
Sample records for rhenium 164

  1. Rhenium (United States)

    John, David A.; Seal, Robert R.; Polyak, Désirée E.; Schulz, Klaus J.; DeYoung,, John H.; Seal, Robert R.; Bradley, Dwight C.


    Rhenium is one of the rarest elements in Earth’s continental crust; its estimated average crustal abundance is less than 1 part per billion. Rhenium is a metal that has an extremely high melting point and a heat-stable crystalline structure. More than 80 percent of the rhenium consumed in the world is used in high-temperature superalloys, especially those used to make turbine blades for jet aircraft engines. Rhenium’s other major application is in platinum-rhenium catalysts used in petroleum refining.Rhenium rarely occurs as a native element or as its own sulfide mineral; most rhenium is present as a substitute for molybdenum in molybdenite. Annual world mine production of rhenium is about 50 metric tons. Nearly all primary rhenium production (that is, rhenium produced by mining rather than through recycling) is as a byproduct of copper mining, and about 80 percent of the rhenium obtained through mining is recovered from the flue dust produced during the roasting of molybdenite concentrates from porphyry copper deposits. Molybdenite in porphyry copper deposits can contain hundreds to several thousand grams per metric ton of rhenium, although the estimated rhenium grades of these deposits range from less than 0.1 gram per metric ton to about 0.6 gram per metric ton.Continental-arc porphyry copper-(molybdenum-gold) deposits supply most of the world’s rhenium production and have large inferred rhenium resources. Porphyry copper mines in Chile account for about 55 percent of the world’s mine production of rhenium; rhenium is also recovered from porphyry copper deposits in the United States, Armenia, Kazakhstan, Mexico, Peru, Russia, and Uzbekistan. Sediment-hosted strata-bound copper deposits in Kazakhstan (of the sandstone type) and in Poland (of the reduced-facies, or Kupferschiefer, type) account for most other rhenium produced by mining. These types of deposits also have large amounts of identified rhenium resources. The future supply of rhenium is likely

  2. Rhenium Re

    International Nuclear Information System (INIS)

    Busev, A.I.; Tiptsova, V.G.; Ivanov, V.M.


    The basic methods for determining rhenium in various objects are presented. The gravimetric determination of rhenium is based on a quantitative precipitation of ReO 4 - ions with tetraphenylarsonium chloride. The determination is not hindered by tungstates and molybdates. The potentiometric determination of rhenium in alloys (>=0.5% Re) is based on perrhenate ion reduction to Re(4) with the titrated solution of the Cr(2) salt. Re(7) is titrated in a hot sulfuric acid solution in the presence of KJ. The relative error of the method is 1 to 3%. The photometric determination of rhenium is performed by the rhodamide method in molybdenum-and tungsten-containing alloys and catalytically, in rocks, after it has been separated in the form of sulfide. The extraction-photometric determination of rhenium is carried out with the aid of methyl violet (analysis of a stock with a high content of Mo, W, Ta, Nb, Ti ahd Zr) and thio-oxine (the determination of Re is hindered by Au, Pt, Pd, Ru, Os, Rh, Ir). Also described are methods for differential-spectrophotometric determination of Re with the aid of thiocarbamide, as well as with the aid of dimethylglyoxime in the presence of SnCl 2 in an acid medium when Re is determined in its alloys with niobium and hafnium. It takes 2 hours to analyze the Hf-Re alloy and 3 hours to analyze the Nb-Re alloy, the standard deviation being 0.005 at 30-50% Re and 0.027 to 0.019 at 10-50% Re

  3. Spherical rhenium metal powder

    International Nuclear Information System (INIS)

    Leonhardt, T.; Moore, N.; Hamister, M.


    The development of a high-density, spherical rhenium powder (SReP) possessing excellent flow characteristics has enabled the use of advanced processing techniques for the manufacture of rhenium components. The techniques that were investigated were vacuum plasma spraying (VPS), direct-hot isostatic pressing (D-HIP), and various other traditional powder metallurgy processing methods of forming rhenium powder into near-net shaped components. The principal disadvantages of standard rhenium metal powder (RMP) for advanced consolidation applications include: poor flow characteristics; high oxygen content; and low and varying packing densities. SReP will lower costs, reduce processing times, and improve yields when manufacturing powder metallurgy rhenium components. The results of the powder characterization of spherical rhenium powder and the consolidation of the SReP are further discussed. (author)

  4. Rhenium Rocket Manufacturing Technology (United States)


    The NASA Lewis Research Center's On-Board Propulsion Branch has a research and technology program to develop high-temperature (2200 C), iridium-coated rhenium rocket chamber materials for radiation-cooled rockets in satellite propulsion systems. Although successful material demonstrations have gained much industry interest, acceptance of the technology has been hindered by a lack of demonstrated joining technologies and a sparse materials property data base. To alleviate these concerns, we fabricated rhenium to C-103 alloy joints by three methods: explosive bonding, diffusion bonding, and brazing. The joints were tested by simulating their incorporation into a structure by welding and by simulating high-temperature operation. Test results show that the shear strength of the joints degrades with welding and elevated temperature operation but that it is adequate for the application. Rhenium is known to form brittle intermetallics with a number of elements, and this phenomena is suspected to cause the strength degradation. Further bonding tests with a tantalum diffusion barrier between the rhenium and C-103 is planned to prevent the formation of brittle intermetallics.

  5. Rhenium corrosion in chloride melts

    International Nuclear Information System (INIS)

    Stepanov, A.D.; Shkol'nikov, S.N.; Vetyukov, M.M.


    The results investigating rhenium corrosion in chloride melts containing sodium, potassium and chromium ions by a gravimetry potentials in argon atmosphere in a sealing quarth cell are described. Rhenium corrosion is shown to be rather considerable in melts containing CrCl 2 . The value of corrosion rate depending on temperature is determined

  6. Rhenium Nanochemistry for Catalyst Preparation

    Directory of Open Access Journals (Sweden)

    Vadim G. Kessler


    Full Text Available The review presents synthetic approaches to modern rhenium-based catalysts. Creation of an active center is considered as a process of obtaining a nanoparticle or a molecule, immobilized within a matrix of the substrate. Selective chemical routes to preparation of particles of rhenium alloys, rhenium oxides and the molecules of alkyltrioxorhenium, and their insertion into porous structure of zeolites, ordered mesoporous MCM matrices, anodic mesoporous alumina, and porous transition metal oxides are considered. Structure-property relationships are traced for these catalysts in relation to such processes as alkylation and isomerization, olefin metathesis, selective oxidation of olefins, methanol to formaldehyde conversion, etc.

  7. Work function of carburized rhenium

    International Nuclear Information System (INIS)

    Pallmer, P.G. Jr.; Gordon, R.L.; Dresser, M.J.


    Variations of the electronic work function of carburized rhenium foils containing approximately 5 at.% carbon have been observed using the contact potential difference technique. Surface work function was observed to vary between 5.25 and 4.1 eV, with the work function of pure rhenium taken as 5.0 eV. Decrease in work function has been ascribed to the formation of graphitic layers on the surface at temperatures below the temperature of saturated solubility. The high work function surface was observed with all carbon in solution and has been ascribed to the presence of amorphous carbon near the surface

  8. Rhenium-osmium geochemistry: method and applications

    International Nuclear Information System (INIS)

    Luck, J.M.


    Experimental methods for chemical separation and isotopic analysis of rhenium-osmium are described. Accurate determinations are obtained for a quantity ratio around 10 -6 -10 -7 g. Development as a geochemical tracer is examined. Study of rhenium-osmium in meteorites allows the determination of solar system chronology and age of the galaxy. Rhenium-osmium chronology in meteorites is improved and osmium isotopes are used as petrogenetic and geological tracers. Molybdenites are studied through 187 Re- 187 Os dating [fr

  9. Rhenium radioisotopes for therapeutic radiopharmaceutical development

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.; Beets, A.L.; Pinkert, J.; Kropp, J.; Lin, W.Y.; Wang, S.Y.


    Rhenium-186 and rhenium-188 represent two important radioisotopes which are of interest for a variety of therapeutic applications in oncology, nuclear medicine and interventional cardiology. Rhenium-186 is directly produced in a nuclear reactor and the 90 hour half-life allows distribution to distant sites. The relatively low specific activity of rhenium-186 produced in most reactors, however, permits use of phosphonates, but limits use for labelled peptides and antibodies. Rhenium-188 has a much shorter 16.9 hour half-life which makes distribution from direct reactor production difficult. However, rhenium-188 can be obtained carrier-free from a tungsten-188/rhenium-188 generator, which has a long useful shelf-life of several months which is cost-effective, especially for developing regions. In this paper we discuss the issues associated with the production of rhenium-186- and rhenium-188 and the development and use of various radiopharmaceuticals and devices labelled with these radioisotopes for bone pain palliation, endoradiotherapy of tumours by selective catheterization and tumour therapy using radiolabelled peptides and antibodies, radionuclide synovectomy and the new field of vascular radiation therapy. (author)

  10. Thermophysical measurements on solid and liquid rhenium

    International Nuclear Information System (INIS)

    Pottlacher, G.; Jager, H.; Neger, T.


    A fast resistive heating technique was used to measure such thermophysical data of solid and liquid rhenium as enthalpy, specific heat, thermal volume expansion, and electrical resistivity. The measurements are performed with heating rates of slightly more than 10 9 K s -1 up to states of superheated liquid rhenium (7500 K)

  11. Electrochemical behaviour of rhenium-graphite electrode

    International Nuclear Information System (INIS)

    Varypaev, V.N.; Krasikov, V.L.


    Electrochemical behaviour of combination electrode from graphite with electrodeposited thin coating of electrolytic rhenium is studied. Solution of 0.5 m NaCl+0.04 m AlCl 3 served as an electrolite. Polarization galvanostatic curves of hydrogen evolution upon electrodes with conditional rhenium thickness of 3.5 and 0.35 μm, 35 and 3.5 nm are obtained. Possibility of preparation of rhenium-graphite cathode with extremely low rhenium consume, electro-chemical properties of which are simu-lar to purely rhenium cathode is shown. Such electrode is characterized with stable in time low cathode potential of hydrogen evolution in chloride electrolyte and during cathode polarization it is not affected by corrosion

  12. Directed light fabrication of rhenium components

    Energy Technology Data Exchange (ETDEWEB)

    Milewski, J.O.; Thoma, D.J.; Lewis, G.K.


    Directed Light Fabrication (DLF) is a direct metal deposition process that fuses powder, delivered by gas into the focal zone of a high powered laser beam to form fully dense near-net shaped components. This is accomplished in one step without the use of molds, dies, forming, pressing, sintering or forging equipment. DLF is performed in a high purity inert environment free from the contaminants associated with conventional processing such as oxide and carbon pickup, lubricants, binding agents, cooling or cleaning agents. Applications using rhenium have historically been limited in part by its workability and cost. This study demonstrates the ability to fuse rhenium metal powder, using a DLF machine, into free standing rods and describes the associated parameter study. Microstructural comparisons between DLF deposited rhenium and commercial rhenium sheet product is performed. This research combined with existing DLF technology demonstrates the feasibility of forming complex rhenium, metal shapes directly from powder.

  13. 76 FR 11324 - Airworthiness Directives; Allied Ag Cat Productions, Inc. Models G-164, G-164A, G-164B, G-164B... (United States)


    ... Airworthiness Directives; Allied Ag Cat Productions, Inc. Models G-164, G-164A, G-164B, G-164B With 73'' Wing... identified in this AD, contact Allied Ag Cat Productions, Inc., 301 West Walnut Street, P.O. Box 482, Walnut... Allied Ag Cat Productions, Inc. Models G-164, G-164A, G-164B, G-164B with 73'' wing gap, G-164B- 15T, G...

  14. Linkable thiocarbamoylbenzamidines as ligands for bioconjugation of Rhenium and Technetium; Kopplungsfaehige Thiocarbamoylbenzamidine als Liganden zur Biokonjugation von Rhenium und Technetium

    Energy Technology Data Exchange (ETDEWEB)

    Castillo Gomez, Juan Daniel


    Bioconjugation reactions with Rhenium and Technetium are of high importance for the development of novel radiopharmaceuticals for nuclear medicine. In this thesis the possibilities for bioconjugation using linkable Thiocarmbamoylbenzamidines as ligands for the complexation of Rhenium and Technetium were examined.

  15. Thiocarbonyl complexes of rhenium. Pt. 1

    International Nuclear Information System (INIS)

    Abram, U.


    Novel rhenium complexes with terminal thiocarbonyl groups have been synthesized from ReCl 3 (Me 2 PhP) 3 and sodium diethyldithiocarbamate. mer-(Diethyldithiocarbamato)tris-(dimethylphenylphosphine)(thiocarbonyl)rhenium( I), mer-[Re(CS)(Me 2 PhP) 3 (Et 2 dtc)], and tris(diethyldithiocarbamato)(thiocarbonyl)rhenium(III), [Re(CS)(Et 2 dtc) 3 ] have been studied by infrared and NMR spectroscopy, mass spectrometry and X-ray diffraction. mer-[Re(CS)(Me 2 PhP) 3 (Et 2 dtc)] crystallizes orthorhombic in the space group P na 2 1 with a=1516.1(2), b=2189.8(2) and c=1035.6(1) pm. Structure solution and refinement converged at R=0.042. The coordination geometry is a distorted octahedron. The Re-C bond length is found to be 184(2) pm. [Re(CS)(Et 2 dtc) 3 ] crystallizes monoclinic in the space group P2 1 /c with a=962.2(6), b=1744.0(2), c=1537.4(6) pm and β=96.21(1) . The final R value is 0.028. In the monomeric complex the rhenium atom is seven-coordinate with an approximate pentagonal-bipyramidal coordination sphere and a rhenium-carbon distance of 181(1) pm. (orig.)

  16. Accelerator Production and Separations for High Specific Activity Rhenium-186

    Energy Technology Data Exchange (ETDEWEB)

    Jurisson, Silvia S. [Univ. of Missouri, Columbia, MO (United States); Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)


    Tungsten and osmium targets were evaluated for the production of high specific activity rhenium-186. Rhenium-186 has potential applications in radiotherapy for the treatment of a variety of diseases, including targeting with monoclonal antibodies and peptides. Methods were evaluated using tungsten metal, tungsten dioxide, tungsten disulfide and osmium disulfide. Separation of the rhenium-186 produced and recycling of the enriched tungsten-186 and osmium-189 enriched targets were developed.

  17. Thermal conduction and linear expansion of sintered rhenium and tungsten-rhenium alloys at a temperature up to 1000 K

    International Nuclear Information System (INIS)

    Pozdnyak, N.Z.; Belyaev, R.A.; Vavilov, Yu.V.; Vinogradov, Yu.G.; Serykh, G.M.


    Preparation technology (by powder metallurgy methods) of sintered rhenium and tungsten-rhenium VR-5, VR-10, and VR-20 alloys is described. Thermal conduction of rhenium and VR-20 alloy has been measured in the temperature range from 300 to 1000 K. The value obtained turned out to be considerably less than those published elsewhere, this testifies to the great thermal contact resistance between the material grains. Also measured is the mean linear expansion coefficient for the mentioned above materials in the same temperature range. Linear expansion increases with rhenium content increase

  18. Rhenium Mechanical Properties and Joining Technology (United States)

    Reed, Brian D.; Biaglow, James A.


    Iridium-coated rhenium (Ir/Re) provides thermal margin for high performance and long life radiation cooled rockets. Two issues that have arisen in the development of flight Ir/Re engines are the sparsity of rhenium (Re) mechanical property data (particularly at high temperatures) required for engineering design, and the inability to directly electron beam weld Re chambers to C103 nozzle skirts. To address these issues, a Re mechanical property database is being established and techniques for creating Re/C103 transition joints are being investigated. This paper discusses the tensile testing results of powder metallurgy Re samples at temperatures from 1370 to 2090 C. Also discussed is the evaluation of Re/C103 transition pieces joined by both, explosive and diffusion bonding. Finally, the evaluation of full size Re transition pieces, joined by inertia welding, as well as explosive and diffusion bonding, is detailed.

  19. Electrodialysis separation of rhenium from silicon

    International Nuclear Information System (INIS)

    Prasolova, O.D.; Borisova, L.V.; Ermakov, A.N.


    A method of separation of ruthenium from silicon by electrodialysis with heterogenuos ion-exchange membranes is developed. The effeciency of purification of rhenium from silicon depending on the number of dialyzer chambers, temperature and pH value of the dialyzate is studed. It is found that an addditional fourth chamber between the middle and anolytic ones causes the purification coefficient increase 50 times. It is necessary to cool the dialyzate in order to reduce silicon migration into the anolyte and reverse diffusion of perrhenate-ion from the anolyte into the dialyzate. The optimal pH value of diaizate is 5.5-6. The method developed has been used for separating rhenium from industrial solution of lead production with complex composition

  20. Rhenium carbene complexes and their applications; Rhenium-Carben-Komplexe und ihre Anwendungen

    Energy Technology Data Exchange (ETDEWEB)

    Hille, Claudia Heidi


    New pharmaceutically suitable metal complexes play an important role in the development of diagnostic and therapeutic agents for cancer treatment. One option concerning new radiopharmaceuticals, is the application of the rhenium isotopes {sup 186}Re and {sup 188}Re. Therefore, water soluble but at the same time stable complexes, which can be synthesized straightforward, are required. In this thesis, several synthetic pathways to such rhenium complexes bearing Nheterocyclic carbenes are presented and applicability tests of literature known complexes conducted. The selected target structures based on monocarbenes turned out to be inappropriate for use in radiopharmaceutical applications, due to their long reaction times and purification issues. Additionally, sterical and electronical effects of the carbene ligands concerning complex formation have been investigated. Possibilities of functionalization at different positions on the heterocycle as well as hydrophilic wingtips - to achieve a better stability in an aqueous media - have been examined to gain information about chemical and physical properties of the resulting complexes. Furthermore, experiments regarding the coordination of various biscarbene ligands, which provides besides the stable chelatisation additionally the possibility of varying the linking bridge, to rhenium(I/V) precursors, have been performed. Dioxo-bis-(1,1{sup '}-methylene-bis(3,3{sup '}-diisopropylimidazolium-2-ylidene)) rhenium(V )-hexafluorophosphate was synthesized via a transmetalation reaction of the corresponding silver carbene with ReOCl{sub 3}(PPh{sub 3}){sub 2} and silver hexafluorophosphate. This complex provided the basis for the first radiolabeled {sup 188}Rhenium NHC complex later on. An enhancement of the kinetic and thermodynamic stability of potential rhenium biscarbene complexes based on modifications concerning the length and character of the bridging moiety between the chelating NHC rings as well as the nature of

  1. Separation of Rhenium (VII) from Tungsten (VI)

    International Nuclear Information System (INIS)

    Vucina, J.; Lukic, D.; Stoiljkovic, M.; Milosevic, M.; Orlic, M.


    Examined were the conditions for an effective separation of tungsten (VI) and rhenium (VII) on alumina if the solution of 0.20 mol dm -3 NaCl, ph=2.6 is used as the aqueous phase. Under the given experimental conditions alumina was found to be much better adsorbent for tungsten than for rhenium. The breakthrough and saturation capacities of alumina at pH=2 are 24 and 78 mg W/g Al 2 O 3 , respectively. With the increase of pH these values decrease. So, at pH=6 they are only 4 and 13 mg W/g Al 2 O 3 respectively. The elution volume for rhenium for the given column dimensions and quantity of the adsorbent is about 16 ml. These results were confirmed by the experiments of the radiological separations. Tungsten-187 remains firmly bound to the alumina. The radionuclide purity of the eluted 186'188 Re at pH=2 is very high. (authors)

  2. Near net shape of powder metallurgy rhenium parts

    International Nuclear Information System (INIS)

    Leonhardt, T.; Downs, J.


    In this paper, a description of the stages of processing necessary to produce a near-net shape (NNS) powder metallurgy (PM) rhenium component through the use of cold isostatic pressing (CIP) to form a complex shape will be explained. This method was primarily developed for the production of the 440 N and 490 N liquid apogee engine combustion chambers used in satellite positioning systems. The CIP to NNS process has been used in the manufacture and production of other rhenium aerospace components as well. Cold isostatic pressing (CIP) to a near net shape utilizing a one or two-part mandrel greatly reduces the quantity of rhenium required to produce the component, and also significantly reduces the number of secondary machining operations necessary to complete the manufacturing process. Further, the developments in near-net shape powder metallurgy rhenium manufacturing techniques have generated significant savings in the area of both time and budget. Overall, cost declined by as much as 35 % for the quantity of rhenium chambers, and manufacturing time was decreased by 30-40 %. The quantity of rhenium metal powder used to produce a rhenium chamber was reduced by approximately 70 %, with a subsequent reduction of nearly 50 % in secondary machining operation schedules. Thus, it is apparent that the overall savings provided by the production of near-net shape powder metallurgy rhenium components will be more than merely another aspect of any project involving high temperature applications, it will constitute significant benefit. (author)

  3. Determination of rhenium in molybdenite by neutron-activation analysis. (United States)

    Terada, K; Yoshimura, Y; Osaki, S; Kiba, T


    A neutron-activation method is described for the determination of rhenium in molybdenite. Radiochemical separation by a carrier technique was carried out very rapidly by means of successive liquid-liquid extraction processes. The recovery of rhenium, which was determined by a spectrophotometric method, was about 93%. About 10 samples could be analysed within 6 hr in parallel runs.

  4. Rhenium: a rare metal critical in modern transportation (United States)

    John, David A.


    Rhenium is a silvery-white, metallic element with an extremely high melting point (3,180 degrees Celsius) and a heat-stable crystalline structure, making it exceptionally resistant to heat and wear. Since the late 1980s, rhenium has been critical for superalloys used in turbine blades and in catalysts used to produce lead-free gasoline.

  5. Crystallochemistry of rhenium compounds with metal-metal bonds

    International Nuclear Information System (INIS)

    Koz'min, P.A.; Surazhskaya, M.D.


    A review is presented including a brief description of atomic structure of 59 coordination rhenium compounds with metal-metal bond. The most important bond lengths and valent angles are presented for each compound. The dependence of rhenium-rhenium bond length on its multiplicity is discussed and possible causes of deviations from this dependence (namely, axial ligand presence, steric repulsion of ligands) are considered. On the basis of qualitative comparison of electronegativity of ligands in dimer compounds with quarternary bond of rhenium-rhenium a supposition is made on the influence of formal charge of atomic group and summary electro-negativity of ligands on the possibility of the metal-metal bond formation

  6. Near-Net Shape Powder Metallurgy Rhenium Thruster (United States)

    Leonhardt, Todd; Hamister, Mark; Carlen, Jan C.; Biaglow, James; Reed, Brian


    This paper describes the development of a method to produce a near-net shape (NNS) powder metallurgy (PM) rhenium combustion chamber of the size 445 N (100 lbf) used in a high performance liquid apogee engine. These engines are used in low earth Orbit and geostationary orbit for satellite positioning systems. The developments in near-net shape powder metallurgy rhenium combustion chambers reported in this paper will reduce manufacturing cost of the rhenium chambers by 25 percent, and reduce the manufacturing time by 30 to 40 percent. The quantity of rhenium metal powder used to produce a rhenium chamber is reduced by approximately 70 percent and the subsequent reduction in machining schedule and costs is nearly 50 percent.

  7. Electrodeposition of rhenium-tin nanowires

    International Nuclear Information System (INIS)

    Naor-Pomerantz, Adi; Eliaz, Noam; Gileadi, Eliezer


    Highlights: → Rhenium-tin nanowires were formed electrochemically, without using a template. → The nanowires consisted of a crystalline-Sn-core/amorphous-Re-shell structure. → The effects of bath composition and operating conditions were investigated. → A mechanism is suggested for the formation of the core/shell structure. → The nanowires may be attractive for a variety of applications. - Abstract: Rhenium (Re) is a refractory metal which exhibits an extraordinary combination of properties. Thus, nanowires and other nanostructures of Re-alloys may possess unique properties resulting from both Re chemistry and the nanometer scale, and become attractive for a variety of applications, such as in catalysis, photovoltaic cells, and microelectronics. Rhenium-tin coatings, consisting of nanowires with a core/shell structure, were electrodeposited on copper substrates under galvanostatic or potentiostatic conditions. The effects of bath composition and operating conditions were investigated, and the chemistry and structure of the coatings were studied by a variety of analytical tools. A Re-content as high as 77 at.% or a Faradaic efficiency as high as 46% were attained. Ranges of Sn-to-Re in the plating bath, applied current density and applied potential, within which the nanowires could be formed, were determined. A mechanism was suggested, according to which Sn nanowires were first grown on top of Sn micro-particles, and then the Sn nanowires reduced the perrhenate chemically, thus forming a core made of crystalline Sn-rich phase, and a shell made of amorphous Re-rich phase. The absence of mutual solubility of Re and Sn may be the driving force for this phase separation.

  8. Highvalent and organometallic technetium and rhenium compounds

    International Nuclear Information System (INIS)

    Oehlke, Elisabeth


    Diagnostic methods in nuclear medicine allow a detailed description of morphological organ structures and their function. The beta emitting isotope Tc-99 has optimal physical properties (140 keV gamma rays, half-life 6 h) and is therefore used for radiopharmaceuticals. The thesis is concerned with the search for new technetium complexes and their reproducible production. The (TcO3) core is of main interest. The second part of the thesis deals with organometallic technetium and rhenium complexes with carbonyl ligands and N-heterocyclic carbenes that show stability in aerobic aqueous solutions.

  9. First principles calculations of interstitial and lamellar rhenium nitrides

    Energy Technology Data Exchange (ETDEWEB)

    Soto, G., E-mail: [Universidad Nacional Autonoma de Mexico, Centro de Nanociencias y Nanotecnologia, Km 107 Carretera Tijuana-Ensenada, Ensenada Baja California (Mexico); Tiznado, H.; Reyes, A.; Cruz, W. de la [Universidad Nacional Autonoma de Mexico, Centro de Nanociencias y Nanotecnologia, Km 107 Carretera Tijuana-Ensenada, Ensenada Baja California (Mexico)


    Highlights: Black-Right-Pointing-Pointer The possible structures of rhenium nitride as a function of composition are analyzed. Black-Right-Pointing-Pointer The alloying energy is favorable for rhenium nitride in lamellar arrangements. Black-Right-Pointing-Pointer The structures produced by magnetron sputtering are metastable variations. Black-Right-Pointing-Pointer The structures produced by high-pressure high-temperature are stable configurations. Black-Right-Pointing-Pointer The lamellar structures are a new category of interstitial dissolutions. - Abstract: We report here a systematic first principles study of two classes of variable-composition rhenium nitride: i, interstitial rhenium nitride as a solid solution and ii, rhenium nitride in lamellar structures. The compounds in class i are cubic and hexagonal close-packed rhenium phases, with nitrogen in the octahedral and tetrahedral interstices of the metal, and they are formed without changes to the structure, except for slight distortions of the unit cells. In the compounds in class ii, by contrast, the nitrogen inclusion provokes stacking faults in the parent metal structure. These faults create trigonal-prismatic sites where the nitrogen residence is energetically favored. This second class of compounds produces lamellar structures, where the nitrogen lamellas are inserted among multiple rhenium layers. The Re{sub 3}N and Re{sub 2}N phases produced recently by high-temperature and high-pressure synthesis belong to this class. The ratio of the nitrogen layers to the rhenium layers is given by the composition. While the first principle calculations point to higher stability for the lamellar structures as opposed to the interstitial phases, the experimental evidence presented here demonstrates that the interstitial classes are synthesizable by plasma methods. We conclude that rhenium nitrides possess polymorphism and that the two-dimensional lamellar structures might represent an emerging class of materials

  10. First principles calculations of interstitial and lamellar rhenium nitrides

    International Nuclear Information System (INIS)

    Soto, G.; Tiznado, H.; Reyes, A.; Cruz, W. de la


    Highlights: ► The possible structures of rhenium nitride as a function of composition are analyzed. ► The alloying energy is favorable for rhenium nitride in lamellar arrangements. ► The structures produced by magnetron sputtering are metastable variations. ► The structures produced by high-pressure high-temperature are stable configurations. ► The lamellar structures are a new category of interstitial dissolutions. - Abstract: We report here a systematic first principles study of two classes of variable-composition rhenium nitride: i, interstitial rhenium nitride as a solid solution and ii, rhenium nitride in lamellar structures. The compounds in class i are cubic and hexagonal close-packed rhenium phases, with nitrogen in the octahedral and tetrahedral interstices of the metal, and they are formed without changes to the structure, except for slight distortions of the unit cells. In the compounds in class ii, by contrast, the nitrogen inclusion provokes stacking faults in the parent metal structure. These faults create trigonal-prismatic sites where the nitrogen residence is energetically favored. This second class of compounds produces lamellar structures, where the nitrogen lamellas are inserted among multiple rhenium layers. The Re 3 N and Re 2 N phases produced recently by high-temperature and high-pressure synthesis belong to this class. The ratio of the nitrogen layers to the rhenium layers is given by the composition. While the first principle calculations point to higher stability for the lamellar structures as opposed to the interstitial phases, the experimental evidence presented here demonstrates that the interstitial classes are synthesizable by plasma methods. We conclude that rhenium nitrides possess polymorphism and that the two-dimensional lamellar structures might represent an emerging class of materials within binary nitride chemistry.

  11. Method of stably radiolabeling antibodies with technetium and rhenium

    International Nuclear Information System (INIS)

    Paik, C.H.; Reba, R.C.; Eckelman, W.C.


    A method is described for labeling antibodies or antibody fragments with radionuclides of technetium or rhenium to obtain stable labeling, comprising: reacting a reduced radioisotope of technetium or rhenium with an antibody or antibody fragment, or a diethylenetriaminepentaacetic acid conjugated antibody or antibody fragment, in the presence of free or carrier-bound diethylenetriaminepentaacetic acid (DTPA). The amount of DTPA is sufficient to substantially completely inhibit binding of the reduced technetium or rhenium to nonstable binding sites of the antibody or antibody fragment, or the DTPA-conjugated antibody or antibody fragment. The resultant stably labeled antibody or antibody fragment, or DTPA[conjugated antibody or antibody fragment is recovered

  12. Nuclear Data Sheets for A=164 (United States)

    Singh, Balraj; Chen, Jun


    Experimental nuclear structure data for the known A=164 isobaric nuclides (Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, Lu, Hf, Ta, W, Re, Os, Ir) have been evaluated, and presented together with Adopted properties of level energies, and associated γ rays. The decay data for these nuclides have also been evaluated, providing Adopted values of γ and β radiations, and log ft values. No excited states are known in 164Eu, 164Tb, and 164Ir. Information for 164Gd, 164Re and 164Os is limited due to insufficient experimental data. For radioactive nuclides, decay schemes of 164Sm, 164Gd and 164Re are not known, and those of 164W, 164Tb, 164Lu, 164Hf, 164Ta and 164W are incomplete. The decay schemes of 164Ho and the two activities of 164Tm seem fairly complete. The decay scheme of 164Yb presents a major problem that the Q(ε) value of 887 keV 29 recommended in 2017Wa10 is in disagreement with the population of levels at 928, 952 and 1060 keV in the daughter nucleus. This decay scheme, which so far has been mainly reported in a secondary reference (1982AdZZ) needs further investigation. Also the masses of 164Yb and 164Tm need either new measurements or a re-evaluation to resolve discrepancy of about 220 keV in the Q value of 164Yb decay to 164Tm. The reactions and decays for which no new experimental information has become available since the 2001 update have undergone revisions to incorporate conversion coefficients from BrIcc code, and evaluated Q values from 2017Wa10, but the essential content of such datasets may have remained the same as in previous evaluations. In this respect the present work greatly benefited from all the previous NDS evaluations (2001Si27,1992Sh07, 1986Sh03,1974Bu30), but at the same time data presented herein supersede all the previous published evaluations.

  13. Separation of tungsten and rhenium on alumina

    Directory of Open Access Journals (Sweden)



    Full Text Available The conditions for the efficient separation of tungsten(VI and rhenium (VII on alumina were established. The distribution coefficients Kd for tungstate and perrhenate anions, as well as the separation factors a (a = KdWO42-/Kd ReO4- were determined using hydrochloric or nitric acid as the aqueous media. A solution of sodium chloride in the pH range 2–6 was also examined. Under all the tested experimental conditions, alumina is a much better adsorbent for tungsten than for rhenium. The obtained results indicated that the best separation of these two elements is achieved when 0.01– 0.1 mol dm-3 HCl or 1.0 mol dm-3 HNO3 are used as the aqueous media. If NaCl is used as the aqueous phase, the best separation is achieved with 0.20 mol dm-3 NaCl, pH 4–6. Under these experimental conditions, the breakthrough and saturation capacities of alumina for tungsten at pH 4 are 17 and 26 mg W/g Al2O3, respectively. With increasing pH, these values decrease. Thus, at pH 6 they are only 4 and 13 mg W/g Al2O3, respectively.

  14. 40 CFR 164.8 - Publication. (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Publication. 164.8 Section 164.8 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS RULES OF PRACTICE... OTHER HEARINGS CALLED PURSUANT TO SECTION 6 OF THE ACT General § 164.8 Publication. All notices of...

  15. 40 CFR 164.6 - Time. (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Time. 164.6 Section 164.6 Protection... OTHER HEARINGS CALLED PURSUANT TO SECTION 6 OF THE ACT General § 164.6 Time. (a) Computation. In computing any period of time prescribed or allowed by these rules, except as otherwise provided, the day of...

  16. Development of industrial hydrogenating catalyst on rhenium base

    International Nuclear Information System (INIS)

    Chistyakova, G.A.; Bat', I.I.; Rebrova, V.V.


    Processes for forming rhenium catalysts on carbon carrier and their catalytic properties in nitrobenzene (NB) reduction were studied. Application of an ammonia preparation to the carbon surface produced impregnated carbon saturated at room temperature with a water solution of the ammonia preparation, taken in a volume equal to the volumetric capacity of the carbon. With one impregnation, 2% rhenium was taken up. Catalysts containing more than 5% rhenium were obtained by impregnating the carbon with heating and use of more concentrated solutions. Catalysts made in this way and dried at 100 0 C had the composition Re 2 OH/carbon/. The most active catalysts were those reduced at 200-250 0 C; higher temperatures, up to 300-500 0 C, decreased the activity. Study of the catalytic properties of the rhenium catalysts in a liquid phase reduction of NB showed that the specific activity of rhenium depends only slightly on the content of the active component in the catalyst and is close to the specific activity of palladium and considerably exceeds that of nickel. Study of the effect of the NB concentration and hydrogen pressure on the activity and stability of the 5% rhenium catalyst indicated that with NB concentrations from 50 to 10% the process takes place at an essentially constant rate; the order of the reaction was close to zero with an apparent activation energy of about 7000 cal/mole. At pressures of 15-200 atm the yield with the 5% catalyst was proportional to the hydrogen pressure. A big advantage of the rhenium catalysts in the reduction of NB is their high selectivity. With a higher activity than palladium and nickel catalysts, 5% rhenium catalyst produces a high operating capacity in a wide range of contact charges, which has considerable significance for industrial use in contact apparatus of the column type. Comparison of the costs of rhenium catalysts and granular carbon carrier with those of nickel, platinum, and palladium showed that 5% rhenium catalyst can

  17. Neutron activation determination of rhenium in shales shales and molybdenites

    International Nuclear Information System (INIS)

    Zajtsev, E.I.; Radinovich, B.S.


