revealing a shallow donor state with an ionization energy of 89 meV and a concentration of 7 × 10{sup 15 }cm{sup −3}, which we attribute to rhenium, as well as a second deeper donor state with ionization energy of 241 meV with high concentration of 2 × 10{sup 19 }cm{sup −3} and net acceptor concentration of 5 × 10{sup 18 }cm{sup −3} related to sulfur vacancies.

  6. Synthesis, structural characterization and photoluminescence properties of rhenium(I) complexes based on bipyridine derivatives with carbazole moieties.

    Science.gov (United States)

    Li, Hong-Yan; Wu, Jing; Zhou, Xin-Hui; Kang, Ling-Chen; Li, Dong-Ping; Sui, Yan; Zhou, Yong-Hui; Zheng, You-Xuan; Zuo, Jing-Lin; You, Xiao-Zeng

    2009-12-21

    Three N,N-bidentate ligands, 5,5'-dibromo-2,2-bipyridine (L1) and two carbazole containing ligands of 5-bromo-5'-carbazolyl-2,2-bipyridine (L2), 5,5'-dicarbazolyl-2,2'-bipyridine (L3), and their corresponding rhenium Re(CO)3Cl(L) complexes (ReL1-ReL3) have been successfully synthesized and characterized by elemental analysis, 1H NMR and IR spectra. Their photophysical properties and thermal analysis, along with the X-ray crystal structure analysis of L3 and complexes ReL1 and ReL3 are also described. In CH2Cl2 solution at room temperature, all complexes display intense absorption bands at ca. 220-350 nm, which can be assigned to spin-allowed intraligand (pi-->pi*) transitions, and the low energy broad bands in the 360-480 nm region are attributed to the metal to ligand charge-transfer d(Re)-->pi* (diimine) (MLCT). The introduction of carbazole moieties improves the MLCT absorption and molar extinction coefficient of these complexes. Upon excitation at the peak maxima, all complexes show strong emissions around 620 nm, which are assigned to d(Re)-->pi* (diimine) MLCT phosphorescence. The photoluminescence lifetime decay of Re(I) complexes were measured and the quantum efficiencies of the rhenium(I) complexes were calculated by using air-equilibrated [Ru(bpy)3]2+ x 2 Cl- aqueous solution as standard (phi(std) = 0.028). The complexes with appended carbazole moieties exhibit enhanced luminescence performances relative to ReL1.

  7. Active and passive vectorization of technetium99m and 188rhenium radiopharmaceuticals for medical imaging and radiotherapy

    International Nuclear Information System (INIS)

    Lepareur, N.

    2003-11-01

    Research for new molecules for nuclear medicine is a field in constant development. Over the past few years, development of new radiopharmaceuticals for radiotherapy has renewed interest for rhenium chemistry. Indeed, its two isotopes 186 Re and 188 Re, owing to their ideal properties and their similitude with 99m Tc, which is widely used as a radiotracer for diagnostic imaging, seem very promising for the preparation of radiopharmaceuticals. In the first part of this manuscript, the synthesis of rhenium and technetium-99 complexes, [M(RPhCS3)2(RPhCS2)] (M = Re, Tc), is described. The preparation of technetium 99m based radiopharmaceuticals, analogues to the pondered complexes, is also described. The stability/reactivity of these complexes has been studied by exchange reactions with potential ligands, specially dithiocarbamates, and also by UV-visible absorption spectroscopy and thermogravimetry. The reactivity of the complexes towards dithiocarbamates leads to the possibility to bind biomolecules to the metallic core, via the dithiocarbamate moiety. This method represents a potential alternative to current ones using the so-called bifunctional approach. In the second part of this manuscript, a new kit formulation for the 188 Re labeling of lipiodol is described, using a complex analogous to those described in the previous part. The labeled oil is a potential cure for hepatocellular carcinoma. The in vitro and in vivo stability of this 188 Re-SSS lipiodol and of its analogue 99m Tc-SSS lipiodol has been studied, and also their in vivo behavior in healthy pigs. This study has shown the quasi-exclusive hepatic fixation of the radiopharmaceutical, and has proven its good stability. Its selectivity for tumors remains to be shown before trying it on humans. (author)

  8. Phase stability, physical properties of rhenium diboride under high pressure and the effect of metallic bonding on its hardness

    International Nuclear Information System (INIS)

    Zhong, Ming-Min; Kuang, Xiao-Yu; Wang, Zhen-Hua; Shao, Peng; Ding, Li-Ping; Huang, Xiao-Fen

    2013-01-01

    Highlights: •The transition pressure P t between the ReB 2 –ReB 2 and MoB 2 –ReB 2 phases is firstly determinate. •The single-bonded B–B feather remains in ReB 2 compounds. •A semiempirical method to evaluate the hardness of crystals with partial metallic bond is presented. •The large hardness (39.1 GPa) of ReB 2 –ReB 2 indicate that it is a superhard material. •The zigzag interconnected B–Re and B–B covalent bonds underlie the ultraincompressibilities. -- Abstract: Using first-principles calculations, the elastic constants, thermodynamic property and structural phase transition of rhenium diboride under pressure are investigated by means of the pseudopotential plane-waves method, as well as the effect of metallic bond on its hardness. Eight candidate structures of known transition-metal compounds are chosen to probe for rhenium diboride ReB 2 . The calculated lattice parameters are consistent with the experimental and theoretical values. Based on the third order Birch–Murnaghan equation of states, the transition pressure P t between the ReB 2 –ReB 2 and MoB 2 –ReB 2 phases is firstly determinate. Elastic constants, shear modulus, Young’s modulus, Poisson’s ratio and Debye temperature are derived. The single-bonded B–B feather remains in ReB 2 compounds. Furthermore, according to Mulliken overlap population analysis, a semiempirical method to evaluate the hardness of multicomponent crystals with partial metallic bond is presented. Both strong covalency and a zigzag topology of interconnected bonds underlie the ultraincompressibilities. In addition, the superior performance and large hardness (39.1 GPa) of ReB 2 –ReB 2 indicate that it is a superhard material

  9. Design criteria for rhenium-reduced nickel-based single-crystal alloys. Identification and computer-assisted conversion

    International Nuclear Information System (INIS)

    Goehler, Thomas

    2016-01-01

    In the present work, design criteria and property models for the creep strength optimization of rhenium-free nickel based single crystal Superalloys are investigated. The study focuses on a typical load condition of 1050 C and 150 MPa, which is representative for flight engine applications. Thereby the key aspect is to link chemical composition, manufacturing processes, microstructure formation and mechanistic understanding of dislocation creep through a computational materials engineering approach. Beside the positive effect of rhenium on solid solution hardening, a second mechanism in which rhenium increases high temperature creep strength is identified. It indirectly stabilizes precipitation hardening by reducing the coarsening kinetics of γ'-rafting. Five 1st and 2nd generation technical Superalloys show a comparable microstructure evolution for up to 2 % plastic elongation, while creep times differ by a factor of five. The application of a microstructure sensitive creep model shows that these coarsening processes can activate γ-cutting and thus lead to an increasing creep rate. Based on these calculations a threshold value of φ γ/γ' > 2,5 at 150 MPa is estimated. This ratio of matrix channel to raft thickness has been proofed for multiple positions by microstructure analysis of interrupted creep tests. The mechanism described previously can be decelerated by the enrichment of the γ-matrix with slow diffusing elements. The same principle also increases the solid solution strength of the γ-matrix. Therefore, the present work delivers an additional mechanistic explanation why creep properties of single phase nickel based alloys can be transferred to two phase technical Superalloys with rafted γ'-structure. Following, the best way to substitute both rhenium fundamental properties, namely a slow diffusion coefficient and a small solubility in g', has been investigated by means of CALPHAD-modeling. Only molybdenum and especially tungsten

  10. Fission fragment angular distribution in the reaction 28Si+176Yb

    International Nuclear Information System (INIS)

    Tripathi, R.; Sudarshan, K.; Sharma, S.K.; Reddy, A.V.R.; Pujari, P.K.; Dutta, D.; Goswami, A.; Ramachandran, K.

    2009-01-01

    Fission fragment angular distribution has been measured in the reaction 28 Si+ 176 Yb at beam energies of 145 and 155 MeV to investigate the contribution from non-compound nucleus fission. Experiments were carried out at BARC-TIFR Pelletron-LINAC accelerator facility, Mumbai. Experimental angular anisotropies in this reaction were observed to be higher than those calculated using statistical theory, indicating contribution from non-compound nucleus fission in this reaction. (author)

  11. Phylogenetic analysis of the MS4A and TMEM176 gene families.

    Directory of Open Access Journals (Sweden)

    Jonathan Zuccolo

    2010-02-01

    Full Text Available The MS4A gene family in humans includes CD20 (MS4A1, FcRbeta (MS4A2, Htm4 (MS4A3, and at least 13 other syntenic genes encoding membrane proteins, most having characteristic tetraspanning topology. Expression of MS4A genes is variable in tissues throughout the body; however, several are limited to cells in the hematopoietic system where they have known roles in immune cell functions. Genes in the small TMEM176 group share significant sequence similarity with MS4A genes and there is evidence of immune function of at least one of the encoded proteins. In this study, we examined the evolutionary history of the MS4A/TMEM176 families as well as tissue expression of the phylogenetically earliest members, in order to investigate their possible origins in immune cells.Orthologs of human MS4A genes were found only in mammals; however, MS4A gene homologs were found in most jawed vertebrates. TMEM176 genes were found only in mammals and bony fish. Several unusual MS4A genes having 2 or more tandem MS4A sequences were identified in the chicken (Gallus gallus and early mammals (opossum, Monodelphis domestica and platypus, Ornithorhyncus anatinus. A large number of highly conserved MS4A and TMEM176 genes was found in zebrafish (Danio rerio. The most primitive organism identified to have MS4A genes was spiny dogfish (Squalus acanthus. Tissue expression of MS4A genes in S. acanthias and D. rerio showed no evidence of expression restricted to the hematopoietic system.Our findings suggest that MS4A genes first appeared in cartilaginous fish with expression outside of the immune system, and have since diversified in many species into their modern forms with expression and function in both immune and nonimmune cells.

  12. Phylogenetic Analysis of the MS4A and TMEM176 Gene Families

    Science.gov (United States)

    Zuccolo, Jonathan; Bau, Jeremy; Childs, Sarah J.; Goss, Greg G.; Sensen, Christoph W.; Deans, Julie P.

    2010-01-01

    Background The MS4A gene family in humans includes CD20 (MS4A1), FcRβ (MS4A2), Htm4 (MS4A3), and at least 13 other syntenic genes encoding membrane proteins, most having characteristic tetraspanning topology. Expression of MS4A genes is variable in tissues throughout the body; however, several are limited to cells in the hematopoietic system where they have known roles in immune cell functions. Genes in the small TMEM176 group share significant sequence similarity with MS4A genes and there is evidence of immune function of at least one of the encoded proteins. In this study, we examined the evolutionary history of the MS4A/TMEM176 families as well as tissue expression of the phylogenetically earliest members, in order to investigate their possible origins in immune cells. Principal Findings Orthologs of human MS4A genes were found only in mammals; however, MS4A gene homologs were found in most jawed vertebrates. TMEM176 genes were found only in mammals and bony fish. Several unusual MS4A genes having 2 or more tandem MS4A sequences were identified in the chicken (Gallus gallus) and early mammals (opossum, Monodelphis domestica and platypus, Ornithorhyncus anatinus). A large number of highly conserved MS4A and TMEM176 genes was found in zebrafish (Danio rerio). The most primitive organism identified to have MS4A genes was spiny dogfish (Squalus acanthus). Tissue expression of MS4A genes in S. acanthias and D. rerio showed no evidence of expression restricted to the hematopoietic system. Conclusions/Significance Our findings suggest that MS4A genes first appeared in cartilaginous fish with expression outside of the immune system, and have since diversified in many species into their modern forms with expression and function in both immune and nonimmune cells. PMID:20186339

  13. Four-quasiparticle isomers and K-forbidden transitions in 176Lu

    International Nuclear Information System (INIS)

    McGoram, T.R.; Dracoulis, G.D.; Kibedi, T.; Mullins, M.; Byrne, A.P.; Baxter, A.M.

    2000-01-01

    Full text: The odd-odd nucleus 176 Lu has been the subject of extensive experimental and theoretical investigation over the last forty years. Much of this interest has stemmed from the role of 176 Lu in the s-process in nucleosynthesis. From a nuclear structure perspective, 176 Lu resides in a region of the nuclear chart where collective rotation and high-K, multi-quasiparticle states compete to form the yrast line (the locus of state with the lowest energy at a given angular momentum). The electromagnetic decay of intermediate and high-K states is often hindered due to the K-selection rule, while apparent violations of this selection rule have been ascribed to Coriolis mixing, shape changes in the gamma-degree of freedom, and so-called 'statistical' mixing. The relative importance of these mechanisms remains an open question. We present here the results of gamma-ray and conversion-electron spectroscopic measurements, performed at the Heavy Ion Facility at the Australian National University in Canberra, using the reaction 176 Yb( 7 Li, α3n) at a beam energy of 45 MeV. Two new four-quasiparticle isomers have been established, with mean lives of 400(100)ns and 58(5)μs, and spin projections and parities of 12 + and (14 + ) respectively. The shorter--lived isomer displays both normal and anomalous K-forbidden decays, which we show is the result of two-state mixing between the isomeric state and a member of a two-quasiparticle rotational band. The implied mixing matrix element of only 5 eV shows explicitly that very small mixing matrix elements may be responsible for anomalous K-hindered decays

  14. Effect of rhenium and osmium on mechanical properties of a 9Cr-2W-0.25V-0.07Ta-0.1C steel

    International Nuclear Information System (INIS)

    Klueh, R.L.; Alexander, D.J.; Sokolov, M.A.

    2000-01-01

    The nuclear transmutation of tungsten to rhenium and osmium in a tungsten-containing steel irradiated in a fission or fusion reactor will change the chemical composition of the steel. To determine the possible consequences of such compositional changes on the mechanical properties, tensile and Charpy impact properties were measured on five 9Cr-2W-0.25V-0.07Ta-0.1C steels that contained different amounts of rhenium, osmium, and tungsten. The mechanical properties changes caused by these changes in composition were minor. Observations were also made on the effect of carbon concentration. The effect of carbon on tensile behavior was minor, but there was a large effect on Charpy properties. Several of the steels showed little effect of tempering temperature on the Charpy transition temperature, a behavior that was tentatively attributed to the low silicon and/or manganese concentration of the experimental steels

  15. Rhenium(V) and technetium(V) complexes of bis(o-hydroxyphenyl)phenylphosphine (PO22-) and (o-hydroxyphenyl)diphenylphosphine (PO-) ligands

    International Nuclear Information System (INIS)

    Luo, Hongyan; Setyawati, Ika; Rettig, S.J.; Orvig, C.

    1995-01-01

    The synthesis of several phosphine-based chelating compounds and chelates formed between these compounds and rhenium or technetium is discussed. Four categories of products result, (i) bis-(o-hydroxyphenyl) diphenylphosphine (PO) complexes, (ii) mono- (PO) complexes, (iii) bis-bis(o-hydroxyphenyl)-phenylphosphine (PO 2 ) complexes, and mixed-(PO) and (PO 2 ) complexes. Molecular structures of these compounds (including isomers) were probed by NMR, MS, and IR spectroscopies and by X-ray crystallography

  16. RHENIUM SOLUBILITY IN BOROSILICATE NUCLEAR WASTE GLASS IMPLICATIONS FOR THE PROCESSING AND IMMOBILIZATION OF TECHNETIUM-99 (AND SUPPORTING INFORMATION WITH GRAPHICAL ABSTRACT)

    Energy Technology Data Exchange (ETDEWEB)

    AA KRUGER; A GOEL; CP RODRIGUEZ; JS MCCLOY; MJ SCHWEIGER; WW LUKENS; JR, BJ RILEY; D KIM; M LIEZERS; P HRMA

    2012-08-13

    The immobilization of 99Tc in a suitable host matrix has proved a challenging task for researchers in the nuclear waste community around the world. At the Hanford site in Washington State in the U.S., the total amount of 99Tc in low-activity waste (LAW) is {approx} 1,300 kg and the current strategy is to immobilize the 99Tc in borosilicate glass with vitrification. In this context, the present article reports on the solubility and retention of rhenium, a nonradioactive surrogate for 99Tc, in a LAW sodium borosilicate glass. Due to the radioactive nature of technetium, rhenium was chosen as a simulant because of previously established similarities in ionic radii and other chemical aspects. The glasses containing target Re concentrations varying from 0 to10,000 ppm by mass were synthesized in vacuum-sealed quartz ampoules to minimize the loss of Re by volatilization during melting at 1000 DC. The rhenium was found to be present predominantly as Re7 + in all the glasses as observed by X-ray absorption near-edge structure (XANES). The solubility of Re in borosilicate glasses was determined to be {approx}3,000 ppm (by mass) using inductively coupled plasma-optical emission spectroscopy (ICP-OES). At higher rhenium concentrations, some additional material was retained in the glasses in the form of alkali perrhenate crystalline inclusions detected by X-ray diffraction (XRD) and laser ablation-ICP mass spectrometry (LA-ICP-MS). Assuming justifiably substantial similarities between Re7 + and Tc 7+ behavior in this glass system, these results implied that the processing and immobilization of 99Tc from radioactive wastes should not be limited by the solubility of 99Tc in borosilicate LAW glasses.

  17. Influence of liposome forms of the rhenium compounds and cis-platin on thiol-disulfide coefficient in the rats’ blood

    Directory of Open Access Journals (Sweden)

    I. V. Klenina

    2007-12-01

    Full Text Available Thiol-disulfide coefficient (TDC and its different modifications in model in vivo were studied. Introduction of the liposome forms of cluster rhenium compounds with organic ligands (CROL leads to both TDC increasing and to the constancy of the TDC. Thus, CROLs aren’t toxic agents and some compounds could mobilize organisms’ thiol defence system. Liposome form of cis-platin leads to the TDC decreasing. Important CROL capacities for its future medical treatment practice were shown.

  18. Activation of catalase activity by a peroxisome-localized small heat shock protein Hsp17.6CII.

    Science.gov (United States)

    Li, Guannan; Li, Jing; Hao, Rong; Guo, Yan

    2017-08-20

    Plant catalases are important antioxidant enzymes and are indispensable for plant to cope with adverse environmental stresses. However, little is known how catalase activity is regulated especially at an organelle level. In this study, we identified that small heat shock protein Hsp17.6CII (AT5G12020) interacts with and activates catalases in the peroxisome of Arabidopsis thaliana. Although Hsp17.6CII is classified into the cytosol-located small heat shock protein subfamily, we found that Hsp17.6CII is located in the peroxisome. Moreover, Hsp17.6CII contains a novel non-canonical peroxisome targeting signal 1 (PTS1), QKL, 16 amino acids upstream from the C-terminus. The QKL signal peptide can partially locate GFP to peroxisome, and mutations in the tripeptide lead to the abolishment of this activity. In vitro catalase activity assay and holdase activity assay showed that Hsp17.6CII increases CAT2 activity and prevents it from thermal aggregation. These results indicate that Hsp17.6CII is a peroxisome-localized catalase chaperone. Overexpression of Hsp17.6CII conferred enhanced catalase activity and tolerance to abiotic stresses in Arabidopsis. Interestingly, overexpression of Hsp17.6CII in catalase-deficient mutants, nca1-3 and cat2 cat3, failed to rescue their stress-sensitive phenotypes and catalase activity, suggesting that Hsp17.6CII-mediated stress response is dependent on NCA1 and catalase activity. Overall, we identified a novel peroxisome-located catalase chaperone that is involved in plant abiotic stress resistance by activating catalase activity. Copyright © 2017 Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, and Genetics Society of China. Published by Elsevier Ltd. All rights reserved.

  19. Use of new tandem cation/anion exchange system with clinical-scale generators provides high specific volume solutions of technetium-99m and rhenium-188

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Guhlke, S.

    1998-01-01

    In this paper we describe the first application of our simple and inexpensive post-elution tandem cation/anion exchange column system which is based on generator elution with salts of weak acids such as ammonium acetate instead of saline solution to provide very high specific volume solutions of technetium-99m and rhenium-188 from clinical-scale molybdenum-99/technetium-99m generator prepared from low specific activity (n,y) molybdenum-99, and tungsten-188/rhenium-188 generators, respectively. Initial passage of the bolus through a strong cation exchange cartridge converts the ammonium acetate to acetic acid which is essentially not ionized at the acidic pH, allowing specific subsequent amine-type (QMA SepPak TM ) anion exchange cartridge column trapping of the microscopic levels of the pertechnetate or perrhenate. Subsequent elution of the anion cartridge with a small volume ( 500 mCi/mL) from the alumina-based tungsten-188/rhenium-188 generator. (author)

  20. Development of pharmaceuticals with radioactive rhenium for cancer therapy. Production of {sup 186}Re and {sup 188}Re, synthesis of labeled compounds and their biodistributions

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    Production of the radioactive rhenium isotopes {sup 186}Re and {sup 188}Re, and synthesis of their labeled compounds have been studied together with the biodistributions of the compounds. This work was carried out by the Working Group on Radioactive Rhenium, consisting of researchers of JAERI and some universities, in the Subcommittee for Production and Radiolabeling under the Consultative Committee of Research on Radioisotopes. For {sup 186}Re, production methods by the {sup 185}Re(n,{gamma}){sup 186}Re reaction in a reactor and by the {sup 186}W(p,n){sup 186}Re reaction with an accelerator, which can produce nocarrier-added {sup 186}Re, have been established. For {sup 188}Re, a production method by the double neutron capture reaction of {sup 186}W, which produces a {sup 188}W/{sup 188}Re generator, has been established. For labeling of bisphosphonate, DMSA, DTPA, DADS, aminomethylenephosphonate and some monoclonal antibodies with the radioactive rhenium isotopes, the optimum conditions, including pH, the amounts of reagents and so on, have been determined for each compound. The biodistributions of each of the labeled compounds in mice have been also obtained. (author)

  1. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    International Nuclear Information System (INIS)

    Eichler, R.; Eichler, B.; Jost, D.T.; Dressler, R.; Tuerler, A.; Gaeggeler, H.W.

    1999-01-01

    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) ↔ X(ads) (X = ReO 3 , HReO 4 ) ΔH ads (ReO 3 ) = -190 ± 10 kJ/mol; ΔS ads (ReO 3 ) = -179±30 J/mol K; ΔH ads (HReO 4 ) = -77 ± 5 kJ/mol; ΔS ads (HReO 4 ) = -187±50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes 169,170,174,176 Re, 152-155 Er, 151-154 Ho, 218 Po, and 214 Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  2. Issues associated with the use of the Tungsten-188/Rhenium188 generator and concentrator system and preparation of Re-188 HDD: A report

    International Nuclear Information System (INIS)

    Knapp, F.F.Jr.; Turner, J.H.; Jeong, J.-M.; Padhy, A.K.

    2004-01-01

    The ready availability of no-carrier-added Rhenium-188 from the Tungsten-188/Rhenium-188 generator represents an important source of a therapeutic radioisotope for a broad range of therapeutic applications in nuclear medicine, oncology, rheumatology and interventional cardiology. The International Atomic Energy Agency (IAEA) is coordinating a clinical trial involving the use of Rhenium188-Lipiodol for therapy of hepatocellular carcinoma. This report summarizes the experience of investigators at ten participating centres associated with the use and performance of the Tungsten-188/Rhenium-188 generators and the preparation and handling of the Re-188 HDD agent. This evaluation has demonstrated the cost effective provision of on-site therapeutic activities of Rhenium-188 and recommendations are made for further development of the next generator prototype in light of this international experience. The high bolus volumes (20-40 ml) of the ORNL generator requires post elution concentration of the Re-188 bolus by passage through the tandem silver cation/anion column system. The high back pressure often encountered during generator elution through the silver cation/anion concentrator system has been identified as a potential problem. The details of a method involving in house preparation of the silver cation columns were provided and implementation of this method for Re-188 bolus concentration is recommended. It is also recommended that ORNL investigators reassess the possibility of increasing Tungsten generator loading capacity and the use of higher specific activity Tungsten-188, with a view to reducing the generator bolus volume. The Re-188 HDD/Lipiodol conjugate?;ate is used in this IAEA trial for radioembolytic therapy of primary liver cancer, and methods for preparation of Re-188 HDD and its extraction into Lipiodol are discussed. Since Re-188 HDD binds to glass surfaces, the recovery yields are variable and can be as low as 40-45%. In an effort to maximize the

  3. The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta

    International Nuclear Information System (INIS)

    Turner, J.H.

    2007-01-01

    intervals of 7 - 11 weeks, in 10 patients at Fremantle Hospital and 7 patients at Erasmus Medical Centre. A multicentre international physician-sponsored randomised controlled trial of 177 Lu octreotate with or without capecitabine will commence in 2008, given that toxicity of combined chemotherapy and radiopeptide therapy is no greater than 177 Lu octreotate alone. 3. Rhenium-188 Lipiodol Hepatocellular carcinoma is the cancer which kills more people in Asia than any other malignancy and if unresectable is incurable. Effective palliation, which may increase survival, has been demonstrated with intrahepatic arterial administration of 131 I-lipiodol (6) and there are even greater potential benefits with 188 Re-lipiodol (7). We are currently testing a commercial prototype of semiautomated shielded synthesis box (Comecer, Castel- bolognese, Italy) for preparation of sterile 188 Re-lipiodol, for eventual installation in radiopharmacies throughout Asia, to provide cost-effective, safe treatment of hepatocellular carcinoma. Given the advent of the 188 W/ 188 Re generator, other therapeutic radio-pharmaceuticals such as 188 Re- HEDP for bone pain palliation of skeletal metastases, 188 Re colloid for radiation synovectomy and 188 Re antibodies for internalizing radioimmunotherapy would be available in-house in radiopharmacies throughout the world, to facilitate cost-effective incorporation of therapeutic nuclear oncology into mainstream clinical management of cancer. (author)

  4. Static quadrupole moment of the Kπ = 14+ isomer in 176W

    International Nuclear Information System (INIS)

    Ionescu-Bujor, M.; Iordachescu, A.; Bucurescu, D.; Brandolini, F.; Lenzi, S. M.; Pavan, P.; Rossi Alvarez, C.; Marginean, N.; Medina, N.H.; Ribas, R.V.; De Poli, M.; Napoli, D. R.; Podolyak, Zs.; Ur, C. A.

    2001-01-01

    The investigation of high-K isomeric states in the deformed nuclei of the A∼180 region has found renewed interest in recent years. Much experimental and theoretical work was devoted to understand the mechanisms which govern their decay to lower-lying states, particularly the anomalous strong decays to low-K states. Other questions of great importance are the quenching of the pairing correlations and the shape polarization effects in the high-seniority multi-quasiparticle excitations. Our interest focused on the 41 ns K π =14 + 3746 keV isomeric state with anomalous decay in 176 W. On the basis of a precise g-factor measurement we assigned to this isomer a pure four-quasiparticle configuration, composed by two protons in the 7/2 + [404] and 9/2 - [514] orbitals and two neutrons in the 7/2 + [633] and 5/2 - [512] orbitals. In the present work the measurement of its static quadrupole moment has been performed. Prior to our experiment, static quadrupole moments have been measured only for three high-K isomeric states of seniority ≥ 4 in the A∼180 region: 16 + in 178 Hf, 35/2 - in 179 W and 25 + in 182 Os. A deformation very similar to that of the ground state has been deduced for the 16 + isomer in 178 Hf, while for the high-K isomers in 179 W and 182 Os significantly smaller deformations were reported. The quadrupole interaction of the 14 + isomeric state in 176 W has been investigated in the electric field gradient (EFG) of the polycrystalline lattice of metallic Tl by applying the time-differential perturbed angular distribution method. For W impurities in Tl host the EFG strength and its temperature dependence have been recently reported. The isomer was populated in the 164 Dy( 16 O,4n) 176 W reaction using a 83 MeV 16 O pulsed beam (pulse width 1.5 ns, repetition period 800 ns) delivered by the XTU-Tandem of Laboratori Nazionali di Legnaro. The target consisted of 0.5 mg/cm 2 metallic 164 Dy on thick Tl backing in which both the recoiling 176 W nuclei and

  5. g-factor of the Kπ = 14+ isomer in 176 W

    International Nuclear Information System (INIS)

    Ionescu-Bujor, M.; Iordachescu, A.; Marginean, N.; Brandolini, F.; Pavan, P.; Lenzi, S.M.; De Poli, M.; Gadea, A.; Martinez, T.; Medina, N.H.; Ribas, R.V.; Podolyak, Zs.

    2000-01-01

    In the deformed A ≅ 180 nuclei with β 2 ≅ 0.25 multi-quasiparticle intrinsic states are able to compete with rotational structures as both proton and neutron Fermi surfaces are close to nucleon orbits with large projections Ω on the prolate symmetry axis. Due to the approximate conservation of the K quantum number, these states often have hindered decays with half-lives ranging from nanoseconds to years. The decay characteristics of the high-K isomers, as well as the properties of the collective bands built on them, were subject of detailed experimental studies over the last decade. Particular attention has been devoted to the apparent breakdown of the K-selection rule observed experimentally in the decay of several high-spin isomeric states of the A ≅ 180 region. A very interesting high-K isomer showing in its decay a severe violation of the K-selection rule has been recently found in 176 W. The isomeric state, with K π = 14 + , T 1/2 = 35(10) ns and E x =3746 keV, de-excites predominantly to states with K=0, bypassing available levels of intermediate K. To elucidate the isomer underlying structure, an experiment to determine its the g-factor has been performed at the LNL XTU-tandem, by applying the time-differential perturbed angular distribution (TDPAD) method in an external magnetic field. The isomer was populated in the 164 Dy( 16 O,4n) 176 W reaction at a bombarding energy of 83 MeV. The 16 O beam has been pulsed with a pulse width of 1.5 ns at a repetition period of 800 ns. In view of the very low isomer population (about 2% of the 4n channel), a high suppression of the continuous beam in-between the beam bursts was necessary for a proper observation of the isomeric decay γ-lines. The target consisted of 0.5 mg/cm 2 metallic 164 Dy on thick Pb backing in which both the recoiling 176 W nuclei and the projectiles were stopped. Two planar Ge detectors and two Ge detectors of 25% efficiency placed at the angles ± 135 angle and ± 45 angle with respect

  6. PET attenuation correction for rigid MR Tx/Rx coils from 176Lu background activity

    Science.gov (United States)

    Lerche, Christoph W.; Kaltsas, Theodoris; Caldeira, Liliana; Scheins, Jürgen; Rota Kops, Elena; Tellmann, Lutz; Pietrzyk, Uwe; Herzog, Hans; Shah, N. Jon

    2018-02-01

    One challenge for PET-MR hybrid imaging is the correction for attenuation of the 511 keV annihilation radiation by the required RF transmit and/or RF receive coils. Although there are strategies for building PET transparent Tx/Rx coils, such optimised coils still cause significant attenuation of the annihilation radiation leading to artefacts and biases in the reconstructed activity concentrations. We present a straightforward method to measure the attenuation of Tx/Rx coils in simultaneous MR-PET imaging based on the natural 176Lu background contained in the scintillator of the PET detector without the requirement of an external CT scanner or PET scanner with transmission source. The method was evaluated on a prototype 3T MR-BrainPET produced by Siemens Healthcare GmbH, both with phantom studies and with true emission images from patient/volunteer examinations. Furthermore, the count rate stability of the PET scanner and the x-ray properties of the Tx/Rx head coil were investigated. Even without energy extrapolation from the two dominant γ energies of 176Lu to 511 keV, the presented method for attenuation correction, based on the measurement of 176Lu background attenuation, shows slightly better performance than the coil attenuation correction currently used. The coil attenuation correction currently used is based on an external transmission scan with rotating 68Ge sources acquired on a Siemens ECAT HR  +  PET scanner. However, the main advantage of the presented approach is its straightforwardness and ready availability without the need for additional accessories.

  7. STELLAR ACTIVITY AND ITS IMPLICATIONS FOR EXOPLANET DETECTION ON GJ 176

    International Nuclear Information System (INIS)

    Robertson, Paul; Endl, Michael; Cochran, William D.; MacQueen, Phillip J.; Henry, Gregory W.; Williamson, Michael H.

    2015-01-01

    We present an in-depth analysis of stellar activity and its effects on radial velocity (RV) for the M2 dwarf GJ 176 based on spectra taken over 10 yr from the High Resolution Spectrograph on the Hobby-Eberly Telescope. These data are supplemented with spectra from previous observations with the HIRES and HARPS spectrographs, and V- and R-band photometry taken over six years at the Dyer and Fairborn observatories. Previous studies of GJ 176 revealed a super-Earth exoplanet in an 8.8-day orbit. However, the velocities of this star are also known to be contaminated by activity, particularly at the 39-day stellar rotation period. We have examined the magnetic activity of GJ 176 using the sodium I D lines, which have been shown to be a sensitive activity tracer in cool stars. In addition to rotational modulation, we see evidence of a long-term trend in our Na I D index, which may be part of a long-period activity cycle. The sodium index is well correlated with our RVs, and we show that this activity trend drives a corresponding slope in RV. Interestingly, the rotation signal remains in phase in photometry, but not in the spectral activity indicators. We interpret this phenomenon as the result of one or more large spot complexes or active regions which dominate the photometric variability, while the spectral indices are driven by the overall magnetic activity across the stellar surface. In light of these results, we discuss the potential for correcting activity signals in the RVs of M dwarfs

  8. Discinesias induzidas por levodopa em 176 pacientes com doença de Parkinson Levodopa-induced dyskinesias in 176 parkisonian patients

    Directory of Open Access Journals (Sweden)

    Maria Sheila G. Rocha

    1995-12-01

    Full Text Available A ocorrência de discinesias dificulta consideravelmente o manuseio terapêutico dos pacientes parkinsonianos tratados com levodopa. Estudamos as características clínicas das discinesias em 176 pacientes com diagnóstico de doença de Parkinson e tratados com levodopa. As discinesias ocorreram, em média, após 6,2 anos de duração da doença e após 4,2 anos de tratamento com levodopa. A maioria dos pacientes (90% achava-se nos estágios II e III de Hoehn & Yahr por ocasião do início das discinesias. As discinesias mais frequentes foram as de "pico de dose" e "contínua". Movimento do tipo distônico ocorreu em 40% dos casos e predominou nas discinesias de "fim de dose" e "bifásica". Distonia matinal correspondeu a 35% dos casos de distonia. Movimentos coreiformes se manifestaram de forma generalizada em 43,2% dos casos. Movimentos distônicos predominaram nos membros inferiores. A discinesia, quando unilateral, ocorreu mais frequüentemente no hemicorpo mais comprometido pela doença de Parkinson. A discinesia orofacial, quando isolada, foi mais frequente nos pacientes mais idosos.Dyskinesias are frequently observed in parkinsonian patients during levodopa treatment. The occurrence of these movement disorders usually makes the therapeutic management of the patients very difficult. The clinical characteristics of 176 patients with dyskinesias were retrospectively studied. Dyskinesias occurred, on average, after 6,2 years of duration of Parkinson's disease and after 4.2 years on treatment with levodopa. Patients were more likely to have dyskinesias during more advanced stages (measured by Hoehn and Yahr scale. Peak of dose and square wave were the types of dyskinesia more frequently described and were associated with choreic movements in most cases. Dystonia occurred in 40% of the cases and was predominant in end of dose and diphasic dyskinesias. Thirty-five percent of dystonia cases presented as "early morning dystonia". Chorea was the

  9. Rhenium complexes of chromophore-appended dipicolylamine ligands: syntheses, spectroscopic properties, DNA binding and X-ray crystal structure

    International Nuclear Information System (INIS)

    Mullice, L.A.; Buurma, N.J.; Pope, S.J.A.; Laye, R.H.; Harding, L.P.