    Described is the technique for neutron activation determination of rhenium in shales and molybdenites with its radiochemical extraction separation by methyl-ethyl ketone. The sensitivity of the analysis is 5x10 -7 %. Experimental checking of the developed technique in reference to the analysis of shales and molybdenites was carried out. Estimated is the possibility of application of X-ray gamma-spectrometer to instrumental determination of rhenium in molybdenites

  18. New extraction chromatographic material for rhenium separation

    International Nuclear Information System (INIS)

    Lucanikova, M.; Czech Technical University, Prague; Kucera, J.; Czech Technical University, Prague; Sebesta, F.


    Three types of the extraction chromatographic materials, composed from Aliquat R 336 deposited in the polyacrylonitrile (PAN) beads and prepared by different procedures, were compared for extraction of rhenium. The best properties were exhibited when the solid extractant was prepared by impregnation of the ready-made PAN beads. Solid extractant prepared by direct coagulation of the beads from the suspension of Aliquat R 336 in solution of PAN in nitric acid differs only by lower capacity in dynamic conditions. Material prepared from the PAN solution in dimethylsulfoxide was the worst because Aliquat R 336 was washed out from the beads during coagulation of the polymer and the extraction capacity was low. As it is shown, the first two solid extractants are fully comparable with the commercial TEVA Resin. (author)

  19. Determination of rhenium in geologic samples of sandstone-type uranium deposit

    International Nuclear Information System (INIS)

    Li Yanan; Wang Xiuqin; Yin Jinshuang


    The thiourea colorimetry method suitable for the determination of samples with rhenium content higher than 5 μg/g is described. The method is characterized by many advantages: stability of analytical results, simplicity and cheapness of reagent, and wide range of analysed samples. The catalytic colorimetry is also applied to determine trace rhenium meeting the demand for comprehensive appraisal of prospecting and exploration, recovery and utilization of rhenium. This method can also be applied to analyse rhenium of other samples

  20. Determination of rhenium in molybdenite by X-ray fluorescence: A combined chemical-spectrometric technique. (United States)

    Solt, M W; Wahlberg, J S; Myers, A T


    Rhenium in molybdenite is separated from molybdenum by distillation of rhenium heptoxide from a perchloric-sulphuric acid mixture. It is concentrated by precipitation of the sulphide and then determined by X-ray fluorescence. From 3 to 1000 microg of rhenium can be measured with a precision generally within 2%. The procedure tolerates larger amounts of molybdenum than the usual colorimetric methods.

  1. Determination of rhenium in molybdenite by X-ray fluorescence. A combined chemical-spectrometric technique (United States)

    Solt, M.W.; Wahlberg, J.S.; Myers, A.T.


    Rhenium in molybdenite is separated from molybdenum by distillation of rhenium heptoxide from a perchloric-sulphuric acid mixture. It is concentrated by precipitation of the sulphide and then determined by X-ray fluorescence. From 3 to 1000 ??g of rhenium can be measured with a precision generally within 2%. The procedure tolerates larger amounts of molybdenum than the usual colorimetric methods. ?? 1969.

  2. Concentration of rhenium from dilute sodium chloride solutions

    Directory of Open Access Journals (Sweden)



    Full Text Available The conditions for the desorption of rhenium from the anion exchange resin Dowex 1-x8 by HNO3, HCl, H2SO4 and NaOH were determined. The solution (5.0´10-3 mol dm-3 Re in 0.15 mol dm-3 NaCl was passed through a column containing 0.10 g of the resin. The total sorbed amount of rhenium was 0.20 g/g of the resin. It was then eluted by the corresponding eluent in the concentration range up to about 3.0 mol dm-3. The highest elution efficiency and the most favourable elution profile were found with 3.0 mol dm-3 HNO3. Over 77 % of the sorbed rhenium was found in the first 5 ml of the eluate. Practically all the rhenium was recovered with 20 ml of the acid. Under the given experimental conditions, HCl and H2SO4 were less favourable while NaOH was not applicable, due to very low efficiency of rhenium elution.

  3. A comparative study of electrochemical and optical properties of rhenium deposited on gold and platinum

    Energy Technology Data Exchange (ETDEWEB)

    Zerbino, Jorge O.; Castro Luna, Ana M.; Martins, M. E. [Consejo Nacional de Investigaciones Cientificas y Tecnicas (CONICET), Buenos Aires (Argentina). Inst. de Investigaciones Fisico-Quimicas, Teoricas y Aplicadas (INIFTA)]. E-mail:; Zinola, Carlos F.; Mendez, Eduardo [Universidad de la Republica, Montevideo (Uruguay). Facultad de Ciencias. Lab. de Electroquimica Fundamental


    Rhenium-containing films were grown on gold and platinum after different potentiostatic and potentiodynamic polarizations in the - 0.20 V to 0.70 V range (vs rhe) in aqueous acid perrhenate. Experimental data were obtained using cyclic voltammetry and ellipsometry, from which the thickness and optical indices of the electrodeposited rhenium layer were calculated. Metallic rhenium deposition on gold takes place at potentials within the hydrogen evolution reaction. Rhenium oxide on platinum is formed in the hydrogen adatom potential domain, whereas metallic rhenium is deposited concurrently with the hydrogen adsorption and evolution reactions on the same metal. (author)

  4. A comparative study of electrochemical and optical properties of rhenium deposited on gold and platinum

    Directory of Open Access Journals (Sweden)

    Zerbino Jorge O.


    Full Text Available Rhenium-containing films were grown on gold and platinum after different potentiostatic and potentiodynamic polarizations in the - 0.20 V to 0.70 V range (vs rhe in aqueous acid perrhenate. Experimental data were obtained using cyclic voltammetry and ellipsometry, from which the thickness and optical indices of the electrodeposited rhenium layer were calculated. Metallic rhenium deposition on gold takes place at potentials within the hydrogen evolution reaction. Rhenium oxide on platinum is formed in the hydrogen adatom potential domain, whereas metallic rhenium is deposited concurrently with the hydrogen adsorption and evolution reactions on the same metal.

  5. Monoclonal Antibodies Radiolabeling with Rhenium-188 for Radioimmunotherapy (United States)

    Martini, Petra; Pasquali, Micol


    Rhenium-188, obtained from an alumina-based tungsten-188/rhenium-188 generator, is actually considered a useful candidate for labeling biomolecules such as antibodies, antibody fragments, peptides, and DNAs for radiotherapy. There is a widespread interest in the availability of labeling procedures that allow obtaining 188Re-labeled radiopharmaceuticals for various therapeutic applications, in particular for the rhenium attachment to tumor-specific monoclonal antibodies (Mo)Abs for immunotherapy. Different approaches have been developed in order to obtain 188Re-radioimmunoconjugates in high radiochemical purity starting from the generator eluted [188Re]ReO4−. The aim of this paper is to provide a short overview on 188Re-labeled (Mo)Abs, focusing in particular on the radiolabeling methods, quality control of radioimmunoconjugates, and their in vitro stability for radioimmunotherapy (RIT), with particular reference to the most important contributions published in literature in this topic. PMID:28951872

  6. Chalcogenhalide cluster rhenium- and molybdenum complexes

    International Nuclear Information System (INIS)

    Fedin, V.P.; Gubin, S.P.; Mishchenko, A.V.; Fedorov, V.E.


    The interaction of rhenium- and molybdenum chalcogenhalides with n-donor ligands (L) is studied. At heating Re 3 X 2 Hal 5 complexes up to 100 deg in DMSO in the L presence obtained are the complexes of the 1-6 composition Re 3 X 2 Hal 5 -x Lx DMSO (X=Se, Hal=Cl, L=Et 3 N(1); X=Se, Hal=Cl, L=Bipy(2); X=Se, Hal=Br, L=Et 3 N(3); X=Se, Hal=Br, L=Bipy(4); X=Te, Hal=Br, L=Et 3 N(5); X=Te, Hal=Br, L=(Me 2 NCH 2 ) 2 (6). In the course of boiling of Mo 3 S 7 Hal 4 with PPh 3 in MeCN the Mo 3 S 7 Hal 4 2PPh 3 complexes (Hal=Cl(7); Br(8)) are obtained. For 1 through 8 complexes the chemical analysis data and IR spectra are given. For 4 and 8 complexes the molecular mass is measured. A possible method of obtaining molecular trinuclear clusters from polymer clusters is discussed

  7. Rhenium-186 direct labelling HIgG

    International Nuclear Information System (INIS)

    Lungu, V.; Mihailescu, G.; Dumitrescu, G.


    The aim of this study is to develop and improve existing radiolabelling techniques of peptides and monoclonal antibodies with 186 Re for achievement of potential agents for cancer targeted radiotherapy. There were selected methods and techniques for the direct labelling of intact HIgG by studding chemical and radiochemical processes of -S-S- bridges prereduction, reduction of 186 ReO 4 - and coupling reaction of rhenium with HIgG. The -S-S- bridges prereduction of HIgG to sulfhydryls was effected using different reducing agents: ascorbic acid, 2,3 dimercaptopropanol, cysteine, active hydrogen. The prereduction reactions are controlled by masic ratios of HIgG/reduction agent, pH, temperature and time of incubation. A pH=4.5 and a 24 hours incubation time are in the advantage of the prereduction yield. The labelling with 186 Re of prereduced HIgG with ascorbic acid or active hydrogen and 37 deg. C incubation in 22 hours releases 92% radiochemical purity. (author)

  8. Epitaxial growth of rhenium with sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Seongshik [National Institute of Standards and Technology, Boulder, CO 80305 (United States) and Department of Physics, University of Illinois, Urbana, IL 61801 (United States)]. E-mail:; Hite, Dustin A. [National Institute of Standards and Technology, Boulder, CO 80305 (United States); Cicak, K. [National Institute of Standards and Technology, Boulder, CO 80305 (United States); Osborn, Kevin D. [National Institute of Standards and Technology, Boulder, CO 80305 (United States); Simmonds, Raymond W. [National Institute of Standards and Technology, Boulder, CO 80305 (United States); McDermott, Robert [University of California, Santa Barbara, CA 93106 (United States); Cooper, Ken B. [University of California, Santa Barbara, CA 93106 (United States); Steffen, Matthias [University of California, Santa Barbara, CA 93106 (United States); Martinis, John M. [University of California, Santa Barbara, CA 93106 (United States); Pappas, David P. [National Institute of Standards and Technology, Boulder, CO 80305 (United States)


    We have grown epitaxial Rhenium (Re) (0001) films on {alpha}-Al{sub 2}O{sub 3} (0001) substrates using sputter deposition in an ultra high vacuum system. We find that better epitaxy is achieved with DC rather than with RF sputtering. With DC sputtering, epitaxy is obtained with the substrate temperatures above 700 deg. C and deposition rates below 0.1 nm/s. The epitaxial Re films are typically composed of terraced hexagonal islands with screw dislocations, and island size gets larger with high temperature post-deposition annealing. The growth starts in a three dimensional mode but transforms into two dimensional mode as the film gets thicker. With a thin ({approx}2 nm) seed layer deposited at room temperature and annealed at a high temperature, the initial three dimensional growth can be suppressed. This results in larger islands when a thick film is grown at 850 deg. C on the seed layer. We also find that when a room temperature deposited Re film is annealed to higher temperatures, epitaxial features start to show up above {approx}600 deg. C, but the film tends to be disordered.

  9. Superhard Rhenium/Tungsten Diboride Solid Solutions. (United States)

    Lech, Andrew T; Turner, Christopher L; Lei, Jialin; Mohammadi, Reza; Tolbert, Sarah H; Kaner, Richard B


    Rhenium diboride (ReB 2 ), containing corrugated layers of covalently bonded boron, is a superhard metallic compound with a microhardness reaching as high as 40.5 GPa (under an applied load of 0.49 N). Tungsten diboride (WB 2 ), which takes a structural hybrid between that of ReB 2 and AlB 2 , where half of the boron layers are planar (as in AlB 2 ) and half are corrugated (as in ReB 2 ), has been shown not to be superhard. Here, we demonstrate that the ReB 2 -type structure can be maintained for solid solutions of tungsten in ReB 2 with tungsten content up to a surprisingly large limit of nearly 50 atom %. The lattice parameters for the solid solutions linearly increase along both the a- and c-axes with increasing tungsten content, as evaluated by powder X-ray and neutron diffraction. From micro- and nanoindentation hardness testing, all of the compositions within the range of 0-48 atom % W are superhard, and the bulk modulus of the 48 atom % solid solution is nearly identical to that of pure ReB 2 . These results further indicate that ReB 2 -structured compounds are superhard, as has been predicted from first-principles calculations, and may warrant further studies into additional solid solutions or ternary compounds taking this structure type.

  10. 46 CFR 164.018-3 - Classification. (United States)


    ... 46 Shipping 6 2010-10-01 2010-10-01 false Classification. 164.018-3 Section 164.018-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... Classification. The following types of retroreflective material are approved under this specification: (a) Type I...

  11. 40 CFR 417.164 - [Reserved (United States)


    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 417.164 Section 417.164 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Detergents Subcategory § 417...

  12. 40 CFR 164.130 - General. (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false General. 164.130 Section 164.130 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS RULES OF PRACTICE... on a pest for which registration has been finally cancelled or suspended by the Administrator...

  13. 40 CFR 164.51 - Other discovery. (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Other discovery. 164.51 Section 164.51... GOVERNING HEARINGS, UNDER THE FEDERAL INSECTICIDE, FUNGICIDE, AND RODENTICIDE ACT, ARISING FROM REFUSALS TO... OTHER HEARINGS CALLED PURSUANT TO SECTION 6 OF THE ACT General Rules of Practice Concerning Proceedings...

  14. 16 CFR 1.64 - Condemnation proceedings. (United States)


    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Condemnation proceedings. 1.64 Section 1.64 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL... Commission that the public interest requires such action, the Commission will apply to the courts for...

  15. Mechanistic Study of Oxygen Atom Transfer Catalyzed by Rhenium Compounds

    Energy Technology Data Exchange (ETDEWEB)

    Shan, Xiaopeng [Iowa State Univ., Ames, IA (United States)


    Two ionic and one neutral methyl(oxo)rhenium(V) compounds were synthesized and structurally characterized. They were compared in reactivity towards the ligands triphenylphosphane, pyridines, pyridine N-oxides. Assistance from Broensted bases was found on ligand displacement of ionic rhenium compounds as well as nucleophile assistance on oxidation of all compounds. From the kinetic data, crystal structures, and an analysis of the intermediates, a structural formula of PicH+3- and mechanisms of ligand displacement and oxidation were proposed.

  16. Effect of Temperature and Mole Ratio on the Synthesis Yield of Rhenium-Tetrofosmin

    Directory of Open Access Journals (Sweden)



    Full Text Available Technetium-99m (99mTc tetrofosmin is widely used in nuclear medicine as a diagnostic agent for myocardial perfusion and as a tumor imaging agent. As a parenteral preparation it requires an evaluation of its pharmacokinetics and stability in-vivo. Since 99mTc has a short half-life and is only available in very low concentrations, it is impossible to characterize its chemical properties and presence in the body. Due to this reason, only technetium-99 (T1/2 = 5 × 105 years, which is available in macro quantities, or natural rhenium can be used for this purpose. In this study rhenium-188 (188Re tetrofosmin will be synthesized and applied, because non-radioactive Re can be easily obtained. Synthesis and radiochemical purity analysis of carrier-added 188Re-tetrofosmin were carried out as a model to study the in-vivo stability of technetium-99m tetrofosmin. Rhenium-188 was used as a tracer to identify the formation of rhenium tetrofosmin. Rhenium gluconate was synthesized first prior to the formation of rhenium tetrofosmin. The quality of labeling for both rhenium gluconate and rhenium tetrofosmin was analyzed using paper- and thin-layer chromatography, respectively. Rhenium gluconate can be synthesized with high labeling yield within 1 hour, whereas rhenium tetrofosmin was synthesized both in room temperature and in an elevated temperature with various tetrofosmin-to-rhenium mole ratios.The results showed that heating at 95oC led to a higher yield of more than 90% within 30 minutes. Rhenium tetrofosmin could be produced in high radiochemical purity using an excess of tetrofosmin with mole ratio of 2000. It is concluded that rhenium tetrofosmin could be synthesized through the formation of rhenium gluconate, and a higher yield could be obtained in a shorter time by heating process.

  17. Electrocatalysis of the hydrogen evolution reaction by rhenium oxides electrodeposited by pulsed-current

    International Nuclear Information System (INIS)

    Vargas-Uscategui, Alejandro; Mosquera, Edgar; Chornik, Boris; Cifuentes, Luis


    Highlights: • Rhenium oxides were produced by means of pulsed current electrodeposition over ITO. • The electrocatalytic behavior of rhenium oxides electrodeposited over ITO was studied. • Electrodeposited rhenium oxides showed electrocatalytic behavior increasing the rate of the hydrogen evolution reaction. • The electrocatalysis behavior was explained considering the relative abundance of Re species on the surface of the electrodeposited material. - Abstract: Rhenium oxides are materials of interest for applications in the catalysis of reactions such as those occurring in fuel cells and photoelectrochemical cells. This research work was devoted to the production of rhenium oxide by means of pulsed current electrodeposition for the electrocatalysis of the hydrogen evolution reaction (HER). Rhenium oxides were electrodeposited over a transparent conductive oxide substrate (Indium Tin-doped Oxide – ITO) in an alkaline aqueous electrolyte. The electrodeposition process allowed the production of rhenium oxides islands (200–600 nm) with the presence of three oxidized rhenium species: Re"I"V associated to ReO_2, Re"V"I associated to ReO_3 and Re"V"I"I associated to H(ReO_4)H_2O. Electrodeposited rhenium oxides showed electrocatalytic behavior over the HER and an increase of one order of magnitude of the exchange current density was observed compared to the reaction taking place on the bare substrate. The electrocatalytic behavior varied with the morphology and relative abundance of oxidized rhenium species in the electrodeposits. Finally, two mechanisms of electrocatalysis were proposed to explain experimental results.

  18. Extraction of rhenium(VII) by phosphorylated podands

    International Nuclear Information System (INIS)

    Turanov, A.N.; Karandashev, V.K.; Baulin, V.E.


    Interphase distribution of ReO 4 - between aqueous solutions of H 2 SO 4 and solutions of phosphoryl-containing podands in organic solvents is studied. Stoichiometry of the complexes extracted is determined. Effect of extractant structure and nature of organic solvent on efficiency of rhenium extraction into organic phase is determined [ru

  19. 45 CFR 164.400 - Applicability. (United States)


    ... SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured Protected Health Information § 164.400 Applicability. The requirements of this subpart shall apply with respect to breaches of protected health...

  20. 46 CFR 164.019-1 - Scope. (United States)


    ..., DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL MATERIALS Personal Flotation Device Components § 164.019-1 Scope. (a) This subpart contains general requirements for standard personal flotation device (PFD) components, procedures for acceptance of...

  1. Rhenium 188 labelling of peptide conjugates

    International Nuclear Information System (INIS)

    Melendez-Alafort, Laura


    Many human tumours express high levels, of somatostatin receptors. In order to make possible a radiotherapeutic treatment of this kind for tumour a series of somatostatin analogues that can tightly chelate beta emitting isotopes have been developed in recent years. The work carried out for this thesis has been aimed towards development of a new therapeutic radiopharmaceutical for treatment of somatostatin receptor positive tumours. The first chapters describe work with technetium-99m to establish the labelling and analytical conditions for a somatostatin analogue, [Tyr 3 ]-octreotide (TOC), as a precursor to undertaking labelling studies with the beta emitter rhenium-188. 6-Hydrazinopyridine-3-carboxylic acid (HYNIC) was conjugated to TOC and labelled with 99m using different coligands. Then the stability, receptor binding and biodistribution of each complex were assessed. 99m Tc-HYNIC-TOC using EDDA as coligand showed the best characteristics, and was superior for tumour imaging in humans than the commercially available 111 In-DTPA-octreotide. The conditions for labelling the HYNIC-TOC conjugate with 188 Re were then optimised using tricine as a co-ligand. A labelling yield of ∼80% was achieved. After purification however, the stability of the complex was low. The use of other coligand systems which had proved useful for 99m Tc labelling was explored, but yields were very poor. Other chelators such as diethylenetriamine pentaacetic acid (DTPA), dimercaptosuccinic acid (DMSA) and mercaptoacetyltriglycine (MAG 3 ) were studied as potential co-ligand agents to label the HYNIC-TOC conjugate with 188 Re but, again low yields of the labelled peptide complexes were achieved. A novel 188 Re-HYNIC complex was prepared in high yields using N-N-disubstituted dithiocarbamates as coligands. However to date, the specific activities achieved with this system are relatively low. The use of the [ 99m Tc(CO) 3 (H 2 O) 3 ] complex to label the HYNIC-TOC conjugate was investigated

  2. The kinetics of anodic dissolution of rhenium in aqueous electrolyte solutions

    International Nuclear Information System (INIS)

    Atanasyants, A.G.; Kornienko, V.A.


    The kinetics of anodic rhenium dissolution was investigated by means of potentiodynamic and potentiostatic polarization curves recorded at temperature from 293 to 333 K in different media (NaOH, KOH, NaCl, NaBr, HCl, H 2 SO 4 ) using the rotating disc technique. It is shown that the kinetics of anodic rhenium dissolution and effective activation energy depend not only on the composition and pH value of the solutions but also on the structure of the dissolving rhenium surface. The investigation of the anodic behaviour of the rhenium monocrystal revealed the existence of anisotropy of the monocrystal electrochemical properties. The experimental results point to an important role of adsorption processes in anodic rhenium dissolution. Rhenium dissolution proceeds with formation of intermediate surface adsorption complexes between the metal and the components of the solution

  3. Determination of rhenium in ores of complex composition by the kinetic method

    Energy Technology Data Exchange (ETDEWEB)

    Pavlova, L G; Gurkina, T V [Kazakhskij Gosudarstvennyj Univ., Alma-Ata (USSR); Tsentral' naya Lab. Yuzhno-Kazakhstanskogo Geologicheskogo Upravleniya, Alma-Ata (USSR))


    The kinetic rhenium determination method is proposed based on rhenium catalytic effect in the reaction of malachite green with thiourea. The accompanying elements, excluding molybdenum, do not interfere with the rhenium determination at their concentration of up to 0.1 M. The interfering influence of molybdenum can be eliminated by addition of tartaric acid to the solution up to the concentration of 0.1 M. This enables to determine rhenium in presence of 1000-fold quantity of molybdenum. The method is applicable for the analysis of complex copper-zinc sulphide ores.

  4. Treatment of liver cancer with Rhenium-188 Lipiodol: Colombian experience

    International Nuclear Information System (INIS)

    Bernal, P.; Osorio, M.; Mendoza, M.; Esguerra, R.; Ucros, G.; Gutierrez, C.; Velez, O.; Cerquera, A.M.; Padhy, A.K.


    Aim:Trans-arterial Radio-conjugate therapy plays an important role in the palliative treatment of inoperable liver cancer. It also helps in reduction of the tumor to an operable state from an inoperable one. As a part of an IAEA sponsored coordinated research project, a new radiopharmaceutical, Rhenium-188 Lipiodol has been developed. The aim of this study was to establish the safety of the radiopharmaceutical and to find out the efficacy of treatment. Materials and Methods: Eight patients suffering from various forms of liver cancer (Hepatocellular carcinoma-4, Metastases from carcinoma of colon-3 and Carcinoid- 1) were treated with Rhenium -188 Lipiodol. Seven out of the eight patients were classified as ECOG- 1 and one as ECOG- 3. Labelling of Rhenium-188 with Lipiodol was carried out according to a protocol developed under the CRP and standardized in our service. Rhenium-188 Lipiodol was administered through the trans-arterial route by either selective (75%) or ultra selective (25%) hepatic arteriography. Administered therapeutic doses ranged between 170 MBq and 4181 MBq. Dosimetric evaluations were made using the IAEA developed dosimetry spreadsheet. All patients were followed up (1-5 months, average = 2 months) after treatment by clinical examination, liver function tests, haematological examinations and CT scans of liver to determine the size of hepatic tumor. Results: Rhenium-188 Lipiodol treatment was well tolerated by all patients. No immediate systemic complications were noted in any of the patients within 72 hrs. following therapy. Only two patients had mild rise in temperature in the immediate post-therapy period, which subsided subsequently. One patient who was classified as Child B and ECOG 3, developed encephalopathy on the seventh day after treatment. He died of hepatic failure. Another one present depressive syndrome, didn't accept food and died Follow-up CT scans in all the surviving (6/8) patients revealed significant reduction of the tumours


    Energy Technology Data Exchange (ETDEWEB)

    de Steese, J. G.; Zollweg, R. J.


    The plasma-anode technique was used to observe anomalously high thermionic emission from a rhenium surface with small cesium coverage, where the work function of the composite surface is greater than the ionization potential of cesium. Data suggest that emission enhancement is caused by increased cesium coverage because of cesiumion trapping near the emitter surface under the influence of an ion-rich sheath. (auth)

  6. Molecular Engineering of Technetium and Rhenium Based Radiopharmaceuticals

    International Nuclear Information System (INIS)

    Zubieta, J.


    The research was based on the observation that despite the extraordinarily rich coordination chemistry of technetium and rhenium and several notable successes in reagent design, the extensive investigations by numerous research groups on a variety of N 2 S 2 and N 3 S donor type ligands and on HYNIC have revealed that the chemistries of these ligands with Tc and Re are rather complex, giving rise to considerable difficulties in the development of reliable procedures for the development of radiopharmaceutical reagents

  7. Manufacture and properties of molybdenum-rhenium alloys

    International Nuclear Information System (INIS)

    Fischer, B.; Freund, D.


    It is necessary to measure strength and creep behavior to guarantee the safe and reliable usage of refractory alloys at extremely high temperatures. In the literature there is very little information available about the properties of Mo-Re alloys at temperatures higher than 1000 C. A special test facility has been designed and built for stress-rupture testing at very high temperatures (up to 3000 C) of refractory metals and alloys in inert atmospheres. - The stress-rupture strength as well as the creep behavior of molybdenum-rhenium alloys with rhenium contents between 41 and 51 wt.% have been determined at temperatures ranging from 1200 to 2000 C, and rupture times of up to 10 hours using this facility. Previous measurements of stress-rupture strength and creep behavior of pure rhenium have been compared with the measurement results of Mo-Re alloys. - The discussion of the values measured is based on metallographic test results and scanning electron microscopy (SEM) images of Mo-Re alloy samples after stress-rupture testing. (orig.) [de

  8. 45 CFR 164.304 - Definitions. (United States)


    ... laptop or desktop computer, or any other device that performs similar functions, and electronic media... SECURITY AND PRIVACY Security Standards for the Protection of Electronic Protected Health Information § 164... and procedures, to manage the selection, development, implementation, and maintenance of security...

  9. 45 CFR 164.308 - Administrative safeguards. (United States)


    ..., contain, and correct security violations. (ii) Implementation specifications: (A) Risk analysis (Required). Conduct an accurate and thorough assessment of the potential risks and vulnerabilities to the... vulnerabilities to a reasonable and appropriate level to comply with § 164.306(a). (C) Sanction policy (Required...

  10. 34 CFR 668.164 - Disbursing funds. (United States)


    ..., DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cash Management § 668.164 Disbursing funds. (a... (iv) Dispensing cash for which the institution obtains a signed receipt from the student or parent. (2... another bank), so that the student does not incur any cost in making cash withdrawals from that office or...

  11. 50 CFR 648.164 - Possession restrictions. (United States)


    ... Atlantic Bluefish Fishery § 648.164 Possession restrictions. (a) No person shall possess more than 15 bluefish in, or harvested from, the EEZ unless that person is the owner or operator of a fishing vessel issued a bluefish commercial permit or is issued a bluefish dealer permit. Persons aboard a vessel that...

  12. Effect of rhenium addition on tungsten fuzz formation in helium plasmas

    NARCIS (Netherlands)

    Khan, A.; De Temmerman, G.; Morgan, T. W.; M. B. Ward,


    The effect of the addition of rhenium to tungsten on the formation of a nanostructure referred to as ‘fuzz’ when exposed to helium plasmas at fusion relevant ion fluxes was investigated in the Magnum and Pilot PSI devices at the FOM Institute DIFFER. The effect rhenium had on fuzz growth was seen to

  13. Synthesis and study of rhenium (5) complexes with benzimidazole and rubeanic acid

    International Nuclear Information System (INIS)

    Basitova, S.M.; Yurina, R.D.; Kotegov, K.V.; Amindzhanov, A.A.


    Mixed rhenium (5) oxohalide complex compounds with benzimidazole and rubeanic acid are synthesized. Composition of the compounds obtained is established by IR spectroscpy thermal and chemical analyses. It is shown that rhenium (5) chloride compound stability to pyrolysis is rather lower than that of the corresponding bromide derivatives

  14. Synthesis and study of rhenium (5) complexes with benzimidazole and rubeanic acid

    Energy Technology Data Exchange (ETDEWEB)

    Basitova, S M; Yurina, R D; Kotegov, K V; Amindzhanov, A A


    Mixed rhenium (5) oxohalide complex compounds with benzimidazole and rubeanic acid are synthesized. Composition of the compounds obtained is established by IR spectroscpy thermal and chemical analyses. It is shown that rhenium (5) chloride compound stability to pyrolysis is rather lower than that of the corresponding bromide derivatives.

  15. Effect of rhenium addition on tungsten fuzz formation in helium plasmas

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Aneeqa, E-mail: [School of Mechanical, Aerospace and Civil Engineering, The University of Manchester, M13 9PL (United Kingdom); De Temmerman, Gregory [ITER Organization, Route de Vinon-sur-Verdon, CS 90 046 - 13067 St Paul Lez Durance Cedex (France); Morgan, Thomas W. [FOM Institute DIFFER – Dutch Institute for Fundamental Energy Research, Partner in the Trilateral Euregio Cluster, Eindhoven (Netherlands); Ward, Michael B. [Institute for Materials Research, School of Chemical Process Engineering, University of Leeds, Leeds, LS2 9JT (United Kingdom)


    The effect of the addition of rhenium to tungsten on the formation of a nanostructure referred to as ‘fuzz’ when exposed to helium plasmas at fusion relevant ion fluxes was investigated in the Magnum and Pilot PSI devices at the FOM Institute DIFFER. The effect rhenium had on fuzz growth was seen to be dependent on time, temperature and flux. Initial fuzz growth was seen to be highly dependent on grain orientation, with rhenium having little effect. Once the fuzz was fully developed, the effect of grain orientation disappeared and the rhenium had an inhibiting effect on growth. This could be beneficial for inhibiting fuzz growth in a future fusion reactor, where transmutation of tungsten to rhenium is expected. It also appears that erosion or annealing of the fuzz is limiting growth of fuzz at higher temperatures in the range of ∼1340 °C.

  16. Effect of rhenium addition on tungsten fuzz formation in helium plasmas

    International Nuclear Information System (INIS)

    Khan, Aneeqa; De Temmerman, Gregory; Morgan, Thomas W.; Ward, Michael B.


    The effect of the addition of rhenium to tungsten on the formation of a nanostructure referred to as ‘fuzz’ when exposed to helium plasmas at fusion relevant ion fluxes was investigated in the Magnum and Pilot PSI devices at the FOM Institute DIFFER. The effect rhenium had on fuzz growth was seen to be dependent on time, temperature and flux. Initial fuzz growth was seen to be highly dependent on grain orientation, with rhenium having little effect. Once the fuzz was fully developed, the effect of grain orientation disappeared and the rhenium had an inhibiting effect on growth. This could be beneficial for inhibiting fuzz growth in a future fusion reactor, where transmutation of tungsten to rhenium is expected. It also appears that erosion or annealing of the fuzz is limiting growth of fuzz at higher temperatures in the range of ∼1340 °C.

  17. Brucellosis: a retrospective evaluation of 164 cases. (United States)

    Kazak, Esra; Akalın, Halis; Yılmaz, Emel; Heper, Yasemin; Mıstık, Reşit; Sınırtaş, Melda; Özakın, Cüneyt; Göral, Güher; Helvacı, Safiye


    Brucellosis is a public health problem that is prevalent in several developing countries. The clinical and laboratory characteristics of 164 cases of brucellosis in Bursa, Turkey, were retrospectively evaluated. The ages of the 164 patients ranged from 15-85 years. All of the patients underwent the Rose Bengal test and 163 (99.4%) patients tested positive. 122 (74.4%) patients were diagnosed with acute brucellosis, 31 (18.9%) with subacute brucellosis and 11 (6.7%) with chronic brucellosis. Focal involvement was found in 101 (61.6%) patients. Although patients with focal involvement had a higher white blood cell count (p = 0.002), those without focal involvement had higher aspartate transaminase and alanine transaminase values, and lower platelet values (p = 0.005, 0.007 and 0.039, respectively). Spondylodiscitis was observed on imaging in 58 (66.7%) of the 87 patients who presented with back pain. Among the 118 patients who were examined within the first month of treatment, 79 (66.9%) responded to treatment. The relapse rate was 11.6% among all 164 patients. Brucellosis should be considered as a differential diagnosis among patients who present with fever, and joint or back pain. Focal involvement should be investigated in the presence of leucocytosis, and subacute or chronic forms of brucellosis. To identify cases of spondylodiscitis, radiography should be performed in patients who present with back pain. Copyright: © Singapore Medical Association

  18. Rhenium(V) complexes with sulfur-containing amino acids

    International Nuclear Information System (INIS)

    Gagieva, S.Ch.; Tautieva, M.A.; Tsaloev, A.T.; Galimov, Yu.B.; Gagieva, L.Ch.; Belyaeva, T.N.


    Rhenium(V) complexes with 2-amino-4-(methylthio)butanoic acid (methionine, Met) and 2-amino-3-sulfopropionic acid (cysteine, Cys) have been synthesized. Depending on the initial reagent ratio, the resulting complexes contain one or two ligand molecules. On heating the compounds with one amino acid molecule, two hydrogen halide molecules are removed at 128-132 deg C to form a molecular complex. The composition, structure, and thermal stability of the complexes have been studied by elemental analysis, conductometry, IR spectroscopy, NMR, and mass spectrometry [ru

  19. Synthesis and physicochemical characterization of rhenium (V) complexes with bisbenzoylthiosemicarbazones

    International Nuclear Information System (INIS)

    Gagieva, S.Ch.; Gutnova, N.A.; Tsaloev, A.T.; Khubulov, A.B.; Arutyunyants, A.A.; Galimov, Yu.B.