    2008-01-01

    The syntheses of two chromophore-appended dipicolylamine-derived ligands and their reactivity with penta-carbonyl-chloro-rhenium have been studied. The resultant complexes each possess the fac-Re(CO) 3 core. The ligands L 1 1-[bis(pyridine-2-yl-methyl)amino]methyl-pyrene and L 2 2-[bis(pyridine-2-yl-methyl)amino]methyl-quinoxaline were isolated via a one-pot reductive amination in moderate yield. The corresponding rhenium complexes were isolated in good yields and characterised by 1 H NMR, MS, IR and UV-Vis studies. X-Ray crystallographic data were obtained for fac-{Re(CO) 3 (L 1 )}(BF 4 ), C 34 H 26 BF 4 N 4 O 3 Re: monoclinic, P2(1)/c, a 18.327(2) Angstroms, α = 90.00 degrees, b 14.1537(14) Angstroms, β96.263(6) degrees, c = 23.511(3) Angstroms, γ 90.00 Angstroms, 6062.4(11) (Angstroms) 3 , Z=8. The luminescence properties of the ligands and complexes were also investigated, with the emission attributed to the appended chromophore in each case. Isothermal titration calorimetry suggests that fac-{Re(CO) 3 (L 1 )}(BF 4 ) self-aggregates cooperatively in aqueous solution, probably forming micelle-like aggregates with a cmc of 0.18 mM. Investigations into the DNA-binding properties of fac-{Re(CO) 3 (L 1 )}(BF 4 ) were undertaken and revealed that fac-{Re(CO) 3 (L 1 )}(BF 4 ) binding to fish sperm DNA (binding constant 1.5 ± 0.2 * 10 5 M -1 , binding site size 3.2 ± 0.3 base pairs) is accompanied by changes in the UV-Vis spectrum as typically observed for pyrene-based intercalators while the calorimetrically determined binding enthalpy (-14 ± 2 kcal mol -1 ) also agrees favourably with values as typically found for intercalators. (authors)

  10. Isomeric ratio measurements for the radiative neutron capture 176Lu(n,γ at DANCE

    Directory of Open Access Journals (Sweden)

    Denis-Petit D.

    2017-01-01

    Full Text Available The isomeric ratios for the neutron capture reaction 176Lu(n,γ to the Jπ = 5/2−, 761.7 keV, T1/2 = 32.8 ns and the Jπ = 15/2+, 1356.9 keV, T1/2 = 11.1 ns levels of 177Lu, have been measured for the first time with the Detector for Advanced Neutron Capture Experiments (DANCE at the Los Alamos National Laboratory. These measured isomeric ratios are compared with TALYS calculations.

  11. Kaznivo dejanje prikazovanja, izdelave, posesti in posredovanja pornografskega gradiva (176. člen KZ-1)

    OpenAIRE

    Jeran, Ana

    2017-01-01

    Analiza 176. člena slovenskega kazenskega zakonika je pokazala, kako zapleteno je vprašanje prepovedi soočenja otrok s pornografskim gradivom in kako nujno potrebna je primerna inkriminacija otroške pornografije zaradi vse bolj razširjenega in dostopnega interneta. Gre za najhitreje rastoči internetni trg, zato je za boj proti tovrstnemu kriminalu potrebno sodelovanje na mednarodni ravni, ki se odraža v številnih mednarodnopravno sprejetih aktih, ki obravnavajo to materijo. Glavni cilj inkrim...

  12. Adsorption properties of technetium and rhenium for hybrid microcapsules enclosing Toa extractant

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Y.; Mimura, H.; Niibori, Y. [Tohoku University, Graduate School of Engineering, Department of Quantum Science and Energy Engineering, Aramaki-Aza-Aoba 6-6-01-2, Aoba-ku, Sendai-shi, Miyagi-ken, 980-8579 Japan (Japan); Koyama, S.; Ohnishi, T., E-mail: yanwu@cyric.tohoku.ac.j [Japan Atomic Energy Agency, O-arai Research and Development Center, Fuels and Materials Department, Alpha-Gamma Section, Narita-cho 4002, O-arai-machi, Ibaraki, 311-1393 Japan (Japan)

    2010-10-15

    Special attention has been given to the separation and recovery of the VII-group elements Tc and Re, in relation to the partitioning of high-level liquid waste (HLLW) generated from the nuclear fuel reprocessing process. In this study, a tertiary amine (tri-n-octylamine Toa), which is effective for the extraction of oxo anions, was encapsulated in a calcium alginate gel polymer (CaALG), and the adsorption behaviours of TcO{sub 4} and ReO{sub 4}{sup -} in the presence of nitric acid and hydrochloric acid were examined by using calcium alginate microcapsules (M Cs) enclosing Toa extractant (Toa-CaALG M Cs). The order of the distribution coefficient K{sub d} for different oxo anions at 0.1 M HNO{sub 3} was ReO{sub 4}{sup -}> WO{sub 4}{sup 2-}> CrO{sub 4}{sup 2-} {approx} MoO{sub 4}{sup 2-}>> SeO{sub 3}{sup 2-}. Toa-CaALG still exhibited high uptake ability for ReO{sub 4}{sup -} even after irradiation with {sup 60}Co {gamma}-rays (dose: 17.6 kGy). Uptake of TcO{sub 4}{sup -} in the presence of 1 M HNO{sub 3} was readily attained within 3 h. Relatively large K{sub d} values above 10{sup 2} cm{sup 3}/g were obtained for Toa-CaALG in the presence of 0.01 {approx} 1 M HNO{sub 3}. All of the TcO{sub 4}{sup -} was successfully adsorbed by Toa-CaALG from the simulated HLLW. The adsorbed TcO{sub 4}{sup -} was then effectively eluted with 5 M or 7 M HNO{sub 3} solution. Further, the selective uptake of ReO{sub 4}{sup -} (a chemical analogue of TcO{sub 4}{sup -}) was confirmed by using actual HLLW (Fbr, Joyo, JAEA), and uptake (%) above 99% was obtained. Toa-CaALG was thus effective for the selective separation and recovery of TcO{sub 4}{sup -} and ReO{sub 4}{sup -} from waste solutions containing highly concentrated HNO{sub 3} and NaNO{sub 3}. Microencapsulation techniques with alginate gel polymer can be applied to other ion exchangers and extractants, and the M Cs immobilizing these adsorbents are effective for the advanced separation of various radionuclides, rare metals and

  13. A new amperometric glucose biosensor based on screen printed carbon electrodes with rhenium(IV - oxide as a mediator

    Directory of Open Access Journals (Sweden)

    ALBANA VESELI

    2012-11-01

    Full Text Available Rhenium(IV-oxide, ReO2, was used as a mediator for carbon paste (CPE and screen printed carbon (SPCE electrodes for the catalytic amperometric determination of hydro-gen peroxide, whose overpotential for the reduction could be lowered to -0.1 V vs. Ag/AgCl in flow injection analysis (FIA using phosphate buffer (0.1 M, pH=7.5 as a carrier. For hydrogen peroxide a detection limit (3σ of 0.8 mg L-1 could be obtained.ReO2-modified SPCEs were used to design biosensors with a template enzyme, i.e. glucose oxidase, entrapped in a Nafion membrane. The resulting glucose sensor showed a linear dynamic range up to 200 mg L-1 glucose with a detection limit (3σ of 0.6 mg L-1. The repeatability was 2.1 % RSD (n = 5 measurements, the reproducibility 5.4 % (n = 5 sensors. The sensor could be applied for the determination of glucose in blood serum in good agreement with a reference method.

  14. Pharmacokinetic properties of new antitumor radiopharmaceutical on the basis of diamond nanoporous composites labeled with rhenium-188

    International Nuclear Information System (INIS)

    Petriev, V M; Tishchenko, V K; Kuril’chik, A A; Skvortsov, V G

    2017-01-01

    Today the development of address therapeutic radionuclide delivery systems directly to tumor tissue is of current interest. It can be achieved by the design of drug containers of specific sizes and shapes from carbon-based composite materials. It will be allowed to enhance the efficacy of anticancer therapy and avoid serious side effects. In this work we studied the pharmacokinetic properties of nanodiamond nanoporous composite labeled with rhenium-188 in rats with hepatocholangioma PC-1 after intratumoral injection. It was established that substantial part of injected radioactivity remained in tumor tissue. Within three hours after 188 Re-nanoporous composites injection activity in tumor constituted 79.1–91.3% of injected dose (ID). Then activity level declined to 45.9% ID at 120 hours. No more than 1.34% ID entered the bloodstream. In soft organs and tissues, except thyroid gland, the content of compound didn’t exceed 0.3% ID/g. The highest activity in thyroid gland was 6.95% ID/g. In conclusion, received results suggest 188 Re-nanoporous composites can be promising radionuclide delivery systems for cancer treatment. (paper)

  15. Syntheses and structures of technetium(V) and rhenium(V) oxo complexes of peptide having KYC-sequence

    International Nuclear Information System (INIS)

    Takayama, T.; Suzuki, K.; Sekine, T.; Kudo, H.

    2000-01-01

    Technetium(V) and rhenium(V) oxo complexes of a peptide having a KYC-sequence such as KYCAR (H 3 L 5 ) and KYCAREPPTRTNAYQGQG-NH 2 (H 3 L 18 ) were synthesized, and structures of the complexes were characterized by spectroscopic techniques. All of the complexes were synthesized by the ligand exchange reaction of [(n-C 4 H 9 ) 4 N][MOCl 4 ] (M = 99 Tc, Re) with peptide in methanol or dimethylformamide solution. These complexes have a square pyramidal structure with an oxo ligand at the apical position. The peptide is coordinated to a metal atom through N amine of lysine. S thiol of cysteine, and N amide of tyrosine and cysteine in the equatorial plane. A lysine (CH 2 ) 4 NH 2 group of the L 5 ligand has the syn conformation with respect to metal-oxo bonding in the complex. The syn isomer was selectively formed in the ligand exchange reaction. The conversion of the syn isomer to the anti isomer was observed only for syn-[ReO(L 5 )], in which the coordination of water to the trans position of the oxo ligand was involved. (orig.)

  16. Syntheses and structures of technetium(V) and rhenium(V) oxo complexes of peptide having KYC-sequence

    Energy Technology Data Exchange (ETDEWEB)

    Takayama, T.; Suzuki, K.; Sekine, T.; Kudo, H. [Dept. of Chemistry, Tohoku Univ., Sendai (Japan)

    2000-07-01

    Technetium(V) and rhenium(V) oxo complexes of a peptide having a KYC-sequence such as KYCAR (H{sub 3}L{sup 5}) and KYCAREPPTRTNAYQGQG-NH{sub 2} (H{sub 3}L{sup 18}) were synthesized, and structures of the complexes were characterized by spectroscopic techniques. All of the complexes were synthesized by the ligand exchange reaction of [(n-C{sub 4}H{sub 9}){sub 4}N][MOCl{sub 4}] (M = {sup 99}Tc, Re) with peptide in methanol or dimethylformamide solution. These complexes have a square pyramidal structure with an oxo ligand at the apical position. The peptide is coordinated to a metal atom through N{sub amine} of lysine. S{sub thiol} of cysteine, and N{sub amide} of tyrosine and cysteine in the equatorial plane. A lysine (CH{sub 2}){sub 4}NH{sub 2} group of the L{sup 5} ligand has the syn conformation with respect to metal-oxo bonding in the complex. The syn isomer was selectively formed in the ligand exchange reaction. The conversion of the syn isomer to the anti isomer was observed only for syn-[ReO(L{sup 5})], in which the coordination of water to the trans position of the oxo ligand was involved. (orig.)

  17. Phytoextraction of rhenium by lucerne (Medicago sativa) and erect milkvetch (Astragalus adsurgens) from alkaline soils amended with coal fly ash.

    Science.gov (United States)

    He, Honghua; Dong, Zhigang; Pang, Jiayin; Wu, Gao-Lin; Zheng, Jiyong; Zhang, Xingchang

    2018-07-15

    Coal fly ash (CFA) is an industrial waste generated in huge amounts worldwide, and the management of CFA has become an environmental concern. Recovery of valuable metals from CFA is one of the beneficial reuse options of CFA. Rhenium (Re) is one of the rarest metals in the Earth's crust and one of the most expensive metals of strategic significance in the world market. A CFA at the Jungar Thermal Power Plant, Inner Mongolia, China, contains more Re than two alkaline soils in the surrounding region. Pot experiments were undertaken to grow lucerne (Medicago sativa) and erect milkvetch (Astragalus adsurgens) in a loessial soil and an aeolian sandy soil amended with different rates (5%, 10%, 20%, and 40%) of CFA. The results show that plant growth was considerably enhanced and Re concentration in plants was significantly increased when CFA was applied to the alkaline soils at rates of ≤20%; while in some cases plant growth was also markedly enhanced by the 40% CFA treatment, which increased plant Re concentration the most of all treatments. Both lucerne and erect milkvetch showed potential for phytoextracting Re from CFA-amended alkaline soils. Using CFA for soil amendment not only offers a potential solution for the waste disposal problem of CFA, but the phytoextraction of Re by both lucerne and erect milkvetch may also bring an economic profit in the future. Copyright © 2018 Elsevier B.V. All rights reserved.

  18. Fabrication of Tungsten-Rhenium Cladding materials via Spark Plasma Sintering for Ultra High Temperature Reactor Applications

    Energy Technology Data Exchange (ETDEWEB)

    Charit, Indrajit; Butt, Darryl; Frary, Megan; Carroll, Mark

    2012-11-05

    This research will develop an optimized, cost-effective method for producing high-purity tungsten-rhenium alloyed fuel clad forms that are crucial for the development of a very high-temperature nuclear reactor. The study will provide critical insight into the fundamental behavior (processing-microstructure- property correlations) of W-Re alloys made using this new fabrication process comprising high-energy ball milling (HEBM) and spark plasma sintering (SPS). A broader goal is to re-establish the U.S. lead in the research field of refractory alloys, such as W-Re systems, with potential applications in very high-temperature nuclear reactors. An essential long-term goal for nuclear power is to develop the capability of operating nuclear reactors at temperatures in excess of 1,000K. This capability has applications in space exploration and some special terrestrial uses where high temperatures are needed in certain chemical or reforming processes. Refractory alloys have been identified as being capable of withstanding temperatures in excess of 1,000K and are considered critical for the development of ultra hightemperature reactors. Tungsten alloys are known to possess extraordinary properties, such as excellent high-temperature capability, including the ability to resist leakage of fissile materials when used as a fuel clad. However, there are difficulties with the development of refractory alloys: 1) lack of basic experimental data on thermodynamics and mechanical and physical properties, and 2) challenges associated with processing these alloys.

  19. High-K isomers in {sup 176}W and mechanisms of K-violation

    Energy Technology Data Exchange (ETDEWEB)

    Crowell, B.; Janssens, R.V.F.; Blumenthal, D.J. [and others

    1995-08-01

    K-isomers are states in deformed nuclei whose {gamma}-decay is hindered by selection rules involving K, the projection of the angular momentum along the axis of symmetry of the nucleus. Previous work with the Argonne Notre Dame BGO Array delineated the existence of two K-isomers in {sup 176}W, one of which had a very unusual pattern of decay. A short description of this work was published as a letter, and a more complete account is being readied for submission. These results provided evidence that quantum-mechanical fluctuations in the nuclear shape may be responsible for some of the observed K-violating transitions. In addition, hints were present in the data of the existence of another K-isomer with an even higher in. An experiment was performed in September 1994 to observe this isomer, using the reaction {sup 50}Ti({sup 130}Te,4n), and a technique in which recoiling {sup 176}W nuclei were created 17-cm upstream of the center of the array and caught on a Pb catcher foil at the center. Intense ({approximately} 3 pnA) beams of {sup 130}Te were supplied by the ECR source using a new sputtering technique. The recoil-shadow geometry was highly successful at removing the background from non-isomeric decays, allowing the weakly populated K-isomers to be detected cleanly. In addition, the availability of pulsed beams from ATLAS and the timing data from the BGO array provided a second technique for isolating the decays of interest, by selecting events in which a given number of BGO detectors fired between beam pulses. This method was used in the previous experiment, and was also applied in this experiment as a second level of selection. As a result, gamma-ray transitions were detected in the present experiment with intensities as small as {approximately} 0.02 % of the {sup 176}W reaction channel. The existence of the new isomer was confirmed, and a partial level-scheme was constructed.

  20. Mass spectrometry of rhenium complexes: a comparative study by using LDI-MS, MALDI-MS, PESI-MS and ESI-MS.

    Science.gov (United States)

    Petroselli, Gabriela; Mandal, Mridul Kanti; Chen, Lee Chuin; Ruiz, Gustavo T; Wolcan, Ezequiel; Hiraoka, Kenzo; Nonami, Hiroshi; Erra-Balsells, Rosa

    2012-03-01

    A group of rhenium (I) complexes including in their structure ligands such as CF(3)SO(3)-, CH(3)CO(2)-, CO, 2,2'-bipyridine, dipyridil[3,2-a:2'3'-c]phenazine, naphthalene-2-carboxylate, anthracene-9-carboxylate, pyrene-1-carboxylate and 1,10-phenanthroline have been studied for the first time by mass spectrometry. The probe electrospray ionization (PESI) is a technique based on electrospray ionization (ESI) that generates electrospray from the tip of a solid metal needle. In this work, mass spectra for organometallic complexes obtained by PESI were compared with those obtained by classical ESI and high flow rate electrospray ionization assisted by corona discharge (HF-ESI-CD), an ideal method to avoid decomposition of the complexes and to induce their oxidation to yield intact molecular cation radicals in gas state [M](+·) and to produce their reduction yielding the gas species [M](-·). It was found that both techniques showed in general the intact molecular ions of the organometallics studied and provided additional structure characteristic diagnostic fragments. As the rhenium complexes studied in the present work showed strong absorption in the UV-visible region, particularly at 355 nm, laser desorption ionization (LDI) mass spectrometry experiments could be conducted. Although intact molecular ions could be detected in a few cases, LDI mass spectra showed diagnostic fragments for characterization of the complexes structure. Furthermore, matrix-assisted laser desorption ionization (MALDI) mass spectra were obtained. Nor-harmane, a compound with basic character, was used as matrix, and the intact molecular ions were detected in two examples, in negative ion mode as the [M](-·) species. Results obtained with 2-[(2E)-3-(4-tert-buthylphenyl)-2-methylprop-2-enylidene] malononitrile (DCTB) as matrix are also described. LDI experiments provided more information about the rhenium complex structures than did the MALDI ones. Copyright © 2012 John Wiley & Sons, Ltd.

  1. Experimental determination of the hydrothermal solubility of ReS2 and the Re–ReO2 buffer assemblage and transport of rhenium under supercritical conditions

    Directory of Open Access Journals (Sweden)

    Wood Scott A

    2002-01-01

    Full Text Available To understand the aqueous species important for transport of rhenium under supercritical conditions, we conducted a series of solubility experiments on the Re–ReO2 buffer assemblage and ReS2. In these experiments, pH was buffered by the K–feldspar–muscovite–quartz assemblage; in sulfur-free systems was buffered by the Re–ReO2 assemblage; and and in sulfur-containing systems were buffered by the magnetite–pyrite–pyrrhotite assemblage. Our experimental studies indicate that the species ReCl40 is dominant at 400°C in slightly acidic to near-neutral, and chloride-rich (total chloride concentrations ranging from 0.5 to 1.0 M environments, and ReCl3+ may predominate at 500°C in a solution with total chloride concentrations ranging from 0.5 to 1.5 M. The results also demonstrate that the solubility of ReS2 is about two orders of magnitude less than that of ReO2. This finding not only suggests that ReS2 (or a ReS2 component in molybdenite is the solubility-controlling phase in sulfur-containing, reducing environments but also implies that a mixing process involving an oxidized, rhenium-containing solution and a solution with reduced sulfur is one of the most effective mechanisms for deposition of rhenium. In analogy with Re, TcS2 may be the stable Tc-bearing phase in deep geological repositories of radioactive wastes.

  2. High-resolution metallic magnetic calorimeters for {beta}-spectroscopy on {sup 187}rhenium and position resolved X-ray spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Porst, Jan-Patrick

    2011-02-01

    This thesis describes the development of metallic magnetic calorimeters (MMCs) for high resolution spectroscopy. MMCs are energy dispersive particle detectors based on the calorimetric principle which are typically operated at temperatures below 100 mK. The detectors make use of a paramagnetic temperature sensor to transform the temperature rise upon the absorption of a particle in the detector into a measurable magnetic flux change in a dc-SQUID. The application of MMCs for neutrino mass measurements and their advantages with respect to other approaches are discussed. In view of this application the development of an MMC optimized for {beta}-endpoint spectroscopy on {sup 187}rhenium is presented. A fully micro-fabricated X-ray detector is characterized and performs close to design values. Furthermore, a new technique to more efficiently couple rhenium absorbers mechanically and thermally to the sensor was developed and successfully tested. By employing a metallic contact, signal rise times faster than 5 {mu}s could be observed with superconducting rhenium absorbers. In addition to the single pixel detectors, an alternative approach of reading out multiple pixels was developed in this work, too. Here, the individual absorbers have a different thermal coupling to only one temperature sensor resulting in a distribution of different pulse shapes. Straightforward position discrimination by means of rise time analysis is demonstrated for a four pixel MMC and a thermal model of the detector is provided. Unprecedented so far, an energy resolution of less than {delta}E{sub FWHM}<5 eV for 5.9 keV X-rays was achieved across all absorbers. (orig.)

  3. Thermal decomposition of rhenium (5) complexes with 1,2,4-triazole. Termicheskoe razlozhenie kompleksov reniya (5) s 1,2,4-triazolom

    Energy Technology Data Exchange (ETDEWEB)

    Amindzhanov, A A; Gagieva, S Ch; Kotegov, K V [Tadzhikskij Gosudarstvennyj Univ., Dushanbe (Tajikistan)

    1991-01-01

    Processes of thermal decomposition of rhenium (5) complexes with 1,2,4-triazole were studied. Thermolysis products were identified on the basis of data of the element analysis, IR spectra, conductometry and other methods. It is ascertained that at the first stage of thermolysis of hydroxyl-containing monomer complexes removal of water molecules occurs, and at the second one - dimerization process with formation of Re-O-Re group. It is shown that the nature of halide ion practically does not affect the temperature of the start of intensive thermal decomposition of the complexes.

  4. Photodetectors: Broad Detection Range Rhenium Diselenide Photodetector Enhanced by (3-Aminopropyl)Triethoxysilane and Triphenylphosphine Treatment (Adv. Mater. 31/2016).

    Science.gov (United States)

    Jo, Seo-Hyeon; Park, Hyung-Youl; Kang, Dong-Ho; Shim, Jaewoo; Jeon, Jaeho; Choi, Seunghyuk; Kim, Minwoo; Park, Yongkook; Lee, Jaehyeong; Song, Young Jae; Lee, Sungjoo; Park, Jin-Hong

    2016-08-01

    The effects of triphenylphosphine (PPh3 ) and (3-amino-propyl)triethoxysilane (APTES) on a rhenium diselenide (ReSe2 ) photodetector are systematically studied by J.-H. Park and co-workers on page 6711 in comparison with a conventional MoS2 device. A very high performance ReSe2 photodetector is demonstrated, which has a broad photodetection range, high photoresponsivity (1.18 × 10(6) A W(-1) ), and fast photoswitching speed (rising/decaying time: 58/263 ms). © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Radiolabeling and biotinylation of internalizing monoclonal antibody chimeric BR96: Potential use of extracorporeal immunoadsorption with enhanced tumor radioactivity retention of Iodine, Indium and Rhenium

    International Nuclear Information System (INIS)

    Chen, JianQing.

    1997-01-01

    In this thesis, methodology of radiolabeling and simultaneous biotinylation for internalizing monoclonal antibody chimeric BR96 have been investigated by using three element groups of potential therapeutic radionuclides iodine, indium and rhenium, and their different labeling methods. The biodistribution and kinetics of biotinylated and radiolabeled chiBR96 have been studied in colon carcinoma isografted rats. The potential use of ECIA, based on the biotin-avidin concept, has been evaluated and compared with the approach of avidin 'chase' in the same animal tumor model with respect to an enhancement of tumor-to-normal tissue (T/N) activity ratio. 131 refs

  6. Radiolabeling and biotinylation of internalizing monoclonal antibody chimeric BR96: Potential use of extracorporeal immunoadsorption with enhanced tumor radioactivity retention of Iodine, Indium and Rhenium

    Energy Technology Data Exchange (ETDEWEB)

    Chen, JianQing

    1997-01-01

    In this thesis, methodology of radiolabeling and simultaneous biotinylation for internalizing monoclonal antibody chimeric BR96 have been investigated by using three element groups of potential therapeutic radionuclides iodine, indium and rhenium, and their different labeling methods. The biodistribution and kinetics of biotinylated and radiolabeled chiBR96 have been studied in colon carcinoma isografted rats. The potential use of ECIA, based on the biotin-avidin concept, has been evaluated and compared with the approach of avidin `chase` in the same animal tumor model with respect to an enhancement of tumor-to-normal tissue (T/N) activity ratio. 131 refs.

  7. Lump Kinetic Analysis of Syngas Composition Effect on Fischer-Tropsch Synthesis over Cobalt and Cobalt-Rhenium Alumina Supported Catalyst

    Directory of Open Access Journals (Sweden)

    Dewi Tristantini

    2016-03-01

    Received: 10th November 2015; Revised: 10th February 2016; Accepted: 16th February 2016 How to Cite: Tristantini, D., Suwignjo, R.K. (2016. Lump Kinetic Analysis of Syngas Composition Effect on Fischer-Tropsch Synthesis over Cobalt and Cobalt-Rhenium Alumina Supported Catalyst. Bulletin of Chemical Reaction Engineering & Catalysis, 11 (1: 84-92. (doi:10.9767/bcrec.11.1.424.84-92 Permalink/DOI: http://dx.doi.org/10.9767/bcrec.11.1.424.84-92

  8. Effect of heat-treatment on microstructure and high-temperature deformation behavior of a low rhenium-containing single crystal nickel-based superalloy

    International Nuclear Information System (INIS)

    Sun, Nairong; Zhang, Lanting; Li, Zhigang; Shan, Aidang

    2014-01-01

    A low rhenium-containing [001] oriented single crystal nickel-based superalloy with different γ′ morphologies induced by various aging treatments was compressed from room temperature to 1000 °C. All the single crystal samples with different γ′ morphologies exhibit anomalous yield behavior. The sample first aged at 1180 °C has the widest anomalous temperature domain and highest yield strengths. The sample first aged at 1000 °C has the highest anomalous peak stress temperature

  9. Physical Properties of Main-belt Comet 176P/LINEAR

    Science.gov (United States)

    Hsieh, Henry H.; Ishiguro, Masateru; Lacerda, Pedro; Jewitt, David

    2011-07-01

    We present a physical characterization of comet 176P/LINEAR, the third discovered member of the new class of main-belt comets, which exhibit cometary activity but are dynamically indistinguishable from main-belt asteroids. Observations show the object exhibiting a fan-shaped tail for at least one month in late 2005, but then becoming inactive in early 2006. During this active period, we measure broadband colors of B - V = 0.63 ± 0.02, V - R = 0.35 ± 0.02, and R - I = 0.31 ± 0.04. Using data from when the object was observed to be inactive, we derive best-fit IAU phase function parameters of H = 15.10 ± 0.05 mag and G = 0.15 ± 0.10, and best-fit linear phase function parameters of m(1, 1, 0) = 15.35 ± 0.05 mag and β = 0.038 ± 0.005 mag deg-1. From this baseline phase function, we find that 176P exhibits a mean photometric excess of ~30% during its active period, implying an approximate total coma dust mass of Md ~ (7.2 ± 3.6) × 104 kg. From inactive data obtained in early 2007, we find a rotation period of P rot = 22.23 ± 0.01 hr and a peak-to-trough photometric range of Δm ~ 0.7 mag. Phasing our photometric data from 176P's 2005 active period to this rotation period, we find that the nucleus exhibits a significantly smaller photometric range than in 2007 that cannot be accounted for by coma damping effects, and as such, are attributed by us to viewing geometry effects. A detailed analysis of these geometric effects showed that 176P is likely to be a highly elongated object with an axis ratio of 1.8 data presented herein were obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership. Additionally, some of the presented data were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National

  10. Fission fragment mass distribution in the 13C+182W and 176Yb reactions

    International Nuclear Information System (INIS)

    Ramachandran, K.; Hinde, D.J.; Dasgupta, M.; Williams, E.; Wakhle, A.; Luong, D.H.; Evers, M.; Carter, I.P.; Das, S.

    2014-01-01

    Fission fragment mass distributions have been measured for many systems and found to be asymmetric in the fission of nuclei with nucleon number A in the range 228-258 and proton number Z in the range 90-100. For lighter systems, it has been observed that fission fragment mass distributions are usually symmetric. At high excitation energies the shell effects are expected to vanish and the nuclei are expected to behave like a charged liquid drop; hence, only symmetric fission is expected for all the nuclei. Even after much experimental and theoretical work in this field, the rate of damping of shell effects with excitation energy is not well known. This abstract reports our measurements with 13 C beams on 182 W and 176 Yb targets

  11. Ultra-small rhenium nanoparticles immobilized on DNA scaffolds: An excellent material for surface enhanced Raman scattering and catalysis studies.

    Science.gov (United States)

    Anantharaj, S; Sakthikumar, K; Elangovan, Ayyapan; Ravi, G; Karthik, T; Kundu, Subrata

    2016-12-01

    Highly Sensitive and ultra-small Rhenium (Re) metal nanoparticles (NPs) were successfully stabilized in water by the staging and fencing action of the versatile biomolecule DNA that resulted in two distinct aggregated chain-like morphologies with average grain sizes of 1.1±0.1nm and 0.7±0.1nm for the very first time within a minute of reaction time. Re NPs are formed by the borohydride reduction of ammonium perrhenate (NH4ReO4) in the presence of DNA at room temperature (RT) under stirring. The morphologies were controlled by carefully monitoring the molar ratio of NH4ReO4 and DNA. The synthesized material was employed in two potential applications: as a substrate for surface enhanced Raman scattering (SERS) studies and as a catalyst for the reduction of aromatic nitro compounds. SERS study was carried out by taking methylene blue (MB) as the probe and the highest SERS enhancement factor (EF) of 2.07×10(7) was found for the aggregated chain-like having average grain size of 0.7±0.1nm. Catalytic reduction of 4-nitro phenol (4-NP), 2-nitro phenol (2-NP) and 4-nitroaniline (4-NA) with a rate constant value of 6×10(-2)min(-1), 33.83×10(-2)min(-1) and 37.4×10(-2)min(-1) have testified the excellent catalytic performance of our Re NPs immobilized on DNA. The overall study have revealed the capability of DNA in stabilizing the highly reactive Re metal at nanoscale and made them applicable in practice. The present route can also be extended to prepare one dimensional (1-D), self-assembled NPs of other reactive metals, mixed metals or even metal oxides for specific applications in water based solutions. Copyright © 2016 Elsevier Inc. All rights reserved.

  12. Dissimilar behavior of technetium and rhenium in borosilicatewaste glass as determined by X-ray absorption spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Lukens, Wayne W.; McKeown, David A.; Buechele, Andrew C.; Muller,Isabelle S.; Shuh, David K.; Pegg, Ian L.

    2006-11-09

    Technetium-99 is an abundant, long-lived (t1/2 = 213,000 yr)fission product that creates challenges for the safe, long-term disposalof nuclear waste. While 99Tc receives attention largely due to its highenvironmental mobility, it also causes problems during its incorporationinto nuclear waste glass due to the volatility of Tc(VII) compounds. Thisvolatility decreases the amount of 99Tc stabilized in the waste glass andcauses contamination of the waste glass melter and off-gas system. Theapproach to decrease the volatility of 99Tc that has received the mostattention is reduction of the volatile Tc(VII) species to less volatileTc(IV) species in the glass melt. On engineering scale experiments,rhenium is often used as a non-radioactive surrogate for 99Tc to avoidthe radioactive contamination problems caused by volatile 99Tc compounds.However, Re(VII) is more stable towards reduction than Tc(VII), so morereducing conditions would be required in the glass melt to produceRe(IV). To better understand the redox behavior of Tc and Re in nuclearwaste glass, a series of glasses were prepared under different redoxconditions. The speciation of Tc and Re in the resulting glasses wasdetermined by X-ray absorption fine structure spectroscopy. Surprisingly,Re and Tc do not behave similarly in the glass melt. Although Tc(0),Tc(IV), and Tc(VII) were observed in these samples, only Re(0) andRe(VII) were found. In no case was Re(IV) (or Re(VI))observed.

  13. Thermal transformations of oxohalide complexes of rhenium(5) and molybdenum(5) with diazo-18-crown-6 in solid phase. Termicheskie prevrashcheniya oksogalogenidnykh kompleksov reniya(5) i molibdena(5) s diaza-18-kraun-6 v tverdoj faze

    Energy Technology Data Exchange (ETDEWEB)

    Ashurova, N Kh; Yakubov, K G [Tadzhikskij Gosudarstvennyj Univ., Dushanbe (Tajikistan)

    1992-11-01

    Methods for synthesis and separation in solid state of the rhenium(5) and molybdenum(5) onium complexes with diaza-18-crown-6(L), the content of which according to the data of elementary analysis, IRS in the close and remote areas, thermogravimetry, conductometry and potentiometry corresponds to the (H[sub 2]L)[EOX[sub 5

  14. Ultrafast Excited-State Dynamics of Rhenium(I) Photosensitizers [Re(Cl)(CO)3(N,N)] and [Re(imidazole)(CO)3(N,N)]+: Diimine Effects

    Czech Academy of Sciences Publication Activity Database

    Nahhas, A. E.; Consani, C.; Blanco-Rodríguez, A. M.; Lancaster, K. M.; Braem, O.; Cannizzo, A.; Towrie, M.; Clark, I. P.; Záliš, Stanislav; Chergui, M.; Vlček, Antonín

    2011-01-01

    Roč. 50, č. 7 (2011), s. 2932-2943 ISSN 0020-1669 R&D Projects: GA MŠk(CZ) ME10124; GA MŠk(CZ) LD11082 Institutional research plan: CEZ:AV0Z40400503 Keywords : rhenium * photosynthesis * diimine effects Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.601, year: 2011

  15. Studies on the preparation and isomeric composition of [sup 186]Re- and [sup 188]Re-pentavalent rhenium dimercaptosuccinic acid complex

    Energy Technology Data Exchange (ETDEWEB)

    Singh, J. (Canterbury Univ. (United Kingdom). Biological Lab.); Reghebi, K.; Lazarus, C.R.; Clarke, S.E.M. (Guy' s Hospital, London (United Kingdom)); Callahan, A.P.; Knapp, F.F. Jr. (Oak Ridge National Lab., TN (United States)); Blower, P.J. (Kent and Canterbury Hospital (United Kingdom))

    1993-03-01

    The preparative conditions for [sup 186]Re(V)DMSA and [sup 188]Re(V)DMSA (DMSA = meso-dimercaptosuccinic acid), [beta]-emitting radiopharmaceuticals that have been shown to localize in medullary thyroid carcinoma, require modification depending on the amount of carrier rhenium and the chemical form and medium in which the rhenium is supplied. Preparative conditions are described for use with carrier-free [sup 188]ReO[sub 4][sup -] in saline, and for use with [sup 186]ReO[sub 4][sup -] in saline, sodium hydroxide or nitric acid. Preparation of [sup 186]Re(V)DMSA (carrier present up to 2 mg per 2.5 ml reaction volume) requires a DMSA:SnCl[sub 2]:Re ratio of 10:5:1 at 100[sup o]C for 30 min. Addition of excess nitric acid or hydrochloric acid up to a concentration of 155 mM does not reduce the yield from 100%. A commercial DMSA kit vial (e.g. Amerscan DMSA) can be used for preparation of [sup 188]Re(V)DMSA (carrier free) provided the required is in a volume of less than 1 ml per vial. A convenient method of concentrating the [sup 188]Re generator eluate to the required volume is described. (Author).