    Rhenium (V) complexing with mono- and bis-benzoylthiosemicarbazones is studied in dependence on hydrohalic acids concentration changes. It is determined that in media with high concentration of hydrohalic acids (6 mol/l HCl, 7 mol/l HBr) in dependence on reaction conditions stable complexes with bi- and tridentate coordination of thiosemicarbazone are formed. In the case of hydrohalic acid concentration decreasing stable binuclear and oxohydroxycomplexes are formed. Composition and structure of the compounds obtained are determined by the methods of element analysis, IR spectroscopy, conductometry. Thermal investigations of the compounds obtained are done [ru

  20. Cermets based on rhenium and rare earth element oxides

    International Nuclear Information System (INIS)

    Varfolomeev, M.B.; Velichko, A.V.; Zajtseva, L.L.; Shishkov, N.V.


    The reduction of perrhenates of rare earth elements and of yttrium by hydrogen and the subsequent sintering have yielded cermets based on rhenium and rare earth element oxides inherent in which are more disperse and homogeneous structures than those of the ''molecular'' rare earth element-Tc cermets. The dispersity of cermets increases in the rare earth elements series from La to Lu. The microhardness of the Re phase in cermets is 490 kgf/mm 2 ; the total microhardness of a cermet is substantially higher

  1. Liquid kit for preparation of {sup 188}rhenium-etidronate

    Energy Technology Data Exchange (ETDEWEB)

    Marczewski, Barbara; Dias, Carla Roberta; Moraes, Vanessa; Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Centro de Radiofarmacia]. E-mail:


    The aim of this study was the preparation of a liquid kit for radiolabeling of {sup 188} Re-HEDP (hydroxyethylidene diphosphonate). {sup 188} Re was obtained from alumina based {sup 188} W/{sup 188} Re generators. This paper reports the efficacy of a cold kit stored for more than two weeks, determined by the dependence of the radiolabeling yields of {sup 188} Re-HEDP on the incubation time, reducing agent concentration, the effects of concentration of ligand, the p H of the reaction and the temperature. The cold kits showed a good stability when carrie-free rhenium-188 was added in the reaction mixture. (author)

  2. Liquid kit for preparation of 188rhenium-etidronate

    International Nuclear Information System (INIS)

    Marczewski, Barbara; Dias, Carla Roberta; Moraes, Vanessa; Osso Junior, Joao Alberto


    The aim of this study was the preparation of a liquid kit for radiolabeling of 188 Re-HEDP (hydroxyethylidene diphosphonate). 188 Re was obtained from alumina based 188 W/ 188 Re generators. This paper reports the efficacy of a cold kit stored for more than two weeks, determined by the dependence of the radiolabeling yields of 188 Re-HEDP on the incubation time, reducing agent concentration, the effects of concentration of ligand, the p H of the reaction and the temperature. The cold kits showed a good stability when carrie-free rhenium-188 was added in the reaction mixture. (author)

  3. Rhenium(V) complexing with benzimidazole in acidic media

    International Nuclear Information System (INIS)

    Zakaeva, R.Sh.; Gagieva, S.Ch.; Kaloev, N.I.; Bukov, N.N.; Panyushkin, V.T.


    Coordination compounds of rhenium(V) with 1H-benzimidazole (L) separated from acid media: (HL) 2 [ReOX 5 ](H 2 O) n and [ReOL x X y (H 2 O) z ](H 2 O) n (HL and L - protonated and deprotonated forms of benzimidazole; X = Cl - , Br - ) were studied by the methods of IR spectroscopy, 1 H NMR spectroscopy and thermal gravimetric analysis. Methods of ligand coordination in the complexes are discussed on the basis of data obtained [ru

  4. Clustering of transmutation elements tantalum, rhenium and osmium in tungsten in a fusion environment (United States)

    You, Yu-Wei; Kong, Xiang-Shan; Wu, Xuebang; Liu, C. S.; Fang, Q. F.; Chen, J. L.; Luo, G.-N.


    The formation of transmutation solute-rich precipitates has been reported to seriously degrade the mechanical properties of tungsten in a fusion environment. However, the underlying mechanisms controlling the formation of the precipitates are still unknown. In this study, first-principles calculations are therefore performed to systemically determine the stable structures and binding energies of solute clusters in tungsten consisting of tantalum, rhenium and osmium atoms as well as irradiation-induced vacancies. These clusters are known to act as precursors for the formation of precipitates. We find that osmium can easily segregate to form clusters even in defect-free tungsten alloys, whereas extremely high tantalum and rhenium concentrations are required for the formation of clusters. Vacancies greatly facilitate the clustering of rhenium and osmium, while tantalum is an exception. The binding energies of vacancy-osmium clusters are found to be much higher than those of vacancy-tantalum and vacancy-rhenium clusters. Osmium is observed to strongly promote the formation of vacancy-rhenium clusters, while tantalum can suppress the formation of vacancy-rhenium and vacancy-osmium clusters. The local strain and electronic structure are analyzed to reveal the underlying mechanisms governing the cluster formation. Employing the law of mass action, we predict the evolution of the relative concentration of vacancy-rhenium clusters. This work presents a microscopic picture describing the nucleation and growth of solute clusters in tungsten alloys in a fusion reactor environment, and thereby explains recent experimental phenomena.

  5. 45 CFR 164.412 - Law enforcement delay. (United States)


    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Law enforcement delay. 164.412 Section 164.412 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES ADMINISTRATIVE DATA STANDARDS AND RELATED... § 164.412 Law enforcement delay. If a law enforcement official states to a covered entity or business...

  6. 29 CFR 2570.164 - Consequences of default. (United States)


    ... 29 Labor 9 2010-07-01 2010-07-01 false Consequences of default. 2570.164 Section 2570.164 Labor Regulations Relating to Labor (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR... ERISA Section 502(c)(8) § 2570.164 Consequences of default. For 502(c)(8) civil penalty proceedings...

  7. 29 CFR 1915.164 - Ship's propulsion machinery. (United States)


    ... 29 Labor 7 2010-07-01 2010-07-01 false Ship's propulsion machinery. 1915.164 Section 1915.164 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.164 Ship's...

  8. Use of cluster rhenium substances with alkyl ligands for inhibition of the Guerin carcinoma Growth

    Directory of Open Access Journals (Sweden)

    O. S. Voronkova


    Full Text Available Quantity and quality of erythrocytes, blood haemoglobin concentration, glucose levels in the erythrocytes and plasma, content of TBA-active products in blood plasma of rats were studied during development of the Guerin carcinoma, introduction of cis-platinum and cluster rhenium substances with organic ligands. It was shown that rhenium substances had essential antioxidant effects and changed the dynamic of tumour growth. The conclusion on perspectiveness of further investigations of rhenium substances with cluster fragment and organic ligands in experiments in vivo with changed redox-status of an organism was drawn.

  9. Reductive coupling of carbon monoxide in a rhenium carbonyl complex with pendant Lewis acids. (United States)

    Miller, Alexander J M; Labinger, Jay A; Bercaw, John E


    Phosphinoborane ligands impart unique reactivity to a rhenium carbonyl cation relative to simple phosphine complexes. Addition of either triethylborohydride or a platinum hydride (that can be formed from H2) forms a rhenium boroxycarbene. This carbene, which crystallizes as a dimer, disproportionates over a period of days to afford the starting cation and a structurally unprecedented boroxy(boroxymethyl)carbene, in which a new C-C bond has been formed between two reduced CO ligands. This product of C-C bond formation can be independently synthesized by addition of 2 equiv of hydride to the rhenium carbonyl cation.

  10. Ambient aging of rhenium filaments used in thermal ionization mass spectrometry: Growth of oxo-rhenium crystallites and anti-aging strategies

    Directory of Open Access Journals (Sweden)

    Joseph M. Mannion


    Full Text Available Degassing is a common preparation technique for rhenium filaments used for thermal ionization mass spectrometric analysis of actinides, including plutonium. Although optimization studies regarding degassing conditions have been reported, little work has been done to characterize filament aging after degassing. In this study, the effects of filament aging after degassing were explored to determine a “shelf-life” for degassed rhenium filaments, and methods to limit filament aging were investigated. Zone-refined rhenium filaments were degassed by resistance heating under high vacuum before exposure to ambient atmosphere for up to 2 months. After degassing the nucleation and preferential growth of oxo-rhenium crystallites on the surface of polycrystalline rhenium filaments was observed by atomic force microscopy and scanning electron microscopy (SEM. Compositional analysis of the crystallites was conducted using SEM-Raman spectroscopy and SEM energy dispersive X-ray spectroscopy, and grain orientation at the metal surface was investigated by electron back-scatter diffraction mapping. Spectra collected by SEM-Raman suggest crystallites are composed primarily of perrhenic acid. The relative extent of growth and crystallite morphology were found to be grain dependent and affected by the dissolution of carbon into filaments during annealing (often referred to as carbonization or carburization. Crystallites were observed to nucleate in region specific modes and grow over time through transfer of material from the surface. Factors most likely to affect the rates of crystallite growth include rhenium substrate properties such as grain size, orientation, levels of dissolved carbon, and relative abundance of defect sites; as well as environmental factors such as length of exposure to oxygen and relative humidity. Thin (∼180 nm hydrophobic films of poly(vinylbenzyl chloride were found to slow the growth of oxo-rhenium crystallites on the filament

  11. Nipponium, the element ascribable to rhenium from the modern chemical viewpoint

    Energy Technology Data Exchange (ETDEWEB)

    Yoshihara, H.K. [Japan Isotope Data Inst., Sendai (Japan)


    Though the discovery of nipponium by Ogawa in 1908 was judged to be false and his work was forgotten for many years, the new element he believed to have found should be ascribed to rhenium (z = 75) by the following reasons: (1) the spectral line of 4882 A agrees well with the present data of rhenium, (2) recalculation of the atomic weight of the element supports the value in the neighbourhood of 185 which is very close to the present value 186.2 of rhenium, and (3) rhenium is actually present in Japanese molybdenite he studied. Therefore, it is concluded that his discovery of the `new` element was correct, but assignment of z = 43 was wrong. (orig.)

  12. Development of unified X-ray fluorescent analysis to determine rhenium content in multicomponent oxide compositions

    International Nuclear Information System (INIS)

    Drobot, D.V.; Belyaev, A.V.; Kutvitskij, V.A.; Rysev, A.P.


    A procedure to prepare rhenium-containing glass-like specimens on the basis of bismuth and boron oxides is proposed. The glasses produced are studied by X-ray fluorescent analysis and routine spectrometric thiocyanate analysis. The results make it possible to determine rhenium in oxide mixtures in the range of its content 0.01 - 10% with S r = 0.03 [ru

  13. Determination of rhenium (7) trace amounts by spectrophotometric titration in medium of mixed solvents

    International Nuclear Information System (INIS)

    Kuznetsov, V.V.; Samorukova, O.L.


    The method has been proposed of determining rhenium (7) microamounts by spectrophotometric titration in the medium water-dimethyl-sulphoxide with the reagent nitrochromazo. The method is based on the formation of ionic pairs K + ReO 4 - in water-organic solvents. The results of rhenium determination are satisfactory in a wide concentration range up to 0.3 mkg in 15 ml which makes the method proposed close in sensitivity to photometric methods and much better in reproducibility

  14. Reductive Coupling of Carbon Monoxide in a Rhenium Carbonyl Complex with Pendant Lewis Acids


    Miller, Alexander J. M.; Labinger, Jay A.; Bercaw, John E.


    Phosphinoborane ligands impart unique reactivity to a rhenium carbonyl cation relative to simple phosphine complexes. Addition of either triethylborohydride or a platinum hydride (that can be formed from H2) forms a rhenium boroxycarbene. This carbene, which crystallizes as a dimer, disproportionates over a period of days to afford the starting cation and a structurally unprecedented boroxy(boroxymethyl)carbene, in which a new C−C bond has been formed between two reduced CO ligands. This prod...

  15. Alkene-glycol interconversion with technetium and rhenium oxo complexes

    International Nuclear Information System (INIS)

    Pearlstein, R.M.; Davison, Alan


    The trioxotechnetium(VII) complexes TcO 3 Cl(AA) (AA = phen, bpy, 5-NO 2 -phen, 3,4,7,8-Me 4 -phen) cleanly oxidize olefins (C 2 R 4 ) in solution at 22 0 C, forming in high yields the corresponding oxotechnetium(V) diolate complexes, TcOCl(OCR 2 CR 2 O)(AA). The complexes have been characterized by 1 H NMR, IR, elemental analysis, and fast atom bombardment mass spectrometry. The free diols isolated by hydrolysis of these diolate complexes with HCl were shown by capillary gas chromatography to represent syn addition of the two hydroxyl groups across the double bond. The related rhenium complex, ReOCl(OCH 2 CH 2 O)(phen) undergoes the reverse reaction when thermalized, releasing ethylene and producing ReO 3 Cl(phen). (author)

  16. Catalytic transformation of functionalized carboxylic acids using multifunctional rhenium complexes. (United States)

    Naruto, Masayuki; Agrawal, Santosh; Toda, Katsuaki; Saito, Susumu


    Carboxylic acids (CAs) are one of the most ubiquitous and important chemical feedstocks available from biorenewable resources, CO 2 , and the petrochemical industry. Unfortunately, chemoselective catalytic transformations of CH n CO 2 H (n = 1-3) groups into other functionalities remain a significant challenge. Herein, we report rhenium V complexes as extremely effective precatalysts for this purpose. Compared to previously reported heterogeneous and homogeneous catalysts derived from high- or low-valent metals, the present method involves a α-C-H bond functionalization, a hydrogenation, and a hydrogenolysis, which affords functionalized alcohols with a wide substrate scope and high chemoselectivity under relatively mild reaction conditions. The results represent an important step toward a paradigm shift from 'low-valent' to 'high-valent' metal complexes by exploring a new portfolio of selective functional group transformations of highly oxygenated organic substrates, as well as toward the exploitation of CAs as a valuable biorenewable feedstock.

  17. Convenient synthesis of bis(alkoxy)rhenium(VII) complexes

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Z.; Al-Ajlouni, A.M.; Espenson, J.H. [Iowa State Univ., Ames, IA (United States)


    The study of high-oxidation-state organorhenium compounds has been a field of continuing activity, thanks to the success of methylrhenium trioxide (CH{sub 3}ReO{sub 3} or MTO) in catalytic processes. This catalyst is effective in oxidations, olefin metathesis, the olefination of aldehydes, and the preparation of other compounds with three-membered rings. The syntheses of some rhenium compounds derived form MTO have been reported. Epoxide formation is a key reaction, and it bears directly on these findings reported here. Re(VII) complexes containing a chelated bis(diolate) ligand can be synthesized by refluxing MTO with 2,3-dimethyl-2,3-diol. Here, the authors report a more convenient method for this preparation. A different series of related compounds consists of chelated bis(diolates) of the Cp*Re-oxo series, Cp*ReO-(diolate).

  18. 40 CFR 164.1 - Number of words. (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Number of words. 164.1 Section 164.1... OTHER HEARINGS CALLED PURSUANT TO SECTION 6 OF THE ACT General § 164.1 Number of words. As used in this part, a word in the singular form shall be deemed to import the plural, and vice versa, as the case may...

  19. Endocavitary treatment of craniopharyngioma cysts by 186-rhenium. Traitement endocavitaire par le rhenium 186 des kystes de craniopharyngiomes

    Energy Technology Data Exchange (ETDEWEB)

    Berenger, N.; Lebtahi, R.; Piketty, M.L.; Merienne, L.; Turak, B.; Bok, R.; Askienazy, S. (Hopital Sainte-Anne, 75 - Paris (France)); Munari, C. (Centre Hospitalier Universitaire, 38 - Grenoble (France))


    Forty-three patients with craniopharyngioma cysts were treated by intracystic injection of 186-rhenium. Leakage of colloid isotope into the CSF spaces during the ''test'' or ''therapeutic'' injection was detected by scintigraphic follow-up (15 cases/58 intracystic injections). In fact the physical characteristics of [sup 186]Re are well adapted to the requirements of treatment and, with the gamma emission, also allows early detection of leakage, avoiding irradiation of neighbouring structures. Follow-up studies revealed that craniopharyngioma cysts were effectively treated, with cessation of fluid formation, progressive shrinkage of the cysts leading to total disappearance in 14 cases (10-156 months, mean 52.5) and a considerable decrease in 13 cases (5-53 months, mean 23).

  20. 45 CFR 164.406 - Notification to the media. (United States)


    ... REQUIREMENTS SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured Protected Health Information § 164.406 Notification to the media. (a) Standard. For a breach of unsecured protected health... the discovery of the breach as provided in § 164.404(a)(2), notify prominent media outlets serving the...

  1. 40 CFR 164.50 - Prehearing conference and primary discovery. (United States)



  2. 34 CFR 303.164 - Public awareness program. (United States)


    ... 34 Education 2 2010-07-01 2010-07-01 false Public awareness program. 303.164 Section 303.164 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION EARLY INTERVENTION PROGRAM FOR INFANTS AND TODDLERS WITH DISABILITIES State Application for a...

  3. 29 CFR 1910.164 - Fire detection systems. (United States)


    ... 29 Labor 5 2010-07-01 2010-07-01 false Fire detection systems. 1910.164 Section 1910.164 Labor... detection systems. (a) Scope and application. This section applies to all automatic fire detection systems... detection systems and components to normal operating condition as promptly as possible after each test or...

  4. 7 CFR 457.164 - Nursery rehabilitation endorsement. (United States)


    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery rehabilitation endorsement. 457.164 Section... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.164 Nursery rehabilitation endorsement. Nursery Crop Insurance Rehabilitation Endorsement If you elect this endorsement and pay the...

  5. 33 CFR 164.78 - Navigation under way: Towing vessels. (United States)


    ...) Evaluates the danger of each closing visual or radar contact; (5) Knows and applies the variation and... type of correction; (6) Knows the speed and direction of the current, and the set, drift, and tidal... vessels. 164.78 Section 164.78 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND...

  6. 46 CFR 164.006-3 - Construction, materials, and workmanship. (United States)


    ... 46 Shipping 6 2010-10-01 2010-10-01 false Construction, materials, and workmanship. 164.006-3..., CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL MATERIALS Deck Coverings for Merchant Vessels § 164.006-3 Construction, materials, and workmanship. (a) It is the intent of this specification to obtain a...

  7. Determination coefficient distribution rhenium and tungsten using method extraction with solvent methyl ethyl ketone

    International Nuclear Information System (INIS)

    Riftanio Natapratama Hidayat; Maria Christina Prihatiningsih; Duyeh Setiawan


    Determination of the distribution coefficient (K d ) of the rhenium and tungsten conducted for the purpose of knowing the value of K d of the two elements. K d value determination is applied to the process of separation rhenium-188 from target of tungsten-188 for the purposes purification of radioisotopes that are made to meet the radionuclide and radiochemical purity. The K d value determination using solvent extraction with methyl ethyl ketone (MEK). Prior to the determination of K d values, determined beforehand the optimum conditions of extraction process based on the effect of agitation time, the volume of MEK, and the pH of the solution. Confirmation the results of the extraction was conducted using UV-Vis spectrophotometer with a complexing KSCN under acidic conditions and reductant SnCl 2 . The results showed that the optimum condition extraction process to feed each of 10 ppm is when the agitation for 10 minutes, the volume of MEK in 20 ml, and the pH below 5. Obtained the maximum recovery of rhenium are drawn to the organic phase as much as 9.545 ppm. However, the condition of the extraction process does not affect the migration of tungsten to the organic phase. Then the maximum K d values obtained at 2.7566 rhenium and tungsten maximum K d is 0.0873. Optimum conditions of extraction process can be further tested on radioactive rhenium and tungsten as an alternative to the separation of radioisotopes. (author)

  8. New leads for fragment-based design of rhenium/technetium radiopharmaceutical agents. (United States)

    Brink, Alice; Helliwell, John R


    Multiple possibilities for the coordination of fac -[Re(CO) 3 (H 2 O) 3 ] + to a protein have been determined and include binding to Asp, Glu, Arg and His amino-acid residues as well as to the C-terminal carboxylate in the vicinity of Leu and Pro. The large number of rhenium metal complex binding sites that have been identified on specific residues thereby allow increased target identification for the design of future radiopharmaceuticals. The core experimental concept involved the use of state-of-art tuneable synchrotron radiation at the Diamond Light Source to optimize the rhenium anomalous dispersion signal to a large value ( f '' of 12.1 electrons) at its L I absorption edge with a selected X-ray wavelength of 0.9763 Å. At the Cu  K α X-ray wavelength (1.5418 Å) the f '' for rhenium is 5.9 electrons. The expected peak-height increase owing to the optimization of the Re f '' was therefore 2.1. This X-ray wavelength tuning methodology thereby showed the lower occupancy rhenium binding sites as well as the occupancies of the higher occupancy rhenium binding sites.

  9. New leads for fragment-based design of rhenium/technetium radiopharmaceutical agents

    Directory of Open Access Journals (Sweden)

    Alice Brink


    Full Text Available Multiple possibilities for the coordination of fac-[Re(CO3(H2O3]+ to a protein have been determined and include binding to Asp, Glu, Arg and His amino-acid residues as well as to the C-terminal carboxylate in the vicinity of Leu and Pro. The large number of rhenium metal complex binding sites that have been identified on specific residues thereby allow increased target identification for the design of future radiopharmaceuticals. The core experimental concept involved the use of state-of-art tuneable synchrotron radiation at the Diamond Light Source to optimize the rhenium anomalous dispersion signal to a large value (f′′ of 12.1 electrons at its LI absorption edge with a selected X-ray wavelength of 0.9763 Å. At the Cu Kα X-ray wavelength (1.5418 Å the f′′ for rhenium is 5.9 electrons. The expected peak-height increase owing to the optimization of the Re f′′ was therefore 2.1. This X-ray wavelength tuning methodology thereby showed the lower occupancy rhenium binding sites as well as the occupancies of the higher occupancy rhenium binding sites.

  10. Near-yrast spectroscopy of 164Yb and neighbouring nuclei

    International Nuclear Information System (INIS)

    Jonsson, S.; Roy, H. and others.


    High-spin states in 164 Yb have been populated in the 152 Sm( 16 0,4n) and 150 Sm( 18 0,4n) reactions. From studies of γ-γ coincidences, γ-ray angular distributions and conversion electron measurements the level scheme has been constructed. The g-band and the S-band have been established to spin and parity 22(sup)+ and 26(sup)+, respectively, and the rotational sequences (π,α)=(-,1) 1 , (-,0) 1 and (-,0) 2 to 23(sup)-, 24(sup)- and 18(sup)-, respectively. The sidebands in 162 , 164 Er and 164 , 166 Yb are discussed. Constructed two-quasineutron configurations and cranked shell model (CSM) calculations are compared with the experimental results in 164 Yb. Residual interactions between quasiparticles in 164 Yb are calculated. Crossing frequencies and the gain in alignment are summarized for the Yb isotopes and the main features are discussed. (author)

  11. Influence of cold rolling and strain rate on plastic response of powder metallurgy and chemical vapor deposition rhenium

    International Nuclear Information System (INIS)

    Koeppel, B.J.; Subhash, G.


    The plastic response of two kinds of rhenium processed via powder metallurgy (PM) and chemical vapor deposition (CVD) were investigated under uniaxial compression over a range of strain rates. The PM rhenium, further cold rolled to 50 and 80 pct of the original thickness, was also investigated to assess the influence of cold work on the plastic behavior. A strong basal texture was detected in all the preceding materials as a result of processing and cold work. Both CVD and PM rhenium exhibited an increase in yield strength and flow stress with increasing strain rate. In PM rhenium, cold work resulted in an increase in hardness and yield strength and a decrease in the work hardening rate. The deformed microstructures revealed extensive twinning in CVD rhenium. At large strains, inhomogeneous deformation mode in the form of classical cup and cone fracture was noticed

  12. Influence of nano-cluster compounds of rhenium drugs on the activity of liver enzymes in a tumor model

    Directory of Open Access Journals (Sweden)

    J. V. Suponko


    Full Text Available Enzymes’ level in rat’s hepatocytes under Guerin's carcinoma T8 development as well as after injection of rhenium compounds and cis-platin has been studied. It has been determined that the decrease of enzymatic activity to the level of the animals of control group was observed at the simultaneous injection of cis-platin and cluster rhenium compounds in nanoliposomal and water-soluble forms. That confirms possible hepatoprotective properties of the rhenium compounds. It has been shown that hepatoprotective properties of rhenium cluster compounds mostly don’t depend on the form of their injection and are detected regardless of anticancer properties. Rhenium-platinum system with β-alanine ligand in aqueous solution, has been found. Its injection is accompanied by the hepatoprotective effect.

  13. Lymph node scintigraphy with sup(99m)Tc-rhenium colloid

    International Nuclear Information System (INIS)

    Mitsuhata, Naoki; Suyama, Bunzo; Matsumura, Yosuke; Ohmori, Hiroyuki


    Lymph node scintigraphy with sup(99m)Tc-rhenium colloid in evaluation of nodal involvement by urological malignancy were performed on twelve cases (4 bladder cancer, 3 prostatic cancer, 2 penile cancer and 3 testicular tumor). These cases had been examined the extent of disease on the basis of findings at pedal lymphangiography, urography, computed tomography or laparotomy. sup(99m)Tc-rhenium colloid in a volume of 0.2 ml (2 mCi) was injected into the first interdigital webs of each foot without local anesthesia. In one case of penile cancer radioactive colloid was directly injected into the glans penis and prepuce including tumor area. Our clinical experience reported here reveals that lymph node scintigraphy with sup(99m)Tc-rhenium colloid can provide a useful method of investigating the lymphatic system. This technique is reproducible and can be performed in poor risk patients or pediatric patients readily and safely. (author)

  14. A study of scandia and rhenium doped tungsten matrix dispenser cathode (United States)

    Wang, Jinshu; Li, Lili; Liu, Wei; Wang, Yanchun; Zhao, Lei; Zhou, Meiling


    Scandia and rhenium doped tungsten powders were prepared by solid-liquid doping combined with two-step reduction method. The experimental results show that scandia was distributed evenly on the surface of tungsten particles. The addition of scandia and rhenium could decrease the particle size of doped tungsten, for example, the tungsten powders doped with Sc 2O 3 and Re had the average size of about 50 nm in diameter. By using this kind of powder, scandia and rhenium doped tungsten matrix with the sub-micrometer sized tungsten grains was obtained. This kind of matrix exhibited good anti-bombardment insensitivity at high temperature. The emission property result showed that high space charge limited current densities of more than 60 A/cm 2 at 900 °C could be obtained for this cathode. A Ba-Sc-O multilayer about 100 nm in thickness formed at the surface of cathode after activation led to the high emission property.

  15. Noncontact surface tension and viscosity measurements of rhenium in the liquid and undercooled states

    International Nuclear Information System (INIS)

    Ishikawa, Takehiko; Paradis, Paul-Francois; Yoda, Shinichi


    Surface tension and viscosity of liquid rhenium, which have hardly been measured due to the extremely high melting temperature of rhenium, were measured using an electrostatic levitation method combined with the oscillation drop technique. Sample position instability problems caused by the photon pressure of the heating lasers and by sample evaporation were solved by modifying the electrodes design. Good sample stability allowed the measurements of the surface tension and the viscosity over wide temperature ranges including the undercooled states. Over the 2800-3600 K interval, the surface tension of rhenium was measured as σ(T)=2.71x10 3 -0.23(T-T m ), where T m is the melting temperature, 3453 K. At T m , the datum agrees well with the literature values. Similarly, on the same temperature range, the viscosity was determined as η(T)=0.08 exp[1.33x10 5 /(RT)] (mPa s)

  16. Effect of rhenium irradiations on the mechanical properties of tungsten for nuclear fusion applications

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Aneeqa, E-mail: [School of Mechanical, Aerospace and Civil Engineering, The University of Manchester, M13 9PL (United Kingdom); Elliman, Robert; Corr, Cormac [Research School of Physics and Engineering, The Australian National University, Canberra, ACT 2601 (Australia); Lim, Joven J.H.; Forrest, Andrew [School of Materials, The University of Manchester, M13 9PL (United Kingdom); Mummery, Paul [School of Mechanical, Aerospace and Civil Engineering, The University of Manchester, M13 9PL (United Kingdom); Evans, Llion M. [Culham Centre for Fusion Energy, Culham Science Centre, Abingdon, Oxon, OX14 3DB (United Kingdom)


    As-received and annealed tungsten samples were irradiated at a temperature of 400 °C with Re and W ions to peak concentrations of 1600 appm (atomic parts per million) and damage levels of 40 dpa (displacements per atom). Mechanical properties were investigated using nanoindentation, and the orientation and depth dependence of irradiation damage was investigated using Electron Back Scatter Diffraction (EBSD). Following irradiation there was a 13% increase in hardness in the as received sheet and a 23% increase in the annealed material for both tungsten and rhenium irradiation. The difference between the tungsten and rhenium irradiated samples was negligible, suggesting that for the concentrations and damage levels employed, the presence of rhenium does not have a significant effect on the hardening mechanism. Energy dependent EBSD of annealed samples provided information about the depth distribution of the radiation damage in individual tungsten grains and confirmed that the radiation damage is orientation dependant.

  17. High-temperature extraction of rhenium from sulfuric acid solutions with trialkylamines

    International Nuclear Information System (INIS)

    Gladyhev, V.P.; Andreeva, N.N.; Kim, E.M.; Kovaleva, S.V.


    This paper attempts to determine the possibility of conducting high-temperature extraction of rhenium from sulfuric acid solutions with trialkylamines (TAA) using higher hydrocarbon-paraffin mixtures as the diluent of the extraction system. Substitution of kerosene by paraffin in the extraction system would permit decreasing the danger of fire and explosions during he extraction process. In extracting rhenium from industrial solutions with a melt of higher paraffins containing TAA and alcohols, the extraction system can be continously heated in heat exchangers through which washing sulfuric acid passes and then goes to the extractor. This permits utilizing the heat and decreases the temperature of the solutions for extraction to the optimum temperatures. Extraction of rhenium with a melt of trioctylamine in paraffin obeys the same mechanisms as high-temperature extraction of ruthenium (IV) by amines in kerosene and aromatic hydrocarbons

  18. Absorption behavior of technetium and rhenium through plant roots

    International Nuclear Information System (INIS)

    Tagami, K.; Uchida, S.


    The absorption behavior of technetium (Tc) and rhenium (Re) through plant roots was studied using nutrient solution culture. Radish samples, grown in culture solutions for 20-30 days in a green house, were transferred into plastic vessels containing nutrient solutions contaminated with multi-tracer solutions including Tc-95m and Re-183. The plant samples were grown individually for 1-7 days under laboratory conditions. The activities of radionuclides in nutrient solutions and oven-dried plant parts (roots, fleshy roots and leaves) were measured with Ge detecting systems. The concentrations of Tc-95m and Re-183 in the nutrient solutions after harvesting the plants were almost the same as those in the initial solution. Possibly, the radionuclides were taken up with water through plant roots. The distributions of Tc and Re in the plants showed no differences, thus, soluble Tc and Re absorption by plant samples were the same. It is suggested that Re could be used as a geochemical tracer of Tc in the soil environment. (author)

  19. Rhenium Dichalcogenides: Layered Semiconductors with Two Vertical Orientations. (United States)

    Hart, Lewis; Dale, Sara; Hoye, Sarah; Webb, James L; Wolverson, Daniel


    The rhenium and technetium diselenides and disulfides are van der Waals layered semiconductors in some respects similar to more well-known transition metal dichalcogenides (TMD) such as molybdenum sulfide. However, their symmetry is lower, consisting only of an inversion center, so that turning a layer upside-down (that is, applying a C2 rotation about an in-plane axis) is not a symmetry operation, but reverses the sign of the angle between the two nonequivalent in-plane crystallographic axes. A given layer thus can be placed on a substrate in two symmetrically nonequivalent (but energetically similar) ways. This has consequences for the exploitation of the anisotropic properties of these materials in TMD heterostructures and is expected to lead to a new source of domain structure in large-area layer growth. We produced few-layer ReS2 and ReSe2 samples with controlled "up" or "down" orientations by micromechanical cleavage and we show how polarized Raman microscopy can be used to distinguish these two orientations, thus establishing Raman as an essential tool for the characterization of large-area layers.

  20. Polymer Photovoltaic Cells with Rhenium Oxide as Anode Interlayer. (United States)

    Wei, Jinyu; Bai, Dongdong; Yang, Liying


    The effect of a new transition metal oxide, rhenium oxide (ReO3), on the performance of polymer solar cells based on regioregular poly(3-hexylthiophene) (P3HT) and methanofullerene [6,6]-phenyl C61-butyric acid methyl ester (PCBM) blend as buffer layer was investigated. The effect of the thickness of ReO3 layer on electrical characteristics of the polymer solar cells was studied. It is found that insertion of ReO3 interfacial layer results in the decreased performance for P3HT: PCBM based solar cells. In order to further explore the mechanism of the decreasing of the open-circuit voltage (Voc), the X-ray photoelectron spectroscopy (XPS) is used to investigate the ReO3 oxidation states. Kelvin Probe method showed that the work function of the ReO3 is estimated to be 5.13eV after thermal evaporation. The results indicated the fact that a portion of ReO3 decomposed during thermal evaporation process, resulting in the formation of a buffer layer with a lower work function. As a consequence, a higher energy barrier was generated between the ITO and the active layer.

  1. A tungsten-rhenium interatomic potential for point defect studies (United States)

    Setyawan, Wahyu; Gao, Ning; Kurtz, Richard J.


    A tungsten-rhenium (W-Re) classical interatomic potential is developed within the embedded atom method interaction framework. A force-matching method is employed to fit the potential to ab initio forces, energies, and stresses. Simulated annealing is combined with the conjugate gradient technique to search for an optimum potential from over 1000 initial trial sets. The potential is designed for studying point defects in W-Re systems. It gives good predictions of the formation energies of Re defects in W and the binding energies of W self-interstitial clusters with Re. The potential is further evaluated for describing the formation energy of structures in the σ and χ intermetallic phases. The predicted convex-hulls of formation energy are in excellent agreement with ab initio data. In pure Re, the potential can reproduce the formation energies of vacancies and self-interstitial defects sufficiently accurately and gives the correct ground state self-interstitial configuration. Furthermore, by including liquid structures in the fit, the potential yields a Re melting temperature (3130 K) that is close to the experimental value (3459 K).

  2. Structure and x-ray density of electrochemically deposited rhenium films

    International Nuclear Information System (INIS)

    Petrovich, V.A.; Fedenkov, A.L.; Shepurev, S.Yu.


    The electrodeposition of rhenium was carried out at a constant cathode-current density and room temperature. The backing was grade KEF-0.02 single-crystal silicon. The absorption coefficient μ of the film was determined for the K α radiation of the copper line. The investigation enabled us to conclude that electrochemically deposited rhenium films can be used as a material for the masking coatings of x-ray patterns, since the absorption coefficients of the x-ray radiation of the resultant films are superior to the similar parameters of traditionally employed materials, and surpass these materials in terms of corrosion resistance and simplicity of production

  3. Influence of ligand structure on anticancer and antioxidant properties of rhenium cluster compounds

    Directory of Open Access Journals (Sweden)

    I. V. Leus


    Full Text Available Under the model growth of T8 Guerin’s carcinoma in rats we studied the anticancer activity of the system rhenium-platinum, which includes cis-dicarboxylates of rhenium (III with different alkyl ligands, erythrocytes number and its morphological structure, erythrocytic stability, blood haemoglobin concentration, catalase activity and concentration of TBA-active products in the rats blood plasma. The renium-platinum system had considerable antioxidat effect and prevented the growth of tumour, that was maximal for a compound with the pivalate ligand.

  4. 33 CFR 164.03 - Incorporation by reference. (United States)


    ...), 1220 L Street NW., Washington, DC 20005 API Specification 9A, Specification for Wire Rope, Section 3... Recommended Standards for Differential NAVSTAR GPS Service, Version 2.1, 1994 164.43 (3) RTCM Paper 71-95...

  5. 49 CFR 572.164 - Thorax assembly and test procedure. (United States)


    ... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.164 Thorax assembly and test procedure. (a... specified in 49 CFR 572.124(c): (1) The maximum sternum displacement relative to the spine, measured with...

  6. Analysis of extreme ultraviolet spectra from laser produced rhenium plasmas (United States)

    Wu, Tao; Higashiguchi, Takeshi; Li, Bowen; Suzuki, Yuhei; Arai, Goki; Dinh, Thanh-Hung; Dunne, Padraig; O'Reilly, Fergal; Sokell, Emma; Liu, Luning; O'Sullivan, Gerry


    Extreme ultraviolet spectra of highly-charged rhenium ions were observed in the 1-7 nm region using two Nd:YAG lasers with pulse lengths of 150 ps and 10 ns, respectively, operating at a number of laser power densities. The maximum focused peak power density was 2.6 × 1014 W cm-2 for the former and 5.5 × 1012 W cm-2 for the latter. The Cowan suite of atomic structure codes and unresolved transition array (UTA) approach were used to calculate and interpret the emission properties of the different spectra obtained. The results show that n = 4-n = 4 and n = 4-n = 5 UTAs lead to two intense quasi-continuous emission bands in the 4.3-6.3 nm and 1.5-4.3 nm spectral regions. As a result of the different ion stage distributions in the plasmas induced by ps and ns laser irradiation the 1.5-4.3 nm UTA peak moves to shorter wavelength in the ps laser produced plasma spectra. For the ns spectrum, the most populated ion stage during the lifetime of this plasma that could be identified from the n = 4-n = 5 transitions was Re23+ while for the ps plasma the presence of significantly higher stages was demonstrated. For the n = 4-n = 4 4p64dN-4p54dN+1 + 4p64dN-14f transitions, the 4d-4f transitions contribute mainly in the most intense 4.7-5.5 nm region while the 4p-4d subgroup gives rise to a weaker feature in the 4.3-4.7 nm region. A number of previously unidentified spectral features produced by n = 4-n = 5 transitions in the spectra of Re XVI to Re XXXIX are identified.

  7. Studies of the structures of rhenium complexes with sulphur-containing amino acids: cysteine and homocysteine

    International Nuclear Information System (INIS)

    Arkowska, A.; Wojciechowski, W.


    Two rhenium compounds have been synthesized: compound 1 with cysteine HS-CH 2 -CH-NH 2 -COOH and compound 2 with homocysteine HS-CH 2 -CH 2 -CH-NH 2 -COOH. On the basis of spectroscopic measurements (IR, far IR, Raman, VIS and UV spectra) and magnetic susceptibility measurements their probable electronic and molecular structures have been determined. (author)

  8. Femtosecond Fluorescence and Intersystem Crossing in Rhenium(I) Carbonyl-Bipyridine Complexes

    Czech Academy of Sciences Publication Activity Database

    Cannizzo, A.; Blanco-Rodríguez, A. M.; Nahhas, A. E.; Šebera, Jakub; Záliš, Stanislav; Vlček, Antonín; Chergui, M.


    Roč. 130, č. 28 (2008), s. 8967-8974 ISSN 0002-7863 R&D Projects: GA MŠk 1P05OC068 Institutional research plan: CEZ:AV0Z40400503 Keywords : rhenium(I) * carbonyl-bipyridine * intersystem crossing Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 8.091, year: 2008

  9. Synthesis, reactivity, and properties of N-fused porphyrin rhenium(I) tricarbonyl complexes. (United States)

    Toganoh, Motoki; Ikeda, Shinya; Furuta, Hiroyuki


    The thermal reactions of N-fused tetraarylporphyrins or N-confused tetraarylporphyrins with Re2(CO)10 gave the rhenium(I) tricarbonyl complexes bearing N-fused porphyrinato ligands (4) in moderate to good yields. The rhenium complexes 4 are characterized by mass, IR, 1H, and 13C NMR spectroscopy, and the structures of tetraphenylporphynato complex 4a and its nitro derivative 15 are determined by X-ray single crystal analysis. The rhenium complexes 4 show excellent stability against heat, light, acids, bases, and oxidants. The aromatic substitution reactions of 4 proceed without a loss of the center metal to give the nitro (15), formyl (16), benzoyl (17), and cyano derivatives (19), regioselectively. In the electrochemical measurements for 4, one reversible oxidation wave and two reversible reduction waves are observed. Their redox potentials imply narrow HOMO-LUMO band gaps of 4 and are consistent with their electronic absorption spectra, in which the absorption edges exceed 1000 nm. Theoretical study reveals that the HOMO and LUMO of the rhenium complexes are exclusively composed of the N-fused porphyrin skeleton. Protonation of 4 takes place at the 21-position regioselectively, reflecting the high coefficient of the C21 atom in the HOMO orbital. The skeletal rearrangement reaction from N-confused porphyrin Re(I) complex (8) to N-fused porphyrin Re(I) complex (4) is suggested from the mechanistic study as well as DFT calculations.

  10. Rhenium solubility in borosilicate nuclear waste glass: implications for the processing and immobilization of technetium-99. (United States)

    McCloy, John S; Riley, Brian J; Goel, Ashutosh; Liezers, Martin; Schweiger, Michael J; Rodriguez, Carmen P; Hrma, Pavel; Kim, Dong-Sang; Lukens, Wayne W; Kruger, Albert A


    The immobilization of technetium-99 ((99)Tc) in a suitable host matrix has proven to be a challenging task for researchers in the nuclear waste community around the world. In this context, the present work reports on the solubility and retention of rhenium, a nonradioactive surrogate for (99)Tc, in a sodium borosilicate glass. Glasses containing target Re concentrations from 0 to 10,000 ppm [by mass, added as KReO(4) (Re(7+))] were synthesized in vacuum-sealed quartz ampules to minimize the loss of Re from volatilization during melting at 1000 °C. The rhenium was found as Re(7+) in all of the glasses as observed by X-ray absorption near-edge structure. The solubility of Re in borosilicate glasses was determined to be ~3000 ppm (by mass) using inductively coupled plasma optical emission spectroscopy. At higher rhenium concentrations, additional rhenium was retained in the glasses as crystalline inclusions of alkali perrhenates detected with X-ray diffraction. Since (99)Tc concentrations in a glass waste form are predicted to be wastes, assuming Tc as Tc(7+) and similarities between Re(7+) and Tc(7+) behavior in this glass system.


    Directory of Open Access Journals (Sweden)

    K. O. Piletska


    Full Text Available Tricarbonyl rhenium(I complexes have a great potential like biomarkers. It is caused their biological stability, low toxicity, large Stokes shifts, and long luminescence lifetimes. Rhenium tricarbonyl complexes fac-[Re(CO3(N^N], where N^N is a ligand with low π* orbitals are excellent candidates as imaging dyes. The method of obtaining potential biomarkers based on tricarbonyl rhenium(I complex with a 4-methyl-2,2’-bipyridine-4’-carboxylate by the addition of biomolecules by peptide synthesis was developed. The new complex [Re(CO3MebpyCOOHBr] was synthesized, composition and structure of which were established by mass spectrometry, IR and NMR spectroscopy. A selective attachment of receptor peptide enkephalin to complex [Re(CO3(MebpyCOOHBr] was performed. The formation of a new compound and its structure has been confirmed by HPLC and mass spectral analysis. The method which has been developed allows to connect various peptides to rhenium(I complex in the solution.

  12. Submersion criticality safety of tungsten-rhenium urania cermet fuel for space propulsion and power applications

    Energy Technology Data Exchange (ETDEWEB)

    Craft, A.E., E-mail: [Center for Space Nuclear Research (CSNR), INL, Idaho Falls, ID (United States); O’Brien, R.C., E-mail: [Center for Space Nuclear Research (CSNR), INL, Idaho Falls, ID (United States); Howe, S.D., E-mail: [Center for Space Nuclear Research (CSNR), INL, Idaho Falls, ID (United States); King, J.C., E-mail: [Nuclear Science and Engineering Program, Metallurgical and Materials Engineering Department, Colorado School of Mines, Golden, CO 80401 (United States)


    Highlights: • Criticality safety studies consider a generic space nuclear reactor in reentry scenarios. • Describes the submersion criticality behavior for a reactor fueled with a tungsten cermet fuel. • Study considers effects of varying fuel content, geometry, and other conditions. - Abstract: Nuclear thermal rockets are the preferred propulsion technology for a manned mission to Mars, and tungsten–uranium oxide cermet fuels could provide significant performance and cost advantages for nuclear thermal rockets. A nuclear reactor intended for use in space must remain subcritical before and during launch, and must remain subcritical in launch abort scenarios where the reactor falls back to Earth and becomes submerged in terrestrial materials (including seawater, wet sand, or dry sand). Submersion increases reflection of neutrons and also thermalizes the neutron spectrum, which typically increases the reactivity of the core. This effect is typically very significant for compact, fast-spectrum reactors. This paper provides a submersion criticality safety analysis for a representative tungsten/uranium oxide fueled reactor with a range of fuel compositions. Each submersion case considers both the rhenium content in the matrix alloy and the uranium oxide volume fraction in the cermet. The inclusion of rhenium significantly improves the submersion criticality safety of the reactor. While increased uranium oxide content increases the reactivity of the core, it does not significantly affect the submersion behavior of the reactor. There is no significant difference in submersion behavior between reactors with rhenium distributed within the cermet matrix and reactors with a rhenium clad in the coolant channels. The combination of the flooding of the coolant channels in submersion scenarios and the presence of a significant amount of spectral shift absorbers (i.e. high rhenium concentration) further decreases reactivity for short reactor cores compared to longer cores.

  13. Tungsten-rhenium composite tube fabricated by CVD for application in 18000C high thermal efficiency fuel processing furnace

    International Nuclear Information System (INIS)

    Svedberg, R.C.; Bowen, W.W.; Buckman, R.W. Jr.


    Chemical Vapor Deposit (CVD) rhenium was selected as the muffle material for an 1800 0 C high thermal efficiency fuel processing furnace. The muffle is exposed to high vacuum on the heater/insulation/instrumentation side and to a flowing argon-8 V/0 hydrogen gas mixture at one atmosphere pressure on the load volume side. During operation, the muffle cycles from room temperature to 1800 0 C and back to room temperature once every 24 hours. Operational life is dependent on resistance to thermal fatigue during the high temperature exposure. For a prototypical furnace, the muffle is approximately 13 cm I.D. and 40 cm in length. A small (about one-half size) rhenium closed end tube overcoated with tungsten was used to evaluate the concept. The fabrication and testing of the composite tungsten-rhenium tube and prototypic rhenium muffle is described

  14. Effect of octanols structure on their extraction ability as regards to rhenium(VII) in sulfuric acid solutions

    International Nuclear Information System (INIS)

    Kasikov, A.G.; Petrova, A.M.


    It is established that extraction ability of octanols as regards to rhenium(VII) and sulfuric acid depends on the structure of alcohol, but if in passage from octanol-1 to octanol-3 as regard to rhenium(VII) it rises, then for H 2 SO 4 it falls. Dependence of the distribution function of rhenium from the concentration of the acid has maximums at 4-7 mol l 1- that the most distinctly it becomes apparent for secondary alcohols. Decreasing the extraction ability of octyl alcohols with the growth of H 2 SO 4 concentration more than 7 mol l 1- is connected with the change of extractant composition and forms of rhenium(VII) being in the solution [ru

  15. Residency of rhenium and osmium in a heavy crude oil (United States)

    DiMarzio, Jenna M.; Georgiev, Svetoslav V.; Stein, Holly J.; Hannah, Judith L.


    Rhenium-osmium (Re-Os) isotope geochemistry is an emerging tool for the study of oil formation and migration processes, and a new technology for petroleum exploration. Little is known, however, about the residency of Re and Os within asphaltene and maltene sub-fractions of crude oil. This information is crucial for understanding the 187Re-187Os radiometric clock held in petroleum systems and for interpreting geochronology for key processes such as oil formation, migration, and biodegradation. In this study, a heavy crude oil was separated into soluble (maltene, MALT) and insoluble (asphaltene, ASPH) fractions using n-heptane as the asphaltene-precipitating agent. The asphaltenes were separated sequentially into sub-fractions using two different solvent pairs (heptane-dichloromethane and acetone-toluene), and the bulk maltenes were separated into saturate, aromatic, and resin (SAR) fractions using open column chromatography. Each asphaltene and maltene sub-fraction was analyzed for Re and Os. The asphaltene sub-fractions and the bulk ASPH, MALT, and crude oil were analyzed for a suite of trace metals by ICP-MS. Our results show that Re and Os concentrations co-vary between the asphaltene sub-fractions, and that both elements are found mostly in the more polar and aromatic sub-fractions. Significant Re and Os are also present in the aromatic and resin fractions of the maltenes. However, each asphaltene and maltene sub-fraction has a distinct isotopic composition, and sub-fractions are not isochronous. This suggests that asphaltene sub-fractionation separates Re-Os complexes to the point where the isotopic integrity of the geochronometer is compromised. The mobility of individual Re and Os isotopes and the decoupling possibilities between radiogenic 187Os produced from 187Re remain elusive, but their recognition in this study is a critical first step. Re and Os correlate strongly with Mo and Cd in the asphaltene sub-fractions, suggesting that these metals occupy

  16. Trinuclear rhenium(III) halide clusters with carboxylate ligands (United States)

    Dougan, Jeffrey Steven

    Four mono(carboxylato)trirhenium complexes and three bis(carboxylato)trirhenium complexes have been synthesized and characterized, principally by mass spectrometry, with supporting evidence from X-ray diffraction. These compounds represent the first trinuclear rhenium carboxylate complexes. The reactions generally proceed readily under comparatively mild conditions. Mass spectrometry has again proved its usefulness as a technique in the field of metal cluster chemistry, having provided the initial identification of the products of the reactions studied. These compounds provide a further base to which future mass spectra of metal cluster compounds can be compared. Re-examination of a reaction reported by Taha and Wilkinson has also cast considerable doubt onto the validity of a conversion widely reported in the literature that transforms (Re3Cl9) x into [Re2(O2CCH3)4Cl 2]. We believe that the literature result is a consequence of the purity of the metal precursor, and suggest that the starting material in the earlier work may have contained ReCl4 or ReCl5. The importance of mass spectrometry in the characterization of the new compounds synthesized in this project has led to a thorough study of calculated isotopic distributions. The information gathered suggests that for isotopically simple molecules, the choice of algorithm for computing an isotopic distribution is unimportant. However, it is important to compute the mass spectrum of an isotopically complex molecule using an algorithm that can, if desired, show the underlying isotopic fine structure of a peak of interest. In the last chapter of this thesis, the results of a project in chemistry education research are presented. Predicting the success of students in general chemistry has long been of interest to the chemistry education community, and several factors have been identified as contributing factors. An off-hand comment by a student inspired an examination of whether continuity with the same instructor for

  17. Testing of electroformed deposited iridium/powder metallurgy rhenium rockets (United States)

    Reed, Brian D.; Dickerson, Robert


    High-temperature, oxidation-resistant chamber materials offer the thermal margin for high performance and extended lifetimes for radiation-cooled rockets. Rhenium (Re) coated with iridium (Ir) allow hours of operation at 2200 C on Earth-storable propellants. One process for manufacturing Ir/Re rocket chambers is the fabrication of Re substrates by powder metallurgy (PM) and the application of Ir coatings by using electroformed deposition (ED). ED Ir coatings, however, have been found to be porous and poorly adherent. The integrity of ED Ir coatings could be improved by densification after the electroforming process. This report summarizes the testing of two 22-N, ED Ir/PM Re rocket chambers that were subjected to post-deposition treatments in an effort to densify the Ir coating. One chamber was vacuum annealed, while the other chamber was subjected to hot isostatic pressure (HIP). The chambers were tested on gaseous oxygen/gaseous hydrogen propellants, at mixture ratios that simulated the oxidizing environments of Earth-storable propellants. ne annealed ED Ir/PM Re chamber was tested for a total of 24 firings and 4.58 hr at a mixture ratio of 4.2. After only 9 firings, the annealed ED Ir coating began to blister and spall upstream of the throat. The blistering and spalling were similar to what had been experienced with unannealed, as-deposited ED Ir coatings. The HIP ED Ir/PM Re chamber was tested for a total of 91 firings and 11.45 hr at mixture ratios of 3.2 and 4.2. The HIP ED Ir coating remained adherent to the Re substrate throughout testing; there were no visible signs of coating degradation. Metallography revealed, however, thinning of the HIP Ir coating and occasional pores in the Re layer upstream of the throat. Pinholes in the Ir coating may have provided a path for oxidation of the Re substrate at these locations. The HIP ED Ir coating proved to be more effective than vacuum annealed and as-deposited ED Ir. Further densification is still required to

  18. Analysis of extreme ultraviolet spectra from laser produced rhenium plasmas

    International Nuclear Information System (INIS)

    Wu, Tao; Dunne, Padraig; O’Reilly, Fergal; Sokell, Emma; Liu, Luning; O’Sullivan, Gerry; Higashiguchi, Takeshi; Suzuki, Yuhei; Arai, Goki; Dinh, Thanh-Hung; Li, Bowen


    Extreme ultraviolet spectra of highly-charged rhenium ions were observed in the 1–7 nm region using two Nd:YAG lasers with pulse lengths of 150 ps and 10 ns, respectively, operating at a number of laser power densities. The maximum focused peak power density was 2.6 × 10 14 W cm −2 for the former and 5.5 × 10 12 W cm −2 for the latter. The Cowan suite of atomic structure codes and unresolved transition array (UTA) approach were used to calculate and interpret the emission properties of the different spectra obtained. The results show that n = 4-n = 4 and n = 4-n = 5 UTAs lead to two intense quasi-continuous emission bands in the 4.3–6.3 nm and 1.5–4.3 nm spectral regions. As a result of the different ion stage distributions in the plasmas induced by ps and ns laser irradiation the 1.5–4.3 nm UTA peak moves to shorter wavelength in the ps laser produced plasma spectra. For the ns spectrum, the most populated ion stage during the lifetime of this plasma that could be identified from the n = 4-n = 5 transitions was Re 23+ while for the ps plasma the presence of significantly higher stages was demonstrated. For the n = 4-n = 4 4p 6 4d N -4p 5 4d N+1  + 4p 6 4d N−1 4f transitions, the 4d-4f transitions contribute mainly in the most intense 4.7–5.5 nm region while the 4p-4d subgroup gives rise to a weaker feature in the 4.3–4.7 nm region. A number of previously unidentified spectral features produced by n = 4-n = 5 transitions in the spectra of Re XVI to Re XXXIX are identified. (paper)

  19. Study on the application of crown ether for neutron activation analysis of rubidium and rhenium in rock samples

    International Nuclear Information System (INIS)

    Wang Xiaolin; Fu Yibei; Liu Yinong; Xiong Zonghua; Hao Fanhua


    The extraction behaviour of rubidium and rhenium with 18-crown-6 (18C6) and benzo-15-crown-5 (B15C5) in nitrobenzene from picric acid or potassium hydroxide solution are studied and methods for separation and determination are developed. The molar ratio of 18C6 to Rb and B15C5 to Re in the extracted species is probably 2:1. Rubidium and rhenium in rock samples are satisfactorily determined by neutron activation method

  20. Study of the electrodeposition of rhenium thin films by electrochemical quartz microbalance and X-ray photoelectron spectroscopy

    International Nuclear Information System (INIS)

    Schrebler, R.; Cury, P.; Suarez, C.; Munoz, E.; Vera, F.; Cordova, R.; Gomez, H.; Ramos-Barrado, J.R.; Leinen, D.; Dalchiele, E.A.


    Rhenium thin films were prepared by electrodeposition from an aqueous solution containing 0.1 M Na 2 SO 4 +H 2 SO 4 , pH 2 in presence of y mM HReO 4 . As substrates polycrystalline gold (y=0.75 mM HReO 4 ) and monocrystalline n-Si(100) (y=40 mM HReO 4 ) were used. The electrochemical growth of rhenium was studied by cyclic voltammetry and electrochemical quartz microbalance on gold electrodes. The results found in the potential region before the hydrogen evolution reaction (her) showed that ReO 3 , ReO 2 and Re 2 O 3 with different hydration grades can be formed. In the potential region where the her is occurring, either on gold or n-Si(100) the electrodeposition of metallic rhenium takes place. On both substrates, rhenium films were formed by electrolysis at constant potential and X-ray photoelectron spectroscopy technique was used to characterise these deposits. It was concluded that the electrodeposited films were of metallic rhenium and only the uppermost atomic layer contained rhenium oxide species

  1. 46 CFR 164.008-3 - Testing procedure. (United States)


    ... control. (1) The furnace temperature shall be determined by at least four mineral insulated thermocouples... further definition of the time-temperature curve, see Appendix I of the ASTM Standard E119, “Fire Tests of... openings are formed during the test, an ignition test as prescribed in § 164.008-4(b) shall take place...

  2. Tilted axis rotation in odd-odd {sup 164}Tm

    Energy Technology Data Exchange (ETDEWEB)

    Reviol, W.; Riedinger, L.L.; Wang, X.Z.; Zhang, J.Y. [Univ. of Tennessee, Knoxville, TN (United States)] [and others


    Ten band structures are observed in {sup 164}Tm, among them sets of parallel and anti-parallel couplings of the proton and neutron spins. The Tilted Axis Cranking scheme is applied for the first time to an odd-odd nucleus in a prominent region of nuclear deformation.

  3. 45 CFR 164.408 - Notification to the Secretary. (United States)


    ... REQUIREMENTS SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured Protected Health Information... of a breach of unsecured protected health information as provided in § 164.404(a)(2), notify the Secretary. (b) Implementation specifications: Breaches involving 500 or more individuals. For breaches of...

  4. 33 CFR 164.33 - Charts and publications. (United States)


    ...) PORTS AND WATERWAYS SAFETY NAVIGATION SAFETY REGULATIONS § 164.33 Charts and publications. (a) Each vessel must have the following: (1) Marine charts of the area to be transited, published by the National... tables published by private entities using data provided by the National Ocean Service. (ii) Tidal...

  5. 46 CFR 164.015-4 - Inspections and tests. (United States)


    ... determined in a standard tensile testing machine with a rate of separation of jaws set at 2 inches per minute....015-4(g)(2) Inches per minute 4 Tensile strength (minimum) 164.015-4(h) P.s.i. 30 20 60 Ultimate... accordance with American Society for Testing Materials Designation D-1692T specification standard. (h...

  6. 2012 December_ Edition_Vol 16_4_article_11

    African Journals Online (AJOL)

    AJRH Managing Editor

    African Journal of Reproductive Health December 2012; 16(4): 108. ORIGINAL .... 'Reynolds' writing pen as an incentive to participate in the ... Tests were done at 0.05 level of significance. ..... Psychology of Women Quarterly 1996; 20:123–.

  7. The process development of laser surface modification of commercially pure titanium (Grade 2) with rhenium (United States)

    Kobiela, K.; Smolina, I.; Dziedzic, R.; Szymczyk, P.; Kurzynowski, T.; Chlebus, E.


    The paper presents the results of the process development of laser surface modification of commercially pure titanium with rhenium. The criterion of the successful/optimal process is the repetitive geometry of the surface, characterized by predictable and repetitive chemical composition over its entire surface as well as special mechanical properties (hardness and wear resistance). The analysis of surface geometry concluded measurements of laser penetration depth and heat affected zone (HAZ), the width of a single track as well as width of a clad. The diode laser installed on the industrial robot carried out the laser treatment. This solution made possible the continuous supply of powder to the substrate during the process. The aim of an investigation is find out the possibility of improving the tribological characteristics of the surface due to the rhenium alloying. The verification of the surface properties (tribological) concluded geometry measurements, microstructure observation, hardness tests and evaluation of wear resistance.

  8. Tungsten - rhenium alloys wire: overview of thermomechanical processing and properties data

    International Nuclear Information System (INIS)

    Bryskin, B.


    The scope of this study encompasses the compositional modifications of the tungsten-rhenium dual system (W-3/5 Re up to W-27 Re) as well as some of the tungsten-molybdenum-rhenium ternary system. The alloys of interest are considered with a specific representation of powder metallurgy route based on doped or undoped tungsten vs. vacuum melted materials. This paper constitutes an in-depth review of structural and mechanical properties and systematic compilation of challenges necessary to provide the quality consistency of severely drawn filaments. The issue of thermomechanical processing trends is addressed as an important part of W-Re fabrication technology to achieve further improvement in design properties of rod and wire. (author)

  9. Effect of deformation and annealing on mechanical properties of nickel-rhenium alloys

    International Nuclear Information System (INIS)

    Mashkova, V.M.


    Studied have been the mechanical properties of nickel-rhenium alloys, depending on the extent of deformation and heat treatment leading to softening. The mechanical properties of the alloys have been estimated by the results of the tensile tests of wire samples. The softening of the alloy at different temperatures is judged about by the variation in hardness. The results of the study indicate that the most abrupt reduction in the hardness of the cold-hardened metal occurs at 900-1,000 deg C and the hold-time of 1 min. Increase in the hold-time at such temperature almost does not reduce the hardness. It is established that in order to soften nickel-rhenium alloys in the process of the cold-deformation at brief annealings in the air the hold-time should not exceed 5 min at 800-900 deg C

  10. Nanograined Net-Shaped Fabrication of Rhenium Components by EB-PVD

    International Nuclear Information System (INIS)

    Singh, Jogender; Wolfe, Douglas E.


    Cost-effective net-shaped forming components have brought considerable interest into DoD, NASA and DoE. Electron beam physical vapor deposition (EB-PVD) offers flexibility in forming net-shaped components with tailored microstructure and chemistry. High purity rhenium (Re) components including rhenium-coated graphite balls, Re- plates and tubes have been successfully manufactured by EB-PVD. EB-PVD Re components exhibited sub-micron and nano-sized grains with high hardness and strength as compared to CVD. It is estimated that the cost of Re components manufactured by EB-PVD would be less than the current CVD and powder-HIP Technologies

  11. Rhenium (5) and molybdenum (5) complexes with 4',4''(5'')-ditretbutyldibenzo-24-crown-8

    International Nuclear Information System (INIS)

    Ashurova, N.Kh.; Yakubov, K.G.; Basitova, S.M.; Tashmukhamedova, A.K.; Sajfullina, N.Zh.


    Rhenium and molybdenum complexes in +5 oxidation degree with 4',4''(5'')-ditretbutyldibenzo-24-crown-8 (L) are synthesized with 75-95 % yield. Composition and structure of compounds produced are investigated using element analysis, conductometry, IR spectroscopy, thermogravimetry methods. Oxidation degree of complexer metal is determined. It is ascertained that the compound composition corresponds to the MOLX 3 formula, where M-Re, Mo; X-Cl - , Br -

  12. Complexes of technetium, rhenium, and rhodium with sexidentate Schiff-base ligands

    International Nuclear Information System (INIS)

    Hunter, G.; Kilcullen, N.


    The monocationic technetium (IV) and rhenium (IV) complexes with the sexidentate Schiff-base ligands tris[2-(2'-hydroxybenzylideneethyl)]amine and its substituted derivatives have been prepared and their electrochemical properties studied. The variable-temperature 90.6 MHz 13 C-{ 1 H} n.m.r. spectrum of the rhodium (III) complex of tris[2-(2-hydroxy-5'-isopropylbenzylideneethyl)-amine] has been observed, indicating fluxionality at temperatures above 218 K. (author)

  13. Analysis of the Nuclear Structure of Rhenium-186 Using Neutron-Induced Reactions (United States)


    5 1.5 Methods ... radioisotope power source for use on the battlefield. 1 Re-Os Cosmochronometer. The isotope 187Re has a half-life in its ground state of 4.35⇥ 1010 years [2...187Os in meteorites permits one to date the nucleosynthesis of rhenium and osmium by high neutron flux events such as supernovae. The Re-Os radioactive

  14. Kinetics and mechanism of nitrobenzene hydrogenation to phenylhydroxylamine in rhenium thiocomplexes solutions

    International Nuclear Information System (INIS)

    Korenyako, G.I.; Belousov, V.M.


    A study was made on kinetics of nitrobenzene hydrogenation to phenylhydroxylamine in dimethylformamide solutions of rhenium thiocomplexes. The mechanism of hydrogenation was suggested. Formation of hydride catalyst complex represents the first stage of the process. Kinetic equation derived on the basis of suggested mechanism corresponds satisfactorily with experimental results. Thermodynamic parameters of separate process stages calculated on the basis of equilibrium constant values testify as well to the benefit of suggested mechanism

  15. The Influence of Cobalt and Rhenium on the Behaviour of MCrAlY Coatings


    Täck, Ulrike


    Superalloys are widely applied as materials for components in the hot section of gas turbines. As superalloys have a limited oxidation life, the application of a coating is vital. The most commonly applied coatings in stationary gas turbines are MCrAlY coatings. Since the turbine components are exposed to high cyclic thermal stresses, MCrAlY coatings must also show a high thermal fatigue resistance. In this thesis, the effect of Cobalt and Rhenium on microstructure, oxidation and thermal fati...

  16. Formamidine sulfinic acid as reducing agent in technetium-99m rhenium sulfide labelling

    Energy Technology Data Exchange (ETDEWEB)

    Neves, M; Patricio, L [Laboratorio Nacional de Engenharia e Technologia Industrial, Sacavem (Portugal). Dept. de Radioisotopes; Ferronha, H [Laboratorio Nacional de Investigacao Veterinaria, Lisboa (Portugal)


    Labelling kinetic studies, radiochemical characterization and particle size evaluation of {sup 99m}Tc rhenium sulfide colloid using formamidine sulfinic acid as reducing agent are described. Comparison with the same colloid which makes use of Sn-sodium pyrophosphate complex as reducing agent showed higher labelling yields, simplification of labelling procedure and a longer shelf life when formamidine sulfinic acid was used. (author) 15 refs.; 7 figs.

  17. Chromatographic separation of rhenium in alumina-methanol/sulfuric acid system

    International Nuclear Information System (INIS)

    Oguma, Koichi


    The adsorption behavior of a number of metals on alumina was surveyed in a methanol-(0.005 -- 0.5) M H 2 SO 4 (3 : 1 v/v) developing solvent by thin-layer chromatography. Over the acid concentration range tested, Re(VII) does not favor the alumina phase to any great extent while the most other metals are strongly adsorbed on alumina. These findings allowed to establish a column chromatographic technique for selective separation of rhenium in a methanol-0.05 M H 2 SO 4 (3 : 1 v/v) eluent. The separation technique thus established was applied to molybdenite analysis for rhenium. About 100-mg powdered sample containing ca. 100 ppm rhenium was decomposed with HNO 3 and then evaporated nearly to dryness. The residue was dissolved in NH 4 OH and the excess NH 4 OH was expelled by evaporation to dryness. The residue was dissolved in 2.5-ml 0.5 M H 2 SO 4 and 10-ml water, the insoluble materials filtered off, and the filtrate diluted to exactly 25 ml with water. A 10-ml aliquot of this solution was mixed with 30-ml methanol and the mixture was passed through a column (diameter 15 mm, bed height 30 mm) containing 5 g of alumina. The column was then washed with 20 ml of a methanol-0.05 M H 2 SO 4 (3 : 1 v/v) mixture. Rhenium was recovered from the loaded solution and the subsequent washings, and was determined spectrophotometrically with Methylene Blue as a chromogenic reagent. The values obtained from four samples of molybdenite are in good agreement with those obtained by neutron activation analysis. The relative standard deviation (n = 4; calculated from the range) was between 2.0 and 5.2 %. (author)

  18. A Study on the Trapping Characteristics of Rhenium Oxide Using Ca(OH){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Tae-Kyo; Eun, Hee-Chul; Choi, Jung-Hoon; Lee, Ki-Rak; Han, Seung-Youb; Park, Hwan-Seo [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)


    The objective of this study was to obtain basic data for trapping gaseous technetium (Tc) oxide generated from the voloxidation process in spent nuclear fuel pyroprocessing. Rhenium (Re) and Ca(OH){sub 2} were used as surrogates for the technetium and a trapping material, respectively. The trapping characteristics of rhenium oxide were investigated with changing temperatures and molar ratios of calcium (Ca) over rhenium, and the thermal behaviors of the trapping products were observed. The products following after the trapping test were identified as Ca(ReO{sub 4}){sub 2} and Ca{sub 5}Re{sub 2}O{sub 12}. The conversion to Ca{sub 5}Re{sub 2}O{sub 12} was preferred with increasing temperatures, and the trapping products were completely converted into Ca5Re2O12 under conditions exceeding 800 ℃, or when maintained at 750 ℃ for 4 hr. The trapping efficiency at a molar ratio of 2.5 (Ca:Re=5:2) was significantly superior to that at the molar ratio of 2.

  19. Characterization of rhenium compounds obtained by electrochemical synthesis after aging process

    Energy Technology Data Exchange (ETDEWEB)

    Vargas-Uscategui, Alejandro, E-mail: [Departamento de Ingeniería de Minas, Facultad de Ciencias Físicas y Matemáticas, Universidad de Chile, Tupper Av. 2069, Santiago (Chile); Mosquera, Edgar [Laboratorio de Materiales a Nanoescala, Departamento de Ciencia de los Materiales, Facultad de Ciencias Físicas y Matemáticas, Universidad de Chile, Tupper Av. 2069, Santiago (Chile); López-Encarnación, Juan M. [Department of Mathematics-Physics and Department of Chemistry, University of Puerto Rico at Cayey, 205 Ave. Antonio R. Barceló, Cayey, PR 00736, USA. (Puerto Rico); Chornik, Boris [Departamento de Física, Facultad de Ciencias Físicas y Matemáticas, Universidad de Chile, Blanco Encalada Av. 2008, Santiago (Chile); Katiyar, Ram S. [Department of Physics and Institute for Functional Nanomaterials, University of Puerto Rico San Juan, San Juan, PR 00931-3343 (United States); Cifuentes, Luis [Departamento de Ingeniería de Minas, Facultad de Ciencias Físicas y Matemáticas, Universidad de Chile, Tupper Av. 2069, Santiago (Chile)


    The proper identification of the molecular nature of the aged rhenium compound obtained by means of electrodeposition from an alkaline aqueous electrolyte was determined. Chemical, structural and vibrational experimental characterization of the aged Re compound showed agreement with quantum-computations, thereby allowing the unambiguous identification of the Re compound as H(ReO{sub 4})H{sub 2}O. - Graphical abstract: Rhenium oxides were electrodeposited on a copper surface and after environmental aging was formed the H(ReO{sub 4})H{sub 2}O compound. The characterization of the synthesized material was made through the comparison of experimental evidence with quantum mechanical computations carried out by means of density functional theory (DFT). - Highlights: • Aged rhenium compound obtained by means of electrodeposition was studied. • The study was made by combining experimental and DFT-computational information. • The aged electrodeposited material is consistent with the H(ReO{sub 4})H{sub 2}O compound.