  16. In-situ field-ion microscope study of the recovery behavior of heavy metal ion-irradiated tungsten, tungsten (rhenium) alloys and molybdenum

    International Nuclear Information System (INIS)

    Nielsen, C.H.

    1977-06-01

    Three field ion microscope (FIM) experiments were carried out to study the annealing behavior of heavy ion irradiated tungsten, tungsten (rhenium) alloys and molybdenum. The first experiment dealt with the stage I long-range migration of tungsten self interstitial atoms (SIAs) in high purity tungsten of resistivity ratio, R = 24,000 (R = rho 300 /rho 4 . 2 , where rho 300 and rho 4 . 2 are the room temperature and 0 0 C resistivities). The FIM specimens were irradiated in situ at 18 K with 30 keV W + ions to an average dose of 5 x 10 12 ions cm -2 and subsequently examined by the pulsed-field evaporation technique. The second experiment dealt with the phenomenon of impurity atom trapping of SIAs during long-range migration. It was shown that rhenium atoms in a tungsten matrix tend to capture tungsten SIAs and remain bound up to temperatures as high as 390 K. The final experiment was concerned with the low temperature annealing kinetics of irradiated molybdenum. High purity molybdenum of resistivity ratio R = 5700 was irradiated at 10 K with 30 keV Mo + ions to a dose of approximately 5 x 10 12 ions cm -2 . The results indicated that the electric field has only a minimal effect on the SIA annealing kinetics. This tends to strengthen the contention that the molybdenum SIA becomes mobile at 32 K

  17. Genome-wide association study in 176,678 Europeans reveals genetic loci for tanning response to sun exposure

    NARCIS (Netherlands)

    Visconti, A. (Alessia); D.L. Duffy (David); F. Liu (Fan); G. Zhu (Gu); Wu, W. (Wenting); C. Yan (Chen); P.G. Hysi (Pirro); C. Zeng (Changqing); Sanna, M. (Marianna); M.M. Iles (Mark M.); P.P. Kanetsky (Peter P.); F. Demenais (Florence); M.A. Hamer (Merel); A.G. Uitterlinden (André); M.A. Ikram (Arfan); T.E.C. Nijsten (Tamar); N.G. Martin (Nicholas); M.H. Kayser (Manfred); T.D. Spector (Timothy); J. Han (Jiali); V. Bataille (Veronique); M. Falchi (Mario)

    2018-01-01

    textabstractThe skin's tendency to sunburn rather than tan is a major risk factor for skin cancer. Here we report a large genome-wide association study of ease of skin tanning in 176,678 subjects of European ancestry. We identify significant association with tanning ability at 20 loci. We confirm

  18. 46 CFR 176.620 - Description of the Alternative Hull Examination (AHE) Program for certain passenger vessels.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Description of the Alternative Hull Examination (AHE... Hull and Tailshaft Examinations § 176.620 Description of the Alternative Hull Examination (AHE) Program for certain passenger vessels. The Alternative Hull Examination (AHE) Program provides you with an...

  19. 46 CFR 176.625 - Eligibility requirements for the Alternative Hull Examination (AHE) Program for certain passenger...

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Eligibility requirements for the Alternative Hull... CERTIFICATION Hull and Tailshaft Examinations § 176.625 Eligibility requirements for the Alternative Hull... if— (1) It is constructed of steel or aluminum; (2) It has an effective hull protection system; (3...

  20. 49 CFR 176.128 - Magazine stowage types “A”, “C” and Special Stowage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Magazine stowage types âAâ, âCâ and Special... CARRIAGE BY VESSEL Detailed Requirements for Class 1 (Explosive) Materials Stowage § 176.128 Magazine...” and “Special”. (b) Magazine stowage type “A”. Magazine stowage type A is required for those substances...

  1. 21 CFR 176.160 - Chromium (Cr III) complex of N-ethyl-N-heptadecylfluoro-octane sulfonyl glycine.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Chromium (Cr III) complex of N-ethyl-N... § 176.160 Chromium (Cr III) complex of N-ethyl-N-heptadecylfluoro-octane sulfonyl glycine. The chromium... by weight of the chromium (Cr III) complex of heptadecylfluoro-octane sulfonic acid may be safely...

  2. Update of monotherapy trials with the new anti-androgen, Casodex (ICI 176,334). International Casodex Investigators

    DEFF Research Database (Denmark)

    Iversen, P

    1994-01-01

    Casodex (ICI 176,334) is a non-steroidal anti-androgen, which has a half-life compatible with once-daily oral dosing. In an open, phase II study on 267 patients given Casodex, 50 mg/day, an overall objective response (i.e. partial regression) was seen in 55.5% of patients (146 of 263) with a furt...

  3. 40 CFR 267.176 - What must I do when I want to stop using the containers?

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Use and Management of Containers § 267.176 What must I do when I want to stop using the containers? You must remove all hazardous waste and hazardous waste residues from...

  4. Readout of a 176 pixel FDM system for SAFARI TES arrays

    Science.gov (United States)

    Hijmering, R. A.; den Hartog, R.; Ridder, M.; van der Linden, A. J.; van der Kuur, J.; Gao, J. R.; Jackson, B.

    2016-07-01

    In this paper we present the results of our 176-pixel prototype of the FDM readout system for SAFARI, a TES-based focal-plane instrument for the far-IR SPICA mission. We have implemented the knowledge obtained from the detailed study on electrical crosstalk reported previously. The effect of carrier leakage is reduced by a factor two, mutual impedance is reduced to below 1 nH and mutual inductance is removed. The pixels are connected in stages, one quarter of the array half of the array and the full array, to resolve intermediate technical issues. A semi-automated procedure was incorporated to find all optimal settings for all pixels. And as a final step the complete array has been connected and 132 pixels have been read out simultaneously within the frequency range of 1-3.8MHz with an average frequency separation of 16kHz. The noise was found to be detector limited and was not affected by reading out all pixels in a FDM mode. With this result the concept of using FDM for multiplexed bolometer read out for the SAFARI instrument has been demonstrated.

  5. Glomerulogenesis: Can it predict the gestational age? A study of 176 fetuses

    Directory of Open Access Journals (Sweden)

    Panduranga Chikkannaiah

    2012-01-01

    Full Text Available Background: Accurate assessment of gestational age of fetuses is essential from both clinical and medico-legal point of view. Crown-rump length, crown-heel length, foot length, and the weight of the fetus are the commonly used parameters for fetal age assessment. However, this estimate often lacks accuracy and sometimes is necessary to combine other data. An analysis of the embryological development of nephrons in the kidney can assist in this determination. Objective : To correlate the gestational age with the histological study of sequential development of nephrons in fetal kidney. Materials and Methods: This study included 176 fetuses delivered between June 2009 and June 2011 and aged from 12 to 40 weeks. The number of glomerular generations counted in hematoxylin and eosin-stained microscopic sections of the kidneys were correlated with the reported period of gestation based on obstetrical methods. Regression analysis was used to determine the statistical significance of the correlation. Results: A high degree of statistically significant correlation was observed between the period of gestation and the number of glomerular generations (P value < 0.0001. Conclusion: The histological assessment of the number of glomerular generations in kidney can be used as a reliable method of estimating fetal age.

  6. Evaluation of technetium-99m/rhenium labelled nucleoside analogues as potential radiotracers in oncology[Dissertation 17173

    Energy Technology Data Exchange (ETDEWEB)

    Desbouis, D

    2007-07-01

    }M). This compound also exhibited a mixed inhibition of the hTK1 with K{sub ic} = 73 {+-} 20 {mu}M. When tested in vitro for cell uptake in transfected cancer cells this technetium thymidine complex revealed a low internalisation of 0.03 {+-} 0.01%ID/(mg/mL). Under the same conditions the [{sup 3}H]thymidine exhibited an uptake of 1.50 {+-} 0.02%lD/(mg/mL). In order to gain potency and selectivity for HSV1-TK, the corresponding 5'-carboxamide 5-ethyl-2', 5'-dideoxyuridine was synthesized. The synthesis of the ligand was performed in seven steps from 2'-deoxyuridine. This ligand was then successfully labelled with the fac-M(CO){sub 3}-core (M = {sup 99m}Tc, Re). The rhenium complex was found to be a selective competitive inhibitor of HSV1-TK (K{sub i} = 4.56 {+-} 0.11 {mu}M). Although the cellular uptake of the technetium 2'-deoxyurine complex (0.10 {+-} 0.01%ID/(mg/mL)) was better than its corresponding technetium thymidine complex, it is still very low compared to thymidine uptake. The second aspect of this work was to develop nucleoside derivatives labelled with technetium-99m/rhenium tricarbonyl core capable of acting as substrates for human cytosolic thymidine kinase (hTKl). hTKl is a target of choice to evaluate cell proliferation due to its overexpression in a variety of cancer cells. [{sup 18}F]Fluorothymidine [{sup 18}F]FLT), which acts as a hTKl substrate, has emerged as a very efficient PET tracer for the monitoring of cell proliferation. Our aim was to develop a SPET tracer with the same mode of action as [{sup 18}F]FLT. We prepared a set of technetium-99m/rhenium complexes of N3 thymidine derivatives with different overall charges (+1, 0 and -1) and variable spacer lengths. The complexes with different overall charges had the same spacer length between chelating system and thymidine moiety (two carbons spacer) while the complexes with different spacer lengths (2, 3, 5 and 10) were all neutral. These compounds were tested for their

  7. A model for the oceanic mass balance of rhenium and implications for the extent of Proterozoic ocean anoxia

    Science.gov (United States)

    Sheen, Alex I.; Kendall, Brian; Reinhard, Christopher T.; Creaser, Robert A.; Lyons, Timothy W.; Bekker, Andrey; Poulton, Simon W.; Anbar, Ariel D.

    2018-04-01

    Emerging geochemical evidence suggests that the atmosphere-ocean system underwent a significant decrease in O2 content following the Great Oxidation Event (GOE), leading to a mid-Proterozoic ocean (ca. 2.0-0.8 Ga) with oxygenated surface waters and predominantly anoxic deep waters. The extent of mid-Proterozoic seafloor anoxia has been recently estimated using mass-balance models based on molybdenum (Mo), uranium (U), and chromium (Cr) enrichments in organic-rich mudrocks (ORM). Here, we use a temporal compilation of concentrations for the redox-sensitive trace metal rhenium (Re) in ORM to provide an independent constraint on the global extent of mid-Proterozoic ocean anoxia and as a tool for more generally exploring how the marine geochemical cycle of Re has changed through time. The compilation reveals that mid-Proterozoic ORM are dominated by low Re concentrations that overall are only mildly higher than those of Archean ORM and significantly lower than many ORM deposited during the ca. 2.22-2.06 Ga Lomagundi Event and during the Phanerozoic Eon. These temporal trends are consistent with a decrease in the oceanic Re inventory in response to an expansion of anoxia after an interval of increased oxygenation during the Lomagundi Event. Mass-balance modeling of the marine Re geochemical cycle indicates that the mid-Proterozoic ORM with low Re enrichments are consistent with extensive seafloor anoxia. Beyond this agreement, these new data bring added value because Re, like the other metals, responds generally to low-oxygen conditions but has its own distinct sensitivity to the varying environmental controls. Thus, we can broaden our capacity to infer nuanced spatiotemporal patterns in ancient redox landscapes. For example, despite the still small number of data, some mid-Proterozoic ORM units have higher Re enrichments that may reflect a larger oceanic Re inventory during transient episodes of ocean oxygenation. An improved understanding of the modern oceanic Re

  8. SU-E-T-181: Clinical Implementation of Task Group 176

    Energy Technology Data Exchange (ETDEWEB)

    Burgdorf, B [University of Pennsylvania, Philadelphia, PA (United States); Yeager, C; Zhou, F; Hand, C [Albert Einstein Medical Center, Philadelphia, PA (United States)

    2015-06-15

    Purpose: The implementation of TG-176 with regards to immobilization devices and couch tops as they effect dosimetric treatment planning. Methods: The external devices used clinically were scanned to measure their HU values. Plans were created in the Eclipse treatment planning system (TPS) using these devices, one that accounted for the correct HU value of the each device and another that did not include the device as a structure. A dose subtraction was performed between the two plans to evaluate the dosimetric differences. The metrics used for evaluation included attenuation and surface dose. Plan parameters were varied to evaluate the impact of the devices in different clinical scenarios. Results: While the exact HU values of our results are clinic-dependent, the protocol being implemented is widely applicable. We recommend a four step process for implementing this task group. First, physics should scan each treatment device to determine accurate HU values. Second, CT therapists should include in the setup note which table top was used during patient CT simulation and are asked to make immobilization devices as uniform in thickness as possible. Therapists should also index the devices whenever possible so beam will traverse the same area of the device. Third, the dosimetrist should manually correct the HU value for any external device, including the couch. For H&N cases, the rails must be removed from the couch structure. When rails are used during treatments, it is important to make note of their exact position in the setup notes. Finally, physicians should be made aware that there could be changes in surface doses depending on whether or not immobilization devices or couch tops are in the beam path. Conclusion: The protocol outlined above was implemented to reduce the errors that arise from ignoring effects of external devices, thus ensuring safer, more accurate patient treatments.

  9. Comparative study of the anchorage and the catalytic properties of nanoporous TiO2 films modified with ruthenium (II) and rhenium (I) carbonyl complexes

    Science.gov (United States)

    Oyarzún, Diego P.; Chardon-Noblat, Sylvie; Linarez Pérez, Omar E.; López Teijelo, Manuel; Zúñiga, César; Zarate, Ximena; Shott, Eduardo; Carreño, Alexander; Arratia-Perez, Ramiro

    2018-02-01

    In this article we study the anchoring of cis-[Ru(bpyC4pyr)(CO)2(CH3CN)2]2+, cis-[Ru(bpy)2(CO)2]2+ and cis-[Ru(bpyac)(CO)2Cl2], onto nanoporous TiO2 employing electropolymerization, electrostatic interaction and chemical bonding. Also, the [Re(bpyac)(CO)3Cl] rhenium(I) complex for chemical anchorage was analyzed. The characterization of TiO2/Ru(II) and TiO2/Re(I) nanocomposite films was performed by field emission scanning electron microscopy (FESEM), electron dispersive X-ray spectroscopy (EDS) and Raman spectroscopy. In addition, for the more stable nanocomposites obtained, the catalytic properties (solar energy conversion and CO2 reduction) were evaluated. The efficiency improvement in redox process derived from the (photo)electrochemical evidence indicates that modified nanoporous TiO2 structures enhance the rate of charge transfer reactions.

  10. Open reading frame 176 in the photosynthesis gene cluster of Rhodobacter capsulatus encodes idi, a gene for isopentenyl diphosphate isomerase.

    OpenAIRE

    Hahn, F M; Baker, J A; Poulter, C D

    1996-01-01

    Isopentenyl diphosphate (IPP) isomerase catalyzes an essential activation step in the isoprenoid biosynthetic pathway. A database search based on probes from the highly conserved regions in three eukaryotic IPP isomerases revealed substantial similarity with ORF176 in the photosynthesis gene cluster in Rhodobacter capsulatus. The open reading frame was cloned into an Escherichia coli expression vector. The encoded 20-kDa protein, which was purified in two steps by ion exchange and hydrophobic...

  11. Study of the production of 177Lu through 176Yb (n, γ) 177Yb → 177Lu nuclear reaction

    International Nuclear Information System (INIS)

    Silva, Giovana Pasqualini da; Osso Junior, Joao Alberto

    2007-01-01

    The beta minus emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of T 1/2 = 6.71 day and maximum and average β - energies of 421 and 133 keV, resulting in a short range of radiation in tissue. The decay is accompanied by the emission of low energy γ-radiation with 208.3 keV (11%) and 113 keV (6.4%) suitable for simultaneous imaging, 177 Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, as also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of 177 Lu from Yb isotopes. The objective of this work is to study the production of 177 Lu through the indirect 176 Yb(n,γ) 177 Yb → 177 Lu nuclear reaction. The results of the production yield of 177 Lu will be shown and compared with the direct reaction. The method of choice for the chemical separation between Lu and Yb was the ion exchange, using an cation exchange resin in Cl - form and α-HIBA as eluent. Preliminary results showed a good separation of 177 Lu from Yb 2 O 3 indirect targets. (author)

  12. Clinical studies on the lymph flow of the esophagus by injecting sup(99m)Tc-rhenium colloid into the esophageal wall

    International Nuclear Information System (INIS)

    Baba, Masamichi; Tanabe, Gen; Nishi, Mitsumasa

    1985-01-01

    Using 29 operative cases lymph flow of the esophagus was investigated by injecting endoscopically sup(99m)Tc-Rhenium colloid. Rhenium colloid lymphoscintigraphy was made, and 30 -- 32 hours after injection RI up take (cpm/g) of resected lymph nodes was counted by scintillation counter. 1. RI up take of resected lymph nodes correspond with the lymphoscintigraphy of resected lymph nodes therefore, RI up take count was available to study the extra-mural lymph flow of the esophagus. 2. In the cases injected at upper part of the esophagus, the high counted RI up take was noted in bifurcation lymph nodes, upper mediastinal lymph nodes and bilateral supraclavicular lymph nodes. In the cases injected at middle part of the esophagus, bilateral supraclavicular lymph nodes, upper mediastinal lymph nodes and left gastric artery lymph nodes revealed the high RI up takes. In the cases injected at lower part of the esophagus, RI up take was highly noted in bifurcation lymph nodes, left gastric artery lymph nodes and celiac axis lymph nodes. In the cases injected at esophago-gastric junction, the high counted RI up take was noted in left gastric artery lymph nodes, celiac axis lymph nodes and the lymph nodes around the left renal vein. 3. In the cases injected at upper, middle parts of the esophagus, bilateral supraclavicular lymph nodes revealed the high RI up take. Some of these lymph nodes are regarded as directly connected with the extra-mural lymph vessls of the esophagus. Therefore, it was suggested that existence of ''direct lymph flow'' from which upper, middle intrathoracic esophagus directly connected to right supraclavicular lymph nodes. 4. It is important to perform bilateral modified neck dissection in case of upper, middle intrathoracic esophageal cancer and is important to dissect the lymph nodes around the left renal vein in case of esophago-gastric cancer and lower intrathoracic esophageal cancer. (J.P.N.)

  13. TU-D-9A-01: TG176: Dosimetric Effects of Couch Tops and Immobilization Devices

    International Nuclear Information System (INIS)

    Olch, A

    2014-01-01

    The dosimetric impact from devices external to the patient is a complex combination of increased skin dose, reduced tumor dose, and altered dose distribution. Although small monitor unit or dose corrections are routinely made for blocking trays, ion chamber correction factors, or tissue inhomogeneities, the dose perturbation of the treatment couch top or immobilization devices are often overlooked. These devices also increase surface dose, an effect which is also often ignored or underestimated. These concerns have grown recently due to the increased use of monolithic carbon fiber couch tops which are optimal for imaging for patient position verification but cause attenuation and increased surface dose compared to the ‘tennis racket’ style couch top they often replace. Also, arc delivery techniques have replaced stationary gantry techniques which cause a greater fraction of the dose to be delivered from posterior angles. A host of immobilization devices are available and used to increase patient positioning reproducibility, and these also have attenuation and skin dose implications which are often ignored. This report of Task Group 176 serves to present a survey of published data that illustrates the magnitude of the dosimetric effects of a wide range of devices external to the patient. The report also provides methods for modeling couch tops in treatment planning systems so the physicist can accurately compute the dosimetric effects for indexed patient treatments. Both photon and proton beams are considered. A discussion on avoidance of high density structures during beam planning is also provided. An important aspect of this report are the recommendations we make to clinical physicists, treatment planning system vendors, and device vendors on how to make measurements of skin dose and attenuation, how to report these values, and for the vendors, an appeal is made to work together to provide accurate couch top models in planning systems. Learning Objectives

  14. Rhenium(5) and molybdenum(5) complexes with 4',4[sup (]5[sup )]-divaleryldibenzo-18-crown-6. Kompleksnye soedineniya reniya(5) i molibdena(5) s 4',4[sup (]5[sup )]-divalerildibenzo-18-kraun-6

    Energy Technology Data Exchange (ETDEWEB)

    Ashurova, N Kh; Yakubov, K G; Tashmukhamedova, A K; Basitova, S M [Tadzhikskij Gosudarstvennyj Univ., Dushanbe (Tajikistan)

    1993-02-01

    Methods for synthesizing oxohalide complexes of rhenium and molybdenum with +5 oxidation degree with 4',4[sup (5)]-divaleryldibenzo-18-crown-6 were developed. Content and composition of prepared compounds were investigated by the methods of element analysis, crystal optics, conductometry, IR spectroscopy in the near and far regions, thermogravimetry. Oxidation degree of the complex-forming metal was determined. It was established that composition of the compounds coressponded to the general formula MOLX [sub [center dot

  15. Rhenium (5) and molybdenum (5) complexes with 4',4''(5'')-ditretbutyldibenzo-24-crown-8. Kompleksnye soedineniya reniya (5) i molibdena (5) s 4',4''(5'')-ditretbutildibenzo-24-kraun-8

    Energy Technology Data Exchange (ETDEWEB)

    Ashurova, N Kh; Yakubov, K G; Basitova, S M; Tashmukhamedova, A K; Sajfullina, N Zh [Tadzhikskij Gosudarstvennyj Univ., Dushanbe (USSR)

    1989-10-01

    Rhenium and molybdenum complexes in +5 oxidation degree with 4',4''(5'')-ditretbutyldibenzo-24-crown-8 (L) are synthesized with 75-95 % yield. Composition and structure of compounds produced are investigated using element analysis, conductometry, IR spectroscopy, thermogravimetry methods. Oxidation degree of complexer metal is determined. It is ascertained that the compound composition corresponds to the MOLX{sub 3} formula, where M-Re, Mo; X-Cl{sup -}, Br{sup -}.

  16. Laparoscopic cholecystectomy in patients over 70 years of age: review of 176 cases Colecistectomía laparoscópica en pacientes mayores de 70 años: nuestra experiencia en 176 casos

    Directory of Open Access Journals (Sweden)

    F. J. Pérez Lara

    2006-01-01

    Full Text Available Introduction: we assessed the results of laparoscopic cholecystectomy in 176 patients over the age of 70 years. Patients and methods: the study included all patients older than 70 years of age who underwent laparoscopic surgery cholelithiasis during the previous ten years. Variables studied included age, sex, type of operation (programmed/emergency, comorbidity, anesthetic risk, intraoperative cholangiography, conversion to open surgery, number of trocars, reoperation, residual choledocholithiasis, postoperative hospital stay, morbidity and mortality. Results: the study included 176 patients (23.29% men and 76.71% women. The mean age was 74.86 years. The mean hospital stay was 1.27 days, with 16.98% morbidity and 0.56% mortality. Conclusions: laparoscopic cholecystectomy is a safe procedure in older patients. It results in faster recovery, a shorter postoperative stay and lower rates of morbidity and mortality than open bile duct surgery.Objetivo: el objetivo de nuestro estudio es el de evaluar los resultados obtenidos en 176 pacientes mayores de 70 años intervenidos mediante colecistectomía laparoscópica. Pacientes y métodos: se incluyen en el estudio todos los pacientes mayores de 70 años diagnosticados de colelitiasis intervenidos por laparoscopia en los diez últimos años. Analizamos los siguientes parámetros: edad, sexo, tipo de intervención (programada/urgente, comorbilidad, riesgo anestésico, colangiografía intraoperatoria, conversión a cirugía abierta, número de trócares, reintervención, coledocolitiasis residual, estancia hospitalaria postoperatoria y morbimortalidad. Resultados: incluimos en el estudio un total de 176 pacientes, de los cuales el 23,29% son varones y 76,71%, tienen una edad media de 74.86 años. En los resultados globales la estancia media hospitalaria es de 1,27 días, morbilidad 16,98% y mortalidad de 0,57%. Conclusiones: la colecistectomía laparoscópica es un procedimiento seguro en pacientes mayores

  17. Synthesis and luminescence behavior of SrGd1.76Eu0.24O4 host for display and dosimetric applications

    Science.gov (United States)

    Singh, Jyoti; Manam, J.; Singh, Fouran

    2018-05-01

    Novel SrGd1.76Eu0.24O4 materials were synthesized by conventional high-temperature solid-state reaction method in air ambiance. The structural and luminescence properties of as-prepared phosphors were explored by XRD, FESEM, TEM, PL and TL techniques. The confirmation of orthorhombic phase formation was obtained by XRD studies. The agglomerated ginger-like morphology of as-synthesized SrGd1.76Eu0.24O4 samples was unfolded by FESEM and TEM studies. Upon 276 and 395 nm UV excitation, SrGd1.76Eu0.24O4 phosphors showed intense red emission. The TL glow curve of SrGd1.76Eu0.24O4 irradiated with γ-rays exhibits two well-resolved peaks at 393 K and 598 K having a shoulder at 537 K. Linearity in a wide dose range 500 Gy-3 kGy are observed in the as-formed SrGd1.76Eu0.24O4 samples. Intense red emission, linear dose response and high reproducibility of SrGd1.76Eu0.24O4 samples broadly indicated its suitability for display and TL dosimetry applications.

  18. An upper limit on hypertriton production in collisions of Ar(1.76 A GeV) + KCl

    Energy Technology Data Exchange (ETDEWEB)

    Agakishiev, G.; Chernenko, S.; Fateev, O.; Zanevsky, Y. [Joint Institute of Nuclear Research, Dubna (Russian Federation); Belver, D.; Cabanelas, P.; Castro, E.; Garzon, J.A. [Univ. de Santiago de Compostela, LabCAF. F. Fisica, Santiago de Compostela (Spain); Blanco, A.; Fonte, P.; Lopes, L.; Mangiarotti, A. [LIP-Laboratorio de Instrumentacao e Fisica Experimental de Particulas, Coimbra (Portugal); Boehmer, M.; Friese, J.; Gernhaeuser, R.; Jurkovic, M.; Kruecken, R.; Maier, L.; Weber, M. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Boyard, J.L.; Hennino, T.; Liu, T.; Moriniere, E.; Ramstein, B. [Universite Paris Sud, Institut de Physique Nucleaire (UMR 8608), CNRS/IN2P3, Orsay Cedex (France); Destefanis, M.; Gilardi, C.; Kuehn, W.; Lange, J.S.; Metag, V.; Spruck, B. [Justus Liebig Universitaet Giessen, II. Physikalisches Institut, Giessen (Germany); Dohrmann, F.; Kaempfer, B.; Kotte, R.; Naumann, L.; Wendisch, C.; Wuestenfeld, J. [Helmholtz-Zentrum Dresden-Rossendorf, Institut fuer Strahlenphysik, Dresden (Germany); Dybczak, A.; Michalska, B.; Palka, M.; Przygoda, W.; Salabura, P.; Trebacz, R.; Wisniowski, M. [Jagiellonian University of Cracow, Smoluchowski Institute of Physics, Krakow (Poland); Epple, E.; Fabbietti, L.; Lapidus, K.; Siebenson, J. [Excellence Cluster ' ' Origin and Structure of the Universe' ' , Garching (Germany); Finocchiaro, P.; Schmah, A.; Spataro, S. [Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare, Catania (Italy); Froehlich, I.; Lorenz, M.; Markert, J.; Michel, J.; Muentz, C.; Pachmayer, Y.C.; Pechenova, O.; Rehnisch, L.; Rustamov, A.; Scheib, T.; Schuldes, H.; Stroebele, H.; Tarantola, A.; Teilab, K. [Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt (Germany); Galatyuk, T.; Gonzalez-Diaz, D. [Technische Universitaet Darmstadt, Darmstadt (Germany); Golubeva, M.; Guber, F.; Ivashkin, A.; Karavicheva, T.; Kurepin, A.; Reshetin, A.; Sadovsky, A. [Russian Academy of Science, Institute for Nuclear Research, Moscow (Russian Federation); Gumberidze, M. [Technische Universitaet Darmstadt, Darmstadt (Germany); Universite Paris Sud, Institut de Physique Nucleaire (UMR 8608), CNRS/IN2P3, Orsay Cedex (France); Heinz, T.; Holzmann, R.; Koenig, I.; Koenig, W.; Kolb, B.W.; Lang, S.; Pechenov, V.; Pietraszko, J.; Schwab, E.; Sturm, C.; Traxler, M.; Yurevich, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Iori, I. [Istituto Nazionale di Fisica Nucleare, Sezione di Milano, Milano (Italy); Krasa, A.; Krizek, F.; Kugler, A.; Sobolev, Yu.G.; Tlusty, P.; Wagner, V. [Academy of Sciences of Czech Republic, Nuclear Physics Institute, Rez (Czech Republic); Kuc, H. [Jagiellonian University of Cracow, Smoluchowski Institute of Physics, Krakow (Poland); Universite Paris Sud, Institut de Physique Nucleaire (UMR 8608), CNRS/IN2P3, Orsay Cedex (France); Mousa, J.; Tsertos, H. [University of Cyprus, Department of Physics, Nicosia (Cyprus); Stroth, J. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt (Germany); Collaboration: HADES Collaboration

    2013-11-15

    A high-statistic data sample of Ar(1.76 AGeV)+KCl events recorded with HADES is used to search for a hypertriton signal. An upper production limit per centrality-triggered event of 1.04 x 10{sup -3} on the 3 {sigma} level is derived. Comparing this value with the number of successfully reconstructed {Lambda} hyperons allows to determine an upper limit on the ratio N{sub 3{sub {Lambda}H}}/N{sub {Lambda}}, which is confronted with statistical and coalescence-type model calculations. (orig.)

  19. An upper limit on hypertriton production in collisions of Ar(1.76 A GeV) + KCl

    International Nuclear Information System (INIS)

    Agakishiev, G.; Chernenko, S.; Fateev, O.; Zanevsky, Y.; Belver, D.; Cabanelas, P.; Castro, E.; Garzon, J.A.; Blanco, A.; Fonte, P.; Lopes, L.; Mangiarotti, A.; Boehmer, M.; Friese, J.; Gernhaeuser, R.; Jurkovic, M.; Kruecken, R.; Maier, L.; Weber, M.; Boyard, J.L.; Hennino, T.; Liu, T.; Moriniere, E.; Ramstein, B.; Destefanis, M.; Gilardi, C.; Kuehn, W.; Lange, J.S.; Metag, V.; Spruck, B.; Dohrmann, F.; Kaempfer, B.; Kotte, R.; Naumann, L.; Wendisch, C.; Wuestenfeld, J.; Dybczak, A.; Michalska, B.; Palka, M.; Przygoda, W.; Salabura, P.; Trebacz, R.; Wisniowski, M.; Epple, E.; Fabbietti, L.; Lapidus, K.; Siebenson, J.; Finocchiaro, P.; Schmah, A.; Spataro, S.; Froehlich, I.; Lorenz, M.; Markert, J.; Michel, J.; Muentz, C.; Pachmayer, Y.C.; Pechenova, O.; Rehnisch, L.; Rustamov, A.; Scheib, T.; Schuldes, H.; Stroebele, H.; Tarantola, A.; Teilab, K.; Galatyuk, T.; Gonzalez-Diaz, D.; Golubeva, M.; Guber, F.; Ivashkin, A.; Karavicheva, T.; Kurepin, A.; Reshetin, A.; Sadovsky, A.; Gumberidze, M.; Heinz, T.; Holzmann, R.; Koenig, I.; Koenig, W.; Kolb, B.W.; Lang, S.; Pechenov, V.; Pietraszko, J.; Schwab, E.; Sturm, C.; Traxler, M.; Yurevich, S.; Iori, I.; Krasa, A.; Krizek, F.; Kugler, A.; Sobolev, Yu.G.; Tlusty, P.; Wagner, V.; Kuc, H.; Mousa, J.; Tsertos, H.; Stroth, J.

    2013-01-01

    A high-statistic data sample of Ar(1.76 AGeV)+KCl events recorded with HADES is used to search for a hypertriton signal. An upper production limit per centrality-triggered event of 1.04 x 10 -3 on the 3 σ level is derived. Comparing this value with the number of successfully reconstructed Λ hyperons allows to determine an upper limit on the ratio N 3 Λ H /N Λ , which is confronted with statistical and coalescence-type model calculations. (orig.)

  20. Rhenium-188 - advantages and clinical potential for use of a readily available, cost effective therapeutic radioisotope for applications in nuclear medicine, oncology and interventional cardiology

    International Nuclear Information System (INIS)

    Knapp, F.F. jr.

    2002-01-01

    Full text: Carrier-free rhenium-188 (Re-188) is readily available from the alumina-based tungsten-188/rhenium-188 generator system and has many attractive properties for a wide variety of therapeutic applications. The 16.9 h half-life, emission of the 2.2 MeV beta particle and versatile chemistry make Re-188 an important candidate for applications where high radiation penetration is required. In addition, emission of a gamma photon (155 KeV, 15 %) permits evaluation of biodistribution, pharmacokinetics and dosimetry estimates. The long physical half-life of the tungsten-188 (W-188) parent (t 1/2 69 days) and consistent generator performance - with high Re-188 yields and low W-188 parent breakthrough - result in an indefinite shelf-life of several months, dependent on the levels of Re-188 required. Post generator elution in-growth of 62 % of Re-188 after 24 hours in combination with high elution yields (75-85 %) result in 50 % daily yields of the maximal Re-188 available. In addition to research being conducted for the development of a wide variety of new therapeutic radiopharmaceuticals and devices, Re-188 is also being evaluated in physician-sponsored clinical trials in over 15 countries, with applications in nuclear medicine, oncology and interventional cardiology. One major current clinical application involves post-angiographic treatment of arterial segments following PTCA using Re-188 perrhenate or MAG3 liquid-filled balloons as an effective and cost-effective approach for inhibition of the hyperplastic response to vessel damage, which delivers uniform dose to the vessel wall. Re-188-HEDP is being used for palliation of metastatic bone pain palliation. This agent is readily prepared from a simple 'kit' and provides pain palliation as effective as other commercially available agents. The use of the Re-188-labeled Anti-NCA-95 antibody (BW 50/183; CD66 a,b,c,e) in conjunction which external beam irradiation and chemotherapy is an effective method for

  1. PET/CT alignment calibration with a non-radioactive phantom and the intrinsic 176Lu radiation of PET detector

    International Nuclear Information System (INIS)

    Wei, Qingyang; Ma, Tianyu; Wang, Shi; Liu, Yaqiang; Gu, Yu; Dai, Tiantian

    2016-01-01

    Positron emission tomography/computed tomography (PET/CT) is an important tool for clinical studies and pre-clinical researches which provides both functional and anatomical images. To achieve high quality co-registered PET/CT images, alignment calibration of PET and CT scanner is a critical procedure. The existing methods reported use positron source phantoms imaged both by PET and CT scanner and then derive the transformation matrix from the reconstructed images of the two modalities. In this paper, a novel PET/CT alignment calibration method with a non-radioactive phantom and the intrinsic 176 Lu radiation of the PET detector was developed. Firstly, a multi-tungsten-alloy-sphere phantom without positron source was designed and imaged by CT and the PET scanner using intrinsic 176 Lu radiation included in LYSO. Secondly, the centroids of the spheres were derived and matched by an automatic program. Lastly, the rotation matrix and the translation vector were calculated by least-square fitting of the centroid data. The proposed method was employed in an animal PET/CT system (InliView-3000) developed in our lab. Experimental results showed that the proposed method achieves high accuracy and is feasible to replace the conventional positron source based methods.

  2. PET/CT alignment calibration with a non-radioactive phantom and the intrinsic 176Lu radiation of PET detector

    Science.gov (United States)

    Wei, Qingyang; Ma, Tianyu; Wang, Shi; Liu, Yaqiang; Gu, Yu; Dai, Tiantian

    2016-11-01

    Positron emission tomography/computed tomography (PET/CT) is an important tool for clinical studies and pre-clinical researches which provides both functional and anatomical images. To achieve high quality co-registered PET/CT images, alignment calibration of PET and CT scanner is a critical procedure. The existing methods reported use positron source phantoms imaged both by PET and CT scanner and then derive the transformation matrix from the reconstructed images of the two modalities. In this paper, a novel PET/CT alignment calibration method with a non-radioactive phantom and the intrinsic 176Lu radiation of the PET detector was developed. Firstly, a multi-tungsten-alloy-sphere phantom without positron source was designed and imaged by CT and the PET scanner using intrinsic 176Lu radiation included in LYSO. Secondly, the centroids of the spheres were derived and matched by an automatic program. Lastly, the rotation matrix and the translation vector were calculated by least-square fitting of the centroid data. The proposed method was employed in an animal PET/CT system (InliView-3000) developed in our lab. Experimental results showed that the proposed method achieves high accuracy and is feasible to replace the conventional positron source based methods.

  3. Active and passive vectorization of technetium{sup 99m} and {sup 188}rhenium radiopharmaceuticals for medical imaging and radiotherapy; Vectorisations active et passive de radiopharmaceutiques du technetium-99m et du rhenium-188 pour l'imagerie medicale et la therapie

    Energy Technology Data Exchange (ETDEWEB)

    Lepareur, N

    2003-11-15

    Research for new molecules for nuclear medicine is a field in constant development. Over the past few years, development of new radiopharmaceuticals for radiotherapy has renewed interest for rhenium chemistry. Indeed, its two isotopes {sup 186}Re and {sup 188}Re, owing to their ideal properties and their similitude with {sup 99m}Tc, which is widely used as a radiotracer for diagnostic imaging, seem very promising for the preparation of radiopharmaceuticals. In the first part of this manuscript, the synthesis of rhenium and technetium-99 complexes, [M(RPhCS3)2(RPhCS2)] (M = Re, Tc), is described. The preparation of technetium{sup 99m} based radiopharmaceuticals, analogues to the pondered complexes, is also described. The stability/reactivity of these complexes has been studied by exchange reactions with potential ligands, specially dithiocarbamates, and also by UV-visible absorption spectroscopy and thermogravimetry. The reactivity of the complexes towards dithiocarbamates leads to the possibility to bind biomolecules to the metallic core, via the dithiocarbamate moiety. This method represents a potential alternative to current ones using the so-called bifunctional approach. In the second part of this manuscript, a new kit formulation for the {sup 188}Re labeling of lipiodol is described, using a complex analogous to those described in the previous part. The labeled oil is a potential cure for hepatocellular carcinoma. The in vitro and in vivo stability of this {sup 188}Re-SSS lipiodol and of its analogue {sup 99m}Tc-SSS lipiodol has been studied, and also their in vivo behavior in healthy pigs. This study has shown the quasi-exclusive hepatic fixation of the radiopharmaceutical, and has proven its good stability. Its selectivity for tumors remains to be shown before trying it on humans. (author)

  4. Active and passive vectorization of technetium{sup 99m} and {sup 188}rhenium radiopharmaceuticals for medical imaging and radiotherapy; Vectorisations active et passive de radiopharmaceutiques du technetium-99m et du rhenium-188 pour l'imagerie medicale et la therapie

    Energy Technology Data Exchange (ETDEWEB)

    Lepareur, N

    2003-11-15

    Research for new molecules for nuclear medicine is a field in constant development. Over the past few years, development of new radiopharmaceuticals for radiotherapy has renewed interest for rhenium chemistry. Indeed, its two isotopes {sup 186}Re and {sup 188}Re, owing to their ideal properties and their similitude with {sup 99m}Tc, which is widely used as a radiotracer for diagnostic imaging, seem very promising for the preparation of radiopharmaceuticals. In the first part of this manuscript, the synthesis of rhenium and technetium-99 complexes, [M(RPhCS3)2(RPhCS2)] (M = Re, Tc), is described. The preparation of technetium{sup 99m} based radiopharmaceuticals, analogues to the pondered complexes, is also described. The stability/reactivity of these complexes has been studied by exchange reactions with potential ligands, specially dithiocarbamates, and also by UV-visible absorption spectroscopy and thermogravimetry. The reactivity of the complexes towards dithiocarbamates leads to the possibility to bind biomolecules to the metallic core, via the dithiocarbamate moiety. This method represents a potential alternative to current ones using the so-called bifunctional approach. In the second part of this manuscript, a new kit formulation for the {sup 188}Re labeling of lipiodol is described, using a complex analogous to those described in the previous part. The labeled oil is a potential cure for hepatocellular carcinoma. The in vitro and in vivo stability of this {sup 188}Re-SSS lipiodol and of its analogue {sup 99m}Tc-SSS lipiodol has been studied, and also their in vivo behavior in healthy pigs. This study has shown the quasi-exclusive hepatic fixation of the radiopharmaceutical, and has proven its good stability. Its selectivity for tumors remains to be shown before trying it on humans. (author)

  5. Determination of rhenium content in molybdenite by ICP-MS after separation of the major matrix by solvent extraction with N-benzoyl-N-phenylhydroxalamine.

    Science.gov (United States)

    Li, Jie; Zhong, Li-feng; Tu, Xiang-lin; Liang, Xi-rong; Xu, Ji-feng

    2010-05-15

    A simple and rapid analytical method for determining the concentration of rhenium in molybdenite for Re-Os dating was developed. The method used isotope dilution-inductively coupled plasma-mass spectrometry (ID-ICP-MS) after the removal of major matrix elements (e.g., Mo, Fe, and W) from Re by solvent extraction with N-benzoyl-N-phenylhydroxylamine (BPHA) in chloroform solution. The effect on extraction efficiency of parameters such as pH (HCl concentration), BPHA concentration, and extraction time were also assessed. Under the optimal experimental conditions, the validity of the separation method was accessed by measuring (187)Re/(185)Re values for a molybdenite reference material (JDC). The obtained values were in good agreement with previously measured values of the Re standard. The proposed method was applied to replicate Re-Os dating of JDC and seven samples of molybdenite from the Yuanzhuding large Cu-Mo porphyry deposit. The results demonstrate good precision and accuracy for the proposed method. The advantages of the method (i.e., simplicity, efficiency, short analysis time, and low cost) make it suitable for routine analysis.

  6. Transducer Like Proteins of Campylobacter jejuni 81-176: Role in chemotaxis and colonization of the chicken gastrointestinal tract

    Directory of Open Access Journals (Sweden)

    Gireesh eRajashekara

    2015-05-01

    Full Text Available Transducer Like Proteins (Tlps, also known as Methyl accepting chemotaxis proteins (MCP, enable enteric pathogens to respond to changing nutrient levels in the environment by mediating taxis towards or away from specific chemoeffector molecules such as nutrients. Despite recent advances in the characterization of chemotaxis responses in Campylobacter jejuni, the impact of Tlps on the adaptation of this pathogen to disparate niches and hosts is not fully characterized. The latter is particularly evident in the case of C. jejuni 81-176, a strain that is known to be highly invasive. Furthermore, the cytoplasmic group C Tlps (Tlp5, 6, and 8 was not extensively evaluated. Here, we investigated the role of C. jejuni 81-176 Tlps in chemotaxis towards various substrates, biofilm formation, in vitro interaction with human intestinal cells, and chicken colonization. We found that the ∆tlp6 and ∆tlp10 mutants exhibited decreased chemotaxis towards aspartate whereas the ∆tlp6 mutant displayed a decreased chemotaxis towards Tri-Carboxylic Acid (TCA cycle intermediates such as pyruvate, isocitrate, and succinate. Our findings also corroborated that more than one Tlp is involved in mediating chemotaxis towards the same nutrient. The deletion of tlps affected important phenotypes such as motility, biofilm formation, and invasion of human intestinal epithelial cells (INT-407. The ∆tlp8 mutant displayed increased motility in soft agar and showed decreased biofilm formation. The ∆tlp8 and ∆tlp9 mutants were significantly defective in invasion in INT-407 cells. The ∆tlp10 mutant was defective in colonization of the chicken proximal and distal gastrointestinal tract, while the ∆tlp6 and ∆tlp8 mutants showed reduced colonization of the duodenum and jejunum. Our results highlight the importance of Tlps in C. jejuni’s adaptation and pathobiology.

  7. Reconciliation of the excess 176Hf conundrum in meteorites: Recent disturbances of the Lu-Hf and Sm-Nd isotope systematics

    Science.gov (United States)

    Bast, Rebecca; Scherer, Erik E.; Sprung, Peter; Mezger, Klaus; Fischer-Gödde, Mario; Taetz, Stephan; Böhnke, Mischa; Schmid-Beurmann, Hinrich; Münker, Carsten; Kleine, Thorsten; Srinivasan, Gopalan

    2017-09-01

    The long-lived 176Lu-176Hf and 147Sm-143Nd radioisotope systems are commonly used chronometers, but when applied to meteorites, they can reveal disturbances. Specifically, Lu-Hf isochrons commonly yield dates up to ∼300 Myr older than the solar system and varying initial 176Hf/177Hf values. We investigated this problem by attempting to construct mineral and whole rock isochrons for eucrites and angrites. Meteorites from different parent bodies exhibit similar disturbance features suggesting that a common process is responsible. Minerals scatter away from isochron regressions for both meteorite classes, with low-Hf phases such as plagioclase and olivine typically being most displaced above (or left of) reference isochrons. Relatively Hf-rich pyroxene is less disturbed but still to the point of steepening Lu-Hf errorchrons. Using our Lu-Hf and Sm-Nd data, we tested various Hf and Lu redistribution scenarios and found that decoupling of Lu/Hf from 176Hf/177Hf must postdate the accumulation of significant radiogenic 176Hf. Therefore early irradiation or diffusion cannot explain the excess 176Hf. Instead, disturbed meteorite isochrons are more likely caused by terrestrial weathering, contamination, or common laboratory procedures. The partial dissolution of phosphate minerals may predominantly remove rare earth elements including Lu, leaving relatively immobile and radiogenic Hf behind. Robust Lu-Hf (and improved Sm-Nd) meteorite geochronology will require the development of chemical or physical methods for removing unsupported radiogenic Hf and silicate-hosted terrestrial contaminants without disturbing parent-daughter ratios.

  8. Study of technetium behaviour in radiopharmaceuticals. Characterization of sup(99m)Tc-pyrophosphate, sup(99m)Tc-dimercaptosuccinate, sup(99m)Tc-diethylenetriaminepentaacetate complexes and sup(99m)Tc-colloidal rhenium sulphide

    International Nuclear Information System (INIS)

    Saccavini, J.-C.

    1980-12-01

    The chemistry of technetium in extremely dilute solution was approached through the study of three complexing agents and a colloid. By the application of high-performance chromatographic techniques to the analysis of (Tc-pyro), (Tc-DTPA), (Tc-DMSA) complexes it was possible to isolate one or more chelates from a single complexing agent. Addition of pertechnetates to a solution of sodium pyrophosphates and stannous chloride at neutral pH leads to the formation of two complexes, both highly osteotropic. By the use of sup(117m)Sn it was shown that tin employed as reducing agent enters into the composition of one of the two complexes, either of which may be obtained preferentially by varying the (Sn)/(pyro) ratio. With technetium at acid pH (2.5) DMSA gives one or more chelates according to the concentration of the reagents present. DTPA with technetium at neutral pH gives a single complex for which a structure is proposed. The addition of calcium, indispensable for DTPA injection, leads to the appearance of a second bimetallic complex in very much smaller proportions than the first. The size distribution of some colloids was studied by ultrafiltration and permeation on gel. The preparation of colloidal rhenium sulphide and the technetium labelling conditions needed to obtain a very fine colloid were developed. The behaviour of technetium in the presence of colloidal rhenium sulphide and tin pyrophosphate was followed by sup(99m)Tc - sup(186)Re and sup(99m)Tc - sup(117m)Sn double-labelling tests. One reduced technetium fraction associates with the hydrolysed tin, the other follows the rhenium sulphide [fr

  9. A randomised, phase II study of repeated rhenium-188-HEDP combined with docetaxel and prednisone versus docetaxel and prednisone alone in castration-resistant prostate cancer (CRPC) metastatic to bone; the Taxium II trial

    Energy Technology Data Exchange (ETDEWEB)

    Dodewaard-de Jong, Joyce M. van [VU University Medical Centre, Department of Medical Oncology, Amsterdam (Netherlands); Meander Medical Centre, Department of Medical Oncology, Amersfoort (Netherlands); Klerk, John M.H. de [Meander Medical Centre, Department of Nuclear Medicine, Amersfoort (Netherlands); Bloemendal, Haiko J. [Meander Medical Centre, Department of Medical Oncology, Amersfoort (Netherlands); University Medical Centre Utrecht, Department of Medical Oncology, Utrecht (Netherlands); Oprea-Lager, Daniela E.; Hoekstra, Otto S. [VU University Medical Centre, Department of Radiology and Nuclear Medicine, Amsterdam (Netherlands); Berg, H.P. van den [Tergooi Medical Hospital, Department of Medical Oncology, Hilversum (Netherlands); Los, Maartje [St Antonius Hospital Utrecht, Department of Medical Oncology, Utrecht (Netherlands); Beeker, Aart [Spaarne Gasthuis, Department of Medical Oncology, Hoofddorp (Netherlands); Jonker, Marianne A. [VU University Medical Centre, Department of Epidemiology and Biostatistics, Amsterdam (Netherlands); O' Sullivan, Joe M. [Queen' s University Belfast, Centre for Cancer Research and Cell Biology, Belfast, Northern Ireland (United Kingdom); Verheul, Henk M.W.; Eertwegh, Alfons J.M. van den [VU University Medical Centre, Department of Medical Oncology, Amsterdam (Netherlands)

    2017-08-15

    Rhenium-188-HEDP is a beta-emitting radiopharmaceutical used for palliation of metastatic bone pain. We investigated whether the addition of rhenium-188-HEDP to docetaxel/prednisone improved efficacy of chemotherapy in patients with CRPC. Patients with progressive CRPC and osteoblastic bone metastases were randomised for first-line docetaxel 75 mg/m{sup 2} 3-weekly plus prednisone with or without 2 injections of rhenium-188-HEDP after the third (40 MBq/kg) and after the sixth (20 MBq/kg) cycle of docetaxel. Primary endpoint was progression-free survival (PFS), defined as either PSA, radiographic or clinical progression. Patients were stratified by extent of bone metastases and hospital. Forty-two patients were randomised for standard treatment and 46 patients for combination therapy. Median number of cycles of docetaxel was 9 in the control group and 8 in the experimental group. Median follow-up was 18.4 months. Two patients from the experimental group did not start treatment after randomisation. In the intention to treat analysis no differences in PFS, survival and PSA became apparent between the two groups. In an exploratory per-protocol analysis median overall survival was significantly longer in the experimental group (33.8 months (95%CI 31.75-35.85)) than in the control group (21.0 months (95%CI 13.61-28.39); p 0.012). Also median PFS in patients with a baseline phosphatase >220U/L was significantly better with combination treatment (9.0 months (95%CI 3.92-14.08) versus 6.2 months (95%CI 3.08-9.32); log rank p 0.005). As expected, thrombocytopenia (grade I/II) was reported more frequently in the experimental group (25% versus 0%). Combined treatment with rhenium-188-HEDP and docetaxel did not prolong PFS in patients with CRPC. The observed survival benefit in the per-protocol analysis warrants further studies in the combined treatment of chemotherapy and radiopharmaceuticals. (orig.)

  10. Analysis of electron pair production in the collision system Ar+KCl at 1.76 AGeV; Analyse der Elektronpaarproduktion im Stosssystem Ar+KCl bei 1,76 AGeV

    Energy Technology Data Exchange (ETDEWEB)

    Lang, Simon Martin

    2008-06-30

    The HADES-spectrometer at GSI is used to measure the production of the light vector mesons {rho}, {omega} and {phi} at SIS energies. Therefore, the medium sized collision system Ar+KCl was measured at 1.76 AGeV kinetic energy of beam particles. In this system the density of particle tracks is much larger as compared to the formerly used collision system C+C, making it necessary to upgrade the data analysis. The previous method of hard-cuts - used for particle identification - was replaced by a newly developed multi-variate analysis based on an artificial neural network. This algorithm has the benefit, that it is more robust against fluctuations in one or more of the used detector observables. This increases the overall efficiency and purity of the analysis procedure. Furthermore, the reconstruction of particle tracks inside the HADES spectrometer is based on a few position information, only. During analysis of raw data, these information are combined to a artificially large manifold of tracks. This leads to the general problem that one has to select the maximum number of true physical tracks out of this set of tracks per event. A new method of track selection is used to filter the data not only to select single tracks, but also to identify electron pairs created during Dalitz-decay of {pi}{sup 0} mesons, which build the bulk of combinatorial background. The result of the analysis is an efficiency corrected invariant mass spectrum of electron pairs, normalized to the mean number of pions per event. The spectrum consists of more than 16,000 pairs with an invariant mass larger than 150 MeV. In total more than 150000 pairs were found. A first comparison with the spectra calculated by using the old analysis approach shows a 30% enhancement in yield of reconstructed electron pairs. A first comparison with a simple thermal model implemented by the Pluto event generator, opens the possibility to compare the measured pair yield of {omega} and {phi} mesons via m{sub T

  11. Crystal structures of a manganese(I and a rhenium(I complex of a bipyridine ligand with a non-coordinating benzoic acid moiety

    Directory of Open Access Journals (Sweden)

    Sheri Lense

    2018-05-01

    Full Text Available The structures of two facially coordinated Group VII metal complexes are reported, namely: fac-bromido[2-(2,2′-bipyridin-6-ylbenzoic acid-κ2N,N′]tricarbonylmanganese(I tetrahydrofuran monosolvate, [MnBr(C17H12N2O2(CO3]·C4H8O, I, and fac-[2-(2,2′-bipyridin-6-ylbenzoic acid-κ2N,N′]tricarbonylchloridorhenium(I tetrahydrofuran monosolvate, [ReCl(C17H12N2O2(CO3]·C4H8O, II. In both complexes, the metal ion is coordinated by three carbonyl ligands, a halide ion, and a 2-(2,2′-bipyridin-6-ylbenzoic acid ligand, in a distorted octahedral geometry. In manganese complex I, the tetrahydrofuran (THF solvent molecule could not be refined due to disorder. The benzoic acid fragment is also disordered over two positions, such that the carboxylic acid group is either positioned near to the bromide ligand or to the axial carbonyl ligand. In the crystal of I, the complex molecules are linked by a pair of C—H...Br hydrogen bonds, forming inversion dimers that stack up the a-axis direction. In the rhenium complex II, there is hydrogen bonding between the benzoic acid moiety and a disordered co-crystallized THF molecule. In the crystal, the molecules are linked by C—H...Cl hydrogen bonds, forming layers parallel to (100 separated by layers of THF solvent molecules.

  12. The chemistry on a subnanometer scale of radiation-induced precipitation and segregation in fast-neutron irradiated tungsten-rhenium alloys

    International Nuclear Information System (INIS)

    Hershitz, R.; Seidman, D.N.

    1984-01-01

    The phenomena of radiation-induced precipitation and segregation have been investigated in W-10 at.% Re and W-25 at.% Re alloys, employing the atom-probe field-ion-microscope technique. The specimens had been irradiated to a fast-neutron fluence of approx.4x10 22 neutrons cm -2 (e>0.1 MeV) at 575, 625 and 675 deg C. This corresponds to 8.6 dpa and an average displacement rate, for the two year irradiation time of 1.4x10 -7 dpa s -1 . In the W-10 at.% Re alloy, coherent, semicoherent and possibly incoherent precipitates with the composition approx.WRe and a disc-shaped morphology -- one or two atomic planes thick -- were detected at a number density of approx.10 16 cm -3 , and a mean diameter of approx.57 A. In the W-25 at.% Re alloy the same precipitates with the composition approx.WRe 3 were detected at a number density of approx.10 17 cm -3 and a mean diameter of 40 A. The semicoherent WRe 3 precipitates were associated with 4 He atoms; that is, they may have been heterogeneously nucleated. None of the other precipitates were associated with either line or planar defects or with any impurity atoms. Therefore, a true homogeneous radiation-induced precipitation occurs in these alloys. In the W-25 at.% Re alloy a two dimensional WRe 3 phase has been observed at a grain boundary. The nucleation of both precipitates in the vicinity of displacement cascades might be produced by primary knock-on atoms. In both cases, the first step in the nucleation is due to the formation of tightly-bound mobile mixed dumbbells which react to form an immobile di-rhenium cluster. Point-defect mechanisms for all the other observations are also discussed

  13. Rhenium(V) oxo complexes relevant to technetium renal imaging agents derived from mercaptoacetylglycylglycylaminobenzoic acid isomers. Structural and molecular mechanics studies

    International Nuclear Information System (INIS)

    Hansen, L.; Taylor, A. Jr; Marzilli, L.G.; Cini, R.

    1992-01-01

    The synthesis and characterization of three rhenium(V) oxo complexes derived from isomers of mercaptoacetylglycylglycylaminobenzoic acid (MAG 2 -ABAH 5 ) are reported. The isomers were synthesized from o-, m- and p-aminobenzoic acid and differed in the position of the terminal carboxyl group. The anions of 8-10, [ReO(MAG 2 -*ABAH)] - (* = para (8), meta (9), ortho (10)), contained the tetraanionic form of the ligands with the carboxyl group protonated. Compounds 8,9, and 10 were synthesized by exchange reactions of ReOCl 3 (Me 2 SO)(Ph 3 P) under moderate conditions and were isolated as [Ph 4 P] + , [Bu 4 N] + , and [Ph 4 P] + salts, respectively. The structures of 8 and 10 were determined by X-ray diffraction methods; except for the location of the carboxyl group, the structures are similar. The coordination geometry is pseudo square pyramidal, with nitrogen and sulfur donor atoms forming a square base and the oxo ligand at the apex. The orientation of the carboxyl group in 10 is anti to the Re double-bond O group. Since the carboxyl groups are protonated in 8 and 10 and in other relevant structures from this class of radiopharmaceuticals including [Ph 4 As][TcO(MAG 3 H)] (MAG 3 H = tetraanionic form of mercaptoacetyltriglycine), the authors developed molecular mechanics parameters that allowed them to calculate the structures of 8, 10, and [TcO(MAG 3 H)] - . They then extended the calculations to all three isomeric complexes in their deprotonated forms and to [TcO(MAG 3 )] 2- in order to approximate their solution phase structures. They conclude that the [TcO(MAG 3 )] 2- species is conformationally flexible, and they have made an initial assessment of structures vs renal clearance

  14. Magnetic interactions in rhenium-containing rare earth double perovskites Sr{sub 2}LnReO{sub 6} (Ln=rare earths)

    Energy Technology Data Exchange (ETDEWEB)

    Nishiyama, Atsuhide; Doi, Yoshihiro; Hinatsu, Yukio, E-mail: hinatsu@sci.hokudai.ac.jp

    2017-04-15

    The perovskite-type compounds containing both rare earth and rhenium Sr{sub 2}LnReO{sub 6} (Ln=Y, Tb-Lu) have been prepared. Powder X-ray diffraction measurements and Rietveld analysis show that Ln{sup 3+} and Re{sup 5+} ions are structurally ordered at the B site of the perovskite SrBO{sub 3}. Magnetic anomalies are found in their magnetic susceptibility and specific heat measurements at 2.6–20 K for Ln=Y, Tb, Dy, Yb, Lu compounds. They are due to magnetic interactions between Re{sup 5+} ions. The results of the magnetic hysteresis and remnant magnetization measurements for Sr{sub 2}YReO{sub 6} and Sr{sub 2}LuReO{sub 6} indicate that the antiferromagnetic interactions between Re{sup 5+} ions below transition temperatures have a weak ferromagnetic component. The analysis of the magnetic specific heat data for Sr{sub 2}YbReO{sub 6} shows that both the Yb{sup 3+} and Re{sup 5+} ions magnetically order at 20 K. For the case of Sr{sub 2}DyReO{sub 6}, magnetic ordering of the Re{sup 5+} moments occurs at 93 K, and with decreasing temperature, the moments of Dy{sup 3+} ferromagnetically order at 5 K from the measurements of magnetic susceptibility and specific heat. - Graphical abstract: Crystal structure of double perovskite Sr{sub 2}LnReO{sub 6}. Red and black lines show cubic and monoclinic unit cells, respectively. - Highlights: • Double perovskites Sr{sub 2}LnReO{sub 6} (Ln=rare earths) were prepared. • They show an antiferromagnetic transition at 2.6–20 K. • In Sr{sub 2}DyReO{sub 6}, Dy and Re moments magnetically order at 5 and 93 K, respectively.

  15. Analysis of electron pair production in the collision system Ar+KCl at 1.76 AGeV

    International Nuclear Information System (INIS)

    Lang, Simon Martin

    2008-01-01

    The HADES-spectrometer at GSI is used to measure the production of the light vector mesons ρ, ω and φ at SIS energies. Therefore, the medium sized collision system Ar+KCl was measured at 1.76 AGeV kinetic energy of beam particles. In this system the density of particle tracks is much larger as compared to the formerly used collision system C+C, making it necessary to upgrade the data analysis. The previous method of hard-cuts - used for particle identification - was replaced by a newly developed multi-variate analysis based on an artificial neural network. This algorithm has the benefit, that it is more robust against fluctuations in one or more of the used detector observables. This increases the overall efficiency and purity of the analysis procedure. Furthermore, the reconstruction of particle tracks inside the HADES spectrometer is based on a few position information, only. During analysis of raw data, these information are combined to a artificially large manifold of tracks. This leads to the general problem that one has to select the maximum number of true physical tracks out of this set of tracks per event. A new method of track selection is used to filter the data not only to select single tracks, but also to identify electron pairs created during Dalitz-decay of π 0 mesons, which build the bulk of combinatorial background. The result of the analysis is an efficiency corrected invariant mass spectrum of electron pairs, normalized to the mean number of pions per event. The spectrum consists of more than 16,000 pairs with an invariant mass larger than 150 MeV. In total more than 150000 pairs were found. A first comparison with the spectra calculated by using the old analysis approach shows a 30% enhancement in yield of reconstructed electron pairs. A first comparison with a simple thermal model implemented by the Pluto event generator, opens the possibility to compare the measured pair yield of ω and φ mesons via m T -scaling with the yield of η mesons

  16. Synthesis and investigation of CrB{sub 4}, MnB{sub 4} and new ternary chromium and rhenium manganese borides; Synthese und Untersuchung von CrB{sub 4}, MnB{sub 4} sowie neuen ternaeren Chrom- und Rheniummanganboriden

    Energy Technology Data Exchange (ETDEWEB)

    Knappschneider, Arno

    2014-10-13

    In the present work single crystals of the tetraborides of chromium and manganese have been grown and allowed a structure refinement of the compounds. Furthermore the physical characteristics for example hardness, electronic properties and magnetism were been determined. Also the ternary tetraboride phase of chromium and manganese was synthesized and a new ternary rhenium manganese diboride could be obtained.

  17. Corn Stover and Wheat Straw Combustion in a 176-kW Boiler Adapted for Round Bales

    Directory of Open Access Journals (Sweden)

    Joey Villeneuve

    2013-11-01

    Full Text Available Combustion trials were conducted with corn stover (CS and wheat straw (WS round bales in a 176-kW boiler (model Farm 2000. Hot water (80 °C stored in a 30,000-L water tank was transferred to a turkey barn through a plate exchanger. Gross calorific value measured in the laboratory was 17.0 and 18.9 MJ/kg DM (dry matter for CS and WS, respectively. Twelve bales of CS (1974 kg DM total, moisture content of 13.6% were burned over a 52-h period and produced 9.2% ash. Average emissions of CO, NOx and SO2 were 2725, 9.8 and 2.1 mg/m3, respectively. Thermal efficiency was 40.8%. For WS, six bales (940 kg DM total, MC of 15% were burned over a 28-h period and produced 2.6% ash. Average emissions of CO, NOx and SO2 were 2210, 40.4 and 3.7 mg/m3, respectively. Thermal efficiency was 68.0%. A validation combustion trial performed a year later with 90 CS bales confirmed good heating performance and the potential to lower ash content (6.2% average.

  18. Biofilm spatial organization by the emerging pathogen Campylobacter jejuni: comparison between NCTC 11168 and 81-176 strains under microaerobic and oxygen-enriched conditions.

    Science.gov (United States)

    Turonova, Hana; Briandet, Romain; Rodrigues, Ramila; Hernould, Mathieu; Hayek, Nabil; Stintzi, Alain; Pazlarova, Jarmila; Tresse, Odile

    2015-01-01

    During the last years, Campylobacter has emerged as the leading cause of bacterial foodborne infections in developed countries. Described as an obligate microaerophile, Campylobacter has puzzled scientists by surviving a wide range of environmental oxidative stresses on foods farm to retail, and thereafter intestinal transit and oxidative damage from macrophages to cause human infection. In this study, confocal laser scanning microscopy (CLSM) was used to explore the biofilm development of two well-described Campylobacter jejuni strains (NCTC 11168 and 81-176) prior to or during cultivation under oxygen-enriched conditions. Quantitative and qualitative appraisal indicated that C. jejuni formed finger-like biofilm structures with an open ultrastructure for 81-176 and a multilayer-like structure for NCTC 11168 under microaerobic conditions (MAC). The presence of motile cells within the biofilm confirmed the maturation of the C. jejuni 81-176 biofilm. Acclimation of cells to oxygen-enriched conditions led to significant enhancement of biofilm formation during the early stages of the process. Exposure to these conditions during biofilm cultivation induced an even greater biofilm development for both strains, indicating that oxygen demand for biofilm formation is higher than for planktonic growth counterparts. Overexpression of cosR in the poorer biofilm-forming strain, NCTC 11168, enhanced biofilm development dramatically by promoting an open ultrastructure similar to that observed for 81-176. Consequently, the regulator CosR is likely to be a key protein in the maturation of C. jejuni biofilm, although it is not linked to oxygen stimulation. These unexpected data advocate challenging studies by reconsidering the paradigm of fastidious requirements for C. jejuni growth when various subpopulations (from quiescent to motile cells) coexist in biofilms. These findings constitute a clear example of a survival strategy used by this emerging human pathogen.

  19. Biofilm spatial organization by the emerging pathogen Campylobacter jejuni: comparison between NCTC 11168 and 81-176 strains under microaerobic and oxygen-enriched conditions

    Directory of Open Access Journals (Sweden)

    Hana eTuronova

    2015-07-01

    Full Text Available During the last years, Campylobacter has emerged as the leading cause of bacterial foodborne infections in developed countries. Described as an obligate microaerophile, Campylobacter has puzzled scientists by surviving a wide range of environmental oxidative stresses on foods farm to retail, and thereafter intestinal transit and oxidative damage from macrophages to cause human infection. In this study, confocal laser scanning microscopy was used to explore the biofilm development of two well-described Campylobacter jejuni strains (NCTC 11168 and 81-176 prior to or during cultivation under oxygen-enriched conditions. Quantitative and qualitative appraisal indicated that C. jejuni formed finger-like biofilm structures with an open ultrastructure for 81-176 and a multilayer-like structure for NCTC 11168 under microaerobic conditions. The presence of motile cells within the biofilm confirmed the maturation of the C. jejuni 81-176 biofilm. Acclimation of cells to oxygen-enriched conditions led to significant enhancement of biofilm formation during the early stages of the process. Exposure to these conditions during biofilm cultivation induced an even greater biofilm development for both strains, indicating that oxygen demand for biofilm formation is higher than for planktonic growth counterparts. Overexpression of cosR in the poorer biofilm-forming strain, NCTC 11168, enhanced biofilm development dramatically by promoting an open ultrastructure similar to that observed for 81-176. Consequently, the regulator CosR is likely to be a key protein in the maturation of C. jejuni biofilm, although it is not linked to oxygen stimulation. These unexpected data advocate challenging studies by reconsidering the paradigm of fastidious requirements for C. jejuni growth when various subpopulations (from quiescent to motile cells coexist in biofilms. These findings constitute a clear example of a survival strategy used by this emerging human pathogen.

  20. Synthesis and characterization of organohydrazino complexes of technetium, rhenium, and molybdenum with the [M(η1-HxNNR)(η2-HyNNR)] core and their relationship to radiolabeled organohydrazine-derivatives chemotactic peptides with diagnostic applications

    International Nuclear Information System (INIS)

    Rose, D.J.; Maresca, K.P.; Nicholson, T.