  20. A Study on the Trapping Characteristics of Rhenium Oxide Using Ca(OH)_2

    International Nuclear Information System (INIS)

    Lee, Tae-Kyo; Eun, Hee-Chul; Choi, Jung-Hoon; Lee, Ki-Rak; Han, Seung-Youb; Park, Hwan-Seo


    The objective of this study was to obtain basic data for trapping gaseous technetium (Tc) oxide generated from the voloxidation process in spent nuclear fuel pyroprocessing. Rhenium (Re) and Ca(OH)_2 were used as surrogates for the technetium and a trapping material, respectively. The trapping characteristics of rhenium oxide were investigated with changing temperatures and molar ratios of calcium (Ca) over rhenium, and the thermal behaviors of the trapping products were observed. The products following after the trapping test were identified as Ca(ReO_4)_2 and Ca_5Re_2O_1_2. The conversion to Ca_5Re_2O_1_2 was preferred with increasing temperatures, and the trapping products were completely converted into Ca5Re2O12 under conditions exceeding 800 ℃, or when maintained at 750 ℃ for 4 hr. The trapping efficiency at a molar ratio of 2.5 (Ca:Re=5:2) was significantly superior to that at the molar ratio of 2.

  1. Diverse roles of hydrogen in rhenium carbonyl chemistry: hydrides, dihydrogen complexes, and a formyl derivative. (United States)

    Li, Nan; Xie, Yaoming; King, R Bruce; Schaefer, Henry F


    Rhenium carbonyl hydride chemistry dates back to the 1959 synthesis of HRe(CO)₅ by Hieber and Braun. The binuclear H₂Re₂(CO)₈ was subsequently synthesized as a stable compound with a central Re₂(μ-H)₂ unit analogous to the B₂(μ-H)₂ unit in diborane. The complete series of HRe(CO)(n) (n = 5, 4, 3) and H₂Re₂(CO)(n) (n = 9, 8, 7, 6) derivatives have now been investigated by density functional theory. In contrast to the corresponding manganese derivatives, all of the triplet rhenium structures are found to lie at relatively high energies compared with the corresponding singlet structures consistent with the higher ligand field splitting of rhenium relative to manganese. The lowest energy HRe(CO)₅ structure is the expected octahedral structure. Low-energy structures for HRe(CO)(n) (n = 4, 3) are singlet structures derived from the octahedral HRe(CO)₅ structure by removal of one or two carbonyl groups. For H₂Re₂(CO)₉ a structure HRe₂(CO)₉(μ-H), with one terminal and one bridging hydrogen atom, lies within 3 kcal/mol of the structure Re₂(CO)₉(η²-H₂), similar to that of Re₂(CO)₁₀. For H₂Re₂(CO)(n) (n = 8, 7, 6) the only low-energy structures are doubly bridged singlet Re₂(μ-H)₂(CO)(n) structures. Higher energy dihydrogen complex structures are also found.

  2. Evaluation of oxide dispersion strengthened (ODS) molybdenum and molybdenum-rhenium alloys

    International Nuclear Information System (INIS)

    Mueller, A.J.; Bianco, R.; Buckman, R.W. Jr.


    Oxide dispersion strengthened (ODS) molybdenum alloys being developed for high temperature applications possess excellent high temperature strength and creep resistance. In addition they exhibit a ductile-to-brittle transition temperature (DBIT) in the worked and stress-relieved condition under longitudinal tensile load well below room temperature. However, in the recrystallized condition, the DBTT maybe near or above room temperature, depending on the volume fraction of oxide dispersion and the amount of prior work. Dilute rhenium additions (7 and 14 wt.%) to ODS molybdenum were evaluated to determine their effect on low temperature ductility. The addition of 7 wt.% rhenium to the ODS molybdenum did not significantly enhance the mechanical properties. However, the addition of 14 wt.% rhenium to the ODS molybdenum resulted in a DBTT well below room temperature in both the stress-relieved and recrystallized condition. Additionally, the tensile strength of ODS Mo-14Re is greater than the base ODS molybdenum at 1,000 to 1,250 C

  3. Electrodeposition of rhenium from chloride melts: Electrochemical nature, structure and applied aspects

    Directory of Open Access Journals (Sweden)

    Vinogradov-Zhabrov O.N.


    Full Text Available Processes involved in the electrodeposition of rhenium from chloride melts have been studied over the temperature interval from 680 to 970 0C at a cathodic current density of 5 to 250 mA/cm2. It has been found that rhenium is deposited in the form of continuous layers. In addition to that the growth of deposits as separate single-crystal needles has also been noticed. Continuous layers had axial growth textures. The crystallographic direction of the textures is due to electrolysis conditions, such as concentration of oxygen-containing impurities, temperature, melt composition and cathodic current density. When the concentration of oxygen-containing impurities in the melt decreased, electrolysis temperature increased, the average radius of the supporting electrolyte cations became smaller, or cathodic current density diminished, the direction of the growth textures was changing as follows: (1010 →(1120 →(101L →(0001 →(0001needles. The microhardness of the deposits in this series is 900 to 250 kg/mm2. The growth of deposits on textured rhenium substrates and single crystals having different orientations, including bent substrates, was studied. It has been found that the epitaxial growth is virtually unlimited in depth if the orientation of the substrate coincides with the growth texture under given conditions. If the substrate orientation deviated from the growth texture, the epitaxial growth was nearly absent. Kinetic parameters were measured using the galvanostatic method. The exchange current density was determined over the interval of (0.01-0.1 A/cm2 depending on the concentration of oxygen-containing impurities, cation composition, type of the surface and its condition. The parameter α⋅Z, which was estimated by two methods, was equal to 2.1-3.1. The diffusion coefficient of rhenium ions has been found to be 2.8 ⋅10 −5 cm2/s at 790 0C and 3.5 ⋅10 −5 cm2/s at 840 0C. Galvanoplastic production of rhenium products, such as

  4. CD40 expression in Wehi-164 cell line. (United States)

    Karimi, Mohammad Hossein; Ebadi, Padideh; Pourfathollah, Ali Akbar; Soheili, Zahra Soheila; Moazzeni, Seyed Mohammad


    CD40-CD154 interaction is an important process for cellular and humoral immunity regulation and can be effective in the body's defense against tumors. In the present study, we evaluated the expression of CD40 in Wehi-164 cell line. CD40 expressions on the cell surface and in the cytoplasm were assessed by flow cytometry and intracellular staining assay, respectively. Also, the mRNA expression was identified by real time-PCR. The obtained results showed the high mRNA and cytoplasmic protein expression of CD40 but no surface expression. These results suggest that the Wehi-164 cell line down regulates expression of CD40 on the surface for evasion of immune system.

  5. Therapeutic applications of Rhenium-188 in nuclear medicine and oncology - Current status and expected future perspectives

    International Nuclear Information System (INIS)

    Knapp, F. F. Jr.


    Full text: The increasing use of unsealed radioactive targeting agents for cancer treatment requires the routine availability of cost-effective radioisotopes. Rhenium-188 (Re-188; half-life 16.9 hours) is a high-energy beta-emitter (E max 2.12 MeV), readily available no- max carrier-added from the alumina-based tungsten-188 (half-life 69 days)/rhenium-188 generator system. Rhenium-188 also emits a 155 keV (15%) gamma photon, permitting gamma camera imaging for biodistribution and dosimetry evaluation. The versatile chemistry of rhenium allows attachment to a wide variety of targeting molecules for Re-188 applications in nuclear oncology for both palliative metastatic treatment and targeted tumor therapy - radionuclide synovectomy, and coronary restenosis therapy. The long parent half-life and consistent performance provide an indefinite generator shelf-life of several months with high Re-188 elution yields (75-85 %) and consistently low W-188 parent breakthrough ( -6 ). Simple post-elution concentration methods have been developed which provide very high specific volume solution of Re-188 for radiolabeling (> 700 mCi/mL saline/1 Ci generator). Over 60 physician-sponsored clinical trials are currently in progress worldwide with applications in nuclear medicine, nuclear oncology and interventional cardiology. A variety of Re-188-labeled therapeutic radiopharmaceuticals and devices are being developed for clinical trials currently in progress for treatment of both benign and metastatic oncological disorders. Palliation of metastatic bone pain with Re-188-HEDP - prepared from a simple 'kit' - has been demonstrated as a cost-effective alternative to similar agents. Recent studies have in fact demonstrated the enhancement of progression-free interval and survival time by repeated Re-188-HEDP injections to patients with metastatic disease from prostate cancer. The use of the Re-188-labeled antiNCA95 (CD66) antibody in conjunction with external beam irradiation is an

  6. 40 CFR 65.164 - Performance test and flare compliance determination notifications and reports. (United States)


    ... determination notifications and reports. 65.164 Section 65.164 Protection of Environment ENVIRONMENTAL..., Control Devices, and Routing to a Fuel Gas System or a Process § 65.164 Performance test and flare... an initially scheduled performance test, there is a delay (due to operational problems, etc.) in...

  7. 45 CFR 164.534 - Compliance dates for initial implementation of the privacy standards. (United States)


    ... privacy standards. 164.534 Section 164.534 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES ADMINISTRATIVE DATA STANDARDS AND RELATED REQUIREMENTS SECURITY AND PRIVACY Privacy of Individually Identifiable Health Information § 164.534 Compliance dates for initial implementation of the privacy standards. (a...

  8. Fabrication and use of zircaloy/tantalum-sheathed cladding thermocouples and molybdenum/rhenium-sheathed fuel centerline thermocouples

    International Nuclear Information System (INIS)

    Wilkins, S.C.; Sepold, L.K.


    The thermocouples described in this report are zircaloy/tantalum-sheathed and molybdenum/rhenium alloy-sheathed instruments intended for fuel rod cladding and fuel centerline temperature measurements, respectively. Both types incorporate beryllium oxide insulation and tungsten/rhenium alloy thermoelements. These thermocouples, operated at temperatures of 2000 0 C and above, were developed for use in the internationally sponsored Severe Fuel Damage test series in the Power Burst Facility. The fabrication steps for both thermocouple types are described in detail. A laser-welding attachment technique for the cladding-type thermocouple is presented, and experience with alternate materials for cladding and fuel therocouples is discussed

  9. Lattice strains in gold and rhenium under nonhydrostatic compression to 37 GPa

    International Nuclear Information System (INIS)

    Duffy, Thomas S.; Shen, Guoyin; Heinz, Dion L.; Shu, Jinfu; Ma, Yanzhang; Mao, Ho-Kwang; Hemley, Russell J.; Singh, Anil K.


    Using energy-dispersive x-ray diffraction techniques together with the theory describing lattice strains under nonhydrostatic compression, the behavior of a layered sample of gold and rhenium has been studied at pressures of 14-37 GPa. For gold, the uniaxial stress component t is consistent with earlier studies and can be described by t=0.06+0.015P where P is the pressure in GPa. The estimated single-crystal elastic moduli are in reasonable agreement with trends based on extrapolated low-pressure data. The degree of elastic anisotropy increases as α, the parameter which characterizes stress-strain continuity across grain boundaries, is reduced from 1.0 to 0.5. For rhenium, the apparent equation of state has been shown to be strongly influenced by nonhydrostatic compression, as evidenced by its dependence on the angle ψ between the diffracting plane normal and the stress axis. The bulk modulus obtained by inversion of nonhydrostatic compression data can differ by nearly a factor of 2 at angles of 0 degree sign and 90 degree sign . On the other hand, by a proper choice of ψ, d spacings corresponding to quasihydrostatic compression can be obtained from data obtained under highly nonhydrostatic conditions. The uniaxial stress in rhenium over the pressure range from 14-37 GPa can be described by t=2.5+0.09P. The large discrepancy between x-ray elastic moduli and ultrasonic data and theoretical calculations indicates that additional factors such as texturing or orientation dependence of t need to be incorporated to more fully describe the strain distribution in hexagonal-close-packed metals. (c) 1999 The American Physical Society

  10. Thermal decomposition of rhenium (5) complexes with 1,2,4-triazole

    International Nuclear Information System (INIS)

    Amindzhanov, A.A.; Gagieva, S.Ch.; Kotegov, K.V.


    Processes of thermal decomposition of rhenium (5) complexes with 1,2,4-triazole were studied. Thermolysis products were identified on the basis of data of the element analysis, IR spectra, conductometry and other methods. It is ascertained that at the first stage of thermolysis of hydroxyl-containing monomer complexes removal of water molecules occurs, and at the second one - dimerization process with formation of Re-O-Re group. It is shown that the nature of halide ion practically does not affect the temperature of the start of intensive thermal decomposition of the complexes

  11. Rhenium(5) and molybdenum(5) complexes with 4',4(5)-divaleryldibenzo-18-crown-6

    International Nuclear Information System (INIS)

    Ashurova, N.Kh.; Yakubov, K.G.; Tashmukhamedova, A.K.; Basitova, S.M.


    Methods for synthesizing oxohalide complexes of rhenium and molybdenum with +5 oxidation degree with 4',4 (5) -divaleryldibenzo-18-crown-6 were developed. Content and composition of prepared compounds were investigated by the methods of element analysis, crystal optics, conductometry, IR spectroscopy in the near and far regions, thermogravimetry. Oxidation degree of the complex-forming metal was determined. It was established that composition of the compounds coressponded to the general formula MOLX · H 2 O, where M - Re, Mo; L -4',4 (5) -divaleryldibenzo-18-crown-6; X -Cl - , Br -

  12. Broad Detection Range Rhenium Diselenide Photodetector Enhanced by (3-Aminopropyl)Triethoxysilane and Triphenylphosphine Treatment. (United States)

    Jo, Seo-Hyeon; Park, Hyung-Youl; Kang, Dong-Ho; Shim, Jaewoo; Jeon, Jaeho; Choi, Seunghyuk; Kim, Minwoo; Park, Yongkook; Lee, Jaehyeong; Song, Young Jae; Lee, Sungjoo; Park, Jin-Hong


    The effects of triphenylphosphine and (3-aminopropyl)triethoxysilane on a rhenium diselenide (ReSe2 ) photodetector are systematically studied by comparing with conventional MoS2 devices. This study demonstrates a very high performance ReSe2 photodetector with high photoresponsivity (1.18 × 10(6) A W(-1) ), fast photoswitching speed (rising/decaying time: 58/263 ms), and broad photodetection range (possible above 1064 nm). © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Fate of rhenium in the environment as a chemical analogue of technetium

    International Nuclear Information System (INIS)

    Tagami, Keiko; Uchida, Shigeo


    Concentrations of rhenium, a chemical analogue of Tc, were measured in various environmental samples by ICP-MS to obtain information values on long-lived 99 Tc mobility in the environment. From the results, it was assumed that Re was removed from the rock and soil by water due to weathering and transport to the sea through rivers. The element would be retained in seawater for a long time, i.e., 2 x 10 5 to 7.5 x 10 5 y. The reservoirs of Re in the sea would be seaweeds, and anoxic and suboxic sediments, especially slightly below the water-sediment interface. (author)

  14. Synthesis, molecular structure and magnetic properties of a rhenium(IV) compound with catechol (United States)

    Cuevas, A.; Geis, L.; Pintos, V.; Chiozzone, R.; Sanchíz, J.; Hummert, M.; Schumann, H.; Kremer, C.


    A novel Re(IV) complex containing catechol as ligand has been prepared and characterized. The crystal structure of (HNEt 3)(NBu 4)[ReCl 4(cat)]·H 2cat was determined. The rhenium ion presents a distorted octahedral geometry, being bonded to a bidentate catecholate group and four chloride anions. The magnetic properties of the complex were studied, a /2 D/ (the energy gap between ±3/2 and ±1/2 Kramers doublets) value of 190(10) cm -1. This is the largest /2 D/ value reported for Re(IV) up to now.

  15. The analysis of mechanism of rhenium-coated tools' wear-resistance rising

    Directory of Open Access Journals (Sweden)

    Daniel Petrosyan


    Full Text Available It is proposed to obtain wear-resistant layers on the hard-alloy materials by thermochemical treatment. In the different field of production – mechanical engineering, metallurgy and military technologies, with machine parts demanding high wearproof and corrosion-proof machinery parts on the surfaces of syntheses of diamonds, with metal surface thermal-diffusion with rhenium, to receive diffusion wearing layers for the first time. A method for thermochemical treatment of hard alloy plates has been investigated, allowing to raise the wear-resistance of cutting and mining tools.

  16. CD40 expression in Wehi-164 cell line


    Karimi, Mohammad Hossein; Ebadi, Padideh; Pourfathollah, Ali Akbar; Soheili, Zahra Soheila; Moazzeni, Seyed Mohammad


    CD40-CD154 interaction is an important process for cellular and humoral immunity regulation and can be effective in the body’s defense against tumors. In the present study, we evaluated the expression of CD40 in Wehi-164 cell line. CD40 expressions on the cell surface and in the cytoplasm were assessed by flow cytometry and intracellular staining assay, respectively. Also, the mRNA expression was identified by real time-PCR. The obtained results showed the high mRNA and cytoplasmic protein ex...

  17. Development of a radiochemical neutron activation analysis procedure for determination of rhenium in biological and environmental samples at ultratrace level

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Byrne, A. R.; Mizera, Jiří; Lučaníková, M.; Řanda, Zdeněk


    Roč. 269, č. 2 (2006), s. 251-257 ISSN 0236-5731 R&D Projects: GA ČR(CZ) GA203/04/0943 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiochemical neutron activation analysis * rhenium * biological and environmental samples Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006

  18. Effect of operational parameters and internal recycle on rhenium solvent extraction from leach liquors using a mixer-settler

    Directory of Open Access Journals (Sweden)

    Mostafa Hosseinzadeh


    Full Text Available The extraction of rhenium from molybdenite roasting dust leach solution was performed using a mixer-settler extractor by tributyl phosphate (TBP diluted in kerosene as the extractant. In the single-stage extraction experiments, effect of the aqueous to organic phase ratios, Qa/Qo, and the number of extraction stages, N, on the rhenium extraction was studied. It was found that using the phase ratio of 1:1 in a two-stage extraction, 87.5% depletion of rhenium was obtained. The comparison of experimental results with the continuous co-current extraction showed a good agreement. The effect of internal recycle of organic phase was investigated in the phase ratio of 1:1 by changing the flow rate ratio of recycle-to-fresh organic phase, Qro/Qfo. The optimum performance was achieved in the phase ratio, Qro/Qfo, equal to 3:7. It was found that improvement in the performance of the mixer-settler for the rhenium-TBP system can be obtained in the phase ratio of 1:1when Qro/Qfo = 3:7.

  19. Separation of Rhenium from Lead-Rich Molybdenite Concentrate via Hydrochloric Acid Leaching Followed by Oxidative Roasting

    Directory of Open Access Journals (Sweden)

    Guanghui Li


    Full Text Available Lead-rich molybdenite is a typical rhenium-bearing molybdenum resource in China, which has not been efficiently utilized due to its high contents of lead and gangue minerals. In this study, hydrochloric acid was used for preliminarily removing lead and calcite from a lead-rich molybdenite concentrate. Oxidative roasting-ammonia leaching was then carried out for separation of rhenium and extraction of molybdenum. The hydrochloric acid leaching experiments revealed that 93.6% Pb and 97.4% Ca were removed when the leaching was performed at 95 °C for 10 min with HCl concentration of 8 wt. % and liquid-solid ratio of 5 (mL/g. The results of direct oxidative roasting indicated that 89.3% rhenium was volatilized from the raw concentrate after roasting at 600 °C for 120 min in air. In contrast, the rhenium volatilization was enhanced distinctly to 98.0% after the acid-leached concentrate (leaching residue was roasted at 550 °C for 100 min. By the subsequent ammonia leaching, 91.5% molybdenum was leached out from the calcine produced from oxidative roasting of the acid-leached concentrate, while only 79.3% Mo was leached from the calcine produced by roasting molybdenite concentrate without pretreatment.

  20. Rhenium-catalyzed dehydrogenative olefination of C(sp(3))-H bonds with hypervalent iodine(III) reagents. (United States)

    Gu, Haidong; Wang, Congyang


    A dehydrogenative olefination of C(sp(3))-H bonds is disclosed here, by merging rhenium catalysis with an alanine-derived hypervalent iodine(III) reagent. Thus, cyclic and acyclic ethers, toluene derivatives, cycloalkanes, and nitriles are all successfully alkenylated in a regio- and stereoselective manner.

  1. Oxidation of iridium coating on rhenium coated graphite at elevated temperature in stagnated air

    International Nuclear Information System (INIS)

    Huang, Yongle; Bai, Shuxin; Zhang, Hong; Ye, Yicong


    Highlights: • Continuous and dense Ir coatings were prepared on graphite by electrodepostion. • The purification of the as-prepared Ir coating was higher than about 99.98%. • The Ir/Re/C specimen kept integrity without significant failures after oxidation. • The average oxidation rate of the Ir coating was about 0.219 mg/(cm 2 min). • Penetrating holes at gains boundaries resulted in the failure of the Ir coating. - Abstract: Continuous and dense iridium coatings were prepared on the rhenium coated graphite specimens by electrodeposition. The iridium/rhenium coated graphite (Ir/Re/C) specimens were oxidized at elevated temperatures in stagnated air for 3600 s. The purification of the as-prepared Ir coating was higher than about 99.98% with the main impurity elements Si, Al, Fe and Ru. After oxidation, the Ir/Re/C specimens kept integrity without significant failures and the average oxidation rate was about 0.219 mg/(cm 2 min). Pores were found at the grain boundaries and concentrated to penetrating holes with the growth of Ir grains, which resulted in disastrous failures of the Ir coating

  2. Oxidation of iridium coating on rhenium coated graphite at elevated temperature in stagnated air

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Yongle; Bai, Shuxin, E-mail:; Zhang, Hong; Ye, Yicong


    Highlights: • Continuous and dense Ir coatings were prepared on graphite by electrodepostion. • The purification of the as-prepared Ir coating was higher than about 99.98%. • The Ir/Re/C specimen kept integrity without significant failures after oxidation. • The average oxidation rate of the Ir coating was about 0.219 mg/(cm{sup 2} min). • Penetrating holes at gains boundaries resulted in the failure of the Ir coating. - Abstract: Continuous and dense iridium coatings were prepared on the rhenium coated graphite specimens by electrodeposition. The iridium/rhenium coated graphite (Ir/Re/C) specimens were oxidized at elevated temperatures in stagnated air for 3600 s. The purification of the as-prepared Ir coating was higher than about 99.98% with the main impurity elements Si, Al, Fe and Ru. After oxidation, the Ir/Re/C specimens kept integrity without significant failures and the average oxidation rate was about 0.219 mg/(cm{sup 2} min). Pores were found at the grain boundaries and concentrated to penetrating holes with the growth of Ir grains, which resulted in disastrous failures of the Ir coating.

  3. Neutron activation determination of rhenium in mineral raw materials of complex composition

    International Nuclear Information System (INIS)

    Shiryaeva, M.B.; Lyubimova, L.N.; Salmin, Yu.P.; Ryumina, K.N.; Tatarkin, M.A.


    The method of neutron-activation rhenium determination in mineral raw material of complex composition is developed, according to which easily hydrolized elements: scandium, iron, lanthanum, ytterbium, protactinium, hafnium and partially ruthenium and osmium are isolated in the form of hydroxides after smelting of a sample, which has been previously irradiated in nuclear reactor (thermal neutron flux 1.2x10 13 n/cm 2 xs for 22 hr) with sodium peroxide and leaching of the melt by water. To separate Re from other interfering elements extraction of perrhenate-ion by methylethylketone from alkali solution is used. Interfering effect of gold is eliminated by its extraction with TBP 30% solution in toluence or benzene from 1 M HNO 3 . Activity of rhenium preparations, singled out from samples of comparison, is measured, using multichannel γ-spectrometer with Ge(Li)-coaxial detector of high resolution (approximately 2.0-2.2 keV over the line 122 keV 5+ Co). Relative standard deviation in Re content range 5x10 -7 -5x10 -2 % does not exceed 0.3

  4. Polarization burst in the BL Lac object AO 0235 + 164

    Energy Technology Data Exchange (ETDEWEB)

    Impey, C D; Brand, P W.J.L. [Edinburgh Univ. (UK). Dept. of Astronomy; Tapia, S [Steward Observatory, Tucson, AZ (USA)


    Simultaneous infrared and optical polarimetry and photometry have been obtained for AO 0235 + 164 covering a five night period. The object underwent a polarization burst during which the 2.2 polarization rose from 17.5 to 28.7 per cent and fell again to 14.9 per cent. At its peak the degree of optical polarization was 43.9 per cent, the highest linear polarization observed in a BL Lac object. The data show the degree of polarization to increase towards shorter wavelengths, and the effect is inconsistent with either dilution by a galactic component or simple one-component synchrotron models. The large changes in polarization are not accompanied by large changes in flux, a result which is difficult to explain using conventional models of these objects. Other implications of the luminosity, polarization and variability are discussed.

  5. Radio variability of the blazar AO 0235 + 164

    International Nuclear Information System (INIS)

    O'dell, S.L.; Dennison, B.; Broderick, J.J.; Altschuler, D.R.; Condon, J.J.; Payne, H.E.; Mitchell, K.J.


    The high-redshift blazar A0 0235 + 164 exhibits flux-density variations which are primarily of the less common variety in which low-frequency flux-density variations track the high-frequency variations but are delayed and of smaller amplitude. Observational results based on five years of monitoring are presented which are correlated over at least a factor of 50 frequency range in the sense expected for an expanding synchrotron component: outbursts propagating toward lower frequencies with diminishing amplitudes. A simple, semiempirical jet model is developed which accounts reasonably well for the radio properties of the object. The predictions of the model are compared with observations, examining the radio flux-density histories, the radio spectral evolution, the radio structure, and evidence for relativistic bulk motion. 59 references

  6. Effect of the method for rhenium neptasulfide preparation on its catalytic properties in hydrogenation of nitrobenzene and m-nitrobenzoic acid

    International Nuclear Information System (INIS)

    Pal'chevskaya, T.A.; Bogutskaya, L.V.; Belousov, V.M.


    The effect of conditions of rhenium heptasulfide synthesis by thiosulfate method on its physicochemical and catalytic properties during hydrogenation of nitrobenzene and m-nitrobenzoic acid has been studied. It is shown that the maximum yield of m-aminobenzoic acid can be attained on insoluble sulfide rhenium contacts, containing excessive amount of sulfur (3.5 %). Under certain conditions of catalyst synthesis particles of Re 2 S 7 soluble in dimethylformamide are formed, which possess selectivity towards amine

  7. Monte Carlo criticality analysis of simple geometries containing tungsten-rhenium alloys engrained with uranium dioxide and uranium mononitride

    International Nuclear Information System (INIS)

    Webb, Jonathan A.; Charit, Indrajit


    Highlights: → The addition of rhenium to the tungsten matrix within W-UO 2 and W-UN CERMET materials can help reduce the risk of submersion criticality accidents while increasing the strength and ductility of tungsten based nuclear fuel elements. → The addition of rhenium up to 30 at.% to simple geometries containing W-UO 2 mixtures can increase the critical mass by 65 kg. → The addition of rhenium up to 30 at.% to simple geometries containing W-UN mixtures can increase the critical mass by 22 kg. → The addition of rhenium by up to 30 at.% to simple geometries containing W-UO 2 mixtures can reduce the change in reactivity change due to water submersion by $5.07. → The addition of rhenium by up to 30 at.% to simple geometries containing W-UN mixtures can reduce the change in reactivity due to water submersion by $3.24. - Abstract: The critical mass and dimensions of simple geometries containing highly enriched uranium dioxide (UO 2 ) and uranium mononitride (UN) encapsulated in tungsten-rhenium alloys are determined using MCNP5 criticality calculations. Spheres as well as cylinders with length to radius ratios of 1.82 are computationally built to consist of 60 vol.% fuel and 40 vol.% metal matrix. Within the geometries, the uranium is enriched to 93 wt.% uranium-235 and the rhenium content within the metal alloy was modeled over the range of 0-30 at.%. The spheres containing UO 2 were determined to have a critical radius of 18.29-19.11 cm and a critical mass ranging from 366 kg to 424 kg. The cylinders containing UO 2 were found to have a critical radius ranging from 17.07 cm to 17.84 cm with a corresponding critical mass of 406-471 kg. Spheres engrained with UN were determined to have a critical radius ranging from 14.82 cm to 15.19 cm and a critical mass between 222 kg and 242 kg. Cylinders which were engrained with UN were determined to have a critical radius ranging from 13.81 cm to 14.15 cm and a corresponding critical mass of 245-267 kg. The critical

  8. Hot rocket plume experiment - Survey and conceptual design. [of rhenium-iridium bipropellants (United States)

    Millard, Jerry M.; Luan, Taylor W.; Dowdy, Mack W.


    Attention is given to a space-borne engine plume experiment study to fly an experiment which will both verify and quantify the reduced contamination from advanced rhenium-iridium earth-storable bipropellant rockets (hot rockets) and provide a correlation between high-fidelity, in-space measurements and theoretical plume and surface contamination models. The experiment conceptual design is based on survey results from plume and contamination technologists throughout the U.S. With respect to shuttle use, cursory investigations validate Hitchhiker availability and adaptability, adequate remote manipulator system (RMS) articulation and dynamic capability, acceptable RMS attachment capability, adequate power and telemetry capability, and adequate flight altitude and attitude/orbital capability.

  9. Hydrodeoxygenation of vicinal OH groups over heterogeneous rhenium catalyst promoted by palladium and ceria support. (United States)

    Ota, Nobuhiko; Tamura, Masazumi; Nakagawa, Yoshinao; Okumura, Kazu; Tomishige, Keiichi


    Heterogeneous ReOx-Pd/CeO2 catalyst showed excellent performance for simultaneous hydrodeoxygenation of vicinal OH groups. High yield (>99%), turnover frequency (300 h(-1)), and turnover number (10,000) are achieved in the reaction of 1,4-anhydroerythritol to tetrahydrofuran. This catalyst can be applied to sugar alcohols, and mono-alcohols and diols are obtained in high yields (≥85%) from substrates with even and odd numbers of OH groups, respectively. The high catalytic performance of ReOx-Pd/CeO2 can be assigned to rhenium species with +4 or +5 valence state, and the formation of this species is promoted by H2/Pd and the ceria support. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. 188Rhenium-HEDP in the Treatment of Pain in Bone Metastases

    International Nuclear Information System (INIS)

    Gaudiano, J.; Savio, E.; Robles, A.; Muniz, S.; Leon, A.; Verdera, S.; Martinez, G.; Hermida, J.C.; Knapp, F.F. Jr.


    Systemic use of radiopharmaceuticals is a recognized alternative method for the treatment of pain in patients with multiple bone metastasis. A new option, 188 Re-HEDP is proposed, using generator-obtained 188 Rhenium (β energy = 2.1 MeV, γ energy = 155 keV, half-life = 16.9 hours). After establishing parameters of biodistribution, dosimetry and image acquisition in mice, rats and rabbits, Phase I and II studies were conducted on 12 patients with multiple metastasis from carcinomas, with pain surpassing other analgesic options. More than 50% pain relief was found in 91% of the patients, with total relief during a variable period in 41% of them allowing opiate and other analgesic drugs to be decreased or withdrawn, and showing a lower bone marrow contribution to total absorbed dose than that reported for other similar radiopharmaceuticals. Further study of this option is recommended in order to determine higher dose protocols without toxic bone marrow reaction possibilities

  11. Determination of rhenium in biological and environmental samples by radiochemical neutron activation analysis

    International Nuclear Information System (INIS)

    Kucera, J.; Mizera, J.; Randa, Z.; Byrne, A.R.; Lucanikova, M.


    Radiochemical neutron activation procedures using liquid-liquid extraction with tetraphenylarsonium chloride in chloroform from 1 M HCl and solid extraction with ALIQUAT 336 incorporated in a polyacrylonitrile binding matrix from 0.1 M HCl were developed for accurate determination of rhenium in biological and environmental samples at the sub-ng.g -1 level. Concentrations of Re in the range of 0.1 to 2.4 ng.g -1 were determined in several botanical reference materials (RM), while in a RM of road dust a value of approx. 10 ng.g -1 was found. Significantly elevated values of Re, up to 90 ng.g -1 , were found in seaweed (brown algae). Results for Re in the brown algae Fucus vesiculosus in which elevated 99 Tc values had previously been determined suggest possible competition between Re and Tc in the accumulation process. (author)

  12. Click-to-Chelate: Development of Technetium and Rhenium-Tricarbonyl Labeled Radiopharmaceuticals

    Directory of Open Access Journals (Sweden)

    Thomas L. Mindt


    Full Text Available The Click-to-Chelate approach is a highly efficient strategy for the radiolabeling of molecules of medicinal interest with technetium and rhenium-tricarbonyl cores. Reaction of azide-functionalized molecules with alkyne prochelators by the Cu(I-catalyzed azide-alkyne cycloaddition (CuAAC; click reaction enables the simultaneous synthesis and conjugation of tridentate chelating systems for the stable complexation of the radiometals. In many cases, the functionalization of (biomolecules with the ligand system and radiolabeling can be achieved by convenient one-pot procedures. Since its first report in 2006, Click-to-Chelate has been applied to the development of numerous novel radiotracers with promising potential for translation into the clinic. This review summarizes the use of the Click-to-Chelate approach in radiopharmaceutical sciences and provides a perspective for future applications.

  13. Mechanical properties of tungsten following rhenium ion and helium plasma exposure

    Directory of Open Access Journals (Sweden)

    C.S. Corr


    Full Text Available Mechanical properties of Tungsten (W samples irradiated with 2 MeV Rhenium (Re ions and helium (He plasma were investigated using nanoindentation. It was found that there was an increase in hardness for all samples following separate irradiation with both Re ion and He plasma. A slight increase in hardness was obtained for combined exposures. A comparable increase in hardness was observed for a pure He plasma with a sample temperature of 473 K and 1273 K. Optical interferometry was employed to compare surface modification of the samples. Grazing incidence small angle x-ray scattering confirmed He nano-bubble formation of approximately 1 nm diameter in the higher temperature sample, which was not observed with samples at the lower temperatures.

  14. Tracing oxidative weathering from the Andes to the lowland Amazon Basin using dissoved rhenium (United States)

    Dellinger, M.; Hilton, R. G.; West, A. J.; Torres, M.; Burton, K. W.; Clark, K. E.; Baronas, J. J.


    Over long timescales (>105 yrs), the abundance of carbon dioxide (CO2) in the atmosphere is determined by the balance of the major carbon sources and sinks. Among the major carbon sources, the oxidation of organic carbon contained within sedimentary rocks ("petrogenic" carbon, or OCpetro) is thought to result in CO2 emission of similar magnitude to that released by volcanism. Rhenium (Re) has been proposed as a proxy for tracing OCpetro oxidation. Here we investigate the source, behavior and flux of dissolved and particulate rhenium (Re) in the Madre de Dios watershed (a major Andean tributary of the Amazon River) and the lowlands, aiming to characterize the behavior of Re in river water and quantify the flux of CO2 released by OCpetro oxidation. Measured Re concentrations in Andean rivers range from 0.07 to 1.55 ppt. In the Andes, Re concentration do not change significantly with water discharge, whereas in the lowlands, Re concentration decrease at high water discharge. Mass balance calculation show that more than 70% of the dissolved Re is sourced from the oxidation of OCpetro the Andes-floodplain system. We calculate dissolved Re flux over a hydrological year to estimate the rates of oxidative weathering, and the associated CO2 release from OCpetro. Rates are high in the Andean headwaters, consistent with estimates from other mountain rivers with similar rates of physical erosion. We find evidence that a significant amount of additional oxidation (Re flux) happens during floodplain transport. These results have important implications for improving our understanding of the source and processes controlling Re in rivers, and allowing us to quantify long-term OCpetro cycling in large river basins.

  15. Rhenium and technetium complexes with phenylbis(2-pyridyl)phosphine and tris(2-pyridyl)phosphine

    Energy Technology Data Exchange (ETDEWEB)

    Saucedo A, S. A. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Calle Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico); Hagenbach, A.; Abram, U., E-mail: [Institut fur Chemie und Biochemie, Freie Universitat Berlin, Fabeckstr. 34-36, D-14195, Berlin (Germany)


    Reactions of common technetium and rhenium precursors with 2-pyridyl phosphines produce novel, air stable tricarbonyl and oxo complexes. (NEt{sub 4}){sub 2}[Re(CO){sub 3}Br{sub 3}] or (NEt{sub 4}){sub 2}[Tc(CO){sub 3}Cl{sub 3}] react with phenylbis(2-pyridyl)phosphine (PPhpy{sub 2}) or tris(2-pyridyl)phosphine (Ppy{sub 3}) under formation of neutral tricarbonyl complexes of the composition [M(CO){sub 3}X(L)] (M = Re, X = Br; M = Tc, X = Cl, L = PPhpy{sub 2} or Ppy{sub 3}), where the ligands coordinate only with two for their nitrogen atoms. Removal of the bromo ligands from (NEt{sub 4}){sub 2}[Re(CO){sub 3}(Br){sub 3}] with AgNO{sub 3}, to force a tripodal coordination, and the subsequent reaction with the Ppy{sub 3} results in the formation of the complex [Re(CO){sub 3}(NO{sub 3})(Ppy{sub 3}{sup -}N,N{sup '})] with a monodentate coordinated nitrato ligand. (NBu{sub 4})[ReOCl{sub 4}] reacts with PPhpy{sub 2} to give the asymmetric, oxo-bridged rhenium (V) dimer (NBu{sub 4})[Re{sub 2}O{sub 2}Cl{sub 5}({mu}-PPhpy{sub 2}{sup -}P,N,N,N{sup '})({mu}-O)], while a similar reaction with (ReOCl{sub 3}(PPh{sub 3}){sub 2}] in boiling Thf results in reduction of the metal and gives (ReCl{sub 3}(OPPhpy{sub 2})(PPh{sub 3})]. The products have been characterized spectroscopically and by X-ray structure analyses. (Author)

  16. Rhenium-188: Availability from the W-188/Re-188 Generator and Status of Current Applications

    International Nuclear Information System (INIS)

    Pillai, M.R.A.; Dash, A.; Knapp, Russ F. Jr.


    Rhenium-188 is one of the most readily available generator derived and useful radionuclides for therapy emitting β-particles (2.12 MeV, 71.1% and 1.965 MeV, 25.6%) and imageable gammas (155 KeV, 15.1%). The 188W/188Re generator is an ideal source for the long term (4-6 months) continuous availability of no carrier added (nca) 188Re suitable for the preparation of radiopharmaceuticals for radionuclide therapy. The challenges associated with the double neutron capture route of production of the parent 188W radionuclide have been a major impediment in the progress of application of 188Re. Tungsten-188 of adequate specific activity can be prepared only in 2-3 of the high flux reactors operating in the World. Several useful technologies have been developed for the preparation of clinical grade 188W/188Re generator. Since the specific activity of 188W used in the generator is relatively low (<5 Ci/g), the eluted 188ReO4- can have low radioactive concentration often insufficient for radiopharmaceutical preparation. However, several efficient post elution concentration techniques have been developed that yield clinically useful 188ReO4-. Rhenium-188 has been used for the preparation of therapeutic radiopharmaceuticals for the management of diseases such as bone metastasis, rheumatoid arthritis and primary cancers. Several early phase clinical studies using radiopharmaceuticals based on 188Re-labeled phosphonates, antibodies, peptides, lipiodol and particulates have been reported. This article reviews the availability, and use of188Re including a discussion of why broader use of 188Re has not progressed as ecpected as a popular radionuclide for therapy.

  17. Rhenium Alloys as Ductile Substrates for Diamond Thin-Film Electrodes. (United States)

    Halpern, Jeffrey M; Martin, Heidi B


    Molybdenum-rhenium (Mo/Re) and tungsten-rhenium (W/Re) alloys were investigated as substrates for thin-film, polycrystalline boron-doped diamond electrodes. Traditional, carbide-forming metal substrates adhere strongly to diamond but lose their ductility during exposure to the high-temperature (1000°C) diamond, chemical vapor deposition environment. Boron-doped semi-metallic diamond was selectively deposited for up to 20 hours on one end of Mo/Re (47.5/52.5 wt.%) and W/Re (75/25 wt.%) alloy wires. Conformal diamond films on the alloys displayed grain sizes and Raman signatures similar to films grown on tungsten; in all cases, the morphology and Raman spectra were consistent with well-faceted, microcrystalline diamond with minimal sp 2 carbon content. Cyclic voltammograms of dopamine in phosphate-buffered saline (PBS) showed the wide window and low baseline current of high-quality diamond electrodes. In addition, the films showed consistently well-defined, dopamine electrochemical redox activity. The Mo/Re substrate regions that were uncoated but still exposed to the diamond-growth environment remained substantially more flexible than tungsten in a bend-to-fracture rotation test, bending to the test maximum of 90° and not fracturing. The W/Re substrates fractured after a 27° bend, and the tungsten fractured after a 21° bend. Brittle, transgranular cleavage fracture surfaces were observed for tungsten and W/Re. A tension-induced fracture of the Mo/Re after the prior bend test showed a dimple fracture with a visible ductile core. Overall, the Mo/Re and W/Re alloys were suitable substrates for diamond growth. The Mo/Re alloy remained significantly more ductile than traditional tungsten substrates after diamond growth, and thus may be an attractive metal substrate for more ductile, thin-film diamond electrodes.

  18. 40 CFR 164.40 - Qualifications and duties of Administrative Law Judge. (United States)


    ... Administrative Law Judge. 164.40 Section 164.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Judicial Ethics of the American Bar Association. (d) Power. Subject to review, as provided elsewhere in... Law Judge, the Administrator or the Environmental Appeals Board. [38 FR 19371, July 20, 1973, as...

  19. 33 CFR 164.43 - Automatic Identification System Shipborne Equipment-Prince William Sound. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Automatic Identification System Shipborne Equipment-Prince William Sound. 164.43 Section 164.43 Navigation and Navigable Waters COAST GUARD... Automatic Identification System Shipborne Equipment—Prince William Sound. (a) Until December 31, 2004, each...

  20. 28 CFR 0.164 - Civil claims that may be closed by Assistant Attorneys General. (United States)


    ... Assistant Attorneys General. 0.164 Section 0.164 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION... General. Assistant Attorneys General are authorized, with respect to matters assigned to their respective... proposed closing should receive the personal attention of the Attorney General, the Deputy Attorney General...

  1. 40 CFR 16.4 - Times, places, and requirements for identification of individuals making requests. (United States)


    ... identification (e.g., driver's license, employee identification card, social security card, or credit card) to... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Times, places, and requirements for identification of individuals making requests. 16.4 Section 16.4 Protection of Environment ENVIRONMENTAL...

  2. 26 CFR 1.164-7 - Taxes of shareholder paid by corporation. (United States)


    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Taxes of shareholder paid by corporation. 1.164...) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.164-7 Taxes of shareholder paid by corporation. Banks and other corporations paying taxes assessed...

  3. 15 CFR 922.164 - Additional activity regulations by Sanctuary area. (United States)


    ... plants may be possessed aboard a vessel in an Ecological Reserve or Sanctuary Preservation Area, provided... Sanctuary area. 922.164 Section 922.164 Commerce and Foreign Trade Regulations Relating to Commerce and... AND COASTAL RESOURCE MANAGEMENT NATIONAL MARINE SANCTUARY PROGRAM REGULATIONS Florida Keys National...

  4. 33 CFR 164.76 - Towline and terminal gear for towing alongside and pushing ahead. (United States)


    ... towing alongside and pushing ahead. 164.76 Section 164.76 Navigation and Navigable Waters COAST GUARD... Towline and terminal gear for towing alongside and pushing ahead. The owner, master, or operator of each vessel towing alongside or pushing ahead shall ensure that the face wires, spring lines, and push gear...

  5. sup(99m)Tc-sulfur-rhenium-colloid and 111In-indiumcitrate in the bone marrow scintigraphy

    International Nuclear Information System (INIS)

    Glaubitt, D.; Haberland, K.; Knoch, K.; Fejer, F.L.; Zachariah, S.; Staedtische Krankenanstalten Krefeld


    Bone marrow scintigraphy using 111 In-Indium-citrate and sup(99m)Tc-sulfur rhenium colloid was compared with each other in 6 male and 3 female patients. Our results in all patients were in favour of 111 In-citrate which caused a better delineation of morphological details than sup(99m)Tc-sulfur rhenium colloid did. In the first days after intravenous administration of 111 In-citrate, radioindium accumulated markedly in the pudendal region, this finding being more distinct in male patients than in female ones. On account of these results a considerable radiation dose has to be assumed in bone marrow scintigraphy using 111 In-citrate as long as the absorbed dose from 111 In has not been estimated under consideration of the radioindium accumulation in the pudendal region. 111 In-citrate should be applied in bone marrow scanning only exceptionally and sup(99m)Tc-sulfur rhenium colloid be preferred in the routine diagnostics of bone marrow. (orig.) [de

  6. Pathologic audit of 164 consecutive cases of vulvar intraepithelial neoplasia. (United States)

    Scurry, James; Campion, Michael; Scurry, Bonnie; Kim, Soo Nyung; Hacker, Neville


    There are 2 types of vulvar intraepithelial neoplasia (VIN): warty-basaloid and differentiated. Differentiated VIN is uncommon and seldom diagnosed prior to carcinoma and, traditionally, is not graded. There are currently 3 grading systems for warty-basaloid VIN: the World Health Organization (WHO) 3 grade system of VIN 1-3, a 2 grade system of low and high grade vulvar intraepithelial lesions, and the revised International Society for the Study of Vulvovaginal Disease (ISSVD) classification which has no grading of VIN. According to the ISSVD, VIN 1 should be abolished and VIN 2 and 3 combined into a single category, simply termed warty-basaloid VIN. To determine the best system for grading warty-basaloid VIN and learn more about differentiated VIN, we reviewed the pathology of 164 consecutive women with VIN. Of these, 134 (82.3%) had warty-basaloid VIN, 29 (18.2%) had differentiated VIN, and 1 had both. Of warty-basaloid VIN cases, 4 had VIN 1, 13 VIN 2, and 118 VIN 3 when graded according to the WHO. All VIN 1 occurred in condylomata acuminata. VIN 2 and 3 were distinguished only by degree of abnormality. Differentiated VIN was diagnosed before SCC in only 7 cases (26.7%). Because the only VIN 1 cases seen were in condylomata acuminata and because VIN 2 and 3 were difficult to distinguish and there appears little clinical reason to do so, our study supports the ISSVD proposal that VIN 1 be abolished and VIN 2 and 3 be combined. There needs to be more clinical awareness of vulvar conditions, so that differentiated VIN is biopsied before cancer has supervened.

  7. Influence of the acid and basic properties of rhenium oxide supported on alumina catalyst on the catalytic performance in olefin metathesis; Influence des proprietes acido-basiques de l`oxyde de rhenium supporte sur les performances catalytiques en metathese des olefines

    Energy Technology Data Exchange (ETDEWEB)

    Nahama, F.


    The aim of this work is to study the influence of the acid-basic properties of rhenium oxide supported on alumina catalyst on the catalytic performance in olefin metathesis. The literature data indicate that the environment of the active site does possess acid properties. However, the nature of the acid sites is still matter of debate. Concerning the Re O{sub x} - Al{sub 2}O{sub 3} interactions, we have shown that perrhenate ions are electrostatically absorbed on alumina. The uptake of rhenium is favoured at acidic pH (below 4), and the absorbed rhenium is in equilibrium with rhenium in solution. The results of rhenium extraction by water strongly suggest that the surface compounds of the calcined Re{sub 2}O{sub 7}/Al{sub 2}O{sub 3} materials is aluminium perrhenate. Characterization of surface acidity of the catalyst by infrared spectroscopy reveals that the initiation of the metathesis reaction is governed essentially by Lewis acidity. This strongly supports the role of Lewis acidity, which is exalted by the increase of the rhenium content and the calcination temperature. Finally, we point out by ammonia adsorption-thermodesorption a band at 1320 cm{sup -1} characteristic of the Lewis acidity of aluminium perrhenate. This result is a second indication of the presence of aluminium perrhenate on the Re{sub 2}O{sub 7}/Al{sub 2}O{sub 3} catalyst surface. (author)

  8. Use of a new tandem cation/anion exchange system with clinical-scale generators provides high specific volume solutions of technetium-99m and rhenium-188

    International Nuclear Information System (INIS)

    Knapp, F.R. Jr.; Beets, A.L.; Mirzadeh, S.; Guhlke, S.; Univ. of Bonn


    In this paper the authors describe the first application of a simple and inexpensive post elution tandem cation-anion exchange column system which is based on generator elution with salts of weak acids such as ammonium acetate instead of saline solution to provide very high specific volume solutions of technetium-99m and rhenium-188 from clinical scale molybdenum-99/technetium-99m generator prepared from low specific activity (n,y) molybdenum-99, and tungsten-188/rhenium-188 generators, respectively. Initial passage of the bolus through a strong cation exchange cartridge converts the ammonium acetate to acetic acid which is essentially not ionized at the acidic pH, allowing specific subsequent amine type (QMA SepPak trademark) anion exchange cartridge column trapping of the microscopic levels of the pertechnetate or perrhenate. Subsequent elution of the anion cartridge with a small volume ( 500 mCi/mL) from the alumina-based tungsten-188/rhenium-188 generator

  9. Intracellular distribution and stability of a luminescent rhenium(I) tricarbonyl tetrazolato complex using epifluorescence microscopy in conjunction with X-ray fluorescence imaging

    International Nuclear Information System (INIS)

    Wedding, Jason L.; Harris, Hugh H.; Bader, Christie A.; Plush, Sally E.; Mak, Rachel


    Optical fluorescence microscopy was used in conjunction with X-ray fluorescence microscopy to monitor the stability and intracellular distribution of the luminescent rhenium(I) complex fac-[Re(CO) 3 (phen)L], where phen = 1,10-phenathroline and L = 5-(4-iodophenyl)tetrazolato, in 22Rv1 cells. The rhenium complex showed no signs of ancillary ligand dissociation, a conclusion based on data obtained via X-ray fluorescence imaging aligning iodine and rhenium distributions. A diffuse reticular localisation was detected for the complex, in the nuclear/perinuclear region of cells, by either optical or X-ray fluorescence techniques. Furthermore, X-ray fluorescence also showed that the Re-I complex disrupted the homeostasis of some biologically relevant elements, such as chlorine, potassium and zinc.

  10. Studies of technetium chemistry. Pt.8. The regularities of the bond length and configuration of rhenium and technetium complexes in crystals

    International Nuclear Information System (INIS)

    Liu Guozheng; Liu Boli


    Some bond length regularities in MO 6 , MO-4, MX 5 α and MX 4 αβ moieties of technetium and rhenium compounds are summarized and rationalized by cavity model. The chemical properties of technetium and rhenium are so similar that their corresponding complexes have almost the same configuration and M-X bond lengths when they are in cavity-controlled state. Technetium and Rhenium combine preferably with N, O, F, S, Cl and Br when they are in higher oxidation states (>3), but preferably with P, Se etc. when they are in lower oxidation states ( 4 αβ is approximately constant; (2) the average M-X bond length of MX 6 varies moderately with the oxidation state of M; (3) the bond length of M-X trans to M-α in MX 5 α has a linear relationship with the angle

  11. 45 CFR 164.414 - Administrative requirements and burden of proof. (United States)


    ... STANDARDS AND RELATED REQUIREMENTS SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured... this subpart or that the use or disclosure did not constitute a breach, as defined at § 164.402. ...

  12. Isomer decay spectroscopy of 164Sm and 166Gd: midshell collectivity around N=100. (United States)

    Patel, Z; Söderström, P-A; Podolyák, Zs; Regan, P H; Walker, P M; Watanabe, H; Ideguchi, E; Simpson, G S; Liu, H L; Nishimura, S; Wu, Q; Xu, F R; Browne, F; Doornenbal, P; Lorusso, G; Rice, S; Sinclair, L; Sumikama, T; Wu, J; Xu, Z Y; Aoi, N; Baba, H; Bello Garrote, F L; Benzoni, G; Daido, R; Fang, Y; Fukuda, N; Gey, G; Go, S; Gottardo, A; Inabe, N; Isobe, T; Kameda, D; Kobayashi, K; Kobayashi, M; Komatsubara, T; Kojouharov, I; Kubo, T; Kurz, N; Kuti, I; Li, Z; Matsushita, M; Michimasa, S; Moon, C-B; Nishibata, H; Nishizuka, I; Odahara, A; Şahin, E; Sakurai, H; Schaffner, H; Suzuki, H; Takeda, H; Tanaka, M; Taprogge, J; Vajta, Zs; Yagi, A; Yokoyama, R


    Excited states in the N=102 isotones 166Gd and 164Sm have been observed following isomeric decay for the first time at RIBF, RIKEN. The half-lives of the isomeric states have been measured to be 950(60) and 600(140) ns for 166Gd and 164Sm, respectively. Based on the decay patterns and potential energy surface calculations, including β6 deformation, a spin and parity of 6- has been assigned to the isomeric states in both nuclei. Collective observables are discussed in light of the systematics of the region, giving insight into nuclear shape evolution. The decrease in the ground-band energies of 166Gd and 164Sm (N=102) compared to 164Gd and 162Sm (N=100), respectively, presents evidence for the predicted deformed shell closure at N=100.

  13. Isomer Decay Spectroscopy of Sm 164 and Gd 166 : Midshell Collectivity Around N =100 (United States)

    Patel, Z.; Söderström, P.-A.; Podolyák, Zs.; Regan, P. H.; Walker, P. M.; Watanabe, H.; Ideguchi, E.; Simpson, G. S.; Liu, H. L.; Nishimura, S.; Wu, Q.; Xu, F. R.; Browne, F.; Doornenbal, P.; Lorusso, G.; Rice, S.; Sinclair, L.; Sumikama, T.; Wu, J.; Xu, Z. Y.; Aoi, N.; Baba, H.; Bello Garrote, F. L.; Benzoni, G.; Daido, R.; Fang, Y.; Fukuda, N.; Gey, G.; Go, S.; Gottardo, A.; Inabe, N.; Isobe, T.; Kameda, D.; Kobayashi, K.; Kobayashi, M.; Komatsubara, T.; Kojouharov, I.; Kubo, T.; Kurz, N.; Kuti, I.; Li, Z.; Matsushita, M.; Michimasa, S.; Moon, C.-B.; Nishibata, H.; Nishizuka, I.; Odahara, A.; Şahin, E.; Sakurai, H.; Schaffner, H.; Suzuki, H.; Takeda, H.; Tanaka, M.; Taprogge, J.; Vajta, Zs.; Yagi, A.; Yokoyama, R.


    Excited states in the N =102 isotones Gd 166 and Sm 164 have been observed following isomeric decay for the first time at RIBF, RIKEN. The half-lives of the isomeric states have been measured to be 950(60) and 600(140) ns for Gd 166 and Sm 164 , respectively. Based on the decay patterns and potential energy surface calculations, including β6 deformation, a spin and parity of 6- has been assigned to the isomeric states in both nuclei. Collective observables are discussed in light of the systematics of the region, giving insight into nuclear shape evolution. The decrease in the ground-band energies of Gd 166 and Sm 164 (N =102 ) compared to Gd 164 and Sm 162 (N =100 ), respectively, presents evidence for the predicted deformed shell closure at N =100 .

  14. 188Rhenium-HEDP in the treatment of pain in bone metastases

    International Nuclear Information System (INIS)

    Gaudiano, J.; Martinez, G.; Hermida, J.C.; Savio, E.; Verdera, S.; Robles, A.; Muniz, S.; Leon, A.; Knapp, F.F.


    Systemic use of radiopharmaceuticals is a recognised alternative method for the treatment of pain in patients with multiple bone metastases. A new option, 188 Re-HEDP is proposed, using generator-obtained 188 Rhenium (β energy = 2.1 MeV, γ energy = 155 keV, half-life = 16.9 hours). After establishing parameters of biodistribution, dosimetry and image acquisition in mice, rats and rabbits, Phase I and II studies were conducted on 12 patients with multiple metastases from carcinomas, with pain surpassing other analgesic options. More than 50% pain relief was found in 91% of the patients, with total relief during a variable period in 41% of them allowing opiate and other analgesic drugs to be decreased or withdrawn, and showing a lower bone marrow contribution to total absorbed dose than that reported for other similar radiopharmaceuticals. Further study of this option is recommended in order to determine higher dose protocols without toxic bone marrow reaction possibilities. (author)

  15. Phosphorene/rhenium disulfide heterojunction-based negative differential resistance device for multi-valued logic (United States)

    Shim, Jaewoo; Oh, Seyong; Kang, Dong-Ho; Jo, Seo-Hyeon; Ali, Muhammad Hasnain; Choi, Woo-Young; Heo, Keun; Jeon, Jaeho; Lee, Sungjoo; Kim, Minwoo; Song, Young Jae; Park, Jin-Hong


    Recently, negative differential resistance devices have attracted considerable attention due to their folded current-voltage characteristic, which presents multiple threshold voltage values. Because of this remarkable property, studies associated with the negative differential resistance devices have been explored for realizing multi-valued logic applications. Here we demonstrate a negative differential resistance device based on a phosphorene/rhenium disulfide (BP/ReS2) heterojunction that is formed by type-III broken-gap band alignment, showing high peak-to-valley current ratio values of 4.2 and 6.9 at room temperature and 180 K, respectively. Also, the carrier transport mechanism of the BP/ReS2 negative differential resistance device is investigated in detail by analysing the tunnelling and diffusion currents at various temperatures with the proposed analytic negative differential resistance device model. Finally, we demonstrate a ternary inverter as a multi-valued logic application. This study of a two-dimensional material heterojunction is a step forward toward future multi-valued logic device research.

  16. Phosphorene/rhenium disulfide heterojunction-based negative differential resistance device for multi-valued logic (United States)

    Shim, Jaewoo; Oh, Seyong; Kang, Dong-Ho; Jo, Seo-Hyeon; Ali, Muhammad Hasnain; Choi, Woo-Young; Heo, Keun; Jeon, Jaeho; Lee, Sungjoo; Kim, Minwoo; Song, Young Jae; Park, Jin-Hong


    Recently, negative differential resistance devices have attracted considerable attention due to their folded current–voltage characteristic, which presents multiple threshold voltage values. Because of this remarkable property, studies associated with the negative differential resistance devices have been explored for realizing multi-valued logic applications. Here we demonstrate a negative differential resistance device based on a phosphorene/rhenium disulfide (BP/ReS2) heterojunction that is formed by type-III broken-gap band alignment, showing high peak-to-valley current ratio values of 4.2 and 6.9 at room temperature and 180 K, respectively. Also, the carrier transport mechanism of the BP/ReS2 negative differential resistance device is investigated in detail by analysing the tunnelling and diffusion currents at various temperatures with the proposed analytic negative differential resistance device model. Finally, we demonstrate a ternary inverter as a multi-valued logic application. This study of a two-dimensional material heterojunction is a step forward toward future multi-valued logic device research. PMID:27819264

  17. 3.3.1. Synthesis, Spectroscopy and Structural Analysis of Technetium and Rhenium Nitrosyl Complexes

    Directory of Open Access Journals (Sweden)

    Terrence\tNicholson*,\tEsther\tChunb, Ashfaq\tMahmood,\tPeter\tMueller,\tAlan\tDavisona\tand\tAlun\tG.\tJones


    Full Text Available Here we report an overview of our synthetic, spectroscopic and structural studies of technetium and rhenium nitrosyl complexes. We review the results from various notes and short papers reported over the past 15 years and discuss their significance in terms of radiopharmaceutical design.A single new complex is reported, the ReI-NO complex [ReICl2(NO(py-N(Et-py], in which the tridentate ligand di-(2-picolyl(N-ethylamine, (py-N(Et-py, is coordinated in a meridional manner. This complex was synthesized from the reaction of the ReI-nitrosyl complex ReCl2(NO(NCMe3] and the neutral tri-amine ligand py-N(Et-py in methylene chloride under argon. The bright red species was isolated chromatographically and recrystallized from CH2Cl2/MeOH under diethylether.A review of literature values for nitrosyl complexes with various ligands bound to the coordination sitetrans- to the nitrosyl group shows only minor variations in the M-N-O bond angle.

  18. Safety and Efficacy of 188-Rhenium-Labeled Antibody to Melanin in Patients with Metastatic Melanoma

    Directory of Open Access Journals (Sweden)

    M. Klein


    Full Text Available There is a need for effective “broad spectrum” therapies for metastatic melanoma which would be suitable for all patients. The objectives of Phase Ia/Ib studies were to evaluate the safety, pharmacokinetics, dosimetry, and antitumor activity of 188Re-6D2, a 188-Rhenium-labeled antibody to melanin. Stage IIIC/IV metastatic melanoma (MM patients who failed standard therapies were enrolled in both studies. In Phase Ia, 10 mCi 188Re-6D2 were given while unlabeled antibody preload was escalated. In Phase Ib, the dose of 188Re-6D2 was escalated to 54 mCi. SPECT/CT revealed 188Re-6D2 uptake in melanoma metastases. The mean effective half-life of 188Re-6D2 was 12.4 h. Transient HAMA was observed in 9 patients. Six patients met the RECIST criteria for stable disease at 6 weeks. Two patients had durable disease stabilization for 14 weeks and one for 22 weeks. Median overall survival was 13 months with no dose-limiting toxicities. The data demonstrate that 188Re-6D2 was well tolerated, localized in melanoma metastases, and had antitumor activity, thus warranting its further investigation in patients with metastatic melanoma.

  19. Laser-induced breakdown spectroscopy measurement of a small fraction of rhenium in bulk tungsten (United States)

    Nishijima, D.; Ueda, Y.; Doerner, R. P.; Baldwin, M. J.; Ibano, K.


    Laser-induced breakdown spectroscopy (LIBS) of bulk rhenium (Re) and tungsten (W)-Re alloy has been performed using a Q-switched Nd:YAG laser (wavelength = 1064 nm, pulse width ∼4-6 ns, laser energy = 115 mJ). It is found that the electron temperature, Te, of laser-induced Re plasma is lower than that of W plasma, and that Te of W-Re plasma is in between Re and W plasmas. This indicates that material properties affect Te in a laser-induced plasma. For analysis of W-3.3%Re alloy, only the strongest visible Re I 488.9 nm line is found to be used because of the strong enough intensity without contamination with W lines. Using the calibration-free LIBS method, the atomic fraction of Re, cRe, is evaluated as a function of the ambient Ar gas pressure, PAr. At PAr 10 Torr due to spectral overlapping of the Re I 488.9 nm line by an Ar II 488.9 nm line.

  20. Bone marrow adsorbed dose of rhenium-186-HEDP and the relationship with decreased platelet counts

    International Nuclear Information System (INIS)

    Klerk, J.M.H. de; Dieren, E.B. van; Schip, A.D. van het


    Rhenium-186(Sn)-1,1-hydroxyethylidene diphosphonate ( 186 Re-HEDP) has been used for palliation of metastatic bone pain. The purpose of this study was to find a relationship between the bone marrow absorbed dose and the toxicity, expressed as the percentage decrease in the peripheral blood platelet count. The bone marrow absorbed dose was calculated according to the MIRD model using data obtained from ten treatments of patients suffering from metastatic prostate cancer; noninvasive and pharmacokinetic method were used. The bone marrow doses were related to toxicity using the pharmacodynamic sigmoid E max model. The mean bone marrow absorbed doses using the noninvasive and pharmacokinetic methods were in a close range to each other (1.07 mGy/MBq and 1.02 mGy/MBq, respectively). There was a good relationship between the toxicity and the bone marrow absorbed dose (r = 0.80). Furthermore, the EDrm 50 (i.e., the bone marrow absorbed dose producing a 50% platelet decrease) to bone marrow for 186 Re-HEDP was on the order of 2 Gy. Although the function of normal bone marrow is affected by metastases in patients with metastatic bone disease, the MIRD model can be used to relate toxicity to the bone marrow absorbed dose after a therapeutic dosage of 186 Re-HEDP. 33 refs., 1 fig., 1 tab

  1. SPS Fabrication of Tungsten-Rhenium Alloys in Support of NTR Fuels Development

    International Nuclear Information System (INIS)

    Webb, Jonathan A.; Charit, Indrajit; Sparks, Cory; Butt, Darryl P.; Frary, Megan; Carroll, Mark


    Tungsten metal slugs were fabricated via Spark Plasma Sintering (SPS) of powdered metals at temperatures ranging from 1575 K to 1975 K and hold times of 5 minutes to 30 minutes, using powders with an average diameter of 7.8 ?m. Sintered tungsten specimens were found to have relative densities ranging from 83 % to 94 % of the theoretical density for tungsten. Consolidated specimens were also tested for their Vickers Hardness Number (VHN), which was fitted as a function of relative density; the fully consolidated VHN was extrapolated to be 381.45 kg/mm2. Concurrently, tungsten and rhenium powders with average respective diameters of 0.5 ?m and 13.3 ?m were pre-processed either by High-Energy-Ball-Milling (HEBM) or by homogeneous mixing to yield W-25at.%Re mixtures. The powder batches were sintered at temperatures of 1975 K and 2175 K for hold times ranging from 0 minutes to 60 minutes yielding relative densities ranging from 94% to 97%. The combination of HEBM and sintering showed a significant decrease in the inter-metallic phases compared to that of the homogenous mixing and sintering.

  2. Sorption of technetium and its analogue rhenium on bentonite material under aerobic conditions

    International Nuclear Information System (INIS)

    Koudelkova, M.; Vinsova, H.; Konirova, R.; Ernestova, M.; Jedinakova-Krizova, V.; Tereesha, M.


    The uptake of technetium on bentonite materials has been studied from the point of view of characterization of long-term radioactive elements behavior in nuclear waste repository. Bentonite R (locality Rokle, Czech Republic) and two types of model groundwater (granitic and bentonite) were selected for the sorption experiments. The aim of our research has been to find out the conditions suitable for the technetium sorption on selected bentonite under oxidizing condition. The sorption experiments with Tc-99 on bentonite have been carried out by batch method. The influence of the addition of different materials (e.g. activated carbon, graphite, Fe 2+ ) with bentonite, the effect of solid: aqueous phase ratio and a pH value on the percentage of technetium uptake and on the K d values were tested. Perrhenate was selected as an analogue of pertechnetate in non-active experiments of capillary electrophoresis (CE) and isotachophoresis (ITP). The percentage of rhenium sorbed on bentonite material was determined from the decrease of perrhenate peak area (CE) and from the shortening of the ITP zone corresponding to perrhenate. Both electromigration methods provided comparable results. The results obtained in this study with non-active material were compared to those of technetium acquired by radiometry and polarography. The 8 days kinetics of the perrhenate and pertechnetate sorption on bentonite was described mathematically with a tendency to predict long-term behavior of studied systems. (authors)

  3. Prototype commercial electrooxidation cell for the recovery of molybdenum and rhenium from molybdenite concentrates

    International Nuclear Information System (INIS)

    Scheiner, B.J.; Pool, D.L.; Lindstrom, R.E.; McCleland, G.E.


    As part of the goal to maximize minerals and metals recovery from primary domestic resources, design factors associated with minimizing current leakage in bipolar cell configurations were studied as a means of improving the efficiency of bipolar electrooxidation cells. Initial studies that were conducted in a small bipolar cell operating at 140 to 145 volts and 15.4 A indicated how design factors could be employed to minimize current leakage around adjacent electrodes during cell operation. Based on these results, a 40-electrode, 108-kVA prototype of an industrial-sized cell was constructed and tested for extracting metal values from offgrade molybdenite concentrates. The feasibility of recovering molybdenum and rhenium from the oxidized pulp also was determined. Feed to the process sequence consisted of flotation concentrates containing 16 to 35% Mo as molybdenite and 6 to 15% Cu. Electrooxidation in the prototype cell results in 84 to 97% Mo and Re extraction with a corresponding energy consumption of 9 to 13 kWh/lb Mo extracted

  4. {sup 188}Rhenium-HEDP in the Treatment of Pain in Bone Metastases

    Energy Technology Data Exchange (ETDEWEB)

    Gaudiano, J.; Savio, E.; Robles, A.; Muniz, S.; Leon, A.; Verdera, S.; Martinez, G.; Hermida, J.C.; Knapp, F.F., Jr.


    Systemic use of radiopharmaceuticals is a recognized alternative method for the treatment of pain in patients with multiple bone metastasis. A new option, {sup 188}Re-HEDP is proposed, using generator-obtained {sup 188}Rhenium ({beta} energy = 2.1 MeV, {gamma} energy = 155 keV, half-life = 16.9 hours). After establishing parameters of biodistribution, dosimetry and image acquisition in mice, rats and rabbits, Phase I and II studies were conducted on 12 patients with multiple metastasis from carcinomas, with pain surpassing other analgesic options. More than 50% pain relief was found in 91% of the patients, with total relief during a variable period in 41% of them allowing opiate and other analgesic drugs to be decreased or withdrawn, and showing a lower bone marrow contribution to total absorbed dose than that reported for other similar radiopharmaceuticals. Further study of this option is recommended in order to determine higher dose protocols without toxic bone marrow reaction possibilities.

  5. β2-adrenergic receptor Thr164Ile polymorphism, obesity, and diabetes

    DEFF Research Database (Denmark)

    Thomsen, Mette; Dahl, Morten; Tybjærg-Hansen, Anne


    The β(2)-adrenergic receptor (ADRB2) influences regulation of energy balance by stimulating catecholamine-induced lipolysis in adipose tissue. The rare functional ADRB2rs1800888(Thr164Ile) polymorphism could therefore influence risk of obesity and subsequently diabetes.......The β(2)-adrenergic receptor (ADRB2) influences regulation of energy balance by stimulating catecholamine-induced lipolysis in adipose tissue. The rare functional ADRB2rs1800888(Thr164Ile) polymorphism could therefore influence risk of obesity and subsequently diabetes....