    1998-01-01

    In this paper, the authors present the details of the preparation of the imaging agent and its imaging properties. In order to define some structural possibilities for the coordination chemistry relevant to these reagents, they also present the results of investigations of the syntheses and structures of Tc, Mo, and Re complexes with hydrazinopyridine, which not only establish the formation of the robust unit, but also implicate chelate formation through the pyridine nitrogen as a significant structural determinant. The structures of the parent (bis)hydrazino-trichlorometalate core compounds are presented, allowing analysis of structural changes that occur when (2) protonation sites on the ligand change, (2) a different metal is employed, and (3) a different chelating hydrazine is utilized. The structures of the thiolate substitution products of these parent compounds are also presented. These derivatives demonstrate that rhenium and technetium have analogous substitution chemistry

  1. Electronic structures and properties of the rhenium alkoxy derivatives Re2O3(OMe)6, Re4O6(OMe)12, and ReMoO2(OMe)7

    International Nuclear Information System (INIS)

    Ermakov, A.I.; Belousov, V.V.; Drobot, D.V.; Shcheglov, P.A.

    2006-01-01

    The geometrical structures, charge distributions, dipole moments, frequencies of normal vibrations, NMR spectra, and total energies of the chemical bonds for the rhenium alkoxy derivatives Re 2 O 3 (OMe) 6 , Re 4 O 6 (OMe) 12 , and ReMoO 2 (OMe) 7 were calculated by the DFT-B3LYP and Hartree-Fock ab initio methods based on the effective core potential theory (LANL2DZ approximation) and the semiempirical PM3(tm) method. Two optimized structures of Re 2 O 3 (OMe) 6 with close energies were found to substantially differ in geometry, 1 H, 13 C, and 17 O NMR spectra, and dipole moment. Various characteristics of the electronic structures and the trans-effect of the ligands in the compounds under consideration were discussed [ru

  2. Pyrazole complexes of rhenium. Synthesis and crystal structure of trans-[Re(O)(OMe)L4]Br2 · L · 4H2O (L - 3,5-dimethylpyrazole)

    International Nuclear Information System (INIS)

    Sokolov, M.N.; Fedorova, N.Eh.; Fedorov, V.E.; Virovets, A.V.; Nun'es, P.

    2002-01-01

    The first rhenium (V) mononuclear complex featuring composition [Re(O)(OMe)L 4 ]Br 2 (L = 3,5-dimethylpyrazole), which is resistant to hydrolysis in neutral aqueous solution, along with its molecular adduct of the composition [Re(O)(OMe)L 4 ]Br 2 · L · 4H 2 O were synthesized. The reaction products were characterized by the methods of elementary analysis, absorption spectroscopy in visible, UV and IR ranges, mass spectrometry. Besides, the adduct structure was studied by the method of X-ray diffraction analysis. It was ascertained that the adduct is crystallized in tetragonal crystal system with unit cell parameters as follows: a = 14.912 (3), c = 17.108 (4) A, sp. gr. I4/m, Z = 4. In the complex molecule linear grouping Re(O)(OMe)] 2+ (Re-O-C angle being equal to 180 deg) is coordinated by four L ligand molecules [ru

  3. Design criteria for rhenium-reduced nickel-based single-crystal alloys. Identification and computer-assisted conversion; Designkriterien fuer rheniumreduzierte Nickelbasis-Einkristalllegierungen. Identifikation und rechnergestuetzte Umsetzung

    Energy Technology Data Exchange (ETDEWEB)

    Goehler, Thomas

    2016-06-17

    In the present work, design criteria and property models for the creep strength optimization of rhenium-free nickel based single crystal Superalloys are investigated. The study focuses on a typical load condition of 1050 C and 150 MPa, which is representative for flight engine applications. Thereby the key aspect is to link chemical composition, manufacturing processes, microstructure formation and mechanistic understanding of dislocation creep through a computational materials engineering approach. Beside the positive effect of rhenium on solid solution hardening, a second mechanism in which rhenium increases high temperature creep strength is identified. It indirectly stabilizes precipitation hardening by reducing the coarsening kinetics of γ'-rafting. Five 1st and 2nd generation technical Superalloys show a comparable microstructure evolution for up to 2 % plastic elongation, while creep times differ by a factor of five. The application of a microstructure sensitive creep model shows that these coarsening processes can activate γ-cutting and thus lead to an increasing creep rate. Based on these calculations a threshold value of φ{sub γ/γ'} > 2,5 at 150 MPa is estimated. This ratio of matrix channel to raft thickness has been proofed for multiple positions by microstructure analysis of interrupted creep tests. The mechanism described previously can be decelerated by the enrichment of the γ-matrix with slow diffusing elements. The same principle also increases the solid solution strength of the γ-matrix. Therefore, the present work delivers an additional mechanistic explanation why creep properties of single phase nickel based alloys can be transferred to two phase technical Superalloys with rafted γ'-structure. Following, the best way to substitute both rhenium fundamental properties, namely a slow diffusion coefficient and a small solubility in g', has been investigated by means of CALPHAD-modeling. Only molybdenum and especially

  4. Spectroscopy of virtual photons in Ar+KCl collisions at E{sub kin}=1.76 AGeV; Spektroskopie virtueller Photonen in Ar+KCl Stoessen bei E{sub kin}=1,76 AGeV

    Energy Technology Data Exchange (ETDEWEB)

    Jurkovic, Martin

    2010-01-14

    The objective of this thesis is the analysis of virtual photon emission originating from the decays of the short lived hadrons produced in Ar+KCl collisions at E{sub kin}=1.76 AGeV. The measured observables were the reconstructed e{sup +}e{sup -} pairs and their kinematic distributions. The data were recorded with the HADES spectrometer assembled at GSI Helmholtzzentrum fuer Schwerionenforschung GmbH in Darmstadt, Germany. Due to the considerably higher combinatorial background originating from the {gamma}-conversion as compared to that from light collision systems (p+p,C+C) investigated so far with HADES, a new method for identification and suppression of conversion electrons using the signal pattern in the RICH-detector was studied. An improvement of signal to background ratio (S/B) reaching 30% was achieved. For the procedure of calculating the e{sup +}/e{sup -} track efficiencies a detailed study of RICH detector signals was performed, leading to an overall improved description of ring observables in the simulation. In total, 32545pm 385 e{sup +}e{sup -} signal pairs with an opening angle {alpha}{sub ee} > 15 and 0.1 < p{sub e} < 1.1 GeV/c were identified, with 7402{+-}222 pairs in the so-called {eta} mass region (0.15 < M{sub ee} < 0.55 GeV/c{sup 2}) and 253{+-}25 for masses M{sub ee} > 0.55 GeV/c{sup 2}. A clear signal from direct {omega} decay with S/B {proportional_to}1 was identified for the first time in the SIS18 energy regime. The extraction of the {omega} yield per produced {pi}{sup 0} results in N({omega})/N({pi}{sup 0}) {approx} (4,5 {+-} 2,5(stat) {+-} 2(sys)) .10{sup -8}. The e{sup +}e{sup -} production in the {eta} mass region was compared to the expected {eta} Dalitz decay {eta}{yields}{gamma}e{sup +}e{sup -} contribution. The measured e{sup +}e{sup -} yield is higher by a factor F = 3.4{+-}0.2(stat){+-}0.6(sys){+-}0.9({eta}) as compared to the {eta} production. The excitation function of the extra e{sup +}/e{sup -} sources shows similar energy

  5. Numerical simulation on vacuum solution heat treatment and gas quenching process of a low rhenium-containing Ni-based single crystal turbine blade

    Directory of Open Access Journals (Sweden)

    Zhe-xin Xu

    2016-11-01

    Full Text Available Numerical heat-transfer and turbulent flow model for an industrial high-pressure gas quenching vacuum furnace was established to simulate the heating, holding and gas fan quenching of a low rhenium-bearing Ni-based single crystal turbine blade. The mesh of simplified furnace model was built using finite volume method and the boundary conditions were set up according to the practical process. Simulation results show that the turbine blade geometry and the mutual shielding among blades have significant influence on the uniformity of the temperature distribution. The temperature distribution at sharp corner, thin wall and corner part is higher than that at thick wall part of blade during heating, and the isotherms show a toroidal line to the center of thick wall. The temperature of sheltered units is lower than that of the remaining part of blade. When there is no shelteration among multiple blades, the temperature distribution for all blades is almost identical. The fluid velocity field, temperature field and cooling curves of the single and multiple turbine blades during gas fan quenching were also simulated. Modeling results indicate that the loading tray, free outlet and the location of turbine blades have important influences on the flow field. The high-speed gas flows out from the nozzle is divided by loading tray, and the free outlet enhanced the two vortex flow at the end of the furnace door. The closer the blade is to the exhaust outlet and the nozzle, the greater the flow velocity is and the more adequate the flow is. The blade geometry has an effect on the cooling for single blade and multiple blades during gas fan quenching, and the effects in double layers differs from that in single layer. For single blade, the cooing rate at thin-walled part is lower than that at thick-walled part, the cooling rate at sharp corner is greater than that at tenon and blade platform, and the temperature at regions close to the internal position is

  6. Spectroscopy of virtual photons in Ar+KCl collisions at Ekin=1.76 AGeV

    International Nuclear Information System (INIS)

    Jurkovic, Martin

    2010-01-01

    The objective of this thesis is the analysis of virtual photon emission originating from the decays of the short lived hadrons produced in Ar+KCl collisions at E kin =1.76 AGeV. The measured observables were the reconstructed e + e - pairs and their kinematic distributions. The data were recorded with the HADES spectrometer assembled at GSI Helmholtzzentrum fuer Schwerionenforschung GmbH in Darmstadt, Germany. Due to the considerably higher combinatorial background originating from the γ-conversion as compared to that from light collision systems (p+p,C+C) investigated so far with HADES, a new method for identification and suppression of conversion electrons using the signal pattern in the RICH-detector was studied. An improvement of signal to background ratio (S/B) reaching 30% was achieved. For the procedure of calculating the e + /e - track efficiencies a detailed study of RICH detector signals was performed, leading to an overall improved description of ring observables in the simulation. In total, 32545pm 385 e + e - signal pairs with an opening angle α ee > 15 and 0.1 e ee 2 ) and 253±25 for masses M ee > 0.55 GeV/c 2 . A clear signal from direct ω decay with S/B ∝1 was identified for the first time in the SIS18 energy regime. The extraction of the ω yield per produced π 0 results in N(ω)/N(π 0 ) ∼ (4,5 ± 2,5(stat) ± 2(sys)) .10 -8 . The e + e - production in the η mass region was compared to the expected η Dalitz decay η→γe + e - contribution. The measured e + e - yield is higher by a factor F = 3.4±0.2(stat)±0.6(sys)±0.9(η) as compared to the η production. The excitation function of the extra e + /e - sources shows similar energy dependence as the π 0 production. Possible candidates for these extra e + e - sources are the Δ Dalitz decays, the NN and πN bremsstrahlung and partly the direct decay of the ρ meson. Relative to the π 0 production in both Ar+KCl and C+C collisions, the e + e - production of unknown composition in Ar

  7. Study of the production of {sup 177}Lu through {sup 176}Yb (n, {gamma}) {sup 177}Yb {yields} {sup 177}Lu nuclear reaction

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Giovana Pasqualini da; Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)]. E-mail: gpsilva@ipen.br; jaosso@ipen.br

    2007-07-01

    The beta minus emitter {sup 177}Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of T{sub 1/2} = 6.71 day and maximum and average {beta}{sup -} energies of 421 and 133 keV, resulting in a short range of radiation in tissue. The decay is accompanied by the emission of low energy {gamma}-radiation with 208.3 keV (11%) and 113 keV (6.4%) suitable for simultaneous imaging, {sup 177}Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, as also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of {sup 177}Lu from Yb isotopes. The objective of this work is to study the production of {sup 177}Lu through the indirect {sup 176}Yb(n,{gamma}){sup 177}Yb {yields} {sup 177}Lu nuclear reaction. The results of the production yield of {sup 177}Lu will be shown and compared with the direct reaction. The method of choice for the chemical separation between Lu and Yb was the ion exchange, using an cation exchange resin in Cl{sup -} form and {alpha}-HIBA as eluent. Preliminary results showed a good separation of {sup 177}Lu from Yb{sub 2}O{sub 3} indirect targets. (author)

  8. Beta decay and rhenium cosmochronology

    International Nuclear Information System (INIS)

    Ashktorab, K.

    1992-01-01

    Among the problems which limit the use of the 187 Re/ 187 Os isobaric pair as a cosmochronometer for the age of the galaxy and the universe are the uncertainties in the partial half-lives of the continuum and bound state decays of 187 Re. While the total half-life of the decay is well established, the partial half-life for the continuum decay is uncertain, and several measurements are not compatible. A high temperature quartz proportional counter was used in this work to remeasure the continuum β - decay of 187 Re. The β endpoint energy for the decay of neutral 187 Re to singly ionized 187 Os of 2.75 ± 0.06 keV agrees with the earlier results. The corresponding half-life of (45 ± 3) x 10 9 years improves and agrees with the earlier measurement of Payne and Drever and refutes other measurements. Based on the new half-life for the continuum decay and a total half-life of (43.5 ± 1.3) x 10 9 years reported by Linder et al., the branching ratio for the bound state decay into discrete atomic states is estimated to be (3 ± 6)% in agreement with the most recent calculated theoretical branching ratio of approximately 1%. Anomalies in beta spectra reported by J.J. Simpson and others have been attributed to a 17 keV heavy-neutrino admixture. If confirmed, the implications from the existence of such a neutrino for particle and astrophysics would be significant. A multiwire open-quotes wall-lessclose quotes stainless steel proportional counter has been used in the present work to investigate the spectral shape of the β decay of 63 Ni. No anomalies in the spectral shape were observed which could be attributed to the presence of 17 keV heavy neutrino

  9. Virtual Compton scattering and the generalized polarizabilities of the proton at Q²=0.92 and 1.76 GeV²

    OpenAIRE

    Fonvieille, H; Laveissiere, G; Degrande, N; Jaminion, S; Jutier, C; Todor, L; Di Salvo, R; Van Hoorebeke, Luc; Alexa, LC; Anderson, BD; Aniol, KA; Arundell, K; Audit, G; Auerbach, L; Baker, FT

    2012-01-01

    Virtual Compton scattering (VCS) on the proton has been studied at the Jefferson Laboratory using the exclusive photon electroproduction reaction ep -> ep gamma. This paper gives a detailed account of the analysis which has led to the determination of the structure functions P-LL - P-TT/epsilon and P-LT and the electric and magnetic generalized polarizabilities (GPs) alpha(E) (Q(2)) and beta(M) (Q(2)) at values of the four-momentum transfer squared Q(2) = 0.92 and 1.76 GeV2. These data, toget...

  10. BATING A REFERENCE INSTALLATION BASED ON CONTROLLED-POTENTIAL COULOMETRY METOD IN THE FRAME OF IMPROVING THE STATE PRIMARY STANDARD GET 176 AND ITS MEASUREMENT CAPABILITIES

    Directory of Open Access Journals (Sweden)

    V. M. Zyskin

    2016-01-01

    Full Text Available The results of developing of reference installation, based on a controlled-potential coulometry, in the frame of improving the State primary standard of the units of mass (molar fraction and mass (molar concentration of a component in the liquid and solid substances and materials GET 176 are presented. The physical principles of controlled-potential coulometry, content and metrological characteristics of the developed installation are considered. Measurement results of copper, iron and lead contents in the certified reference materials of metals' solutions and CRM of brass produced by BAM, Germany, obtained using reference installation are given.

  11. Particle-number conserving analysis for the 2-quasiparticle and high-K multi-quasiparticle states in doubly-odd 174,176Lu

    International Nuclear Information System (INIS)

    Li Bingheng; Lei Yi'an; Zhang Zhenhua

    2013-01-01

    Two-quasiparticle bands and low-lying excited high-K four-, six-, and eight-quasiparticle bands in the doubly-odd 174,176 Lu are analyzed by using the cranked shell model (CSM) with the pairing correlations treated by a particle-number conserving (PNC) method, in which the blocking effects are taken into account exactly. The proton and neutron Nilsson level schemes for 174,176 Lu are taken from the adjacent odd-A Lu and Hf isotopes, which are adopted to reproduce the experimental bandhead energies of the one-quasiproton and one-quasineutron bands of these odd-A Lu and Hf nuclei, respectively. Once the quasiparticle configurations are determined, the experimental bandhead energies and the moments of inertia of these two- and multi-quasiparticle bands are well reproduced by PNC-CSM calculations. The Coriolis mixing of the low-K (K=|Ω 1 -Ω 2 |) two-quasiparticle band of the Gallagher-Moszkowski doublet with one nucleon in the Ω=1/2 orbital is analyzed. (authors)

  12. PET/CT alignment calibration with a non-radioactive phantom and the intrinsic {sup 176}Lu radiation of PET detector

    Energy Technology Data Exchange (ETDEWEB)

    Wei, Qingyang [School of Automation and Electrical Engineering, University of Science & Technology Beijing, Beijing 100083 (China); Ma, Tianyu; Wang, Shi; Liu, Yaqiang [Department of Engineering Physics, Tsinghua University, Beijing 100084 (China); Gu, Yu, E-mail: guyu@ustb.edu.cn [School of Automation and Electrical Engineering, University of Science & Technology Beijing, Beijing 100083 (China); Dai, Tiantian, E-mail: maxinedtt@163.com [Department of Radiation Oncology, China-Japan Friendship Hospital, Beijing 100029 (China)

    2016-11-01

    Positron emission tomography/computed tomography (PET/CT) is an important tool for clinical studies and pre-clinical researches which provides both functional and anatomical images. To achieve high quality co-registered PET/CT images, alignment calibration of PET and CT scanner is a critical procedure. The existing methods reported use positron source phantoms imaged both by PET and CT scanner and then derive the transformation matrix from the reconstructed images of the two modalities. In this paper, a novel PET/CT alignment calibration method with a non-radioactive phantom and the intrinsic {sup 176}Lu radiation of the PET detector was developed. Firstly, a multi-tungsten-alloy-sphere phantom without positron source was designed and imaged by CT and the PET scanner using intrinsic {sup 176}Lu radiation included in LYSO. Secondly, the centroids of the spheres were derived and matched by an automatic program. Lastly, the rotation matrix and the translation vector were calculated by least-square fitting of the centroid data. The proposed method was employed in an animal PET/CT system (InliView-3000) developed in our lab. Experimental results showed that the proposed method achieves high accuracy and is feasible to replace the conventional positron source based methods.

  13. Surface structure determination of group 11 metals adsorbed on a rhenium(10 anti 10) surface by low-energy electron diffraction

    Energy Technology Data Exchange (ETDEWEB)

    Messahel, Lyria

    2012-11-12

    This thesis deals with the computational surface determination of various long-range ordered phases formed by thin films of copper, silver, and gold adsorbed on the rhenium- (10 anti 10) surface. It is based upon LEED-I,V curves for these phases that were recorded in the course of detailed experimental investigations of the respective films carried out in our group (using techniques such as LEED, MEED, and TPD). In order to solve the intricate puzzle of surface structural analysis, the electron elastic scattering behaviour of the investigated coinage metal phases was calculated using the Erlangen TensErLEED program package. Thereby first a set of theoretical LEED-I,V curves is derived for a guessed reference structure. Subsequently its structural input parameters are varied in a trial-and-error procedure until optimal agreement between experiment and theory is attained. The (1 x 1) phases formed by the deposited metals were tackled first to establish an absolute coverage calibration and to elucidate the respective growth modes on the Re(10 anti 10) surface. In all three cases the (1 x 1) structure is developed best at a coverage {Theta}{sub Cu,Ag,Au}=2 ML=1 BL. Extension of the investigation to experimental I,V curves for higher Cu coverages revealed that this element continues to grow bilayerwise, thereby retaining the Re hcp morphology. Ag, in contrast to Cu and Au, happens not to grow as homogeneously, and the TPD data suggest that Ag films exhibit the so-called simultaneous-multilayer (SM) growth mode. The following analysis of the sub-bilayer coverage range shows that the three systems exhibit considerable differences. While Cu, having a negative lattice misfit compared to Re, shows no long-range ordered superstructures, Ag and Au with a similar positive misfit form a couple of such phases. Ag features both a (1 x 4) phase, stable at ambient temperatures, that upon heating transforms into a c(2 x 2) phase that only exists at elevated temperatures. The

  14. Surface structure determination of group 11 metals adsorbed on a rhenium(10 anti 10) surface by low-energy electron diffraction

    International Nuclear Information System (INIS)

    Messahel, Lyria

    2012-01-01

    This thesis deals with the computational surface determination of various long-range ordered phases formed by thin films of copper, silver, and gold adsorbed on the rhenium- (10 anti 10) surface. It is based upon LEED-I,V curves for these phases that were recorded in the course of detailed experimental investigations of the respective films carried out in our group (using techniques such as LEED, MEED, and TPD). In order to solve the intricate puzzle of surface structural analysis, the electron elastic scattering behaviour of the investigated coinage metal phases was calculated using the Erlangen TensErLEED program package. Thereby first a set of theoretical LEED-I,V curves is derived for a guessed reference structure. Subsequently its structural input parameters are varied in a trial-and-error procedure until optimal agreement between experiment and theory is attained. The (1 x 1) phases formed by the deposited metals were tackled first to establish an absolute coverage calibration and to elucidate the respective growth modes on the Re(10 anti 10) surface. In all three cases the (1 x 1) structure is developed best at a coverage Θ Cu,Ag,Au =2 ML=1 BL. Extension of the investigation to experimental I,V curves for higher Cu coverages revealed that this element continues to grow bilayerwise, thereby retaining the Re hcp morphology. Ag, in contrast to Cu and Au, happens not to grow as homogeneously, and the TPD data suggest that Ag films exhibit the so-called simultaneous-multilayer (SM) growth mode. The following analysis of the sub-bilayer coverage range shows that the three systems exhibit considerable differences. While Cu, having a negative lattice misfit compared to Re, shows no long-range ordered superstructures, Ag and Au with a similar positive misfit form a couple of such phases. Ag features both a (1 x 4) phase, stable at ambient temperatures, that upon heating transforms into a c(2 x 2) phase that only exists at elevated temperatures. The structure

  15. Measurement of the generalized polarizabilities of the proton in virtual Compton scattering at Q2=0.92 and 1.76 GeV2.

    Science.gov (United States)

    Laveissière, G; Todor, L; Degrande, N; Jaminion, S; Jutier, C; Di Salvo, R; Van Hoorebeke, L; Alexa, L C; Anderson, B D; Aniol, K A; Arundell, K; Audit, G; Auerbach, L; Baker, F T; Baylac, M; Berthot, J; Bertin, P Y; Bertozzi, W; Bimbot, L; Boeglin, W U; Brash, E J; Breton, V; Breuer, H; Burtin, E; Calarco, J R; Cardman, L S; Cavata, C; Chang, C-C; Chen, J-P; Chudakov, E; Cisbani, E; Dale, D S; de Jager, C W; De Leo, R; Deur, A; d'Hose, N; Dodge, G E; Domingo, J J; Elouadrhiri, L; Epstein, M B; Ewell, L A; Finn, J M; Fissum, K G; Fonvieille, H; Fournier, G; Frois, B; Frullani, S; Furget, C; Gao, H; Gao, J; Garibaldi, F; Gasparian, A; Gilad, S; Gilman, R; Glamazdin, A; Glashausser, C; Gomez, J; Gorbenko, V; Grenier, P; Guichon, P A M; Hansen, J O; Holmes, R; Holtrop, M; Howell, C; Huber, G M; Hyde-Wright, C E; Incerti, S; Iodice, M; Jardillier, J; Jones, M K; Kahl, W; Kato, S; Katramatou, A T; Kelly, J J; Kerhoas, S; Ketikyan, A; Khayat, M; Kino, K; Kox, S; Kramer, L H; Kumar, K S; Kumbartzki, G; Kuss, M; Leone, A; LeRose, J J; Liang, M; Lindgren, R A; Liyanage, N; Lolos, G J; Lourie, R W; Madey, R; Maeda, K; Malov, S; Manley, D M; Marchand, C; Marchand, D; Margaziotis, D J; Markowitz, P; Marroncle, J; Martino, J; McCormick, K; McIntyre, J; Mehrabyan, S; Merchez, F; Meziani, Z E; Michaels, R; Miller, G W; Mougey, J Y; Nanda, S K; Neyret, D; Offermann, E A J M; Papandreou, Z; Pasquini, B; Perdrisat, C F; Perrino, R; Petratos, G G; Platchkov, S; Pomatsalyuk, R; Prout, D L; Punjabi, V A; Pussieux, T; Quémenér, G; Ransome, R D; Ravel, O; Real, J S; Renard, F; Roblin, Y; Rowntree, D; Rutledge, G; Rutt, P M; Saha, A; Saito, T; Sarty, A J; Serdarevic, A; Smith, T; Smirnov, G; Soldi, K; Sorokin, P; Souder, P A; Suleiman, R; Templon, J A; Terasawa, T; Tieulent, R; Tomasi-Gustaffson, E; Tsubota, H; Ueno, H; Ulmer, P E; Urciuoli, G M; Vanderhaeghen, M; Van De Vyver, R; Van der Meer, R L J; Vernin, P; Vlahovic, B; Voskanyan, H; Voutier, E; Watson, J W; Weinstein, L B; Wijesooriya, K; Wilson, R; Wojtsekhowski, B B; Zainea, D G; Zhang, W-M; Zhao, J; Zhou, Z-L

    2004-09-17

    We report a virtual Compton scattering study of the proton at low c.m. energies. We have determined the structure functions P(LL)-P(TT)/epsilon and P(LT), and the electric and magnetic generalized polarizabilities (GPs) alpha(E)(Q2) and beta(M)(Q2) at momentum transfer Q(2)=0.92 and 1.76 GeV2. The electric GP shows a strong falloff with Q2, and its global behavior does not follow a simple dipole form. The magnetic GP shows a rise and then a falloff; this can be interpreted as the dominance of a long-distance diamagnetic pion cloud at low Q2, compensated at higher Q2 by a paramagnetic contribution from piN intermediate states.

  16. Hospital-based Clostridium difficile infection surveillance reveals high proportions of PCR ribotypes 027 and 176 in different areas of Poland, 2011 to 2013.

    Science.gov (United States)

    Pituch, Hanna; Obuch-Woszczatyński, Piotr; Lachowicz, Dominika; Wultańska, Dorota; Karpiński, Paweł; Młynarczyk, Grażyna; van Dorp, Sofie M; Kuijper, Ed J

    2015-01-01

    As part of the European Clostridium difficile infections (CDI) surveillance Network (ECDIS-Net), which aims to build capacity for CDI surveillance in Europe, we constructed a new network of hospital-based laboratories in Poland. We performed a survey in 13 randomly selected hospital-laboratories in different sites of the country to determine their annual CDI incidence rates from 2011 to 2013. Information on C. difficile laboratory diagnostic testing and indications for testing was also collected. Moreover, for 2012 and 2013 respectively, participating hospital-laboratories sent all consecutive isolates from CDI patients between February and March to the Anaerobe Laboratory in Warsaw for further molecular characterisation, including the detection of toxin-encoding genes and polymerase chain reaction (PCR)-ribotyping. Within the network, the mean annual hospital CDI incidence rates were 6.1, 8.6 and 9.6 CDI per 10,000 patient-days in 2011, 2012, and 2013 respectively. Six of the 13 laboratories tested specimens only on the request of a physician, five tested samples of antibiotic-associated diarrhoea or samples from patients who developed diarrhoea more than two days after admission (nosocomial diarrhoea), while two tested all submitted diarrhoeal faecal samples. Most laboratories (9/13) used tests to detect glutamate dehydrogenase and toxin A/B either separately or in combination. In the two periods of molecular surveillance, a total of 166 strains were characterised. Of these, 159 were toxigenic and the majority belonged to two PCR-ribotypes: 027 (n=99; 62%) and the closely related ribotype 176 (n=22; 14%). The annual frequency of PCR-ribotype 027 was not significantly different during the surveillance periods (62.9% in 2012; 61.8% in 2013). Our results indicate that CDIs caused by PCR-ribotype 027 predominate in Polish hospitals participating in the surveillance, with the closely related 176 ribotype being the second most common agent of infection.

  17. Crystal identification for a dual-layer-offset LYSO based PET system via Lu-176 background radiation and mean shift algorithm

    Science.gov (United States)

    Wei, Qingyang; Ma, Tianyu; Xu, Tianpeng; Zeng, Ming; Gu, Yu; Dai, Tiantian; Liu, Yaqiang

    2018-01-01

    Modern positron emission tomography (PET) detectors are made from pixelated scintillation crystal arrays and readout by Anger logic. The interaction position of the gamma-ray should be assigned to a crystal using a crystal position map or look-up table. Crystal identification is a critical procedure for pixelated PET systems. In this paper, we propose a novel crystal identification method for a dual-layer-offset LYSO based animal PET system via Lu-176 background radiation and mean shift algorithm. Single photon event data of the Lu-176 background radiation are acquired in list-mode for 3 h to generate a single photon flood map (SPFM). Coincidence events are obtained from the same data using time information to generate a coincidence flood map (CFM). The CFM is used to identify the peaks of the inner layer using the mean shift algorithm. The response of the inner layer is deducted from the SPFM by subtracting CFM. Then, the peaks of the outer layer are also identified using the mean shift algorithm. The automatically identified peaks are manually inspected by a graphical user interface program. Finally, a crystal position map is generated using a distance criterion based on these peaks. The proposed method is verified on the animal PET system with 48 detector blocks on a laptop with an Intel i7-5500U processor. The total runtime for whole system peak identification is 67.9 s. Results show that the automatic crystal identification has 99.98% and 99.09% accuracy for the peaks of the inner and outer layers of the whole system respectively. In conclusion, the proposed method is suitable for the dual-layer-offset lutetium based PET system to perform crystal identification instead of external radiation sources.

  18. Development of a certified reference material for composition of high-purity copper as a transfer standard within GET 176-2013

    Directory of Open Access Journals (Sweden)

    Veniamin M. Zyskin

    2017-01-01

    Full Text Available Introduction. The paper gives information on the development of a certified reference material (CRM for composition of high-purity copper (Cu CRM UNIIM. The CRM is included as the transfer standard into the State primary standard of the mass (molar fraction and mass (molar concentration of the component in liquid and solid substances and materials based on coulometry GET 176-2013.Materials and methods. The CRM represents pieces of oxygen-free copper wire rod, brand KMB, produced according to GOST R 53803-2010, weighing from 0.5 to 1g. The CRM is packed in plastic vials with the capacity of 30 or 50 cm3. The certified characteristic of the CRM is copper mass fraction in copper wire rod, expressed in percentages. The certified value for copper mass fraction was established by the primary method of controlled-potential coulometry using the State primary standard GET 176-2013.Results. The permitted interval of the certified value for copper mass fraction in the CRM is from 99,950 % to 100,000 %. The relative expanded uncertainty (k=2 of the certified value for copper mass fraction does not exceed 0,030 %; the relative standard uncertainty due to inhomogeneity does not exceed 0.010 %; the relative standard uncertainty due to instability does not exceed 0.010 %. The shelf life of the developed CRM is 10 years provided that standard storage conditions are ensured.Discussion and conclusions. The developed CRM is included into the State register of type approved RMs under the number GSO 10800-2016. The CRM of high-purity copper (Cu CRM UNIIM as a transfer standard is intended for reproduction, storage and transfer of the copper mass fraction unit to other reference materials and chemical reagents by the method of comparison using a comparator and by conducting direct measurements. This CRM may also be used:– for verification of measuring instruments (MIs according to the state verification schedule described in GOST R 8.735.0-2014,– for calibration

  19. Six-year clinical follow-up after treatment of diffuse in-stent restenosis with cutting balloon angioplasty followed by intracoronary brachytherapy with liquid rhenium-188-filled balloon via transradial approach

    International Nuclear Information System (INIS)

    Hang Chiling; Wu Chiungjen; Hsieh Bortsung

    2010-01-01

    Long-term follow-up studies revealed a significant decline in the benefits of intracoronary radiation for in-stent restenosis. A total of 25 study and 25 contemporaneous control patients with diffuse in-stent restenosis who underwent cutting balloon angioplasty (CBA) transradially, followed by subsequent intracoronary irradiation with a liquid β-emitter Rhenium-188 ( 188 Re)-filled balloon were enrolled in the study. The mean clinical follow-up durations were 64.9±13.0 and 66.3±13.8 months for the irradiated and control patients, respectively. Six-month angiographic restenosis was observed in 16% (4 of 25) of the patients in the irradiated group and 48% (12 of 25) of the patients in the control groups (P=0.03). The 6-month major adverse cardiac events (MACE) rate was 12% and 44%, respectively (P=0.025). The 3-year follow-up angiography was performed in 16 of 21 (76%) irradiated patients and in 4 of 13 (31%) control patients who had no significant restenosis at the 6-month angiographic follow-up. Restenosis occurred in 1 of 16 (7%) irradiated patients and 2 of 4 (50%) control patients. Late target lesion revascularization was performed in 1 irradiated and 2 control patients. The MACE rate within 6 years was significantly reduced in the irradiated group (20% vs. 56%, P=0.019). Brachytherapy using 188 Re-filled balloon following CBA for diffuse in-stent restenotic native coronary arteries is effective in reducing target lesion restenosis and improving long-term outcomes. (author)

  20. Coupled Nd-142, Nd-143 and Hf-176 Isotopic Data from 3.6-3.9 Ga Rocks: New Constraints on the Timing of Early Terrestrial Chemical Reservoirs

    Science.gov (United States)

    Bennett, Vickie C.; Brandon, alan D.; Hiess, Joe; Nutman, Allen P.

    2007-01-01

    Increasingly precise data from a range of isotopic decay schemes, including now extinct parent isotopes, from samples of the Earth, Mars, Moon and meteorites are rapidly revising our views of early planetary differentiation. Recognising Nd-142 isotopic variations in terrestrial rocks (which can only arise from events occurring during the lifetime of now extinct Sm-146 [t(sub 1/2)=103 myr]) has been an on-going quest starting with Harper and Jacobsen. The significance of Nd-142 variations is that they unequivocally reflect early silicate differentiation processes operating in the first 500 myr of Earth history, the key time period between accretion and the beginning of the rock record. The recent establishment of the existence of Nd-142 variations in ancient Earth materials has opened a new range of questions including, how widespread is the evidence of early differentiation, how do Nd-142 compositions vary with time, rock type and geographic setting, and, combined with other types of isotopic and geochemical data, what can Nd-142 isotopic variations reveal about the timing and mechanisms of early terrestrial differentiation? To explore these questions we are determining high precision Nd-142, Nd-143 and Hf-176 isotopic compositions from the oldest well preserved (3.63- 3.87 Ga), rock suites from the extensive early Archean terranes of southwest Greenland and western Australia.

  1. Electric quadrupole moments and strong interaction effects in pionic atoms of 165Ho, 175Lu, 176Lu, 179Hf and 181Ta

    International Nuclear Information System (INIS)

    Olaniyi, B.; Shor, A.; Cheng, S.C.; Dugan, G.; Wu, C.S.

    1981-05-01

    The effective quadrupole moments Q sub(eff) of the nuclei of 165 Ho, 175 Lu, 176 Lu, 179 Hf and 181 Ta were accurately measured by detecting the pionic atom 5g-4f x-rays of the elements. The spectroscopic quadrupole moments, Q sub(spec), were obtained by correcting Q sub(eff) for nuclear finite size effect, distortion of the pion wave function by the pion-nucleus strong interaction, and contribution to the energy level splittings by the strong interaction. The intrinsic quadrupole moments, Q 0 , were obtained by projecting Q sub(spec) into the frame of reference fixed on the nucleus. The shift, epsilon 0 , and broadening, GAMMA 0 , of the 4f energy level due to the strong interactions between the pion and the nucleons for all the elements were also measured. Theoretical values of epsilon 0 and GAMMA 0 were calculated and compared to the experimental values. The measured values of Q 0 were compared with the existing results in muonic and pionic atoms. The measured values of epsilon 0 and GAMMA 0 were also compared with existing values. (auth)

  2. Coulomb-nuclear interference measurements of 168Yb, 176Hf, 178Hf, and 180Hf and lifetime measurements in 186Hg

    International Nuclear Information System (INIS)

    Nettles, W.G.

    1979-01-01

    Alpha scattering measurements were performed at center-of-mass energies near the Coulomb barrier. These energies allow for nuclear as well as pure Coulomb forces to play a significant role in the excitation process. The interference of these two forces is very sensitive to the sign of the E4 ground-state moment, whereas pure Coulomb excitation is not. Systematics of the E4 moments of the rare earth mass region indicate a transition in the magnitude and sign of the reduced matrix element of the M(E4) operator between 0 + and 4 + states from small and positive to large and negative between Yb and W. Previous Coulomb-nuclear interference measurements show that this reduced matrix element for 180 Hf is large and negative. The present results agree with that conclusion. It is also shown that the above reduced matrix element for 178 Hf, like that of 180 Hf, is large and negative. The small and positive moment (matrix element) for 168 Yb is seen to be consistent with the experimental data. No conclusions are drawn for the E4 moment in 176 Hf. The measurement of nuclear lifetimes shorter than 500 ps requires the use of plastic scintilltor detectors. These detectors, however have very poor energy resolution. A system is described that uses plastic scintillators with a magnetic lens spectrometer for energy selection. The system was used to measure the lifetime of the 522-keV 0 + sate in 186 Hf. A data analysis method using higher-order distribution moments is also presented

  3. Analysis of proteomes released from in vitro cultured eight Clostridium difficile PCR ribotypes revealed specific expression in PCR ribotypes 027 and 176 confirming their genetic relatedness and clinical importance at the proteomic level

    Czech Academy of Sciences Publication Activity Database

    Dresler, J.; Krůtová, M.; Fučíková, A.; Klimentová, J.; Hrůzová, V.; Ďuráčová, M.; Houdková, K.; Salovská, B.; Matějková, J.; Hubálek, Martin; Pajer, P.; Píša, L.; Nyč, O.

    2017-01-01

    Roč. 9, Aug 14 (2017), č. článku 45. ISSN 1757-4749 Institutional support: RVO:61388963 Keywords : Clostridium difficile * label-free quantification * proteome * PCR ribotype 027 * PCR ribotype 176 Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.756, year: 2016 https://gutpathogens.biomedcentral.com/articles/10.1186/s13099-017-0194-9

  4. Evolution of E 2 transition strength in deformed hafnium isotopes from new measurements on 172Hf,174Hf, and 176Hf

    Science.gov (United States)

    Rudigier, M.; Nomura, K.; Dannhoff, M.; Gerst, R.-B.; Jolie, J.; Saed-Samii, N.; Stegemann, S.; Régis, J.-M.; Robledo, L. M.; Rodríguez-Guzmán, R.; Blazhev, A.; Fransen, Ch.; Warr, N.; Zell, K. O.

    2015-04-01

    Background: The available data for E 2 transition strengths in the region between neutron-deficient hafnium and platinum isotopes are far from complete. More and precise data are needed to enhance the picture of structure evolution in this region and to test state-of-the-art nuclear models. In a simple model, the maximum collectivity is expected at the middle of the major shell. However, for actual nuclei, particularly in heavy-mass regions, which should be highly complex, this picture may no longer be the case, and one should use a more realistic nuclear-structure model. We address this point by studying the spectroscopy of Hf as a representative case. Purpose: We remeasure the 21+ half-lives of 172,174,176Hf, for which there is some disagreement in the literature. The main goal is to measure, for the first time, the half-lives of higher-lying states of the rotational band. The new results are compared to a theoretical calculation for absolute transition strengths. Method: The half-lives were measured using γ -γ and conversion-electron-γ delayed coincidences with the fast timing method. For the determination of half-lives in the picosecond region, the generalized centroid difference method was applied. For the theoretical calculation of the spectroscopic properties, the interacting boson model is employed, whose Hamiltonian is determined based on microscopic energy-density functional calculations. Results: The measured 21+ half-lives disagree with results from earlier γ -γ fast timing measurements, but are in agreement with data from Coulomb excitation experiments and other methods. Half-lives of the 41+ and 61+ states were measured, as well as a lower limit for the 81+ states. Conclusions: This work shows the importance of a mass-dependent effective boson charge in the interacting boson model for the description of E 2 transition rates in chains of nuclei. It encourages further studies of the microscopic origin of this mass dependence. New experimental

  5. Development of novel strategy for the synthesis of organometallic compounds usable as protein ligands: application to the human cyclophilin hCyp-18; Developpement de ligands de proteines par assemblage combinatoire autour d'un coeur de rhenium{sup V}: application a la cyclophiline hCyp-18

    Energy Technology Data Exchange (ETDEWEB)

    Clavaud, C

    2006-02-15

    This thesis describes a new strategy for the development of bioactive organometallic compounds, basing on the combinatorial assembly of sub-chemical libraries (A and B) independent but complementary and able to coordinate a metallic heart M to form A-M-B complex potential ligands of biomolecules. The coordination of metals, well adapted to the production of molecular variety is usually used in medicinal chemistry, in diagnostic and therapeutic nuclear medicine. Among the useful elements, the rhenium and the technetium are metals of choice for the development of the assembly strategy because of their chemical and radiochemical properties and of the structure analogy of their complexes. This strategy was validated in vitro. The protein chosen for this purpose was the cyclophilin hCyp-18. (N.C.)

  6. Molybdenum-rhenium superconducting suspended nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    Aziz, Mohsin; Christopher Hudson, David; Russo, Saverio [Centre for Graphene Science, College of Engineering, Mathematics and Physical Sciences, University of Exeter, Exeter EX4 4QF (United Kingdom)

    2014-06-09

    Suspended superconducting nanostructures of MoRe 50%/50% by weight are fabricated employing commonly used fabrication steps in micro- and nano-meter scale devices followed by wet-etching with Hydro-fluoric acid of a SiO{sub 2} sacrificial layer. Suspended superconducting channels as narrow as 50 nm and length 3 μm have a critical temperature of ≈6.5 K, which can increase by 0.5 K upon annealing at 400 °C. A detailed study of the dependence of the superconducting critical current and critical temperature upon annealing and in devices with different channel widths reveals that desorption of contaminants is responsible for the improved superconducting properties. These findings pave the way for the development of superconducting electromechanical devices using standard fabrication techniques.

  7. The Electrodeposition of Rhenium and Its Alloys

    Science.gov (United States)

    2015-09-18

    did not have benefit. A combination of vanillin, sodium lauryl sulfate, and gelatin , and equal concentrations of Ni2+ and ReO4 - yielded a coating...substrate, thus facilitating good bonding between the coating and substrate. Similar phenomenon would occur between a silver substrate and...electrodeposited metal coating. Historically, this is why most successful electroplating process used copper, brass (copper-zinc alloy), and silver as substrates

  8. Stability of rhenium-188 labeled antibody

    International Nuclear Information System (INIS)

    Lim, B. K.; Jung, J. M.; Jung, J. K.; Lee, D. S.; Lee, M. C.

    1999-01-01

    For clinical application of beta-emitter labeled antibody, high specific activity is important. Carrier-free Re-188 from W-188/Re-188 generator is an ideal radionuclide for this purpose. However, low stability of Re-188 labeled antibody, especially in high specific activity, due to radiolytic decomposition by high energy (2.1 MeV) beta ray was problem. We studied the stability of Re-188 labeled antibody, and stabilizing effect of several nontoxic radical-quenching agents. Pre-reduced monoclonal antibody (CEA79.4) was labeled with Re-188 by incubating with generator-eluted Re-188-perrhenate in the presence of stannous tartrate for 2 hr at room temperature. Radiochemical purity of each preparation was determined by chromatography (ITLC-SG/acetone, ITLC-SG/Umezawa, Whatman No.1/saline). Human serum albumin was added to the labeled antibodies(2%). Stability of Re-188-CEA79.4 was investigated in the presence of vitamin C, ethanol, or Tween 80 as radical-quenching agents. Specific activities of 4.29∼5.11 MBq/μg were obtained. Labeling efficiencies were 88±4%(n=12). Very low stability after removal of stannous tartrate from the preparation was observed. If stored after purging with N 2 , all the preparations were stable for 10 hr. However, if contacted with air, stability decreased. Perrhenate and Re-188-tartrate was major impurity in declined preparation (12∼47 and 9∼38% each, after 10 hr). Colloid-formation was not a significant problem in all cases. Addition of vitamin C stabilized the labeled antibodies either under N 2 or under air by reducing the formation of perrhenate. High specific activity Re-188 labeled antibody is unstable, especially, in the presence of oxygen. Addition of vitamin C increased the stability

  9. Unusual Metalloporphyrin Complexes of Rhenium and Technetium

    Science.gov (United States)

    1975-06-06

    vitamin 8216,17). Changes or modification of general porphyrin metabolism are associated with cancer, drug metabolism, 18and specific disease syndromes ...D. Adler, F. R. Longo, J. D. Finarelli, J. Goldmacher, J. Assour, and L. Korsakoff , J. Org. Chem., 32; 476 (1967). 67. G. H. Barnett, M. F. Hudson

  10. On rhenium (7) state in aqueous solutions

    International Nuclear Information System (INIS)

    Sinyakova, G.S.

    1979-01-01

    The methods of spectrophotometry, electric conductivity and potentiometric titration have been used in studying the interaction in the system Re(7)-H 3 O + -H 2 O. It has been found that sodium perrhenate and perrhenic acid dissociate on dilution but not the way typical of binary electrolytes. Perrhenic acid is a mixture of the acids HReO 4 and H 5 ReO 6 . The two acids do not undergo differential titration. The conventional ionization constant, as calculated from the data of potentiometric titration, K 1 =(2.34+-0.52)x10 -2 . A step-wise dissociation of the H 4 ReO 6 - anion has been found, K 2 =(2.04+-0.30)x10 -8 , K 3 =(4.90+-0.20)x10 -12

  11. A triad of rhenium-mediated transformations

    Indian Academy of Sciences (India)

    Unknown

    Gangopadhyay J, Sengupta S, Bhattacharyya S, Chakraborty I and Chakravorty A 2002 Inorg. Chem. 41 2616. 9. Geldard J F and Lions F 1965 J. Org. Chem. 30 318. 10. Kliegman J M and Barnes R K 1970 Tetrahedron 26 2555. 11. Bhattacharyya S, Chakraborty I, Dirghangi B K and Chakravorty A 2001 Inorg. Chem.40286.

  12. Results of Time-of-Flight Neutron Capture Measurements of 176,177,178,179 Hf-enriched and nat Hf samples at 10 m, 30 m and 60 m stations of GELINA

    International Nuclear Information System (INIS)

    Ware, T.C.; Dean, C.J.; Borella, A.; Kopecky, S.; Moens, A.; Schillebeeckx, P.; Janeva, N.; Moxon, M.C.

    2014-04-01

    Neutron capture measurements have been performed at the time-offlight facility GELINA to determine neutron resonance parameters for 174,176,177,178,179,180 Hf. In total, 16 distinct experiments were conducted at the 12 m, 28 m and 58 m capture stations using C 6 D 6 detectors with a moderated neutron beam and the accelerator operating at 50 Hz or 800 Hz. Measurements were performed with nat Hf metallic samples and oxide samples enriched in 176 Hf, 177 Hf, 178 Hf and 179 Hf. This report describes the experimental details required to deliver the experimental capture yields to the EXFOR data library which is maintained by the Nuclear Energy Agency of the OECD and the Nuclear Data Section of the IAEA. The experimental conditions and data reduction procedures are described. In addition, the full covariance information based on the AGS concept is given, such that resonance parameters together with their covariances can be derived in a least squares adjustment to the data. (author)

  13. Toward metrological traceability for DNA fragment ratios in GM quantification. 1. Effect of DNA extraction methods on the quantitative determination of Bt176 corn by real-time PCR.

    Science.gov (United States)

    Corbisier, Philippe; Broothaerts, Wim; Gioria, Sabrina; Schimmel, Heinz; Burns, Malcolm; Baoutina, Anna; Emslie, Kerry R; Furui, Satoshi; Kurosawa, Yasunori; Holden, Marcia J; Kim, Hyong-Ha; Lee, Yun-Mi; Kawaharasaki, Mamoru; Sin, Della; Wang, Jing

    2007-05-02

    An international CCQM-P60 pilot study involving eight national metrological institutes was organized to investigate if the quantification of genetically modified (GM) corn powder by real-time PCR was affected by the DNA extraction method applied. Four commonly used extraction methods were compared for the extraction of DNA from a GM Bt176 corn powder. The CTAB-based method yielded the highest DNA template quantity and quality. A difference in the 260 nm/230 nm absorbance ratio was observed among the different extraction methods. Real-time amplification of sequences specific for endogenous genes zein and hmg as well as transgenic sequences within the cryIA(b) gene and a fragment covering the junction between the transformed DNA and the plant genome were used to determine the GM percentage. The detection of the transgenic gene was affected by the quantity and quality of template used for the PCR reaction. The Bt176 percentages measured on diluted or purified templates were statistically different depending on the extraction method applied.

  14. Volatility literature of chlorine, iodine, cesium, strontium, technetium, and rhenium; technetium and rhenium volatility testing

    International Nuclear Information System (INIS)

    Langowski, M.H.; Darab, J.G.; Smith, P.A.

    1996-03-01

    A literature review pertaining to the volatilization of Sr, Cs, Tc (and its surrogate Re), Cl, I and other related species during the vitrification of Hanford Low Level Waste (LLW) streams has been performed and the relevant information summarized. For many of these species, the chemistry which occurs in solution prior to the waste stream entering the melter is important in dictating their loss at higher temperatures. In addition, the interactive effects between the species being lost was found to be important. A review of the chemistries of Tc and Re was also performed. It was suggested that Re would indeed act as an excellent surrogate for Tc in non-radioactive materials testing. Experimental results on Tc and Re loss from sodium aluminoborosilicate melts of temperatures ranging from 900--1350 degrees C performed at PNL are reported and confirm that Re behaves in a nearly identical manner to that of technetium

  15. Why do pathological stage IA lung adenocarcinomas vary from prognosis?: a clinicopathologic study of 176 patients with pathological stage IA lung adenocarcinoma based on the IASLC/ATS/ERS classification.

    Science.gov (United States)

    Zhang, Jie; Wu, Jie; Tan, Qiang; Zhu, Lei; Gao, Wen

    2013-09-01

    Patients with pathological stage IA adenocarcinoma (AC) have a variable prognosis, even if treated in the same way. The postoperative treatment of pathological stage IA patients is also controversial. We identified 176 patients with pathological stage IA AC who had undergone a lobectomy and mediastinal lymph node dissection at the Shanghai Chest Hospital, Shanghai, China, between 2000 and 2006. No patient had preoperative treatment. The histologic subtypes of all patients were classified according to the 2011 International Association for the Study of Lung Cancer (IASLC)/American Thoracic Society (ATS)/European Respiratory Society (ERS) international multidisciplinary lung AC classification. Patients' 5-year overall survival (OS) and 5-year disease-free survival (DFS) were calculated using Kaplan-Meier and Cox regression analyses. One hundred seventy-six patients with pathological stage IA AC had an 86.6% 5-year OS and 74.6% 5-year DFS. The 10 patients with micropapillary predominant subtype had the lowest 5-year DFS (40.0%).The 12 patients with solid predominant with mucin production subtype had the lowest 5-year OS (66.7%). Univariate and multivariate analysis showed that sex and prognositic groups of the IASLC/ATS/ERS histologic classification were significantly associated with 5-year DFS of pathological stage IA AC. Our study revealed that sex was an independent prognostic factor of pathological stage IA AC. The IASLC/ATS/ERS classification of lung AC identifies histologic categories with prognostic differences that could be helpful in clinical therapy.

  16. Energy independent partial wave analysis of the reactions π+-p→Nππ between 1.36 and 1.76GeV c.m.s. energy

    International Nuclear Information System (INIS)

    Dolbeau, J.; Triantis, F.A.; Neveu, M.; Cadiet, F.

    1975-01-01

    A new partial wave analysis of the three reactions π - p→pπ - π 0 , π - p→nπ + π - , and π + p→pπ + π 0 is presented at nine c.m. energies between 1.36 and 1.76GeV, using about 91300 Nππ events. Within the framework of the generalized isobar model it is possible to describe the data with Δ, rho and sigma(ππ, i=0) production, as well as to reproduce the π - p→nπ 0 π 0 and π + p→nπ + π + cross sections. New prescriptions for the description of sigma and for the centrifugal barrier term are obtained. Furthermore, at the highest energy, there is evidence for N* production and for the presence of a ππ interaction, contributing about 5% to the cross sections of the reaction π - p→pπ - π 0 and π + p→pπ + π 0 . Finally, Argand plots are presented, showing the main inelastic couplings for ten resonances in this energy range [fr

  17. Comparison between exercise electrocardiogram and thallium 201 myocardial perfusion imaging during exercise, after dipyridamole and at rest, for the diagnosis of stable angina pectoris. 176 cases were studied with coronary angiography

    International Nuclear Information System (INIS)

    Machecourt, J.; Denis, B.; Comet, M.; Wolf, J.E.; Dimitriou, R.; Pellet, J.; Noel, P.M.

    1981-01-01

    The purpose of this study was to compare the diagnostic interest of the electrocardiogram stress test (EST) and the thallium myocardial imaging during exercise (TIE). For this, the cases of 176 patients with stable angina pectoris who underwent a coronary arteriogram were studied. These patients were divided into two groups: a first group of 113 patients without a previous history of myocardial infarction, nor a Q wave on their electrocardiogram and a second group of 63 patients with angina pectoris after a previous myocardial infarction. All patients underwent a combined EST and TIE. The sensitivity and the specificity of the EST and the TIE were studied, and the post-test risk after either a positive test or a negative test was calculated according to Bayes' theorem. In the first group 62 patients had a coronary stenosis and 51 had a normal arteriogram. The sensitivity of the TIE was higher than that of the EST: 80% versus 64%, p < 0.01. Even when the maximum effort was not reached during the EST, the TIE kept the same sensitivity. The diagnosis of angina pectoris cannot be absolutely established by the separate use of the TIE or the EST. However, their predictive value increases when both are correlated. Moreover, for female patients, the TIE is more specific than the EST because of the higher frequency of false positive or equivocal results of the EST in that population. (Auth.)

  18. 40 CFR 82.176 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... replacement of class I or II compounds causes formulators to change other components in a product, formulators... environmental and human health risk associated with the use of any class I or class II substitute. (7... consumed, transformed or destroyed in the manufacturing or use process are exempt from reporting...

  19. 46 CFR 176.645 - AHE Procedure.

    Science.gov (United States)

    2010-10-01

    ... hull for examination, except internal tanks that carry fuel (unless damage or deterioration is discovered or suspect), sewage, or potable water. Internal sewage and potable water tanks may be examined... repairs if the assessment or repairs cannot be completed to the satisfaction of the OCMI while the vessel...

  20. 32 CFR 176.5 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... services that has no established limitation on the amount of time of residence to help meet long-term needs of homeless individuals and families; and, (v) Any other activity that clearly meets an identified.... Homeless person. (1) An individual or family who lacks a fixed, regular, and adequate nighttime residence...

  1. 32 CFR 176.10 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... received by HHS prior to October 25, 1994, and were spending with the Secretary of HHS on that date. These... application, but property has not been assigned or otherwise disposed of by the Military Department, the LRA...

  2. Publications | Page 176 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... and institutions to build local capacity through funding, knowledge sharing, and ... Through books, articles, research publications, and studies, we aim to widen ... A group of agricultural practitioners from all over Sudan gathered in the city of ...

  3. Search Results | Page 176 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... (FBOs) are one of the driving forces for political and social change. ... In this project, IDRC will partner with the Norman Paterson School of International Affairs (NPSIA) in furthering a program of research on international human rights. Project.

  4. 49 CFR 176.83 - Segregation.

    Science.gov (United States)

    2010-10-01

    ... presence of one or more steel bulkheads or decks between them or a combination thereof. Intervening spaces... substance but vary only in their water content (for example, sodium sulfide in Division 4.2 or Class 8) or... applied. (11) Certain exceptions from segregation for waste cyanides or waste cyanide mixtures or...

  5. Reference: 176 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available tricted to a few tissues, including senescing leaves. Disruption of GPT2 has no obvious effect on growth and development under greenh...ouse conditions, whereas the mutations gpt1-1 and gpt1-2

  6. 32 CFR 176.30 - LRA application.

    Science.gov (United States)

    2010-07-01

    ... Plan(s) or any other existing housing, social service, community, economic, or other development plans...) Notices of interest proposing assistance to homeless persons and/or families. (i) A description of the... activities need not be limited to expressions of interest in property, but may also include discussions of...

  7. 21 CFR 176.300 - Slimicides.

    Science.gov (United States)

    2010-04-01

    ... disodium ethylenebis(dithiocarba-mate) Disodium cyanodithioimidocarbonate n-Dodecylguanidine hydrochloride... pound, calculated as silver fluoride, per ton of paper produced. Silver nitrate Sodium dimethyldithiocarbamate Sodium 2-mercaptobenzothiazole Sodium pentachlorophenate Sodium trichlorophenate 1,3,6,8...

  8. 49 CFR 176.137 - Portable magazine.

    Science.gov (United States)

    2010-10-01

    ... requirements: (1) It must be weather-tight, constructed of wood or metal lined with wood at least 2 cm (0.787... wood, a portable magazine must be framed of nominal 5 cm × 10 cm (2×4 inch) lumber, and sheathed with... used for the stowage of Class 1 (explosive) materials under such construction, handling, and stowage...

  9. Search Results | Page 176 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Filter by type .... Ugandan-Canadian partnership advances research on disability studies ... Without formal research and concrete data, a knowledge gap exists that hinders disabled peoples' organizations in Uganda from effectively advocating ...

  10. 46 CFR 160.176-8 - Materials.

    Science.gov (United States)

    2010-10-01

    ... transmission rate of inflation chamber materials must not be increased by more than 10% after being subjected... other metal part in contact with it; and (ii) Unless it is expendable (such as an inflation medium... type. (c) Inflation chamber materials—(1) All materials. (i) The average permeability of inflation...

  11. 49 CFR 176.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... not penetrate accommodations, machinery spaces or other work areas by means of entrances or other... cargo, to prevent damage during transportation. Explosives anchorage means an anchorage so designated... whose stowage together may result in undue hazards in the case of leakage, spillage, or other accident...

  12. Structure of rhenium (5) complexes with petroleum organic sulfur compounds

    International Nuclear Information System (INIS)

    Akhmadieva, R.G.; Yusupova, N.A.; Numanov, N.U.; Basitova, S.M.

    1985-01-01

    Structure of Re(5) complexes with petroleum sulfides (L) of ReOCl 3 (L) 2 composition is studied by the UV- and IR-spectroscopy method in a short-wave and long-wave ranges. It is shown that Re(5) complex with L are of the form of flattened octahedron,where three Cl atoms and one L molecule are arranged in the plane around Re atom. The structure is analogous to structure of Re complexes with synthetic cyclic sulfides

  13. Technetium and rhenium tracers with metabolizable ester functions

    International Nuclear Information System (INIS)

    Syhre, R.; Seifert, S.; Schneider, F.; Pietzsch, H.J.; Spies, H.; Johannsen, B.

    1993-01-01

    Re-DMSA (dimercaptosuccinic acid) ester complexes were prepored by ligand exchange reactions. To determine whether the ester band in Re-DMSA ester complexes is susceptible to cleavage by esterases, incubation experiments with tissue homogenates and plasma were carried out. (BBR)

  14. Comparative electrochemistry of technetium (V) and rhenium (V) dioxo complexes

    International Nuclear Information System (INIS)

    Kremer, C.; Kremer, E.; Dominguez, S.; Mederos, A.

    1996-01-01

    The heavy use of 99m Tc in nuclear medicine and the recent development of 188 Re radiopharmaceuticals have encouraged the comparative study of Tc and Re coordination compounds. In this work, the electrochemistry of [M v O 2 (amine) 2 ] + (M = Tc, Re; amine = ethylenediamine, 1,3-diaminopropane, diethylenetriamine, triethylenetetramine) complexes is studied by cyclic voltammetry and the results are compared. The voltammograms of these compounds, obtained at different pH values, show that [ReO 2 (amine) 2 + cations are thermodynamically stable even when protonated. On the other hand, analogous Tc compounds are not so stable and easily decompose if existing as [TcO (OH) (amine) 2 ] 2+ . (author). 17 refs., 3 figs., 1 tab

  15. Rhenium-Catalyzed Deoxydehydration of Diols and Polyols

    DEFF Research Database (Denmark)

    Dethlefsen, Johannes Rytter; Fristrup, Peter

    2015-01-01

    The substitution of platform chemicals of fossil origin by biomass-derived analogues requires the development of chemicaltransformations capable of reducing the very high oxygen contentof biomass. One such reaction, which has received increasingattention within the past five years, is the heniumc......The substitution of platform chemicals of fossil origin by biomass-derived analogues requires the development of chemicaltransformations capable of reducing the very high oxygen contentof biomass. One such reaction, which has received increasingattention within the past five years...... systems that have been developed withemphasis on the nature of the reductant, the substrate scope,and mechanistic investigations....

  16. Tertiary phosphine complexes of rhenium: a spectroscopic study

    International Nuclear Information System (INIS)

    Fergusson, J.E.; Heveldt, P.F.

    1976-01-01

    Complexes of the type ReOX 3 L 2 , ReNX 2 L 3 , ReX 3 (NO)L 2 and ReX 2 (NO)L 3 have been studied using, UV visible, IR and H 1 , C 13 NMR spectroscopy. (X is a halogen, Cl, Br, I and L is a tertiary phosphine Et 3 P and Et 2 PhP). Evidence obtained on the blue cis isomer ReOCl 3 L 2 suggests that the halogens are arranged on a face of the octahedral complex. Assignments of ν(Re-X) and ν(Re-P) vibrations have been made. Three complexes of technetium, [TcCl 4 (Ph 3 P) 2 ], [TcCl 3 (Et 2 PhP) 3 ] and [TcCl 3 (NO)(Et 2 PhP) 2 ] have been isolated. (author)

  17. Rhenium and Manganese-Catalyzed Selective Alkenylation of Indoles

    KAUST Repository

    Wang, Chengming

    2018-04-06

    An efficient rhenium‐catalyzed regioselective C‐H bond alkenylation of indoles is reported. The protocol operates well for internal as well as terminal alkynes, affording products in good to excellent yields. Furthermore, a manganese catalyzed, acid free, regioselective C2‐alkenylation of indoles with internal alkynes is described. The directing groups can be easily removed after the reaction and the resulting products can be used as valuable building blocks for the synthesis of diverse heterocyclic compounds.

  18. Bone uptake by di and tetraphosphonates labeled with Rhenium-188

    International Nuclear Information System (INIS)

    Faintuch, B.L.; Osso, J.A. Jr.; Muramoto, E.; Faintuch, S.

    2002-01-01

    MDP (methylenediphosphonate) and HEDP (hydroxyethylidenediphosphonate), both diphosphonates, and EDTMP (ethylenediamine tetramethylene phosphonic acid) a tetraphosphonate ligand, have been labeled with 188 Re for use in metastatic bone-pain palliation. The aim of this study was a comparison between the three complexes 188 Re-MDP, 188 Re-HEDP and 188 Re-EDTMP concerning the complexation conditions, in order to achieve maximum yield, stability and bone uptake. Methods: MDP was dissolved in water and HEDP and EDTMP were dissolved in NaOH 1N followed by decreasing pH with HCl 1N. To all mixtures stannous chloride and 188 ReO 4 were added in a nitrogen atmosphere. The preparations were heated in a boiling water bath for 15 min. The yields as well as the radiochemical stability were estimated by ITLC. Different concentrations of phosphonates and stannous chloride were evaluated. Biodistribution studies in swiss mice were done for the three 188 Re-phosphonates that presented the best radiochemical yield. Results: For 188 Re-MDP and 188 Re-HEDP the optimal ligand concentration for maximum complexation was 30 mg whereas for 188 Re-EDTMP, it was 40 mg. The best amount of SnCl 2 .2H 2 O was 2 mg/mL for MDP, 3 mg/mL for HEDP and 1 mg/mL for EDTMP. In these conditions the three complexes showed a complexation yield above 95%. All of them presented 4-hour radiochemical stability without the need for ascorbic acid solution, but for 24 hours this stability existed only in the presence of that substance otherwise re-oxidation of 188 Re occurred. All products showed a great uptake by the kidneys. 188 Re-EDTMP had the greatest uptake by the bone (3.13 ± 0.18% ID/g) followed by 188 Re-MDP (1.18 ± 0.05%ID/g) and 188 Re-HEDP (1.03 ± 0.12 %ID/g), 4 hour postinjection. 188 Re-EDTMP displayed a bone/muscle ratio of 28.5, 188 Re-MDP 4.9 and 188 Re-HEDP 4.9. Conclusion: 188 Re-EDTMP demonstrated the best potential as a radiopharmaceutical for bone cancer pain relief, encouraging further dosimetric studies and clinical trials

  19. Gamma bands in doubly odd rhenium and iridium nuclei

    Directory of Open Access Journals (Sweden)

    Balodis M.

    2015-01-01

    Full Text Available Structure of the |K ± 2| bands in doubly-odd nuclei belonging to the transitional deformation region at A∼190 is discussed. Relation of these quasi gamma-bands with the non-axial deformation of the parent two-quasiparticle configurations is studied. Using available experimental information, new tentative |K ± 2| bands are proposed in 188Re, and 192,194Ir nuclei. Coexistence of two-quasiparticle states with different deformation modes is considered in the case of 188Re and 194Ir.

  20. Mitochondria Targeting with Luminescent Rhenium(I) Complexes.

    Science.gov (United States)

    Skiba, Joanna; Bernaś, Tytus; Trzybiński, Damian; Woźniak, Krzysztof; Ferraro, Giarita; Marasco, Daniela; Merlino, Antonello; Shafikov, Marsel Z; Czerwieniec, Rafał; Kowalski, Konrad

    2017-05-15

    Two new neutral fac -[Re(CO)₃(phen)L] compounds ( 1 , 2 ), with phen = 1,10-phenanthroline and L = O₂C(CH₂)₅CH₃ or O₂C(CH₂)₄C≡CH, were synthetized in one-pot procedures from fac -[Re(CO)₃(phen)Cl] and the corresponding carboxylic acids, and were fully characterized by IR and UV-Vis absorption spectroscopy, ¹H- and 13 C-NMR, mass spectrometry and X-ray crystallography. The compounds, which display orange luminescence, were used as probes for living cancer HeLa cell staining. Confocal microscopy revealed accumulation of both dyes in mitochondria. To investigate the mechanism of mitochondrial staining, a new non-emissive compound, fac -[Re(CO)₃(phen)L], with L = O₂C(CH₂)₃((C₅H₅)Fe(C₅H₄), i.e., containing a ferrocenyl moiety, was synthetized and characterized ( 3 ). 3 shows the same mitochondrial accumulation pattern as 1 and 2 . Emission of 3 can only be possible when ferrocene-containing ligand dissociates from the metal center to produce a species containing the luminescent fac -[Re(CO)₃(phen)]⁺ core. The release of ligands from the Re center was verified in vitro through the conjugation with model proteins. These findings suggest that the mitochondria accumulation of compounds 1 - 3 is due to the formation of luminescent fac -[Re(CO)₃(phen)]⁺ products, which react with cellular matrix molecules giving secondary products and are uptaken into the negatively charged mitochondrial membranes. Thus, reported compounds feature a rare dissociation-driven mechanism of action with great potential for biological applications.

  1. Mitochondria Targeting with Luminescent Rhenium(I Complexes

    Directory of Open Access Journals (Sweden)

    Joanna Skiba

    2017-05-01

    Full Text Available Two new neutral fac-[Re(CO3(phenL] compounds (1,2, with phen = 1,10-phenanthroline and L = O2C(CH25CH3 or O2C(CH24C≡CH, were synthetized in one-pot procedures from fac-[Re(CO3(phenCl] and the corresponding carboxylic acids, and were fully characterized by IR and UV-Vis absorption spectroscopy, 1H- and 13C-NMR, mass spectrometry and X-ray crystallography. The compounds, which display orange luminescence, were used as probes for living cancer HeLa cell staining. Confocal microscopy revealed accumulation of both dyes in mitochondria. To investigate the mechanism of mitochondrial staining, a new non-emissive compound, fac-[Re(CO3(phenL], with L = O2C(CH23((C5H5Fe(C5H4, i.e., containing a ferrocenyl moiety, was synthetized and characterized (3. 3 shows the same mitochondrial accumulation pattern as 1 and 2. Emission of 3 can only be possible when ferrocene-containing ligand dissociates from the metal center to produce a species containing the luminescent fac­[Re(CO3(phen]+ core. The release of ligands from the Re center was verified in vitro through the conjugation with model proteins. These findings suggest that the mitochondria accumulation of compounds 1–3 is due to the formation of luminescent fac-[Re(CO3(phen]+ products, which react with cellular matrix molecules giving secondary products and are uptaken into the negatively charged mitochondrial membranes. Thus, reported compounds feature a rare dissociation-driven mechanism of action with great potential for biological applications.

  2. ELECTROCHEMICAL STUDY OF RHENIUM-TELLURIUM-COPPER SYSTEM

    OpenAIRE

    E.A.Salakhova*1, D.B.Tagiyev2, P.E.Kalantarova3 and A.M.Askerova4

    2017-01-01

    The formation of the triple alloys Re-Te-Cu on the platinum electrode at volt amperemetric cycling has been studied. The investigation was carried out from chloride acidic solution containing tellurium acid, potassium perrhenate, chloride copper. The kinetics of the processes was controlled using the measurements by the method of cyclic volt-amperometry on the device İVİUMSTAT. For the analysis of composition and structure the methods of XRD (X-ray diffraction analysis) were used, and the inv...

  3. Inorganic heterocycles with two manganes or rhenium carbonyl units

    International Nuclear Information System (INIS)

    Kuellmer, V.; Vahrenkamp, H.

    1977-01-01

    From the reactive complexes [(CO) 4 M-E-Sn(CH 3 ) 3 ] 2 (M = Mn,Re; E = S,Se) with (CH 3 ) 2 PCl via the non-isolable four-membered ring intermediates [(CO) 4 M-E-P(CH 3 ) 2 ] 2 the six-membered heterocycles[-(CO) 4 M-P(CH 3 ) 2 -E-] 2 are formed. By use of (CH 3 ) 2 AsCl both the four-membered ring intermediates and the six-membered ring products can be isolated. The six-membered heterocycles can be opened by trimethylphosphine. (orig./HK) [de

  4. Quadrupole interactions in pionic and muonic tantalum and rhenium

    International Nuclear Information System (INIS)

    Konijn, J.; Doesburg, W. van; Ewan, G.T; Johansson, T.; Tibell, G.