  6. The role of sialomucin CD164 (MGC-24v or endolyn) in prostate cancer metastasis

    International Nuclear Information System (INIS)

    Havens, AM; Jung, Y; Sun, YX; Wang, J; Shah, RB; Bühring, HJ; Pienta, KJ; Taichman, RS


    The chemokine stromal derived factor-1 (SDF-1 or CXCL12) and its receptor CXCR4 have been demonstrated to be crucial for the homing of stem cells and prostate cancers to the marrow. While screening prostate cancers for CXCL12-responsive adhesion molecules, we identified CD164 (MGC-24) as a potential regulator of homing. CD164 is known to function as a receptor that regulates stem cell localization to the bone marrow. Using prostate cancer cell lines, it was demonstrated that CXCL12 induced both the expression of CD164 mRNA and protein. Functional studies demonstrated that blocking CD164 on prostate cancer cell lines reduced the ability of these cells to adhere to human bone marrow endothelial cells, and invade into extracellular matrices. Human tissue microarrays stained for CD164 demonstrated a positive correlation with prostate-specific antigen levels, while its expression was negatively correlated with the expression of androgen receptor. Our findings suggest that CD164 may participate in the localization of prostate cancer cells to the marrow and is further evidence that tumor metastasis and hematopoietic stem cell trafficking may involve similar processes

  7. Elementary steps of the catalytic oxidation of CO in a gas phase in the presence of rhenium cations with carbonyl and oxygen ligands: a comparison with heterogeneous catalysis

    International Nuclear Information System (INIS)

    Goncharov, V.B.; Fialko, E.F.; Shejnin, D.Eh.; Kikhtenko, A.V.


    Reactivity in a gaseous phase o rhenium (Re + ) and rhenium monocarbonyl (ReCO + ) in the reaction of CO oxidation in oxygen-containing reagents (NO, O 2 , H 2 O) is studied through the method of the ionic cyclotron resonance. It is shown that presence of carbonyl ligand essentially influences the ion reactivity. The effective channel of the metal monocarbonyl ions oxidation through molecular oxygen is found. Accounting for this stage makes of possible to explain the low-temperature activity of a number of oxide catalyzer Mo, W in the reaction of CO oxidation by molecular oxygen

  8. High-resolution metallic magnetic calorimeters for β-spectroscopy on 187rhenium and position resolved X-ray spectroscopy

    International Nuclear Information System (INIS)

    Porst, Jan-Patrick


    This thesis describes the development of metallic magnetic calorimeters (MMCs) for high resolution spectroscopy. MMCs are energy dispersive particle detectors based on the calorimetric principle which are typically operated at temperatures below 100 mK. The detectors make use of a paramagnetic temperature sensor to transform the temperature rise upon the absorption of a particle in the detector into a measurable magnetic flux change in a dc-SQUID. The application of MMCs for neutrino mass measurements and their advantages with respect to other approaches are discussed. In view of this application the development of an MMC optimized for β-endpoint spectroscopy on 187 rhenium is presented. A fully micro-fabricated X-ray detector is characterized and performs close to design values. Furthermore, a new technique to more efficiently couple rhenium absorbers mechanically and thermally to the sensor was developed and successfully tested. By employing a metallic contact, signal rise times faster than 5 μs could be observed with superconducting rhenium absorbers. In addition to the single pixel detectors, an alternative approach of reading out multiple pixels was developed in this work, too. Here, the individual absorbers have a different thermal coupling to only one temperature sensor resulting in a distribution of different pulse shapes. Straightforward position discrimination by means of rise time analysis is demonstrated for a four pixel MMC and a thermal model of the detector is provided. Unprecedented so far, an energy resolution of less than ΔE FWHM <5 eV for 5.9 keV X-rays was achieved across all absorbers. (orig.)

  9. Thermal transformations of oxohalide complexes of rhenium(5) and molybdenum(5) with diazo-18-crown-6 in solid phase

    International Nuclear Information System (INIS)

    Ashurova, N.Kh.; Yakubov, K.G.


    Methods for synthesis and separation in solid state of the rhenium(5) and molybdenum(5) onium complexes with diaza-18-crown-6(L), the content of which according to the data of elementary analysis, IRS in the close and remote areas, thermogravimetry, conductometry and potentiometry corresponds to the (H 2 L)[EOX 5 ], where E = Re, Mo; X = Cl - , Br - . Thermotransformation of onium compounds is studied by methods of thermal methods (TG-DTG-DTA combined study). Their avility to be affected by solid-phase dehydrohalogenization, e.i. anderson regrouping. The thermolysis products, corresponding to the general formula (EOLX 3 ), are separated and studied

  10. Synthesis, characterization, and photophysical properties of a thiophene-functionalized bis(pyrazolyl) pyridine (BPP) tricarbonyl rhenium(I) complex. (United States)

    Lytwak, Lauren A; Stanley, Julie M; Mejía, Michelle L; Holliday, Bradley J


    A bromo tricarbonyl rhenium(I) complex with a thiophene-functionalized bis(pyrazolyl) pyridine ligand (L), ReBr(L)(CO)(3) (1), has been synthesized and characterized by variable temperature and COSY 2-D (1)H NMR spectroscopy, single-crystal X-ray diffraction, and photophysical methods. Complex 1 is highly luminescent in both solution and solid-state, consistent with phosphorescence from an emissive (3)MLCT excited state with an additional contribution from a LC (3)(pi-->pi*) transition. The single-crystal X-ray diffraction structure of the title ligand is also reported.

  11. Evaluation of a new component used for isotopic lymphography: colloidal rhenium sulfide sup(99m)Tc labelled

    International Nuclear Information System (INIS)

    Pecking, A.; Le Mercier, N.; Gobin, R.; Bardy, A.; Najean, Y.


    We have studied for lymphatic scintigraphy a new radiopharmaceutical, sup(99m)Tc-labelled rhenium sulfocolloid. This preliminary study includes 20 adults patients with lymphomas and lymphoedemas. The principal advantage of this drug is its absence of toxicity and local pain, so that a rapid sub-cutaneous injection without local anesthesia is made possible. Good results have been obtained, as well in morphological studies of para-aortic and mammary lymph nodes as for kinetic studies of lymphatic flow in lymphoedemas. No liver and spleen uptake of radio-isotope was observed after foot injection [fr

  12. Physico-chemical characterisation and biological evaluation of 188-Rhenium colloids for radiosynovectomy

    International Nuclear Information System (INIS)

    Ures, Ma Cristina; Savio, Eduardo; Malanga, Antonio; Fernández, Marcelo; Paolino, Andrea; Gaudiano, Javier


    Radiosynovectomy is a type of radiotherapy used to relieve pain and inflammation from rheumatoid arthritis. In this study, 188-Rhenium ( 188 Re) colloids were characterized by physical and biological methodologies. This was used to assess which parameters of the kit formulation would be the basis in the development of a more effective radiopharmaceutical for synovectomy. Intraarticular injection in knees of rabbits assessed cavity leakage of activity. The physical characteristics of tin (Sn) and sulphur (S) colloids were determined to assess the formulation with suitable properties. Particles were grouped in three ranges for analyzing their distribution according to their number, volume and surface. The ideal particle size range was considered to be from 2 to 10 microns. Membrane filtration and laser diffraction characterization methodologies were used. While membrane filtration could give misleading data, laser diffraction proportions more reliable results. The Sn colloid showed a better distribution of particle volume and surface than S colloid, in the 2 to 10 microns range. The 188 Re-Sn colloid was obtained with a radiochemical purity higher than 95% after 30 minutes of autoclaving. While Sn colloid kit stability was verified for 60 days, the 188 Re-Sn preparation was stable in the first 24 hrs. No significant intrabatch variability (n = 3) was detected. Biodistribution and scintigraphic studies in rabbits after intraarticular injection showed relevant activity only in knee, being 90% at 48 hours. The 188 Re-Sn colloid is easy to prepare, is stable for 24 hours and shows minimal cavity leakage after intraarticular injection into rabbit knees, suggesting this radiotherapeutical agent has suitable physical properties for evaluation for joint treatment in humans

  13. Sorption of technetium and its analogue rhenium on bentonite material under aerobic conditions

    International Nuclear Information System (INIS)

    Vinsova, H.; Koudelkova, M.; Konirova, R.; Vecernik, P.; Jedinakova-Krizova, V.


    The uptake of technetium on bentonite materials has been studied from the point of view of characterization of long-term radioactive elements behavior in nuclear waste repository. Bentonite R (locality Rokle, Czech Republic) and two types of model groundwater (granitic and bentonite) were selected for the sorption experiments. It is generally known that bentonite materials show an excellent cation-exchange capacity and, on the other hand, a poor uptake of anions. Technetium occurs under aerobic conditions in its most stable oxidation state (+VII) as pertechnetate, which makes a question of its sorption on bentonite more complex when compared with e.g. Cs + or Sr 2+ . To increase the K d values for technetium sorption on bentonite, it is necessary to carry out the experiments under anaerobic conditions in the presence of reducing agent, which is capable to lower the oxidation state of technetium which enables its successful immobilization. The aim of our research has been to find out the conditions suitable for the technetium sorption on selected bentonite under oxidizing conditions. The sorption experiments with Tc-99 on bentonite have been carried out by batch method. The influence of the addition of different materials (e.g. activated carbon, graphite, Fe 2+ , Fe) with bentonite, the effect of solid:aqueous phase ratio and a pH value on the percentage of technetium uptake and on the K d values were tested. Perrhenate was selected as an analogue of pertechnetate in non-active experiments of capillary electrophoresis (CE) and isotachophoresis (ITP). The percentage of rhenium sorbed on bentonite material was determined from the decrease of perrhenate peak area (CE) and from the shortening of the ITP zone corresponding to perrhenate. Both electromigration methods provided comparable results. The results obtained in this study with non-active material were compared to those of technetium acquired by radiometry and polarography. (authors)

  14. Photocatalytic Conversion of CO2 to CO using Rhenium Bipyridine Platforms Containing Ancillary Phenyl or BODIPY Moieties (United States)

    Andrade, Gabriel A.; Pistner, Allen J.; Yap, Glenn P.A.; Lutterman, Daniel A.; Rosenthal, Joel


    Harnessing of solar energy to drive the reduction of carbon dioxide to fuels requires the development of efficient catalysts that absorb sunlight. In this work, we detail the synthesis, electrochemistry and photophysical properties of a set of homologous fac-ReI(CO)3 complexes containing either an ancillary phenyl (8) or BODIPY (12) substituent. These studies demonstrate that both the electronic properties of the rhenium center and BODIPY chromophore are maintained for these complexes. Photolysis studies demonstrate that both assemblies 8 and 12 are competent catalysts for the photochemical reduction of CO2 to CO in DMF using triethanolamine (TEOA) as a sacrificial reductant. Both compounds 8 and 12 display TOFs for photocatalytic CO production upon irradiation with light (λex ≥ 400 nm) of ~5 hr−1 with TON values of approximately 20. Although structural and photophysical measurements demonstrate that electronic coupling between the BODIPY and fac-ReI(CO)3 units is limited for complex 12, this work clearly shows that the photoactive BODIPY moiety is tolerated during catalysis and does not interfere with the observed photochemistry. When taken together, these results provide a clear roadmap for the development of advanced rhenium bipyridine complexes bearing ancillary BODIPY groups for the efficient photocatalytic reduction of CO2 using visible light. PMID:24015374

  15. Isomer Decay Spectroscopy of Sm-164 and Gd-166: Midshell Collectivity Around N=100


    Patel, Z; Soederstroem, P-A; Podolyak, Z; Regan, PH; Walker, PM; Watanabe, H; Ideguchi, E; Simpson, GS; Liu, HL; Nishimura, S; Wu, Q; Xu, FR; Browne, F; Doornenbal, P; Lorusso, G


    © 2014 American Physical Society. Excited states in the N=102 isotones Gd166 and Sm164 have been observed following isomeric decay for the first time at RIBF, RIKEN. The half-lives of the isomeric states have been measured to be 950(60) and 600(140) ns for Gd166 and Sm164, respectively. Based on the decay patterns and potential energy surface calculations, including β6 deformation, a spin and parity of 6- has been assigned to the isomeric states in both nuclei. Collective observables are disc...

  16. Evaluation of technetium-99m/rhenium labelled nucleoside analogues as potential radiotracers in oncology

    International Nuclear Information System (INIS)

    Desbouis, D.


    cell uptake in transfected cancer cells this technetium thymidine complex revealed a low internalisation of 0.03 ± 0.01%ID/(mg/mL). Under the same conditions the [ 3 H]thymidine exhibited an uptake of 1.50 ± 0.02%lD/(mg/mL). In order to gain potency and selectivity for HSV1-TK, the corresponding 5'-carboxamide 5-ethyl-2', 5'-dideoxyuridine was synthesized. The synthesis of the ligand was performed in seven steps from 2'-deoxyuridine. This ligand was then successfully labelled with the fac-M(CO) 3 -core (M = 99m Tc, Re). The rhenium complex was found to be a selective competitive inhibitor of HSV1-TK (K i = 4.56 ± 0.11 μM). Although the cellular uptake of the technetium 2'-deoxyurine complex (0.10 ± 0.01%ID/(mg/mL)) was better than its corresponding technetium thymidine complex, it is still very low compared to thymidine uptake. The second aspect of this work was to develop nucleoside derivatives labelled with technetium-99m/rhenium tricarbonyl core capable of acting as substrates for human cytosolic thymidine kinase (hTKl). hTKl is a target of choice to evaluate cell proliferation due to its overexpression in a variety of cancer cells. [ 18 F]Fluorothymidine [ 18 F]FLT), which acts as a hTKl substrate, has emerged as a very efficient PET tracer for the monitoring of cell proliferation. Our aim was to develop a SPET tracer with the same mode of action as [ 18 F]FLT. We prepared a set of technetium-99m/rhenium complexes of N3 thymidine derivatives with different overall charges (+1, 0 and -1) and variable spacer lengths. The complexes with different overall charges had the same spacer length between chelating system and thymidine moiety (two carbons spacer) while the complexes with different spacer lengths (2, 3, 5 and 10) were all neutral. These compounds were tested for their substrate activity with respect to recombinant hTKl. The phosphorylation rates of neutral and negative complexes were found to be similar, ranging between 15-16% with respect to thymidine

  17. Adsorption and Diffusion of Lithium and Sodium on Defective Rhenium Disulfide: A First Principles Study. (United States)

    Mukherjee, Sankha; Banwait, Avinav; Grixti, Sean; Koratkar, Nikhil; Singh, Chandra Veer


    Single-layer rhenium disulfide (ReS 2 ) is a unique material with distinctive, anisotropic electronic, mechanical, and optical properties and has the potential to be used as an anode in alkali-metal-ion batteries. In this work, first principles calculations were performed to systematically evaluate the potential of monolayer pristine and defective ReS 2 as anodes in lithium (Li)- and sodium (Na)-ion batteries. Our calculations suggest that there are several potential adsorption sites for Li and Na on pristine ReS 2 , owing to its low-symmetry structure. Additionally, the adsorption of Li and Na over pristine ReS 2 is very strong with adsorption energies of -2.28 and -1.71 eV, respectively. Interestingly, the presence of point defects causes significantly stronger binding of the alkali-metal atoms with adsorption energies in the range -2.98 to -3.17 eV for Li and -2.66 to -2.92 eV for Na. Re single vacancy was found to be the strongest binding defect for Li adsorption, whereas S single vacancy was found to be the strongest for Na. The diffusion of these two alkali atoms over pristine ReS 2 is anisotropic, with an energy barrier of 0.33 eV for Li and 0.16 eV for Na. The energy barriers associated with escaping a double vacancy and single vacancy for Li atoms are significantly large at 0.60 eV for the double-vacancy case and 0.51 eV for the single-vacancy case. Similarly, for Na, they are 0.59 and 0.47 eV, respectively, which indicates slower migration and sluggish charging/discharging. However, the diffusion energy barrier over a Re single vacancy is found to be merely 0.42 eV for a Li atom and 0.28 eV for Na. Overall, S single and double vacancies can reduce the diffusion rate by 10 3 -10 5 times for Li and Na ions, respectively. These results suggest that monolayer ReS 2 with a Re single vacancy adsorbs Li and Na stronger than pristine ReS 2 , with negligible negotiation with the charging/discharging rate of the battery, and therefore they can be used as an anode

  18. Analysis of a rhenium-osmium solid-solution spike by inductively coupled plasma mass spectrometry

    International Nuclear Information System (INIS)

    Richardson, J.M.; Dickin, A.P.; McNutt, R.H.; McAndrew, J.I.; Beneteau, S.B.


    The rhenium-osmium decay scheme ( 187 Re → 187 Os) offers a unique opportunity to investigate the genesis of, and directly date, ultramafic rock, sulphide and platinum ore deposits. Inductively coupled plasma mass spectrometry (ICP-MS) is a viable method for Os isotopic analysis as it provides the high temperatures necessary to ionise Os. The sample can be introduced into the ICP mass spectrometer either by conventional nebulisation or by distillation using an Os ''generator''. Generator-mode analysis is superior to nebulisation because (i) the total number of counts is two orders of magnitude higher for a given sample size and (ii) Os oxidises readily to volatile OsO 4 , which has a boiling-point lower than most Re compounds, so that Os can be efficiently separated from 187 Re. The importance of Os loss during sample preparation was minimised by combining the sample powder with a powdered Re-Os isotopic spike prior to any chemical treatment. The spike is in a nickel sulphide matrix and was made by a thioacetamide co-precipitation of Os, Re and Ni followed by a fire assay. The 190 Os/ 192 Os ratio in this preparation is 51.5 ± 0.9, the 187 Os 188 Os ratio is 0.063 ± 0.006 and the 185 Re/ 187 Re ratio is 17.04 - + 0.41. These values are within the error limits quoted by the Oak Ridge National Laboratory and Techsnabexport, the suppliers of the metallic spikes. Parameters that significantly influence the Os analyses include the oxidising agent and the run temperature. The oxidising agent H 5 IO 6 is preferred to H 2 O 2 or HNO 3 as it has the highest electrode potential, provides a prolonged, consistent reaction and is more stable when stored. Chilling the sample and the H 5 IO 6 , initially retards uncontrolled OsO 4 emission. Heat applied later in the run releases OsO 4 and helps maintain a high count rate. Thus, OsO 4 can be generated in a steady, controllable and reproducible manner. (author)

  19. Rhenium-188 Lipiodol Therapy of Hepatocellular Carcinoma: Results of a multicentre-multinational study

    International Nuclear Information System (INIS)

    Padhy, A.K.; Bernal, P.; Buscombe, R.J.


    Full text: A multi-centre study was sponsored by the IAEA to assess the safety and efficacy of trans-arterial Rhenium-188 HDD Lipiodol in the treatment of inoperable Hepatocellular Carcinoma. The radioconjugate was prepared by using an HDD kit and Lipiodol. Over three years, 185 patients received at least one treatment. The dose administered was based on radiation absorbed dose to critical normal organs, calculated following a ''scout'' dose (approximately 4 mCi) of radioconjugate. The organs at greatest risk for radiation toxicity are the liver, the lung and the bone marrow. An Excel spreadsheet was used to determine maximum tolerated activity, defined as the amount of radioactivity calculated to deliver no more than 12 Gy to lungs, 30 Gy to liver, or 1.5 Gy to bone marrow. A single treatment was given to 134 patients, 42 patients received two doses, 8 received three and one patient received four treatments. The total injected activity including the scout dose during the first treatment ranged from 21 to 364 mCi (average 108 mCi). Patients were followed for at least l2 weeks after therapy. The clinical parameters evaluated included toxicity, response as determined objectively by contrast enhanced computed tomography, palliation of symptoms, overall survival, performance status (Karnofsky), and hepatic function (Child's classification). Liver function tests, serum alpha-fetoprotein (AFP) levels and complete blood counts were done at each follow-up visit. Side effects were minimal and usually presented as loss of appetite, right hypochondrial discomfort and low-grade fever. Liver function tests at 24 and 72 hours showed no significant changes and complete blood counts at 1 week, 4 weeks and 12 weeks showed no changes (no bone marrow suppression). Data on largest tumour diameter after therapy and/or tumour response as evaluated from CT scans are available for 88 patients. Complete disappearance of tumour was recorded in 3 (3%), partial response in 19 (22%), stable

  20. 25 CFR 16.4 - Exchange of information within the Department. (United States)


    ... Section 16.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR PROBATE ESTATES OF INDIANS OF... information may be useful in discharging the duties covered by the regulations in this part, the Bureau shall..., concerning the estate and status of an Indian of the Five Civilized Tribes for whom legal assistance should...

  1. 26 CFR 1.164-5 - Certain retail sales taxes and gasoline taxes. (United States)


    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Certain retail sales taxes and gasoline taxes. 1....164-5 Certain retail sales taxes and gasoline taxes. For taxable years beginning before January 1...) and tax on the sale of gasoline, diesel fuel or other motor fuel paid by the consumer (other than in...

  2. 43 CFR 30.164 - What must I do to purchase at probate? (United States)


    ... HEARINGS PROCEDURES Purchase at Probate § 30.164 What must I do to purchase at probate? Any eligible purchaser must submit a written request to OHA to purchase at probate before the decision or order is issued. ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false What must I do to purchase at probate? 30...

  3. 40 CFR 98.164 - Monitoring and QA/QC requirements. (United States)


    ... Methods for Instrumental Determination of Carbon, Hydrogen, and Nitrogen in Petroleum Products and... Determination of Carbon, Hydrogen, and Nitrogen in Laboratory Samples of Coal (incorporated by reference, see... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Hydrogen Production § 98.164 Monitoring and QA/QC requirements...

  4. 45 CFR 164.520 - Notice of privacy practices for protected health information. (United States)


    ... DATA STANDARDS AND RELATED REQUIREMENTS SECURITY AND PRIVACY Privacy of Individually Identifiable Health Information § 164.520 Notice of privacy practices for protected health information. (a) Standard... 45 Public Welfare 1 2010-10-01 2010-10-01 false Notice of privacy practices for protected health...

  5. 45 CFR 164.522 - Rights to request privacy protection for protected health information. (United States)


    ... ADMINISTRATIVE DATA STANDARDS AND RELATED REQUIREMENTS SECURITY AND PRIVACY Privacy of Individually Identifiable Health Information § 164.522 Rights to request privacy protection for protected health information. (a)(1... 45 Public Welfare 1 2010-10-01 2010-10-01 false Rights to request privacy protection for protected...

  6. 45 CFR 164.528 - Accounting of disclosures of protected health information. (United States)


    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Accounting of disclosures of protected health... Health Information § 164.528 Accounting of disclosures of protected health information. (a) Standard: Right to an accounting of disclosures of protected health information. (1) An individual has a right to...

  7. 46 CFR 164.023-3 - Specifications and standards incorporated by reference. (United States)


    ... are: Federal Standards and Test Method Standards The following test methods in Federal Test Method Standard No. 191A, Textile Test Methods, July 20, 1978: (1) Method 4010, Length-Weight Relation; Thread..., Polyester Core: Cotton-, Rayon-, or Polyester-Covered, September 30, 1986—164.023-5. (7) MIL-T-43624A—Thread...

  8. Analysis of Optical Variations of BL Lac Object AO 0235+164 Wang ...

    Indian Academy of Sciences (India)

    obtain statistically meaningful values for the cross-correlation time lags ... deviation, the fifth represents the largest variations, the sixth represents the fractional ..... 6. Conclusions. The multi-band optical data are collected on the object of AO 0235 + 164. The time lags among the B, V, R and I bands have been analysed.

  9. 49 CFR 173.164 - Mercury (metallic and articles containing mercury). (United States)


    ... ounces) of mercury per package; (iv) Tubes which are completely jacketed in sealed leakproof metal cases... 49 Transportation 2 2010-10-01 2010-10-01 false Mercury (metallic and articles containing mercury... Than Class 1 and Class 7 § 173.164 Mercury (metallic and articles containing mercury). (a) For...

  10. Solid-state thermolysis of a fac-rhenium(I) carbonyl complex with a redox non-innocent pincer ligand. (United States)

    Jurca, Titel; Chen, Wen-Ching; Michel, Sheila; Korobkov, Ilia; Ong, Tiow-Gan; Richeson, Darrin S


    The development of rhenium(I) chemistry has been restricted by the limited structural and electronic variability of the common pseudo-octahedral products fac-[ReX(CO)3L2] (L2 = α-diimine). We address this constraint by first preparing the bidentate bis(imino)pyridine complexes [(2,6-{2,6-Me2C6H3N=CPh}2C5H3N)Re(CO)3X] (X = Cl 2, Br 3), which were characterized by spectroscopic and X-ray crystallographic means, and then converting these species into tridentate pincer ligand compounds, [(2,6-{2,6-Me2C6H3N=CPh}2C5H3N)Re(CO)2X] (X = Cl 4, Br 5). This transformation was performed in the solid-state by controlled heating of 2 or 3 above 200 °C in a tube furnace under a flow of nitrogen gas, giving excellent yields (≥95 %). Compounds 4 and 5 define a new coordination environment for rhenium(I) carbonyl chemistry where the metal center is supported by a planar, tridentate pincer-coordinated bis(imino)pyridine ligand. The basic photophysical features of these compounds show significant elaboration in both number and intensity of the d-π* transitions observed in the UV/Vis spec tra relative to the bidentate starting materials, and these spectra were analyzed using time-dependent DFT computations. The redox nature of the bis(imino)pyridine ligand in compounds 2 and 4 was examined by electrochemical analysis, which showed two ligand reduction events and demonstrated that the ligand reduction shifts to a more positive potential when going from bidentate 2 to tridentate 4 (+160 mV for the first reduction step and +90 mV for the second). These observations indicate an increase in electrostatic stabilization of the reduced ligand in the tridentate conformation. Elaboration on this synthetic methodology documented its generality through the preparation of the pseudo-octahedral rhenium(I) triflate complex [(2,6-{2,6-Me2C6H3N=CPh}2C5H3N)Re(CO)2OTf] (7, 93 % yield). Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Preliminary results of transarterial Rhenium-188 HDD Lipiodol in treatment of inoperable primary hepatocellular carcinoma

    International Nuclear Information System (INIS)

    Sundram, Felix


    Full text: In this paper we present our early experience with a new radio-conjugate, namely rhenium-188 HDD Lipiodol (Re-188 lipiodol). Imported radiopharmaceuticals are generally expensive, particularly for developing countries. A Tungsten (W-188-Re 188) generator obtained from ORNL (Oak Ridge National Laboratory, Tennessee, USA) allows us on-site production of a beta emitting therapeutic isotope (Re-188) for up to 6 months from a single generator. The objectives of this study were to establish the safety of trans-arterial Re-188 lipiodol in patients with inoperable HCC, and determine the adverse effects and efficacy for this radio-conjugate treatment in a multi-center study of patients with advanced HCC. A multi-center study was sponsored by the International Atomic Energy Agency (Vienna) to assess the safety and efficacy of trans-arterial Re-188 HDD conjugated lipiodol (radio-conjugate) in the treatment of patients with inoperable hepatocellular carcinoma (HCC), The radio-conjugate was prepared by using a HDD (4-hexadecyl 1-2, 9, 9-tetramethyl-4, 7-diaza-1, 10-decanethiol) kit developed in Korea, and lipiodol. Over a period of eighteen months seventy patients received at least one treatment of radio-conjugate. Some patients were re-treated if there was no evidence of disease progression. The level of radio-conjugate administered was based on radiation-absorbed dose to critical normal organs, calculated following a 'scout' dose of radio-conjugate. The organs at greatest risk for radiation toxicity are the normal liver, the lung and the bone marrow. A specially designed spreadsheet was used to determine maximum tolerated activity (MTA), defined as the amount of radioactivity calculated to deliver no more than 12 Gray (Gy) to lungs, or 30 Gy to liver, or 1.5 Gy to bone marrow. These doses have been found to be safe in multiple trials using external beam therapy and systemically administered radiopharmaceuticals. Patients were followed for at least twelve weeks

  12. Application of rhenium 186 radiosynovectomy in elbow diffuse pigmented villonodular synovitis: Case report with multiple joint involvement

    International Nuclear Information System (INIS)

    Koca, Go Khan; Ozsoy, Ha Kan; Atilgan, Hasan Ikbal; Demirel, Koray; Dincel, Veysel Ercan; Korkmaz, Meliha


    After surgical therapy of diffuse pigmented villonodular synovitis (DPVNS), recurrence is seen in almost half of the patients. The effectiveness of radiosynovectomy (RSV)in preventing recurrence and complaints of DPVNS is well known. Elbow involvement in DPVNS is a very rare condition; therefore, RSV in elbow hasn't been experienced widely. The aim of this case report is to show the effectiveness of RSV with rhenium 186 (Re 186)sulfide colloid. We applied Re 186 sulfide colloid to the elbow joint of DPVNS patients six weeks after arthroscopic synovectomy. As a result, the patient did not have any complaints, and our findings are compatible with residue or recurrence on magnetic resonance imaging (MRI)in sixth and twentieth month controls after administration. We concluded that Re 186 is an effective adjuvant therapy for the prevention of recurrence and complaints

  13. Development of a radiochemical neutron activation analysis procedure for determination of rhenium in biological and environmental samples at ultratrace level

    International Nuclear Information System (INIS)

    Kucera, J.; Lucanikova, M.; Czech Technical Univ., Prague


    Radiochemical neutron activation procedures using liquid-liquid extraction with tetraphenylarsonium chloride in chloroform from 1M HCl and solid extraction with ALIQUAT 336 incorporated in a polyacrylonitrile binding matrix from 0.1M HCl were developed for accurate determination of rhenium in biological and environmental samples at the sub-ng x g -1 level. Concentrations of Re in the range of 0.1 to 2.4 ng x g -1 were determined in several botanical reference materials (RM), while in a RM of road dust a value of ∼ 10 ng x g -1 was found. Significantly elevated values of Re, up to 90 ng x g -1 were found in seaweed (brown algae). Results for Re in the brown algae Fucus vesiculosus in which elevated 99 Tc values had previously been determined suggested possible competition between Re and Tc in the accumulation process. (author)

  14. Determination of rhenium traces in river water by Q-ICP-MS and HR-ICP-MS

    International Nuclear Information System (INIS)

    Uchida, S.; Tagami, K.; Saito, M.


    A simple separation method was applied to determine rhenium in river water using Q-ICP-MS and HR-ICP-MS. Re was concentrated from 420-925 ml river water using a TEVA resin minicolumn. Such extraction using a resin could separate Re from most sample matrices and trace elements. Almost 100% recovery was found throughout the method as determined with radioactive multitracers. The HR-ICP-MS was also used for the direct determination because of its low detection limit for Re (0.007 pg/ml). The Re concentration in the river water samples ranged from 0.9 to 6.5 pg/ml and the three analysis results showed good agreement with each other. (author)

  15. A Fluorine-18 Radiolabeling Method Enabled by Rhenium(I) Complexation Circumvents the Requirement of Anhydrous Conditions. (United States)

    Klenner, Mitchell A; Pascali, Giancarlo; Zhang, Bo; Sia, Tiffany R; Spare, Lawson K; Krause-Heuer, Anwen M; Aldrich-Wright, Janice R; Greguric, Ivan; Guastella, Adam J; Massi, Massimiliano; Fraser, Benjamin H


    Azeotropic distillation is typically required to achieve fluorine-18 radiolabeling during the production of positron emission tomography (PET) imaging agents. However, this time-consuming process also limits fluorine-18 incorporation, due to radioactive decay of the isotope and its adsorption to the drying vessel. In addressing these limitations, the fluorine-18 radiolabeling of one model rhenium(I) complex is reported here, which is significantly improved under conditions that do not require azeotropic drying. This work could open a route towards the investigation of a simplified metal-mediated late-stage radiofluorination method, which would expand upon the accessibility of new PET and PET-optical probes. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. 27 CFR 70.164 - Surrender of property subject to levy in the case of life insurance and endowment contracts. (United States)


    ... the case of life insurance and endowment contracts. (a) In general. This section provides special rules relating to the surrender of property subject to levy in the case of life insurance and endowment... subject to levy in the case of life insurance and endowment contracts. 70.164 Section 70.164 Alcohol...

  17. 77 FR 66186 - 164th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of... (United States)


    ... DEPARTMENT OF LABOR Employee Benefits Security Administration 164th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 164th open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans (also known as...

  18. 77 FR 59420 - 164th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of... (United States)


    ... DEPARTMENT OF LABOR Employee Benefits Security Administration 164th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 164th open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans (also known as...

  19. Identification of rhenium donors and sulfur vacancy acceptors in layered MoS{sub 2} bulk samples

    Energy Technology Data Exchange (ETDEWEB)

    Brandão, F. D., E-mail:; Ribeiro, G. M.; Vaz, P. H.; González, J. C.; Krambrock, K. [Departamento de Física, Universidade Federal de Minas Gerais, CP 702, 30.123-970 Belo Horizonte, MG (Brazil)


    MoS{sub 2} monolayers, a two-dimensional (2D) direct semiconductor material with an energy gap of 1.9 eV, offer many opportunities to be explored in different electronic devices. Defects often play dominant roles in the electronic and optical properties of semiconductor devices. However, little experimental information about intrinsic and extrinsic defects or impurities is available for this 2D system, and even for macroscopic 3D samples for which MoS{sub 2} shows an indirect bandgap of 1.3 eV. In this work, we evaluate the nature of impurities with unpaired spins using electron paramagnetic resonance (EPR) in different geological macroscopic samples. Regarding the fact that monolayers are mostly obtained from natural crystals, we expect that the majority of impurities found in macroscopic samples are also randomly present in MoS{sub 2} monolayers. By EPR at low temperatures, rhenium donors and sulfur vacancy acceptors are identified as the main impurities in bulk MoS{sub 2} with a corresponding donor concentration of about 10{sup 8–12} defects/cm{sup 2} for MoS{sub 2} monolayer. Electrical transport experiments as a function of temperature are in good agreement with the EPR results, revealing a shallow donor state with an ionization energy of 89 meV and a concentration of 7 × 10{sup 15 }cm{sup −3}, which we attribute to rhenium, as well as a second deeper donor state with ionization energy of 241 meV with high concentration of 2 × 10{sup 19 }cm{sup −3} and net acceptor concentration of 5 × 10{sup 18 }cm{sup −3} related to sulfur vacancies.