    1981-01-01

    The hyperfine splitting of pionic and muonic X-rays in natural Re has been studied using the known ratio (accurate to 1.6 parts in 10 5 ) of the quadrupole moments of the two naturally occurring 185 Re and 187 Re isotopes. From the hyperfine splitting of the 5g → 4f and 4f → 3d pionic X-rays the effective quadrupole hyperfine constants were determined to be 187 A 2 sup(e)sup(f)sup(f) (4f) = 1.163 +- 0.010 keV and 187 A 2 sup(e)sup(f)sup(f) (3d) = 5.39 +- 0.63 keV, giving strong interaction quadrupole shifts epsilon 2 (4f) = 46 +- 10 eV and epsilon 2 (3d) = 1.3 +- 0.6 keV. The strong interaction monopole shifts epsilon 0 and widths GAMMA 0 of the 5g, 4f and 3d levels have also been measured. For the two higher orbits, standard optical-potential calculations fit the measured shifts and widths quite well. The observed deeper-lying 3d state, however, has shifts and widths that differ by a factor of 2 or more from the predictions. From the measured quadrupole hyperfine constants of the 4f level we calculate the spectroscopic quadrupole moments to be 187 Qsup(μ) = 2.09 +- 0.04 b, 187 Qsup(π) = 2.07 +- 0.02 b, 185 Qsup(μ) = 2.21 +- 0.04 b, and 185 Qsup(π) = 2.18 +- 0.02 b. In addition, muonic X-rays from 181 Ta were observed; using the same methods for determining the quadrupole moments as above, a value of 181 Qsup(μ) = 3.28 +- 0.06 b was obtained, in good agreement with earlier published data. (orig.)

  5. Fundamental and Applied Bioorganometallic Chemistry of Technetium and Rhenium

    International Nuclear Information System (INIS)

    Alberto, R.; Braband, H.; Benz, M.; Can, D.; Imstepf, S.; Felber, M.; Spingler, B.

    2016-01-01

    Site directed accumulation is the base for therapy and imaging with inorganic medicinal compounds. To match selectively the structural properties of receptors, the topology of targeting complexes must be flexible and easily adaptable. For in vivo application, kinetic stability is desirable and in an advanced design, the complex itself can become part of the structure to be recognized by the receptor (3D structural space occupation concept).1 To match these requirements, we introduced the fac-{99mTcI(CO)3}+ building block many years ago. Many different complexes with this core were subjected to targeting studies and the organometallic chemistry of Tc developed rapidly beyond designs for molecular imaging. Some prominent examples will give insight into their structures and activities for molecular imaging. For complementing the fac-{99mTcI(CO)3}+ tag, we switched from low- to high-valent complexes. The isolobal fac-{99mTcVII(O)3}+ building block was introduced.2 Preparation of TcVII complexes is an example about how research is translated to routinely applicable conditions. For proceeding towards theranostics, homologous complexes with Re for therapy and with 99mTc complexes for imaging are mandatory. A new synthetic approach enabled the preparation of cyclopentadienyl complexes of both elements and based on pharmaceutically active lead structures.3 Newly introduced bis-arene complexes scopes at using these structures in analogy to ferrocene.4 The presentation exemplifies how questions from, ultimately practical, application lead to basic developments. Unexpected results in turn influence the discovery of new imaging and therapeutic agents.5 (1) Meggers, E. Curr. Opin. Chem. Biol. 2007, 11, 287. (2) Braband, H.; Tooyama, Y.; Fox, T.; Alberto, R. Chem. Eur. J. 2009, 15, 633. (3) Can, D.; Spingler, B.; Schmutz, P.; Mendes, F.; Raposinho, P.; Fernandes, C.; Carta, F.; Innocenti, A.; Santos, I.; Supuran, C. T.; Alberto, R. Angew. Chem. Int. Edit. 2012, 51, 3354. (4) Benz, M.; Braband, H.; Schmutz, P.; Halter, J.; Alberto, R. Chem. Sci. 2015, 6, 165. (5) S. Imstepf, S.; Pierroz, V.; Raposinho, P.; Bauwens, M.; Felber, M.; Fox, T.; Shapiro, A.B:; Freudenberg, R.; Fernandes, C.; Gama, S.; Gasser, G.; Motthagy, F.; Santos, I.R.; Alberto R. Bioconjugate Chem. 2015, DOI: 10.1021/acs.bioconjchem.5b00466 (author)

  6. Homogeneous deuterium exchange using rhenium and platinum chloride catalysts

    International Nuclear Information System (INIS)

    Fawdry, R.M.

    1979-01-01

    Previous studies of homogeneous hydrogen isotope exchange are mostly confined to one catalyst, the tetrachloroplatinite salt. Recent reports have indicated that chloride salts of iridium and rhodium may also be homogeneous exchange catalysts similar to the tetrachloroplatinite, but with much lower activities. Exchange by these homogeneous catalysts is frequently accompanied by metal precipitation with the termination of homogeneous exchange, particularly in the case of alkane exchange. The studies presented in this thesis describe two different approaches to overcome this limitation of homogeneous hydrogen isotope exchange catalysts. The first approach was to improve the stability of an existing homogeneous catalyst and the second was to develop a new homogeneous exchange catalyst which is free of the instability limitation

  7. Rhenium Uptake as Analogue 96Tc by Steel Corrosion Products

    International Nuclear Information System (INIS)

    K.M. Krupka; C.F. Brown; H. Todd Schaef; S. M. Heald; M. M. Valenta; B. W. Arey

    2006-01-01

    Static batch experiments were used to examine the sorption of dissolved perrhenate [Re(VII)], as a surrogate for pertechnetate [Tc(VII)], on corrosion products of A-516 carbon steel coupons contacted with synthetic groundwater or dilute water. After 109 days of contact time, the concentration of dissolved Re(VII) in the synthetic groundwater matrix decreased by approximately 26%; the dilute water matrix experienced a 99% decrease in dissolved Re(VII) over the same time period. Bulk x-ray diffraction (XRD) results for the corroded steel coupons showed that the corrosion products consisted primarily of maghemite, lepidocrocite, and goethite. Analyses of the coupons by scanning electron microscopy/energy dispersive spectroscopy (SEM/EDS) indicated that Re was present with the morphologically complex assemblages of Fe oxide/hydroxide corrosion products for samples spiked with the highest dissolved Re(VII) concentration (1.0 mmol/L) used for these experiments. Analyses of corroded steel coupons contacted with solutions containing 1.0 mmol/L Re(VII) by synchrotron-based methods confirmed the presence of Re sorbed with the corrosion product on the steel coupons. Analyses showed that the Re sorbed on these corroded coupons was in the +7 oxidation state, suggesting that the Re(VII) uptake mechanism did not involve reduction of Re to a lower oxidation state, such as +4. The results of our studies using Re(VII) as an analogue for 99 Tc(VII) suggest that 99 Tc(VII) would also be sorbed with steel corrosion products and that the inventory of 99 Tc(VII) released from breached waste packages would be lower than what is now conservatively estimated

  8. Nanostructured Tungsten Rhenium Components for Propulsion Systems, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Revolutionizing the space propulsion industry through innovative, relatively low-cost, manufacturing techniques is extremely needed. Specifically, advancements are...

  9. New ternary oxides with rhenium(4) of the perovskite structure

    Energy Technology Data Exchange (ETDEWEB)

    Jezowska-Trzebiatowska, B; Nowakowski, T; Mrozinski, J [Wroclaw Univ. (Poland)

    1978-01-01

    A series of ternary oxides described by general formula CaIrsub(x)Resub(1-x)O/sub 3/, where x 0.25; 0.33; 0.66; 0.75, has been obtained. The X-ray investigations have shown, that these compounds have a distorted perovskite structure. The proximal coordination sphere of Re/sup 4 +/ and Ir/sup 4 +/ ions constituted by an octahedron of oxide ions was confirmed by the IR spectra.

  10. QUANTUM CALCULATIONS OF ENERGETICS OF RHENIUM CLUSTERS IN TUNGSTEN

    Energy Technology Data Exchange (ETDEWEB)

    Setyawan, Wahyu; Nandipati, Giridhar; Roche, Kenneth J.; Kurtz, Richard J.; Wirth, Brian D.

    2015-09-22

    Density functional theory was employed to explore the energetic properties of clusters up to size 2 of Re in W. While WW<111> is the most stable intrinsic dumbbell, ReW<110> is more stable than ReW<111>. However, when they are trapped by a substitutional Re (Re_s), ReW<111> becomes more stable than ReW<110>. In this case, the most stable configuration forms a ReWRe crowdion with the W atom in between the Re atoms. Simulations of a ReW[111] (dumbbell’s vector is from Re to W) approaching a Re_s along [111] indicate that the binding energy decreases from 0.83 eV at the first nearest neighbor (NN1) to 0.10 eV at NN3 and ~0 at NN4. In addition, while ReW<111> and ReW<110> are stable near a Re_s at NN1, the ReW<100> instantaneously rotates toward ReW<111>.

  11. Preparation of rhenium-186 tin colloid as radio synovectomy agent

    International Nuclear Information System (INIS)

    Cecep T Rustendi; Martalena Ramli; M Subur

    2010-01-01

    Radio synovectomy is an alternative therapy besides surgery whereby a beta-emitting radiopharmaceutical is delivered into the affected synovial compartment in order to threat rheumatoid arthritis. One of radiopharmaceuticals that could be applied as radio synovectomy agent is 186 Re-Sn colloid. Preparation of 186 Re-Sn colloid has been carried out by searching the best condition of the reaction to obtain a high labeling efficiency (>95%), appropriate particle size and stable at room temperature. Preparation of 186 Re-Sn colloid has been done successfully using a mol ratio of Sn to Re with value 1000:1 (~50 mg SnCl 2 .2H 2 O) by heating for 90 minutes and resulting >95% labeling efficiency. Stability of 186 Re-Sn colloid was found to be good enough when it was stored at room temperature for 24 hours. The 186 Re-Sn colloid was also found to have an appropriate particle size for radiopharmaceutical agent for radio synovectomy. (author)

  12. Rhenium and Manganese-Catalyzed Selective Alkenylation of Indoles

    KAUST Repository

    Wang, Chengming; Rueping, Magnus

    2018-01-01

    An efficient rhenium‐catalyzed regioselective C‐H bond alkenylation of indoles is reported. The protocol operates well for internal as well as terminal alkynes, affording products in good to excellent yields. Furthermore, a manganese catalyzed, acid free, regioselective C2‐alkenylation of indoles with internal alkynes is described. The directing groups can be easily removed after the reaction and the resulting products can be used as valuable building blocks for the synthesis of diverse heterocyclic compounds.

  13. Surface-Cycling of Rhenium and its Isotopes

    Science.gov (United States)

    2009-06-01

    25.20 40.6861 -74.0386 Profile 2, 2006/06/06 † Station 1 8.7 8.8 1.69 27000 1,450 41.0437 -73.8807 Station 2 8.2 7.1 1.15 18400 1,000 41.0840 -73.8840...Birck, J. L., Herzig, P. M., and Hofmann, A. W. (1998), Os iso - topic composition and Os and Re distributions in the active mound of the TAG

  14. Rhenium(V) Complexes Containing Mono- and Tridentate Imido ...

    African Journals Online (AJOL)

    NICO

    via the imido nitrogen and deprotonated acetoxy oxygen.8. We have now .... tronic energy gaps between the filled and empty orbitals have been obtained with the ..... for 1 and 2 and these were optimized in a singlet state with the. B3LYP and ...

  15. Liposomes as carriers of the beta-emitters rhenium-186 and rhenium-188 for use in radiotherapy

    International Nuclear Information System (INIS)

    Haefeli, U.

    1989-01-01

    The two radioisotopes Re-186 and Re-188 are highly favoured as therapeutic nuclides in nuclear medicine due to their unique radiation characteristics. For application in future (e.g. radiosynoviorthesis of the knee) we have chosen liposomes as biodegradable and non-irriting carriers. They were filled with radioactive Re in therapeutic doses of >370 MBq (10 mCi). 1. Small unilamellar liposomes (SUV's) of an average size of 28 nm were prepared by ultrasonic irradiation. They encapsulated only 0.64% of the perrhenate. 2. Liposomes carrying DTPA-SA in their bilayer (SA=octadecylamine) were produced in order to form a complex with Tc and Re. Technetium was complexed in high yield and the Tc-DTPA-liposome bindings were found to be stable when tested by dialysis. Similar attempts to complex Re were not successful because the amount of Sn(+II) required for the reduction was so high that the liposomes were destroyed. 3. Methylthiosemicarbazide (mts) was coupled covalently to aminomethylpolystyrene. These spheres were used as a very convenient and simple model for testing the labelling-yield and the stability of the Re-mts-complex. 4. Two isomers of the complex ReO(OEt)Cl 2 (PPh 3 ) 2 (Rephos) were characterized. These highly lipid-soluble inactive complexes were irradiated by neutrons and then used to prepare a mixed micelle with egg yolk lecithin and the detergent sodium deoxycholate. Liposomes were produced in a size of 60-80 nm in a very simple way by gelfiltration. Up to 53.5% of the radioactive Rephos was incorporated. Monitoring the stability by dialysis an initial loss of 10-15% and subsequent linear decrease were observed. The daily loss could be reduced to 1.0% by the addition of ascorbic acid. After 8 days, 82% of the initial activity still remained in the vesicles. 5. [ReO 2 (en) 2 ]Cl.2H 2 O and [ReO 2 (1,4,8,11-tetraazaundecane)]Cl were synthesized and characterized. 6. A direct enzymatic method to determine the remaining cholate in liposomes was developed, requiring only a simple dilution step. (author) 17 figs., 19 tabs., 111 refs

  16. Rhenium and technetium: application of organometallic rhenium and technetium complexes in radiopharmacy. Evaluation of optimal anchor groups

    International Nuclear Information System (INIS)

    Alberto, R.; Schibli, R.; Egli, A.; Schaffland, A.; Rattat, D.; Mueller, J.; Iftimia, M.; Berke, H.; Kaden, T.A.; Abram, U.

    1997-01-01

    The coordinative properties of the '[fac-M(CO) 3 ] + ' moiety (M= 188 Re, Re, 99 Tc and 99m Tc) have been investigated in water and organic solvents in order to evaluate the anchor group attached to antibodies, small peptides and biologically active molecules. The preparation of [M(OH 2 ) 3 (CO) 3 ] + has been improved in a way that this complex can be prepared from a Kit formulation. The '[fac-M(CO) 3 ] + ' has been transformed to the '[fac-M(NO)(CO) 2 ] 2+ ' moiety to achieve higher direct labelling yields and faster incorporation kinetics. (author) 5 figs

  17. Godiva and Juliet Diagnostics CED-1 (IER-176)

    Energy Technology Data Exchange (ETDEWEB)

    Scorby, J C

    2011-12-21

    A suite of diagnostics are being proposed for use in the Juliet experiment (IER-128). In order to calibrate and test the diagnostics prior to use, the LLNL calibration facility and Godiva pulsed reactor will be used to provide intense sources of neutrons and gammas. Due to the similarities of the Godiva and Juliet radiation fields, the diagnostics being developed and tested for Juliet can also play an on-going role in diagnostics for Godiva as well as, perhaps, other critical assembly experiments. Similar work is also being conducted for IER-147 for the purpose of characterizing the Godiva radiation field in support of an upcoming international nuclear accident dosimetry exercise. Diagnostics developed and fielded under IER-147 can provide valuable data with respect to the neutron and gamma energy spectrums in the vicinity of Godiva which is relevant to the calibration of Juliet diagnostics.

  18. 37 CFR 1.76 - Application data sheet.

    Science.gov (United States)

    2010-07-01

    ... includes the correspondence address, which may be indicated by reference to a customer number, to which... title of the invention, a suggested classification, by class and subclass, the Technology Center to... application, the type of application (e.g., utility, plant, design, reissue, provisional), whether the...

  19. 46 CFR 176.402 - Initial inspection for certification.

    Science.gov (United States)

    2010-10-01

    ..., spars, rigging, sails, piping, main and auxiliary machinery, pressure vessels, steering apparatus... make the vessel available for all applicable inspections discussed in this paragraph, and in Subpart H...

  20. 46 CFR 176.404 - Subsequent inspections for certification.

    Science.gov (United States)

    2010-10-01

    ..., and on a sailing vessel, rigging and sails. The owner or operator must conduct all tests as required by the OCMI, and make the vessel available for all specific inspections and drills required by...

  1. All projects related to | Page 176 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Region: Cambodia, Far East Asia, Central Asia, South Asia ... assumed that the cost of tobacco-related disease to national economies and households is ... An investigation into the determinants of business performance in Francophone Africa.

  2. 40 CFR 180.176 - Mancozeb; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... Asparagus (negligible residue) 0.1 Banana 4.0 Banana, pulp 0.5 Barley, bran 20 Barley, flour 20 Barley..., straw 25 Onion, bulb 0.5 Papaya (whole fruit with no residue present in the edible pulp after the peel...

  3. 46 CFR 160.176-15 - Production tests and inspections.

    Science.gov (United States)

    2010-10-01

    ... known weight and winch, (B) a scale, winch, and fixed anchor, or (C) a tensile test machine that is... laboratory inspector tests and inspects the lot; (ii) Perform required testing of each incoming lot of... produced the components used in the lifejacket. (d) Samples. (1) Samples used in testing and inspections...

  4. 49 CFR 176.600 - General stowage requirements.

    Science.gov (United States)

    2010-10-01

    ... POISON label, being transported on a vessel, must be stowed clear of living quarters and any ventilation ducts serving living quarters and separated from foodstuffs, except when the hazardous materials and the.... (c) Each package bearing a POISON label displaying the text “PG III” or bearing a “PG III” mark...

  5. 49 CFR 176.800 - General stowage requirements.

    Science.gov (United States)

    2010-10-01

    ... must be stowed clear of living quarters, and away from foodstuffs and cargo of an organic nature. (b) A...) which also bears a FLAMMABLE LIQUID label must be stowed away from all sources of heat and ignition...

  6. 40 CFR 63.176 - Quality improvement program for pumps.

    Science.gov (United States)

    2010-07-01

    ... type (e.g., piston, horizontal or vertical centrifugal, gear, bellows); pump manufacturer; seal type... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Quality improvement program for pumps... improvement program for pumps. (a) In Phase III, if, on a 6-month rolling average, the greater of either 10...

  7. Low lying magnetic dipole strength distribution in 176Hf

    International Nuclear Information System (INIS)

    Kuliev, A. A.; Ertugral, F.; Yakut, H.; Bektasoglu, M.; Guliyev, E.

    2006-01-01

    In this study the scissors mode 1 + states are systematically investigated within the rotational invariant Quasiparticle Random Phase Approximation (QRPA) for 1 76Hf isotopes. We consider the 1 + vibrations generated by the isovector spin-spin interactions and the isoscalar (h 0 ) and isovector (h 1 ) quadrupole type separable forces restoring the broken symmetry by a deformed mean field. It has been shown that restoration of the broken rotational symmetry of the Hamiltonian essentially decreases the B(M1) value of the low lying 1 + states and increases the collectivization of the scissors mode excitations in the spectroscopic energy region. Agreement between the calculated mean excitation energies as well as the summed B(M1) value of the scissors mode excitations and the available experimental data of 1 76Hf is rather good. For instance, distributions of the calculated B(M1) transition strengths in the 1 76 Hf isotopes with respect to K π =1 + excitations is represented in Figure. Thus, we see that the models which use the Hamiltonian with broken rotational symmetry strongly overestimate the M1 strength at low energy. These results indicate an importance of the models which are free from the low-energy spurious states. The marked differences between the results for 1 + states, calculated in rotational invariant (RI) and non-rotational invariant (NRI) model indicate the importance of the approaches which are free from spurious low-energy solutions. A separation of the rotational state from the 1 + states changes somewhat the distribution of the B(M1) strength in the spectroscopic energy region and increases the fragmentation of the scissors mode 1 + excitations in agreement with the experimental data

  8. What we do | Page 176 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    AIDS Review 2005 : What's Cooking? ... de la Información - REDIS/DIRSI) is a multidisciplinary network that supports effective participation in ... Middle East, North Of Sahara, South Of Sahara, Central Asia, Far East Asia, South Asia ... consumer goods, marketing services, financial services, and other goods and services.

  9. Dicty_cDB: CHQ176 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vv*lipqsilmi tmpvqlmhvqkkvv*lilqsilmitmlvpltpvhhqlafptpqltvmivihvp*thvqiq pvvatlqsmlmiiihvl*ihvpnqqvslipqsm*...lqsmlmiiihvpsmpvpnqqvllipqsm*mittnvqlmhvpkkvv*lipqsilmi tmpvqlmhvqkkvv*lilqsilmitmlvpltpvhhqlafptpqltvmivihv

  10. 32 CFR 176.35 - HUD's review of the application.

    Science.gov (United States)

    2010-07-01

    ... other existing housing, social service, community economic, or other development plans adopted by the... to the expressed interest and requests of representatives of the homeless, whether the application... communities in the vicinity of the installation. (2) Impact of notices of interest. Takes into consideration...

  11. 46 CFR 160.176-13 - Approval Tests.

    Science.gov (United States)

    2010-10-01

    ... paragraph (b)(1) of this section is repeated with each subject wearing an insulated, hooded parka and gloves... and in the second test, parka and gloves. (c) Inflation Testing. No second stage donning is allowed in... platform using only his or her hands on the top of the platform as an aid and without pushing off of the...

  12. 21 CFR 176.120 - Alkyl ketene dimers.

    Science.gov (United States)

    2010-04-01

    ..., processing, preparing, treating, packaging, transporting, or holding food, subject to the provisions of this... paperboard. (c) The alkyl ketene dimers may be used in the form of an aqueous emulsion which may contain...

  13. What we do | Page 176 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Community Based Natural Resource Management in the Greater Limpopo Trans ... Foreign Direct Investment Behaviour in Low and Middle Income Countries ... Central Asia, Far East Asia, South Asia, Cambodia, China, Indonesia, Viet Nam, ...

  14. 49 CFR 176.805 - On deck stowage.

    Science.gov (United States)

    2010-10-01

    ... for leakage from any package to drain away from other cargo into an overboard scupper or freeing port... stowage is not practical, sufficient clean dry sand must be placed under and around the lower tier of...

  15. 21 CFR 176.200 - Defoaming agents used in coatings.

    Science.gov (United States)

    2010-04-01

    ...-(Dinonylphenyl)-ω-hydroxy-poly(oxy-1,2-ethanediyl), containing 7 to 24 moles of ethylene oxide per mole of... palmitate Mineral oil Mustardseed oil, sulfated, ammonium, potassium, or sodium salt Myristyl alcohol... the intended effect, which is to prevent or control the formation of foam. (2) The defoaming agents...

  16. 7 CFR 17.6 - Discounts, fees, commissions and payments.

    Science.gov (United States)

    2010-01-01

    ... the supplier; (ii) Give the supplier a competitive advantage in relation to other potential suppliers... anything given in return for any consideration, services, or benefits received or to be received. (a... acted as a selling agent to obtain a contract even though the payment may be for services performed that...

  17. 1935 15' Quad #176 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  18. What we do | Page 176 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This knowledge can be used as a tool for addressing pressing global challenges. We share ... Middle East, Central Asia, Far East Asia, South Asia, Peru, South Africa ... Foreign Direct Investment Behaviour in Low and Middle Income Countries.

  19. Lymphoscintigraphic diagnosis of the lymph node metastasis of esophageal cancer

    International Nuclear Information System (INIS)

    Terui, Shoji; Kawai, Hideo; Hirashima, Toshio; Yamaguchi, Hajime; Kato, Hoichi; Iizuka, Norifumi

    1985-01-01

    Lymphoscintigraphy with 99m Tc-labeled rhenium sulfur colloid was performed preoperatively in 30 patients with esopohageal cancer. It showed hot nodes in a total of 267 lymph nodes, 176 mediastinal nodes and 91 celiac artery nodes. Of these 267 nodes, 47 (18 %) were found to have metastasis, including 34 (19 %) mediastinal nodes and 13 (14 %) celiac artery nodes. On the other hand, the number of non-visualized lymph nodes (cold nodes) was 542. Of them, 78 (14 %) had metastasis; 46 (15 %) were mediastinal nodes and 32 (14 %) were celiac artery nodes. (Namekawa, K.)

  20. Effect of rhenium injection methods on emission characteristics of metalloceramic alloys

    International Nuclear Information System (INIS)

    Ostach, E.M.; Redega, K.P.; Savranskaya, E.S.; Chapajkina, L.A.

    1975-01-01

    Ni-29% Re-3.6% BaBe 3 O 5 pseudoalloy prepared by chemical mixing had a higher secondary electron emission coefficient than the same alloy prepared by mechanical mixing. This is apparently due to more uniform distribution of Re and BaBe 3 O 5 in the former case. In the chemical mixing method, rhenic acid and Ni, Ba, and Be nitrates were the starting materials. The metals were precipitated by means of (NH 4 ) 2 CO 3 . The precipitate was filtered out, dried, and partially reduced in H to give a fine powder containing the desired amounts of Ni, Re, and uniformly dispersed BaBe 3 O 5 . In the mechanical mixing method, Ni powder (8-10 μm), coarse Re powder (40-60 μm) or fine Re powder ( 3 O 5 obtained by preliminary calcining of a mixture of BaCO 3 and BeO were mixed

  1. Chemical reactivity of analogous technetium(V) and rhenium(V) dioxo complexes

    International Nuclear Information System (INIS)

    Kremer, C.; Kremer, E.; Leon, A.

    1993-01-01

    All complexes of the series [MO 2 L 2 ] + (M = Tc, Re, L = ethylenediamine (en), 1,3-diaminopropane (1,3-dap)) have been synthesized and their chemical reactivities investigated. The following properties were studied: stability of the aqueous solutions at different pH values, substitution kinetics, lipophilicity and protein binding. The complexes show very similar reactivity in aqueous solution. From a radiopharmaceutical point of view, no significant difference in their in vivo behavior is expected. (author) 12 refs.; 1 fig.; 3 tabs

  2. Tungsten-188/carrier-free rhenium-188 perrhenic acid generator system

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.; Lisic, E.C.; Mirzadeh, S.; Callahan, A.P.

    1993-01-01

    A generator system for providing a carrier-free radioisotope in the form of an acid comprises a chromatography column in tandem fluid connection with an ion exchange column, the chromatography column containing a charge of a radioactive parent isotope. The chromatography column, charged with a parent isotope, is eluted with an alkali metal salt solution to generate the radioisotope in the form of an intermediate solution, which is passed through the ion-exchange column to convert the radioisotope to a carrier-free acid form

  3. Preliminary results of transarterial rhenium-188 HDD lipiodol in the treatment of inoperable primary hepatocellular carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Sundram, Felix [Nuclear Medicine Department (The PET Centre), Singapore General Hospital, Block 2 Basement 1, Outram Road, 169608 (Singapore); Chau, Tran Chi Minh [Nuclear Medicine Department, Cho Ray Hospital, Ho Chi Minh City (Viet Nam); Onkhuudai, Peljee [Nuclear Medicine Department, First Central University Hospital, Ulaanbatax (Mongolia); Bernal, Patricia [Nuclear Medicine Department, Fundacion Santa Fe, Bogota (Colombia); Padhy, Ajit Kumar [Division of Human Health, International Atomic Energy Agency, Vienna (Austria)

    2004-02-01

    The radioconjugate was prepared by using an HDD (4-hexadecyl 1-2,9,9-tetramethyl-4,7-diaza-1,10-decanethiol) kit, and lipiodol. Over a period of 18 months, 70 patients received at least one treatment of radioconjugate. Some patients were re-treated if there was no evidence of disease progression. The level of radioconjugate administered was based on radiation-absorbed dose to critical normal organs, calculated following a ''scout'' dose of radioconjugate. The organs at greatest risk for radiation toxicity are the normal liver, the lung and the bone marrow. An Excel spreadsheet was used to determine maximum tolerated activity (MTA), defined as the amount of radioactivity calculated to deliver no more than 12 Gy to lungs, or 30 Gy to liver, or 1.5 Gy to bone marrow. Patients were followed for at least 12 weeks after therapy, until recovery from all toxicity. The clinical parameters evaluated included toxicity, response as determined by contrast-enhanced CT, palliation of symptoms, overall survival, performance status (Karnofsky) and hepatic function (Child's classification). Liver function tests, serum {alpha}-fetoprotein (AFP) levels and complete blood counts were done at each follow-up visit. In the majority of patients, the scout dose studies indicated the radiation absorbed dose to normalliver to be the limiting factor to the treatment dose, while in a few patients dose to lung was the limiting factor. Radiation dose to bone marrow was negligible and was thus not a factor for the MTA calculations. Side-effects were minimal and usually presented as loss of appetite, right hypochondrial discomfort and low-grade fever, even at high levels of administered radioactivity. The symptoms resolved with simple supportive therapy within 3 days of onset. Liver function tests at 24 and 72 h showed no significant changes and complete blood counts at 1 week, 4 weeks and 12 weeks showed no changes (no bone marrow suppression). Sixteen patients were treated in the dose escalation phase of the study, when the activities administered started at 1.8 GBq (50 mCi) and rose to 7.7 GBq (206 mCi). In the efficacy phase of the study a further 54 patients were treated. Both groups of patients are included in this paper. The treatment activity of {sup 188}Re-lipiodol administered transarterially ranged from 1.8 to 9.8 GBq (50-265 mCi), with a mean activity of 4.6 GBq (124 mCi). Survival at 3 months was 90%, and at 6 months, 60%; 19% survived for 1 year. Mean survival after treatment in the total treated group of 70 patients was 9.5 months, with a range of 1-18 months. The results of the study show that {sup 188}Re-lipiodol is a safe and cost-effective method to treat primary HCC via the transarterial route. (orig.)

  4. Electrochemical properties of manganese and rhenium complexes with organic redox ligands

    Energy Technology Data Exchange (ETDEWEB)

    Bumberg, A.A.; Milaev, A.G.; Okhlobystin, O.Yu.

    1983-03-01

    Pyrilium salts, 4H-pyrans and phenols that contain sigma-bound groups M(CO)/sub 3/ (M=Mn, Re) are investigated using the methods of classic and commutated polarography, disc rotating electrode with a ring and cyclic voltamperometry. The first single electron stage of electrochemical reduction of pyrilium cations containing sigma-bound substitutuents ..pi..=C/sub 5/H/sub 4/M(CO/sub 3/) (M=Mn, Re) takes place without any rupture of metal-carbon bonds and brings about rather stable vacant, metal organic radicals. Electrochemical dehydration of appropriate 4H-pyrans takes place through a stage of formation of these vacant radicals and complexes with the formation of metal organic pyrilium cations. Electrochemical oxidation of spatially hindrance phenols containing in 4-th position ..pi..-C/sub 5/H/sub 4/Re(CO/sub 3/) and C/sub 5/H/sub 4/Mn(CO)/sub 2/P(Ph)/sub 3/ substitutes takes place with the formation of appropriate cation radicals as intermediates and brings about vacant phenoxyls that contain charged organometallic group.

  5. The Oxidation of Rhenium(III) by Dioxygen in the Presence of Tri ...

    African Journals Online (AJOL)

    NICO

    Both compounds were characterized by 1H NMR and infrared spectroscopy, and ... Microanalyses were obtained on a Carlo Erba EA 1108 elemental .... Spectral Characterization ... of this signal so far downfield indicates the existence of the.

  6. Chemistry of rhenium and technetium. II. Schiff base complexes with polyfunctional amino acids

    International Nuclear Information System (INIS)

    Du Preez, J.G.H.; Gerber, T.I.A.; Fourie, P.J.; Van Wyk, A.J.

    1984-01-01

    Amino acid Schiff base technetium(V) complexes of salicylaldehyde with l-cysteine, l-serine, l-histodine, l-threonine, l-glutamic acid and l-tryptophan have been preapred by direct reaction and by constituent combination. The amino acid part of the ligands coordinates to the technetium through the carboxylate group, while the other available functional group of the amino acids plays a more minor role as blocking group or in intramolecular bonding. 3 tables

  7. Dehydrogenation of light alkanes over rhenium catalysts on conventional and mesoporous MFI supports

    DEFF Research Database (Denmark)

    Rovik, Anne Krogh; Hagen, Anke; Schmidt, I.

    2006-01-01

    Recently, Re/HZSM-5 (Si/Al = 15) was shown to be an efficient catalyst for ethane dehydrogenation and aromatization at 823 K and atmospheric pressure. In this reaction, the major initial products were benzene, toluene and xylene (BTX), but increasing amounts of ethene were produced with time...

  8. Octachloro- And Octabromoditechnetate(III) And Their Rhenium(III) Congeners

    International Nuclear Information System (INIS)

    Poineau, F.; Sattelberger, A.P.; Conradson, S.D.; Czerwinski, K.R.

    2008-01-01

    The compound (n-Bu 4 N) 2 Tc 2 Br 8 was prepared by the metathesis of (n-Bu 4 N) 2 Tc 2 Cl 8 with HBr (g) in dichloromethane and characterized by X-ray absorption fine structure spectroscopy and UV-vis spectroscopy. Analysis of the data gives a Tc-Tc distance of 2.16(1) (angstrom) and a Tc-Br distance of 2.48(1) (angstrom). The Tc(III) oxidation state was inferred by the position of the edge absorption, which reveals a shift of 12 eV between (n-Bu 4 N) 2 Tc 2 Br 8 and NH 4 TcO 4 . The analogous shift between (n-Bu 4 N) 2 Tc 2 Cl 8 and NH 4 TcO 4 is 11 eV. The UV-vis spectrum of Tc 2 Br 8 2- in dichloromethane exhibits the characteristic (delta) → (delta)* transition at 13717 cm -1 . The M 2 X 8 2- (M = Re, Tc; X = Cl, Br) UV-vis spectra are compared, and the position of the (delta) → (delta)* transition discussed

  9. Platinum–Rhenium synergy on reducible oxide supports in aqueous-phase glycerol reforming

    NARCIS (Netherlands)

    Ciftci, A.; Eren, S.; Ligthart, D.A.J.M.; Hensen, E.J.M.

    2014-01-01

    A significant support effect was observed for the aqueous-phase reforming (APR) of glycerol over a series of Pt- and PtRe-loaded ceria-, ceria–zirconia-, zirconia-, and titania-supported catalysts. Glycerol conversion rates decreased in the order Pt/TiO2>Pt/ZrO2>Pt/CeZrO2>Pt/CeO2. Upon addition of

  10. Impact of triaxiality on the rotational structure of neutron-rich rhenium isotopes

    Directory of Open Access Journals (Sweden)

    M.W. Reed

    2016-01-01

    Full Text Available A number of 3-quasiparticle isomers have been found and characterised in the odd-mass, neutron-rich, 187Re, 189Re and 191Re nuclei, the latter being four neutrons beyond stability. The decay of the isomers populates states in the rotational bands built upon the 9/2−[514] Nilsson orbital. These bands exhibit a degree of signature splitting that increases with neutron number. This splitting taken together with measurements of the M1/E2 mixing ratios and with the changes observed in the energy of the gamma-vibrational band coupled to the 9/2−[514] state, suggests an increase in triaxiality, with γ values of 5°, 18° and 25° deduced in the framework of a particle-rotor model.

  11. Preliminary results of transarterial rhenium-188 HDD lipiodol in the treatment of inoperable primary hepatocellular carcinoma

    International Nuclear Information System (INIS)

    Sundram, Felix; Chau, Tran Chi Minh; Onkhuudai, Peljee; Bernal, Patricia; Padhy, Ajit Kumar

    2004-01-01

    The radioconjugate was prepared by using an HDD (4-hexadecyl 1-2,9,9-tetramethyl-4,7-diaza-1,10-decanethiol) kit, and lipiodol. Over a period of 18 months, 70 patients received at least one treatment of radioconjugate. Some patients were re-treated if there was no evidence of disease progression. The level of radioconjugate administered was based on radiation-absorbed dose to critical normal organs, calculated following a ''scout'' dose of radioconjugate. The organs at greatest risk for radiation toxicity are the normal liver, the lung and the bone marrow. An Excel spreadsheet was used to determine maximum tolerated activity (MTA), defined as the amount of radioactivity calculated to deliver no more than 12 Gy to lungs, or 30 Gy to liver, or 1.5 Gy to bone marrow. Patients were followed for at least 12 weeks after therapy, until recovery from all toxicity. The clinical parameters evaluated included toxicity, response as determined by contrast-enhanced CT, palliation of symptoms, overall survival, performance status (Karnofsky) and hepatic function (Child's classification). Liver function tests, serum α-fetoprotein (AFP) levels and complete blood counts were done at each follow-up visit. In the majority of patients, the scout dose studies indicated the radiation absorbed dose to normalliver to be the limiting factor to the treatment dose, while in a few patients dose to lung was the limiting factor. Radiation dose to bone marrow was negligible and was thus not a factor for the MTA calculations. Side-effects were minimal and usually presented as loss of appetite, right hypochondrial discomfort and low-grade fever, even at high levels of administered radioactivity. The symptoms resolved with simple supportive therapy within 3 days of onset. Liver function tests at 24 and 72 h showed no significant changes and complete blood counts at 1 week, 4 weeks and 12 weeks showed no changes (no bone marrow suppression). Sixteen patients were treated in the dose escalation phase of the study, when the activities administered started at 1.8 GBq (50 mCi) and rose to 7.7 GBq (206 mCi). In the efficacy phase of the study a further 54 patients were treated. Both groups of patients are included in this paper. The treatment activity of 188 Re-lipiodol administered transarterially ranged from 1.8 to 9.8 GBq (50-265 mCi), with a mean activity of 4.6 GBq (124 mCi). Survival at 3 months was 90%, and at 6 months, 60%; 19% survived for 1 year. Mean survival after treatment in the total treated group of 70 patients was 9.5 months, with a range of 1-18 months. The results of the study show that 188 Re-lipiodol is a safe and cost-effective method to treat primary HCC via the transarterial route. (orig.)

  12. A new series of rhenium VII compounds: sodium-rare earth perrhenates

    International Nuclear Information System (INIS)

    Slimane, Z.A.A.; Silvestre, J.-P.; Freundlich, William

    1978-01-01

    Synthesis by solid state reaction or in aqueous solution and radiocrystallographical study of the hexagonal sodium-rare earth perrhenates NaLn(ReO 4 ) 4 (Ln=La, Nd, Sm, Eu, Gd, Er) and of the tetragonal tetrahydrates NaLn(ReO 4 ) 4 , 4H 2 O (Ln=Eu, Gd, Er, Lu) [fr

  13. Study of oxygenated compounds of rhenium VII: actinide perrhenates, molybdo- and tungstoperrhenates

    International Nuclear Information System (INIS)

    Silvestre, J.-P.

    1978-01-01

    Crystallographic data for the perrhenates of the actinides and their hydrates. Study of the thermal stability of the perrhenates of the actinides. Double perrhenates of thorium and monovalent elements: Th 5 M 2 (ReO 4 ) 22 , ThM(ReO 4 ) 5 , ThM 2 (ReO 4 ) 6 with M = Na, K, Rb, Cs and Tl; ThM 3 (ReO 4 ) 7 with M=K, Rb, Cs and Tl are showing up in the study of the systems Th(ReO 4 ) 4 -M(ReO 4 ). Study of the possibilities of substitution Re 7+ -Mo 6+ and Re 7+ -W 6+ : non stoechiometric cubic compounds Thsub(1/2-x/4)(Msub(1-x)Resub(x)O 4 ) with 1/6 3 (MO 4 )(ReO 4 ) (M = Mo, W) are disclosed [fr

  14. Tungsten-zirconium carbide-rhenium alloys with extraordinary thermal stability

    Energy Technology Data Exchange (ETDEWEB)

    Yang, X.D. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Xie, Z.M.; Miao, S. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Liu, R.; Jiang, W.B. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Zhang, T., E-mail: zhangtao@issp.ac.cn [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Wang, X.P., E-mail: xpwang@issp.ac.cn [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Fang, Q.F. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Liu, C.S., E-mail: csliu@issp.ac.cn [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Luo, G.N. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Liu, X. [Southwest Institute of Plasma Physics, Chengdu (China)

    2016-05-15

    The low recrystallization temperature (1200 °C) of pure W is a serious limitation for application as facing plasma materials in fusion reactor. In this paper, W-0.5wt.%ZrC-1wt.%Re (WZR) alloy with recrystallization temperature up to 1800 °C was prepared by mechanical milling and spark plasma sintering. The grain size of WZR alloy is about 2.6 μm, smaller than that of pure W (4.4 μm), which keeps unchanged until the annealing temperature increases to 1800 °C. Tensile tests indicate that the WZR alloys exhibit excellent comprehensive properties: the ductile to brittle transition temperature of WZR is in the range from 400 °C to 500 °C, about 200 °C lower than that of pure W prepared by the same process; the total elongation (TE) of WZR at 600 °C is above 30%, which is about 2 times that of pure W (at 700 °C). Meanwhile its tensile strength keeps ∼450 MPa before and after 1800 °C annealing as well as its TE increases after annealing. WZR alloy exhibits higher hardness (489HV) than that of pure W (453HV) at room temperature. Microstructure analysis indicates that the strengthening of nano-sized ZrC particles dispersion and Re solid solution improve tensile properties and thermal stability of WZR alloy.

  15. Synergistic effect of rhenium and ruthenium in nickel-based single-crystal superalloys

    Energy Technology Data Exchange (ETDEWEB)

    Yu, X.X. [Department of Physics, Tsinghua University, Beijing 100084 (China); Department of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Wang, C.Y., E-mail: cywang@mail.tsinghua.edu.cn [Department of Physics, Tsinghua University, Beijing 100084 (China); Central Iron and Steel Research Institute, Beijing 100081 (China); Zhang, X.N. [Institute of Microstructure and Property of Advanced Materials, Beijing University of Technology, Beijing 100124 (China); Yan, P. [Central Iron and Steel Research Institute, Beijing 100081 (China); Zhang, Z., E-mail: zezhang@zju.edu.cn [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China)

    2014-01-05

    Highlights: • Re and Ru synergistic effects in nickel-based superalloys are investigated. • The Al site occupation of Re atom in the γ′ phase is observed directly. • The addition of Ru results in the repartitioning of Re to γ phase. -- Abstract: The microstructures of ternary Ni–Al–Re and quaternary Ni–Al–Re–Ru single-crystal alloys were investigated at atomic and electronic levels to clarify the synergistic effect of Re and Ru in nickel-based single-crystal superalloys. In the Ni–Al–Re alloy, it was directly observed that Re atom occupied the Al site of γ′ phase. In the Ni–Al–Re–Ru alloy, the mechanisms of Re repartition between γ and γ′ phases were proposed. In the dendritic cores, high concentrations of Re exceeded the solubility limit of γ′ phase and partitioned to γ phase, which led to the homogenization. In the interdendritic regions, Ru resulted in the repartitioning of Re to γ phase which was proved by transmission electron microscopy and first-principles calculations.

  16. High temperature strengthening mechanism of hafnium carbide in a tungsten-rhenium matrix

    International Nuclear Information System (INIS)

    Luo, A.; Shin, K.S.; Jacobson, D.L.

    1991-01-01

    The interrelationship between the testing temperature and HfC strength increment of an arc-melted W-3.6Re-0.4HfC was determined from 1950 K to 2980 K in a vacuum of better than 1.3x10 -5 Pa (10 -7 torr). The present research was focused on the characteristic temperature at which the rapid coarsening of HfC particles occurred and the effect of the second-phase particle size on the high temperature strength properties of this material. It was found that the HfC particle strengthening was effective in a W-Re matrix up to a characteristic temperature of 2450 K in the short-term tensile test. Carbon was found to be the rate-limiting solute in the HfC particle growth. The strength of HfC strengthened alloy at temperature above 0.5 T m is proportional to the square root of particle volume fraction. The yield strengths of W-3.6Re-0.26HfC calculated based on the particle statistical distribution had good agreement with the experimental values from 1950 K to 2980 K. Besides, an addition of 0.26 percent HfC in tungsten resulted in about 28 percent increase in the activation energy of plastic deformation at high temperatures

  17. A rhenium complex doped in a silica molecular sieve for molecular oxygen sensing: Construction and characterization.

    Science.gov (United States)

    Yang, Xiaozhou; Li, Yanxiao

    2016-01-15

    This paper reported a diamine ligand and its Re(I) complex for potential application in oxygen sensing. The novelty of this diamine ligand localized at its increased conjugation chain which had a typical electron-withdrawing group of 1,3,4-oxadiazole. Electronic distribution of excited electrons and their lifetime were supposed to be increased, favoring oxygen sensing collision. This hypothesis was confirmed by single crystal analysis, theoretical calculation and photophysical measurement. It was found that this Re(I) complex had a long-lived emission peaking at 545 nm, favoring sensing application. By doping this complex into a silica matrix MCM-41, oxygen sensing performance and mechanism of the resulting composites were discussed in detail. Non-linear Stern-Volmer working curves were observed with maximum sensitivity of 5.54 and short response time of ~6 s. Copyright © 2015 Elsevier B.V. All rights reserved.

  18. Melanoma Therapy with Rhenium-Cyclized Alpha Melanocyte Stimulating Hormone Peptide Analogs

    Energy Technology Data Exchange (ETDEWEB)

    Thomas P Quinn

    2005-11-22

    Malignant melanoma is the 6th most commonly diagnosed cancer with increasing incidence in the United States. It is estimated that 54,200 cases of malignant melanoma will be newly diagnosed and 7,600 cases of death will occur in the United States in the year 2003 (1). At the present time, more than 1.3% of Americans will develop malignant melanoma during their lifetime (2). The average survival for patients with metastatic melanoma is about 6-9 months (3). Moreover, metastatic melanoma deposits are resistant to conventional chemotherapy and external beam radiation therapy (3). Systematic chemotherapy is the primary therapeutic approach to treat patients with metastatic melanoma. Dacarbazine is the only single chemotherapy agent approved by FDA for metastatic melanoma treatment (5). However, the response rate to Dacarbazine is only approximately 20% (6). Therefore, there is a great need to develop novel treatment approaches for metastatic melanoma. The global goal of this research program is the rational design, characterization and validation of melanoma imaging and therapeutic radiopharmaceuticals. Significant progress has been made in the design and characterization of metal-cyclized radiolabeled alpha-melanocyte stimulating hormone peptides. Therapy studies with {sup 188}Re-CCMSH demonstrated the therapeutic efficacy of the receptor-targeted treatment in murine and human melanoma bearing mice (previous progress report). Dosimetry calculations, based on biodistribution data, indicated that a significant dose was delivered to the tumor. However, {sup 188}Re is a very energetic beta-particle emitter. The longer-range beta-particles theoretically would be better for larger tumors. In the treatment of melanoma, the larger primary tumor is usually surgically removed leaving metastatic disease as the focus of targeted radiotherapy. Isotopes with lower beta-energies and/or shorter particle lengths should be better suited for targeting metastases. The {sup 177}Lu-DOTA-Re(Arg11)CCMSH and {sup 212}Pb-DOTA-Re(Arg11)CCMSH complexes were developed and synthesized to investigate its ability to target and deliver an effective dose to small melanoma tumors and metastatic deposits. Dosimetry calculations for {sup 188}Re-CCMSH and {sup 212}Pb/{sup 212}Bi[DOTA]-Re(Arg11)CCMSH were compared in the B16/F1 mouse melanoma flank tumor model to analyze the delivered dose to tumor and normal organs.

  19. Melanome Therapy with Rhenium Cyclized Alpha Melanocyte Stimulating Hormone Peptide Analogs. Final report

    International Nuclear Information System (INIS)

    Quinn, Thomas P.

    2005-01-01

    Malignant melanoma is the 6th most commonly diagnosed cancer with increasing incidence in the United States. It is estimated that 54,200 cases of malignant melanoma will be newly diagnosed and 7,600 cases of death will occur in the United States in the year 2003 (1). At the present time, more than 1.3% of Americans will develop malignant melanoma during their lifetime (2). The average survival for patients with metastatic melanoma is about 6-9 months (3). Moreover, metastatic melanoma deposits are resistant to conventional chemotherapy and external beam radiation therapy (3). Systematic chemotherapy is the primary therapeutic approach to treat patients with metastatic melanoma. Dacarbazine is the only single chemotherapy agent approved by FDA for metastatic melanoma treatment (5). However, the response rate to Dacarbazine is only approximately 20% (6). Therefore, there is a great need to develop novel treatment approaches for metastatic melanoma. The global goal of this research program is the rational design, characterization and validation of melanoma imaging and therapeutic radiopharmaceuticals. Significant progress has been made in the design and characterization of metal-cyclized radiolabeled alpha-melanocyte stimulating hormone peptides. Therapy studies with 188 Re-CCMSH demonstrated the therapeutic efficacy of the receptor-targeted treatment in murine and human melanoma bearing mice (previous progress report). Dosimetry calculations, based on biodistribution data, indicated that a significant dose was delivered to the tumor. However, 188 Re is a very energetic beta-particle emitter. The longer-range beta-particles theoretically would be better for larger tumors. In the treatment of melanoma, the larger primary tumor is usually surgically removed leaving metastatic disease as the focus of targeted radiotherapy. Isotopes with lower beta-energies and/or shorter particle lengths should be better suited for targeting metastases. The 177 Lu-DOTA-Re(Arg11)CCMSH and 212 Pb-DOTA-Re(Arg11)CCMSH complexes were developed and synthesized to investigate its ability to target and deliver an effective dose to small melanoma tumors and metastatic deposits. Dosimetry calculations for 188 Re-CCMSH and 212 Pb/ 212 Bi[DOTA]-Re(Arg11)CCMSH were compared in the B16/F1 mouse melanoma flank tumor model to analyze the delivered dose to tumor and normal organs.

  20. Improved Rhenium Thrust Chambers for In-Space Propulsion, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — Radiation-cooled, bipropellant thrust chambers are being considered for the ascent/descent engines and reaction control systems for NASA missions such as Mars Sample...

  1. Synthesis and marking with technetium and rhenium of a new radiotracer from para-toluidine

    International Nuclear Information System (INIS)

    Laouini, Emna

    2011-01-01

    The development of nuclear medicine is based on the research of new radiotracers especially those which target the neuro degenerative diseases. In fact, the precocious diagnostic of these diseases using the radiopharmaceuticals is the only mean to defeat it. The biodistribution of a new cytectrene derivative from para-toluidine, having a lipophilic character and a low molecular weight, showed a new radiotracer which is able to clear the blood brain barrier and characterised with prolonged brain retention. The features of this complex contribute to make it a radiopharmaceutical to diagnostic aim in clinical use.

  2. Speciation of rhenium and radiogenic osmium in molybdenite by sensitive XAFS

    International Nuclear Information System (INIS)

    Takahashi, Y.

    2006-01-01

    For the speciation of trace elements in rocks and minerals, fluorescence XAFS using energy-dispersive Ge detector has been often used. By this method, however, high quality fluorescence XAFS cannot be obtained under intense scattering and/or fluorescence from other predominant elements in the samples. To deal with this problem, we developed a system for fluorescence XAFS using a bent crystal analyzer to selectively extract fluorescence x-rays of a target element. In this paper, speciation of Os in molybdenite has been studied as an example of the application. Radiometric dating using various radioactive decay systems has been widely applied to various terrestrial and extraterrestrial materials. Although the information is closely related to chemical stabilities of parent and daughter nuclides and the reliability of the radiometric dating, there have been few investigations on the direct identification of the chemical state of the daughter nuclides. In this study, we chose Re-Os system in molybdenite for the possible application of this idea, since initial abundance of Os in molybdenite is often negligible compared with radiogenic Os in molybdenite rich in Re. From XAFS spectra, we have investigated local structure of Re and Os in molybdenite. Details of the analyses will be given in the presentation. (author)

  3. Pharmacokinetics and normal organ dosimetry following intraperitoneal rhenium-186-labeled monoclonal antibody

    International Nuclear Information System (INIS)

    Breitz, H.B.; Durham, J.S.; Fisher, D.R.

    1995-01-01

    Pharmacokinetics, biodistribution and radiation dose estimates following intraperitoneal administration of a 186 Re-labeled murine antibody, NR-LU-10, were assessed in 27 patients with advanced ovarian cancer. Quantitative gamma camera imaging and gamma counting of serum and intraperitoneal fluid radioactivity were used to obtain data for dosimetry estimation. The MIRD intraperitoneal model was used to estimate dose to normal organs from radioactivity within the peritoneal cavity. The absorbed dose to normal peritoneum was estimated in two ways: from the gamma camera activity and peritoneal fluid samples. Serum activity peaked at 44 hr and depended on the concentration of radioactivity in the peritoneal fluid. Mean cumulative urinary excretion of 186 Re was 50% by 140 hr. Estimates of radiation absorbed dose to normal organs in rad/mCi administered (mean ± s.d.) were whole body 0.7 ± 0.3; marrow 0.4 ±0.1; liver 1.9 ±0.9; lungs 1.3 ± 0.7; kidneys 0.2 ± 0.2; intestine 0.2 ±0.2. Peritoneal surface dose estimates varied depending on the volume of fluid infused and the method of dose determination. Using gamma camera data, the peritoneal dose ranged for 7 to 36 rad/mCi. Using peritoneal fluid sample data, the dose ranged from 2 to 25 rad/mCi. Significant myelosuppression was observed at marrow doses above 100 rad. Noninvasive methods of dose estimation for intraperitoneal administration of radioimmunoconjugates provide reasonable estimates when compared with previously described methods. 31 refs., 6 figs., 2 tabs

  4. Dissociative chemisorption of N2 on Rhenium: Dynamics at high impact energies

    DEFF Research Database (Denmark)

    Henriksen, Niels Engholm; Billing, Gert D.; Hansen, Flemming Yssing

    1990-01-01

    forcing model. It is found that the energy transfer from the molecule to the phonons of the crystal is very significant. The smaller than unity dissociative sticking probability found experimentally even at the highest impact energies well above the barrier energy can be accounted for by the Landau...

  5. Therapeutic efficacy and dosimetric aspects of Rhenium-188-HEDP in bone pain palliation

    International Nuclear Information System (INIS)

    Liepe, Knut

    2005-01-01

    Full text: Bone metastases are a frequent complication of cancer, occurring in up 70% of patients suffering from advanced breast or prostate cancer and often present with severe bone pain. In this purpose the radionuclide therapy is a useful option for cancer patients. Different radionuclides are described, such as 89 Sr, 32 P, 153 Sm-EDTMP, 186 Re-HEDP, 131 I-BDP3, 90 Y, 117mSn-DTPA, 188 Re-HEDP and 188 Re-DMSA. The most experiences are available for 89 Sr. An indication for the treatment are patients with osteoblastic metastases, bone pain, sufficient bone marrow function and at least of three bone metastases visualized in bone scan. A bisphosphonate therapy, a chemotherapy with lower bone marrow toxicity or a local field external beam radiotherapy represent no contraindications, especially because the reported synergistic effects to the systemic radionuclide therapy. In 33 treated patients (breast and prostate cancer) we investigated the effect of 188 Re-HEDP on pain relief, analgesic intake and impairment of bone marrow function. There were an improvement on the Karnofsky performance scale from 74 7% to 85 9% 12 weeks after therapy (p= 0.001). The pain score showed a maximum decrease from 44 ± 18% to 27 ± 20% in the 3rd to the 8th week after therapy (p = .009) and 76% had a pain relief (20% were pain free). The maximal differences between the values of platelets and leukocytes before and after therapy were not statistically significant (p = 0.021 and p = 0.094). In 105 investigated patients treated with different radionuclides ( 89 Sr, 153 Sm-EDTMP, 186 Re-HEDP, 188 Re-HEDP and 89 Sr in combination with chemotherapy) no different therapeutic efficacy of the treatments were observed. In dose calculation of 188 Re-HEDP a radiation dose of 3.83 ± 2.01 mGy/MBq (12.6 Gy for 3300 MBq) for bone metastases and 0.61 ± 0.21 mGy/MBq (2 Gy for 3300 MBq) were found. With the introducing of radionuclide treatments with chemotherapy and repeated treatments, the calculation of bone marrow radiation-absorbed dose is more significant. But the dose calculation by MIRDOSE based on the hypothesis of a homogeneous distribution of the radiopharmaceutical in the bone metastases and a 50% uptake in the cortical and trabecular bone. For calculation of the uptake animals studies were developed to induce osteoblastic bone metastases by intra-ossaer administration of prostate cancer cells. In autoradiographic studies (BAS 500, Fuji; resolution of 0.5 μm) bone metastases and skeleton were investigated after 188 Re-HEDP. In the bone metastases a tumour to muscle ratio (T/M) of 48 ± 7 and a tumour to non-tumour ratio (T/NT) of 9.7 ± 1.5 (7.5 to 11.7) was found. The distribution in the metastases was inhomogeneous with a minimal T/NT of 7.0 ± 1.0 (4.9 to 8.5) and a maximal T/NT of 17.4 ± 2.7 (11.6 to 22.6). The ratio between the trabecular and cortical bone in non-tumour bone was 68.6 ± 7.2% to 31.4 ± 7.2 %. The inhomogeneous distribution could favour high beta energy radionuclides for a more homogeneous dose distribution in bone metastases. The MIRDOSE calculation underestimates the bone marrow dose; the uptake in the trabecular bone is higher than in the cortical part. The higher uptake in the trabecular bone decreases the hypothetic dose reducing effect of low beta energy radionuclides to the bone marrow. (author)

  6. Phosphorescent rhenium emitters based on two electron-withdrawing diamine ligands: Structure, characterization and electroluminescent performance

    Energy Technology Data Exchange (ETDEWEB)

    Rui, Mei, E-mail: meirui2015@163.com [College of Science, Hebei North University, Zhangjiakou 075000, Hebei (China); Yuhong, Wang [College of Science, Hebei North University, Zhangjiakou 075000, Hebei (China); Yinting, Wang; Na, Zhang [Communication Training Base of The Headquarters of The General Staff, Zhangjiakou 075100, Hebei (China)

    2014-09-15

    In this paper, two diamine ligands having electron-withdrawing oxadiazole group and their corresponding Re(I) complexes were synthesized. Their geometric structure, electronic transition, photophysical property, thermal stability and electrochemical property were discussed in detail. Experimental data suggested that both complexes were promising yellow emitters with suited energy levels and good thermal stability for electroluminescent application. The correlation between emission performance and electron-withdrawing group was analyzed. It was found that electron-withdrawing group favored emission performance improvement. Their electroluminescence performance was also explored. Yellow electroluminescence was observed with maximum brightness of 1743 cd/m{sup 2}. - Highlights: • Oxadiazole derived diamine ligands and their Re(I) complexes were synthesized. • Their characters and properties were analyzed and compared in detail. • Electron-withdrawing group was proved to be positive for PL improvement. • Electroluminescence was obtained with maximum brightness of 1743 cd/m{sup 2}.

  7. Rhenium-osmium systematics of calcium-aluminium-rich inclusions in carbonaceous chondrites

    Science.gov (United States)

    Becker, H.; Morgan, J.W.; Walker, R.J.; MacPherson, G.J.; Grossman, J.N.

    2001-01-01

    The Re-Os isotopic systematics of calcium-aluminium-rich inclusions (CAIs) in chondrites were investigated in order to shed light on the behavior of the Re-Os system in bulk chondrites, and to constrain the timing of chemical fractionation in primitive chondrites. CAIs with relatively unfractionated rare earth element (REE) patterns (groups I, III, V, VI) define a narrow range of 187Re/188Os (0.3764-0.4443) and 187Os/188Os (0.12599-0.12717), and high but variable Re and Os abundances (3209-41,820 ppb Os). In contrast, CAIs that show depletions in highly refractory elements and strongly fractionated REE patterns (group II) also show a much larger range in 187Re/188Os (0.409-0.535) and 187Os/188Os (0.12695-0.13770), and greater than an order of magnitude lower Re and Os abundances than other groups (e.g., 75.7-680.2 ppb Os). Sixteen bulk CAIs and CAI splits plot within analytical uncertainty of a 4558 Ga reference isochron, as is expected for materials of this antiquity. Eight samples, however, plot off the isochron. Several possible reasons for these deviations are discussed. Data for multiple splits of one CAI indicate that the nonisochronous behavior for at least this CAI is the result of Re-Os reequilibration at approximately 1.6 Ga. Thus, the most likely explanation for the deviations of most of the nonisochronous CAIs is late-stage open-system behavior of Re and Os in the asteroidal environment. The 187Os/188Os-Os systematics of CAIs are consistent with previous models that indicate group II CAIs are mixtures of components that lost the bulk of their highly refractory elements in a previous condensation event and a minor second component that provided refractory elements at chondritic relative proportions. The high Re/Os of group II CAIs relative to other CAIs and chondrite bulk rocks may have been caused by variable mobilization of Re and Os during medium- to low-temperature parent body alteration ??4.5 Ga ago. This model is favored over nebular models, which pose several difficulties. The narrow range of 187Os/188Os in group I, III, V, and VI bulk CAIs, and the agreement with 187Os/188Os of whole rock carbonaceous chondrites suggest that on a bulk inclusion scale, secondary alteration only modestly fractionated Re/Os in these CAIs. The average of 187Os/188Os for group I, III, V, and VI CAIs is indistinguishable from average CI chondrites, indicating a modern solar system value for 187Os/188Os of 0.12650, corresponding to a 187Re/188Os of 0.3964. Copyright ?? 2001 Elsevier Science Ltd.

  8. Development of the method of the preparation of albumin microspheres labelled 188-rhenium

    International Nuclear Information System (INIS)

    Dyomin, D.N.; Petriev, V.M.

    2001-01-01

    The basis of effective and wide usage of radioisotope methods in diagnostic and therapy of tumoral and not tumoral diseases is development of new radiopharmaceuticals, described by high functional value and safety. The efficiency and safety of radiopharmaceuticals are defined by the nuclear - physical characteristics of radionuclides, and also physicochemical and biological properties of carriers for selective delivery of radionuclides. Therefore an important direction in radiopharmacy is the search, the development and estimation of particular properties radiopharmaceuticals for radiotherapy of tumoral and not tumoral diseases, where the main thing is the choice of optimal carriers and radionuclides. At present time two types of carriers are used for delivery radionuclides: soluble preparations and insoluble so-called microparticles. (authors)

  9. Synthesis and structure of a rhenium(V) complex containing a ...

    African Journals Online (AJOL)

    methylphenyl) salicylideneimine) was prepared by the reaction of [NH4][ReO4] with H3mps in the presence of triphenylphosphine and hydrochloric acid in glacial acetic acid. Crystallization from acetonitrile gave the product 1.CH3CN.

  10. Rhenium-Promoted C-C Bond-Cleavage Reactions of Internal Propargyl Alcohols.

    Science.gov (United States)

    Lee, Kui Fun; Bai, Wei; Sung, Herman H Y; Williams, Ian D; Lin, Zhenyang; Jia, Guochen

    2018-06-07

    The first examples of C-C bond cleavage reactions of internal propargyl alcohols to give vinylidene complexes are described. Treatment of [Re(dppm) 3 ]I with RC≡CC(OH)R'R'' (R=aryl, alkyl; C(OH)R'R''=C(OH)Ph 2, C(OH)Me 2 , C(OH)HPh, C(OH)H 2 ) produced the vinylidene complexes ReI(=C=CHR)(dppm) 2 with the elimination of C(O)R'R''. Computational studies support that the reactions proceed through a β-alkynyl elimination of alkoxide intermediates Re{OC(R')(R'')C≡CR}(dppm) 2 . © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. The Polysaccharide Capsule of Campylobacter jejuni 81-176 Modulates the Host Immune Response

    Science.gov (United States)

    2012-12-17

    immune response 3 4 Alexander C. Maue1, Krystle L. Mohawk1, David K. Giles*2, Frédéric Poly1, Cheryl 5 P. Ewing1, Yuening Jiao3, Ginyoung Lee3, Zuchao...McGowan, D. Musher , A. Martin and J. 652 Richards. 1998. Phosphorylcholine on the lipooligosaccharide of 653 Haemophilus influnezae contributes to

  12. 21 CFR 133.176 - Pasteurized cheese spread with fruits, vegetables, or meats.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Pasteurized cheese spread with fruits, vegetables... fruits, vegetables, or meats. (a) Pasteurized cheese spread with fruits, vegetables, or meats, or... prepared cooked, canned, or dried fruit; any properly prepared cooked, canned, or dried vegetable; any...

  13. Godiva IV and Juliet Diagnostics CED-1, Rev. 1 (IER-176)

    Energy Technology Data Exchange (ETDEWEB)

    Scorby, J C; Myers, W L

    2012-04-11

    The Juliet experiment is currently in preliminary design (IER-128). This experiment will utilize a suite of diagnostics to measure the physical state of the device (temperature, surface motion, stress, etc.) and the total and time rate of change of neutron and gamma fluxes. A variety of potential diagnostics has been proposed in this CED-1 report. Based on schedule and funding, a subset of diagnostics will be selected for testing using the Godiva IV pulsed reactor as a source of neutrons and gammas. The diagnostics development and testing will occur over a two year period (FY12-13) culminating in a final set of diagnostics to be fielded for he Juliet experiment currently proposed for execution in FY15.

  14. 176: EVIDENCE-BASED AND EFFECTIVE RESEARCH SKILLS OF IRANIAN MIDDLE SCHOOL STUDENTS

    Science.gov (United States)

    Mostafaei, Helia; Sadeghi-Ghyassi, Fatemeh; Mostafaei, Hadi

    2017-01-01

    Background and aims Recently, digital research is very popular in schools. The capacity of students to do an effective search is unclear which can lead to utilization of unacceptable evidence in their research. Aims To evaluate middle school students' effective search skills. Methods This survey was done during the summer school of Farzanegan talented students middle school. The self-administrated questionnaire studied 30 items about effective search and digital research skills of students. One hundred questionnaires were distributed in this summer school and students in the 7th and 8th grades filled the questionnaires. The administration of the questionnaire was counted as their concept. All data was analyzed at Excel 2013. Results Eighty percent of students including 67.5% of the seventh and 32.5% of the eighth grade students responded to the questionnaires respectively. Shockingly, 96.2% of students only googled and most of them (73.7%) type the topic of their research in Persian to start their research strategy. More than half of them (52.5) believed the result of their search is mostly or always correct and 66.2% of them copy-pasted their findings without any assessment. Surprisingly, only 27.5% of them have proposed that they had problem with appraising the evidence. The best sources of the students for finding the answer of their questions were: Wikipedia, telegram, TV, books, E-Books, YouTube, classmates, Facebook and student information websites, and EBSCO, accordingly. 76.2% acknowledged that internet has turned students into copy machines. Only 31.2% agreed their teachers taught them how to do effective research. Conclusion Most of the students were not familiar with valid sources of research evidence. Language barrier may limit their access to best evidence. Most students were not used to retrieving the evidence.

  15. N-Linked Protein Glycosylation is Required for Full Competence in Campylobacter jejuni 81-176

    National Research Council Canada - National Science Library

    Larsen, Joseph C; Szymanski, Christine; Guerry, Patricia

    2004-01-01

    ...) that have subsequently been found in Helicobacter pylori and Wolinella succinogenes. Mutational analyses of some of these genes have implicated their involvement in intestinal epithelial cell invasion and natural competence...

  16. 76 FR 176 - Amended Certification Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2011-01-03

    ... Hewlett Packard Company. The workers are engaged in marketing, sales, call center, customer experience... Group--Desktop (Cupertino only), Customer Warranty, Emerging Business, Supply Chain, Volume Operations... Hewlett Packard Company, Personal Systems Group--Desktop (Fort Collins only), Customer Warranty, Emerging...

  17. The accusation of 'world disturbers' (Acts 17:6 in socio-political context

    Directory of Open Access Journals (Sweden)

    Jeremy Punt

    2016-03-01

    Full Text Available �Acts 17:1�9 presents a narrative of the consequences of Paul�s engagements in Thessalonica�s synagogue. Following Paul and Silas� reported successful 3-week mission, some Jews hauled Paul and Silas� host, Jason, and a number of Jesus followers before the authorities. The threefold accusation was that Paul and Silas turned the world upside down, acted against Caesar�s decrees and claimed another king, Jesus. This incident is investigated from the perspective of Acts� presentation of competing missions, in the context of the intersectionality of religion and politics in the 1st century CE. The article challenges a narrow theological interpretation of Acts 17, insisting on the need for and value of a socio-political interpretive lens to make sense of the rhetoric of this chapter.Intradisciplinary and/or interdisciplinary implications: The article challenges a narrow theological interpretation of Acts 17, insisting on the need for and value of a socio-political interpretive lens to make sense of the rhetoric of this chapter.

  18. 18 CFR 367.1760 - Account 176, Derivative instrument assets-Hedges.

    Science.gov (United States)

    2010-04-01

    ... change in the fair value of derivative instrument assets designated by the service company as cash flow... flow hedge it will record the change in the fair value of the derivative instrument in this account... must record the change in the fair value of the derivative instrument in this account with a concurrent...

  19. SEM-analysis of grain boundary porosity in three S-176 specimens

    International Nuclear Information System (INIS)

    Malen, K.; Birath, S.; Mattsson, O.

    1980-10-01

    Porosity in UO 2 -fuel has been studied in scanning electron microscope (SEM). The aim was to obtain a basis for evaluation of porosity in high burnup power reactor fuel. Three specimens have been analyzed. In the high temperature zones porosity can be seen both on grain boundaries and at grain edges. In the low temperature regions very little changes seem to have occurred during irradiation. (author)

  20. 46 CFR 176.600 - Drydock and internal structural examination intervals.

    Science.gov (United States)

    2010-10-01

    ... including fuel tanks, and may require the vessel to be drydocked or taken out of service to assess the extent of the damage, and to effect permanent repairs. The OCMI may also decrease the drydock examination...