  20. Synthesis, structural characterization and photoluminescence properties of rhenium(I) complexes based on bipyridine derivatives with carbazole moieties. (United States)

    Li, Hong-Yan; Wu, Jing; Zhou, Xin-Hui; Kang, Ling-Chen; Li, Dong-Ping; Sui, Yan; Zhou, Yong-Hui; Zheng, You-Xuan; Zuo, Jing-Lin; You, Xiao-Zeng


    Three N,N-bidentate ligands, 5,5'-dibromo-2,2-bipyridine (L1) and two carbazole containing ligands of 5-bromo-5'-carbazolyl-2,2-bipyridine (L2), 5,5'-dicarbazolyl-2,2'-bipyridine (L3), and their corresponding rhenium Re(CO)3Cl(L) complexes (ReL1-ReL3) have been successfully synthesized and characterized by elemental analysis, 1H NMR and IR spectra. Their photophysical properties and thermal analysis, along with the X-ray crystal structure analysis of L3 and complexes ReL1 and ReL3 are also described. In CH2Cl2 solution at room temperature, all complexes display intense absorption bands at ca. 220-350 nm, which can be assigned to spin-allowed intraligand (pi-->pi*) transitions, and the low energy broad bands in the 360-480 nm region are attributed to the metal to ligand charge-transfer d(Re)-->pi* (diimine) (MLCT). The introduction of carbazole moieties improves the MLCT absorption and molar extinction coefficient of these complexes. Upon excitation at the peak maxima, all complexes show strong emissions around 620 nm, which are assigned to d(Re)-->pi* (diimine) MLCT phosphorescence. The photoluminescence lifetime decay of Re(I) complexes were measured and the quantum efficiencies of the rhenium(I) complexes were calculated by using air-equilibrated [Ru(bpy)3]2+ x 2 Cl- aqueous solution as standard (phi(std) = 0.028). The complexes with appended carbazole moieties exhibit enhanced luminescence performances relative to ReL1.

  1. Active and passive vectorization of technetium99m and 188rhenium radiopharmaceuticals for medical imaging and radiotherapy

    International Nuclear Information System (INIS)

    Lepareur, N.


    Research for new molecules for nuclear medicine is a field in constant development. Over the past few years, development of new radiopharmaceuticals for radiotherapy has renewed interest for rhenium chemistry. Indeed, its two isotopes 186 Re and 188 Re, owing to their ideal properties and their similitude with 99m Tc, which is widely used as a radiotracer for diagnostic imaging, seem very promising for the preparation of radiopharmaceuticals. In the first part of this manuscript, the synthesis of rhenium and technetium-99 complexes, [M(RPhCS3)2(RPhCS2)] (M = Re, Tc), is described. The preparation of technetium 99m based radiopharmaceuticals, analogues to the pondered complexes, is also described. The stability/reactivity of these complexes has been studied by exchange reactions with potential ligands, specially dithiocarbamates, and also by UV-visible absorption spectroscopy and thermogravimetry. The reactivity of the complexes towards dithiocarbamates leads to the possibility to bind biomolecules to the metallic core, via the dithiocarbamate moiety. This method represents a potential alternative to current ones using the so-called bifunctional approach. In the second part of this manuscript, a new kit formulation for the 188 Re labeling of lipiodol is described, using a complex analogous to those described in the previous part. The labeled oil is a potential cure for hepatocellular carcinoma. The in vitro and in vivo stability of this 188 Re-SSS lipiodol and of its analogue 99m Tc-SSS lipiodol has been studied, and also their in vivo behavior in healthy pigs. This study has shown the quasi-exclusive hepatic fixation of the radiopharmaceutical, and has proven its good stability. Its selectivity for tumors remains to be shown before trying it on humans. (author)

  2. Phase stability, physical properties of rhenium diboride under high pressure and the effect of metallic bonding on its hardness

    International Nuclear Information System (INIS)

    Zhong, Ming-Min; Kuang, Xiao-Yu; Wang, Zhen-Hua; Shao, Peng; Ding, Li-Ping; Huang, Xiao-Fen


    Highlights: •The transition pressure P t between the ReB 2 –ReB 2 and MoB 2 –ReB 2 phases is firstly determinate. •The single-bonded B–B feather remains in ReB 2 compounds. •A semiempirical method to evaluate the hardness of crystals with partial metallic bond is presented. •The large hardness (39.1 GPa) of ReB 2 –ReB 2 indicate that it is a superhard material. •The zigzag interconnected B–Re and B–B covalent bonds underlie the ultraincompressibilities. -- Abstract: Using first-principles calculations, the elastic constants, thermodynamic property and structural phase transition of rhenium diboride under pressure are investigated by means of the pseudopotential plane-waves method, as well as the effect of metallic bond on its hardness. Eight candidate structures of known transition-metal compounds are chosen to probe for rhenium diboride ReB 2 . The calculated lattice parameters are consistent with the experimental and theoretical values. Based on the third order Birch–Murnaghan equation of states, the transition pressure P t between the ReB 2 –ReB 2 and MoB 2 –ReB 2 phases is firstly determinate. Elastic constants, shear modulus, Young’s modulus, Poisson’s ratio and Debye temperature are derived. The single-bonded B–B feather remains in ReB 2 compounds. Furthermore, according to Mulliken overlap population analysis, a semiempirical method to evaluate the hardness of multicomponent crystals with partial metallic bond is presented. Both strong covalency and a zigzag topology of interconnected bonds underlie the ultraincompressibilities. In addition, the superior performance and large hardness (39.1 GPa) of ReB 2 –ReB 2 indicate that it is a superhard material

  3. Design criteria for rhenium-reduced nickel-based single-crystal alloys. Identification and computer-assisted conversion

    International Nuclear Information System (INIS)

    Goehler, Thomas


    In the present work, design criteria and property models for the creep strength optimization of rhenium-free nickel based single crystal Superalloys are investigated. The study focuses on a typical load condition of 1050 C and 150 MPa, which is representative for flight engine applications. Thereby the key aspect is to link chemical composition, manufacturing processes, microstructure formation and mechanistic understanding of dislocation creep through a computational materials engineering approach. Beside the positive effect of rhenium on solid solution hardening, a second mechanism in which rhenium increases high temperature creep strength is identified. It indirectly stabilizes precipitation hardening by reducing the coarsening kinetics of γ'-rafting. Five 1st and 2nd generation technical Superalloys show a comparable microstructure evolution for up to 2 % plastic elongation, while creep times differ by a factor of five. The application of a microstructure sensitive creep model shows that these coarsening processes can activate γ-cutting and thus lead to an increasing creep rate. Based on these calculations a threshold value of φ γ/γ' > 2,5 at 150 MPa is estimated. This ratio of matrix channel to raft thickness has been proofed for multiple positions by microstructure analysis of interrupted creep tests. The mechanism described previously can be decelerated by the enrichment of the γ-matrix with slow diffusing elements. The same principle also increases the solid solution strength of the γ-matrix. Therefore, the present work delivers an additional mechanistic explanation why creep properties of single phase nickel based alloys can be transferred to two phase technical Superalloys with rafted γ'-structure. Following, the best way to substitute both rhenium fundamental properties, namely a slow diffusion coefficient and a small solubility in g', has been investigated by means of CALPHAD-modeling. Only molybdenum and especially tungsten

  4. Effect of rhenium and osmium on mechanical properties of a 9Cr-2W-0.25V-0.07Ta-0.1C steel

    International Nuclear Information System (INIS)

    Klueh, R.L.; Alexander, D.J.; Sokolov, M.A.


    The nuclear transmutation of tungsten to rhenium and osmium in a tungsten-containing steel irradiated in a fission or fusion reactor will change the chemical composition of the steel. To determine the possible consequences of such compositional changes on the mechanical properties, tensile and Charpy impact properties were measured on five 9Cr-2W-0.25V-0.07Ta-0.1C steels that contained different amounts of rhenium, osmium, and tungsten. The mechanical properties changes caused by these changes in composition were minor. Observations were also made on the effect of carbon concentration. The effect of carbon on tensile behavior was minor, but there was a large effect on Charpy properties. Several of the steels showed little effect of tempering temperature on the Charpy transition temperature, a behavior that was tentatively attributed to the low silicon and/or manganese concentration of the experimental steels

  5. Rhenium(V) and technetium(V) complexes of bis(o-hydroxyphenyl)phenylphosphine (PO22-) and (o-hydroxyphenyl)diphenylphosphine (PO-) ligands

    International Nuclear Information System (INIS)

    Luo, Hongyan; Setyawati, Ika; Rettig, S.J.; Orvig, C.


    The synthesis of several phosphine-based chelating compounds and chelates formed between these compounds and rhenium or technetium is discussed. Four categories of products result, (i) bis-(o-hydroxyphenyl) diphenylphosphine (PO) complexes, (ii) mono- (PO) complexes, (iii) bis-bis(o-hydroxyphenyl)-phenylphosphine (PO 2 ) complexes, and mixed-(PO) and (PO 2 ) complexes. Molecular structures of these compounds (including isomers) were probed by NMR, MS, and IR spectroscopies and by X-ray crystallography


    Energy Technology Data Exchange (ETDEWEB)



    The immobilization of 99Tc in a suitable host matrix has proved a challenging task for researchers in the nuclear waste community around the world. At the Hanford site in Washington State in the U.S., the total amount of 99Tc in low-activity waste (LAW) is {approx} 1,300 kg and the current strategy is to immobilize the 99Tc in borosilicate glass with vitrification. In this context, the present article reports on the solubility and retention of rhenium, a nonradioactive surrogate for 99Tc, in a LAW sodium borosilicate glass. Due to the radioactive nature of technetium, rhenium was chosen as a simulant because of previously established similarities in ionic radii and other chemical aspects. The glasses containing target Re concentrations varying from 0 to10,000 ppm by mass were synthesized in vacuum-sealed quartz ampoules to minimize the loss of Re by volatilization during melting at 1000 DC. The rhenium was found to be present predominantly as Re7 + in all the glasses as observed by X-ray absorption near-edge structure (XANES). The solubility of Re in borosilicate glasses was determined to be {approx}3,000 ppm (by mass) using inductively coupled plasma-optical emission spectroscopy (ICP-OES). At higher rhenium concentrations, some additional material was retained in the glasses in the form of alkali perrhenate crystalline inclusions detected by X-ray diffraction (XRD) and laser ablation-ICP mass spectrometry (LA-ICP-MS). Assuming justifiably substantial similarities between Re7 + and Tc 7+ behavior in this glass system, these results implied that the processing and immobilization of 99Tc from radioactive wastes should not be limited by the solubility of 99Tc in borosilicate LAW glasses.

  7. Influence of liposome forms of the rhenium compounds and cis-platin on thiol-disulfide coefficient in the rats’ blood

    Directory of Open Access Journals (Sweden)

    I. V. Klenina


    Full Text Available Thiol-disulfide coefficient (TDC and its different modifications in model in vivo were studied. Introduction of the liposome forms of cluster rhenium compounds with organic ligands (CROL leads to both TDC increasing and to the constancy of the TDC. Thus, CROLs aren’t toxic agents and some compounds could mobilize organisms’ thiol defence system. Liposome form of cis-platin leads to the TDC decreasing. Important CROL capacities for its future medical treatment practice were shown.

  8. Vectorization of a classical trajectory code on a floating point systems, Inc. Model 164 attached processor. (United States)

    Kraus, Wayne A; Wagner, Albert F


    A triatomic classical trajectory code has been modified by extensive vectorization of the algorithms to achieve much improved performance on an FPS 164 attached processor. Extensive timings on both the FPS 164 and a VAX 11/780 with floating point accelerator are presented as a function of the number of trajectories simultaneously run. The timing tests involve a potential energy surface of the LEPS variety and trajectories with 1000 time steps. The results indicate that vectorization results in timing improvements on both the VAX and the FPS. For larger numbers of trajectories run simultaneously, up to a factor of 25 improvement in speed occurs between VAX and FPS vectorized code. Copyright © 1986 John Wiley & Sons, Inc.

  9. Yrast bands and signature inversion in double odd 162,164Lu

    International Nuclear Information System (INIS)

    Cardona, M.A.; Hojman, D.; Kreiner, A.J.; Somacal, H.; Davidson, J.; Davidson, M.; Acuna, D. de; Napoli, D.R.; Rico, J.; Burch, R.; Bazzacco, D.; Lenzi, S.M.; Rossi Alvarez, C.; Blasi, N.; Lo Bianco, G.


    High spin rotational bands in 162 Lu and 164 Lu have been studied by means of the 139 La( 28 Si,5n) and 139 La( 29(30) Si,4(5)n) reactions respectively. For both nuclei the yrast sequence which is associated with the πh 11/2 x νi 13/2 configuration shows the signature inversion feature. (orig.)

  10. Use of new tandem cation/anion exchange system with clinical-scale generators provides high specific volume solutions of technetium-99m and rhenium-188

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Guhlke, S.


    In this paper we describe the first application of our simple and inexpensive post-elution tandem cation/anion exchange column system which is based on generator elution with salts of weak acids such as ammonium acetate instead of saline solution to provide very high specific volume solutions of technetium-99m and rhenium-188 from clinical-scale molybdenum-99/technetium-99m generator prepared from low specific activity (n,y) molybdenum-99, and tungsten-188/rhenium-188 generators, respectively. Initial passage of the bolus through a strong cation exchange cartridge converts the ammonium acetate to acetic acid which is essentially not ionized at the acidic pH, allowing specific subsequent amine-type (QMA SepPak TM ) anion exchange cartridge column trapping of the microscopic levels of the pertechnetate or perrhenate. Subsequent elution of the anion cartridge with a small volume ( 500 mCi/mL) from the alumina-based tungsten-188/rhenium-188 generator. (author)

  11. Development of pharmaceuticals with radioactive rhenium for cancer therapy. Production of {sup 186}Re and {sup 188}Re, synthesis of labeled compounds and their biodistributions

    Energy Technology Data Exchange (ETDEWEB)



    Production of the radioactive rhenium isotopes {sup 186}Re and {sup 188}Re, and synthesis of their labeled compounds have been studied together with the biodistributions of the compounds. This work was carried out by the Working Group on Radioactive Rhenium, consisting of researchers of JAERI and some universities, in the Subcommittee for Production and Radiolabeling under the Consultative Committee of Research on Radioisotopes. For {sup 186}Re, production methods by the {sup 185}Re(n,{gamma}){sup 186}Re reaction in a reactor and by the {sup 186}W(p,n){sup 186}Re reaction with an accelerator, which can produce nocarrier-added {sup 186}Re, have been established. For {sup 188}Re, a production method by the double neutron capture reaction of {sup 186}W, which produces a {sup 188}W/{sup 188}Re generator, has been established. For labeling of bisphosphonate, DMSA, DTPA, DADS, aminomethylenephosphonate and some monoclonal antibodies with the radioactive rhenium isotopes, the optimum conditions, including pH, the amounts of reagents and so on, have been determined for each compound. The biodistributions of each of the labeled compounds in mice have been also obtained. (author)

  12. Magnetic moments of high spin rotational states in 158Dy and 164Dy+

    International Nuclear Information System (INIS)

    Seiler-Clark, G.


    For the study of their magnetic moments yrast states in 158 Dy and 164 Dy were excited via the multiple-Coulomb excitation by a 4.7 MeV/u 208 Pb beam. Hereby especially the question was of interest, how the one-particle effects in the nuclear structure in the region of the backbending anomaly in 158 Dy take effects on the g-factors of the high spin states in this region. The particle-γ angular correlations perturbed in the transient magnetic field during the passing of the excited Dy ions through a thin magnetized iron foil were measured. By the selective position-sensitive detection of Dy recoil ions and Pb projectiles under forward angles it was possible to determine additionally to the g-factors in the backbending region also g-factors in the spin region I 158 Dy and 164 Dy by detection of the particle-γ correlations precessing in the static hyperfine field after implantation in iron. The static hyperfine field was at the 4 + state in 164 Dy determined to B (Dy,Fe) = 245+-25 T. The g-factors were determined by comparison of the experimental results with calculations of the perturbed angular correlations by time-differential regarding of the population and de-excitation of the yrast states as well as by precession and hyperfine-relaxation effects during the flight of the Dy ions in the vacuum. (orig./HSI) [de

  13. Issues associated with the use of the Tungsten-188/Rhenium188 generator and concentrator system and preparation of Re-188 HDD: A report

    International Nuclear Information System (INIS)

    Knapp, F.F.Jr.; Turner, J.H.; Jeong, J.-M.; Padhy, A.K.


    The ready availability of no-carrier-added Rhenium-188 from the Tungsten-188/Rhenium-188 generator represents an important source of a therapeutic radioisotope for a broad range of therapeutic applications in nuclear medicine, oncology, rheumatology and interventional cardiology. The International Atomic Energy Agency (IAEA) is coordinating a clinical trial involving the use of Rhenium188-Lipiodol for therapy of hepatocellular carcinoma. This report summarizes the experience of investigators at ten participating centres associated with the use and performance of the Tungsten-188/Rhenium-188 generators and the preparation and handling of the Re-188 HDD agent. This evaluation has demonstrated the cost effective provision of on-site therapeutic activities of Rhenium-188 and recommendations are made for further development of the next generator prototype in light of this international experience. The high bolus volumes (20-40 ml) of the ORNL generator requires post elution concentration of the Re-188 bolus by passage through the tandem silver cation/anion column system. The high back pressure often encountered during generator elution through the silver cation/anion concentrator system has been identified as a potential problem. The details of a method involving in house preparation of the silver cation columns were provided and implementation of this method for Re-188 bolus concentration is recommended. It is also recommended that ORNL investigators reassess the possibility of increasing Tungsten generator loading capacity and the use of higher specific activity Tungsten-188, with a view to reducing the generator bolus volume. The Re-188 HDD/Lipiodol conjugate?;ate is used in this IAEA trial for radioembolytic therapy of primary liver cancer, and methods for preparation of Re-188 HDD and its extraction into Lipiodol are discussed. Since Re-188 HDD binds to glass surfaces, the recovery yields are variable and can be as low as 40-45%. In an effort to maximize the

  14. The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta

    International Nuclear Information System (INIS)

    Turner, J.H.


    intervals of 7 - 11 weeks, in 10 patients at Fremantle Hospital and 7 patients at Erasmus Medical Centre. A multicentre international physician-sponsored randomised controlled trial of 177 Lu octreotate with or without capecitabine will commence in 2008, given that toxicity of combined chemotherapy and radiopeptide therapy is no greater than 177 Lu octreotate alone. 3. Rhenium-188 Lipiodol Hepatocellular carcinoma is the cancer which kills more people in Asia than any other malignancy and if unresectable is incurable. Effective palliation, which may increase survival, has been demonstrated with intrahepatic arterial administration of 131 I-lipiodol (6) and there are even greater potential benefits with 188 Re-lipiodol (7). We are currently testing a commercial prototype of semiautomated shielded synthesis box (Comecer, Castel- bolognese, Italy) for preparation of sterile 188 Re-lipiodol, for eventual installation in radiopharmacies throughout Asia, to provide cost-effective, safe treatment of hepatocellular carcinoma. Given the advent of the 188 W/ 188 Re generator, other therapeutic radio-pharmaceuticals such as 188 Re- HEDP for bone pain palliation of skeletal metastases, 188 Re colloid for radiation synovectomy and 188 Re antibodies for internalizing radioimmunotherapy would be available in-house in radiopharmacies throughout the world, to facilitate cost-effective incorporation of therapeutic nuclear oncology into mainstream clinical management of cancer. (author)

  15. Rhenium complexes of chromophore-appended dipicolylamine ligands: syntheses, spectroscopic properties, DNA binding and X-ray crystal structure

    International Nuclear Information System (INIS)

    Mullice, L.A.; Buurma, N.J.; Pope, S.J.A.; Laye, R.H.; Harding, L.P.


    The syntheses of two chromophore-appended dipicolylamine-derived ligands and their reactivity with penta-carbonyl-chloro-rhenium have been studied. The resultant complexes each possess the fac-Re(CO) 3 core. The ligands L 1 1-[bis(pyridine-2-yl-methyl)amino]methyl-pyrene and L 2 2-[bis(pyridine-2-yl-methyl)amino]methyl-quinoxaline were isolated via a one-pot reductive amination in moderate yield. The corresponding rhenium complexes were isolated in good yields and characterised by 1 H NMR, MS, IR and UV-Vis studies. X-Ray crystallographic data were obtained for fac-{Re(CO) 3 (L 1 )}(BF 4 ), C 34 H 26 BF 4 N 4 O 3 Re: monoclinic, P2(1)/c, a 18.327(2) Angstroms, α = 90.00 degrees, b 14.1537(14) Angstroms, β96.263(6) degrees, c = 23.511(3) Angstroms, γ 90.00 Angstroms, 6062.4(11) (Angstroms) 3 , Z=8. The luminescence properties of the ligands and complexes were also investigated, with the emission attributed to the appended chromophore in each case. Isothermal titration calorimetry suggests that fac-{Re(CO) 3 (L 1 )}(BF 4 ) self-aggregates cooperatively in aqueous solution, probably forming micelle-like aggregates with a cmc of 0.18 mM. Investigations into the DNA-binding properties of fac-{Re(CO) 3 (L 1 )}(BF 4 ) were undertaken and revealed that fac-{Re(CO) 3 (L 1 )}(BF 4 ) binding to fish sperm DNA (binding constant 1.5 ± 0.2 * 10 5 M -1 , binding site size 3.2 ± 0.3 base pairs) is accompanied by changes in the UV-Vis spectrum as typically observed for pyrene-based intercalators while the calorimetrically determined binding enthalpy (-14 ± 2 kcal mol -1 ) also agrees favourably with values as typically found for intercalators. (authors)

  16. LM1-64: a Newly Reported Lmc-Pn with WR Nucleus (United States)

    Pena, M.; Olguin, L.; Ruiz, M. T.; Torres-Peimbert, S.


    The object LM1-64 was reported by Lindsay & Mullan (1963, Irish Astron. J., 5, 51) as a probable PN in the LMC. Optical and UV spectra taken by us confirm that suggestion. LM1-64 is a high excitation planetary nebulae which shows evidence of having a WC central star. Broad stellar emission at lambda 4650 is detected in the optical spectrum obtained with the CTIO 4m telescope, in 1989. A UV spectrum in the range from 1200 Angstroms to 2000 Angstroms was obtained with IUE in 1990. We have measured all the emission line fluxes available and determined values for the physical conditions and chemical abundances of the nebular ionized gas. The derived values are T(OIII) = 14000K, log He/H = 11.05, log C/H = 9.48, log O/H = 8.55 and log Ne/H = 7.94. LM1-64 shows a large C enhancement in the envelope as result of the central star activity, while He, O and Ne are comparable to the average values reported for the LMC-PNe (Monk, Barlow & Clegg, 1988, MNRAS, 234, 583). We have estimated the He II Zanstra temperature of the central star to be ~ 80,000 K. This temperature is much higher than the values reported for the known LMC-PNe with WR nucleus that Monk et al. have classified as W4 to W8. The only other high temperature WR nucleus in a LMC-PN is N66 which recently showed evidence of undergoing a WR episode (Torres-Peimbert, Ruiz, Peimbert & Pe\\ na, 1993, IAU Symp. 155, eds. A. Acker & R. Weinberger, in press).

  17. Analysis of factor VIII gene inversions in 164 unrelated hemophilia A families

    Energy Technology Data Exchange (ETDEWEB)

    Vnencak-Jones, L.; Phillips, J.A. III; Janco, R.L. [Vanderbilt Univ. School of Medicine, Nashville, TN (United States)] [and others


    Hemophilia A is an X-linked recessive disease with variable phenotype and both heterogeneous and wide spread mutations in the factor VIII (F8) gene. As a result, diagnostic carrier or prenatal testing often relies upon laborious DNA linkage analysis. Recently, inversion mutations resulting from an intrachromosomal recombination between DNA sequences in one of two A genes {approximately}500 kb upstream from the F8 gene and a homologous A gene in intron 22 of the F8 gene were identified and found in 45% of severe hemophiliacs. We have analyzed banked DNA collected since 1986 from affected males or obligate carrier females representing 164 unrelated hemophilia A families. The disease was sporadic in 37%, familial in 54% and in 10% of families incomplete information was given. A unique deletion was identified in 1/164, a normal pattern was observed in 110/164 (67%), and 53/164 (32%) families had inversion mutations with 43/53 (81%) involving the distal A gene (R3 pattern) and 10/53 (19%) involving the proximal A gene (R2 pattern). While 19% of all rearrangements were R2, in 35 families with severe disease (< 1% VIII:C activity) all 16 rearrangements seen were R3. In 18 families with the R3 pattern and known activities, 16 (89%) had levels < 1%, with the remaining 2 families having {le} 2.4% activity. Further, 18 referrals specifically noted the production of inhibitors and 8/18 (45%) had the R3 pattern. Our findings demonstrate that the R3 inversion mutation patterns is (1) only seen with VIII:C activity levels of {le} 2.4%, (2) seen in 46% of families with severe hemophilia, (3) seen in 45% of hemophiliacs known to have inhibitors, (4) not correlated with sporadic or familial disease and (5) not in disequilibrium with the Bcl I or Taq I intron 18 or ST14 polymorphisms. Finally, in families positive for an inversion mutation, direct testing offers a highly accurate and less expensive alternative to DNA linkage analysis.

  18. A new amperometric glucose biosensor based on screen printed carbon electrodes with rhenium(IV - oxide as a mediator

    Directory of Open Access Journals (Sweden)



    Full Text Available Rhenium(IV-oxide, ReO2, was used as a mediator for carbon paste (CPE and screen printed carbon (SPCE electrodes for the catalytic amperometric determination of hydro-gen peroxide, whose overpotential for the reduction could be lowered to -0.1 V vs. Ag/AgCl in flow injection analysis (FIA using phosphate buffer (0.1 M, pH=7.5 as a carrier. For hydrogen peroxide a detection limit (3σ of 0.8 mg L-1 could be obtained.ReO2-modified SPCEs were used to design biosensors with a template enzyme, i.e. glucose oxidase, entrapped in a Nafion membrane. The resulting glucose sensor showed a linear dynamic range up to 200 mg L-1 glucose with a detection limit (3σ of 0.6 mg L-1. The repeatability was 2.1 % RSD (n = 5 measurements, the reproducibility 5.4 % (n = 5 sensors. The sensor could be applied for the determination of glucose in blood serum in good agreement with a reference method.

  19. Pharmacokinetic properties of new antitumor radiopharmaceutical on the basis of diamond nanoporous composites labeled with rhenium-188

    International Nuclear Information System (INIS)

    Petriev, V M; Tishchenko, V K; Kuril’chik, A A; Skvortsov, V G


    Today the development of address therapeutic radionuclide delivery systems directly to tumor tissue is of current interest. It can be achieved by the design of drug containers of specific sizes and shapes from carbon-based composite materials. It will be allowed to enhance the efficacy of anticancer therapy and avoid serious side effects. In this work we studied the pharmacokinetic properties of nanodiamond nanoporous composite labeled with rhenium-188 in rats with hepatocholangioma PC-1 after intratumoral injection. It was established that substantial part of injected radioactivity remained in tumor tissue. Within three hours after 188 Re-nanoporous composites injection activity in tumor constituted 79.1–91.3% of injected dose (ID). Then activity level declined to 45.9% ID at 120 hours. No more than 1.34% ID entered the bloodstream. In soft organs and tissues, except thyroid gland, the content of compound didn’t exceed 0.3% ID/g. The highest activity in thyroid gland was 6.95% ID/g. In conclusion, received results suggest 188 Re-nanoporous composites can be promising radionuclide delivery systems for cancer treatment. (paper)

  20. Syntheses and structures of technetium(V) and rhenium(V) oxo complexes of peptide having KYC-sequence

    International Nuclear Information System (INIS)

    Takayama, T.; Suzuki, K.; Sekine, T.; Kudo, H.


    Technetium(V) and rhenium(V) oxo complexes of a peptide having a KYC-sequence such as KYCAR (H 3 L 5 ) and KYCAREPPTRTNAYQGQG-NH 2 (H 3 L 18 ) were synthesized, and structures of the complexes were characterized by spectroscopic techniques. All of the complexes were synthesized by the ligand exchange reaction of [(n-C 4 H 9 ) 4 N][MOCl 4 ] (M = 99 Tc, Re) with peptide in methanol or dimethylformamide solution. These complexes have a square pyramidal structure with an oxo ligand at the apical position. The peptide is coordinated to a metal atom through N amine of lysine. S thiol of cysteine, and N amide of tyrosine and cysteine in the equatorial plane. A lysine (CH 2 ) 4 NH 2 group of the L 5 ligand has the syn conformation with respect to metal-oxo bonding in the complex. The syn isomer was selectively formed in the ligand exchange reaction. The conversion of the syn isomer to the anti isomer was observed only for syn-[ReO(L 5 )], in which the coordination of water to the trans position of the oxo ligand was involved. (orig.)

  1. Syntheses and structures of technetium(V) and rhenium(V) oxo complexes of peptide having KYC-sequence

    Energy Technology Data Exchange (ETDEWEB)

    Takayama, T.; Suzuki, K.; Sekine, T.; Kudo, H. [Dept. of Chemistry, Tohoku Univ., Sendai (Japan)


    Technetium(V) and rhenium(V) oxo complexes of a peptide having a KYC-sequence such as KYCAR (H{sub 3}L{sup 5}) and KYCAREPPTRTNAYQGQG-NH{sub 2} (H{sub 3}L{sup 18}) were synthesized, and structures of the complexes were characterized by spectroscopic techniques. All of the complexes were synthesized by the ligand exchange reaction of [(n-C{sub 4}H{sub 9}){sub 4}N][MOCl{sub 4}] (M = {sup 99}Tc, Re) with peptide in methanol or dimethylformamide solution. These complexes have a square pyramidal structure with an oxo ligand at the apical position. The peptide is coordinated to a metal atom through N{sub amine} of lysine. S{sub thiol} of cysteine, and N{sub amide} of tyrosine and cysteine in the equatorial plane. A lysine (CH{sub 2}){sub 4}NH{sub 2} group of the L{sup 5} ligand has the syn conformation with respect to metal-oxo bonding in the complex. The syn isomer was selectively formed in the ligand exchange reaction. The conversion of the syn isomer to the anti isomer was observed only for syn-[ReO(L{sup 5})], in which the coordination of water to the trans position of the oxo ligand was involved. (orig.)

  2. Phytoextraction of rhenium by lucerne (Medicago sativa) and erect milkvetch (Astragalus adsurgens) from alkaline soils amended with coal fly ash. (United States)

    He, Honghua; Dong, Zhigang; Pang, Jiayin; Wu, Gao-Lin; Zheng, Jiyong; Zhang, Xingchang


    Coal fly ash (CFA) is an industrial waste generated in huge amounts worldwide, and the management of CFA has become an environmental concern. Recovery of valuable metals from CFA is one of the beneficial reuse options of CFA. Rhenium (Re) is one of the rarest metals in the Earth's crust and one of the most expensive metals of strategic significance in the world market. A CFA at the Jungar Thermal Power Plant, Inner Mongolia, China, contains more Re than two alkaline soils in the surrounding region. Pot experiments were undertaken to grow lucerne (Medicago sativa) and erect milkvetch (Astragalus adsurgens) in a loessial soil and an aeolian sandy soil amended with different rates (5%, 10%, 20%, and 40%) of CFA. The results show that plant growth was considerably enhanced and Re concentration in plants was significantly increased when CFA was applied to the alkaline soils at rates of ≤20%; while in some cases plant growth was also markedly enhanced by the 40% CFA treatment, which increased plant Re concentration the most of all treatments. Both lucerne and erect milkvetch showed potential for phytoextracting Re from CFA-amended alkaline soils. Using CFA for soil amendment not only offers a potential solution for the waste disposal problem of CFA, but the phytoextraction of Re by both lucerne and erect milkvetch may also bring an economic profit in the future. Copyright © 2018 Elsevier B.V. All rights reserved.

  3. Fabrication of Tungsten-Rhenium Cladding materials via Spark Plasma Sintering for Ultra High Temperature Reactor Applications

    Energy Technology Data Exchange (ETDEWEB)

    Charit, Indrajit; Butt, Darryl; Frary, Megan; Carroll, Mark


    This research will develop an optimized, cost-effective method for producing high-purity tungsten-rhenium alloyed fuel clad forms that are crucial for the development of a very high-temperature nuclear reactor. The study will provide critical insight into the fundamental behavior (processing-microstructure- property correlations) of W-Re alloys made using this new fabrication process comprising high-energy ball milling (HEBM) and spark plasma sintering (SPS). A broader goal is to re-establish the U.S. lead in the research field of refractory alloys, such as W-Re systems, with potential applications in very high-temperature nuclear reactors. An essential long-term goal for nuclear power is to develop the capability of operating nuclear reactors at temperatures in excess of 1,000K. This capability has applications in space exploration and some special terrestrial uses where high temperatures are needed in certain chemical or reforming processes. Refractory alloys have been identified as being capable of withstanding temperatures in excess of 1,000K and are considered critical for the development of ultra hightemperature reactors. Tungsten alloys are known to possess extraordinary properties, such as excellent high-temperature capability, including the ability to resist leakage of fissile materials when used as a fuel clad. However, there are difficulties with the development of refractory alloys: 1) lack of basic experimental data on thermodynamics and mechanical and physical properties, and 2) challenges associated with processing these alloys.

  4. Mass spectrometry of rhenium complexes: a comparative study by using LDI-MS, MALDI-MS, PESI-MS and ESI-MS. (United States)

    Petroselli, Gabriela; Mandal, Mridul Kanti; Chen, Lee Chuin; Ruiz, Gustavo T; Wolcan, Ezequiel; Hiraoka, Kenzo; Nonami, Hiroshi; Erra-Balsells, Rosa


    A group of rhenium (I) complexes including in their structure ligands such as CF(3)SO(3)-, CH(3)CO(2)-, CO, 2,2'-bipyridine, dipyridil[3,2-a:2'3'-c]phenazine, naphthalene-2-carboxylate, anthracene-9-carboxylate, pyrene-1-carboxylate and 1,10-phenanthroline have been studied for the first time by mass spectrometry. The probe electrospray ionization (PESI) is a technique based on electrospray ionization (ESI) that generates electrospray from the tip of a solid metal needle. In this work, mass spectra for organometallic complexes obtained by PESI were compared with those obtained by classical ESI and high flow rate electrospray ionization assisted by corona discharge (HF-ESI-CD), an ideal method to avoid decomposition of the complexes and to induce their oxidation to yield intact molecular cation radicals in gas state [M](+·) and to produce their reduction yielding the gas species [M](-·). It was found that both techniques showed in general the intact molecular ions of the organometallics studied and provided additional structure characteristic diagnostic fragments. As the rhenium complexes studied in the present work showed strong absorption in the UV-visible region, particularly at 355 nm, laser desorption ionization (LDI) mass spectrometry experiments could be conducted. Although intact molecular ions could be detected in a few cases, LDI mass spectra showed diagnostic fragments for characterization of the complexes structure. Furthermore, matrix-assisted laser desorption ionization (MALDI) mass spectra were obtained. Nor-harmane, a compound with basic character, was used as matrix, and the intact molecular ions were detected in two examples, in negative ion mode as the [M](-·) species. Results obtained with 2-[(2E)-3-(4-tert-buthylphenyl)-2-methylprop-2-enylidene] malononitrile (DCTB) as matrix are also described. LDI experiments provided more information about the rhenium complex structures than did the MALDI ones. Copyright © 2012 John Wiley & Sons, Ltd.

  5. Experimental determination of the hydrothermal solubility of ReS2 and the Re–ReO2 buffer assemblage and transport of rhenium under supercritical conditions

    Directory of Open Access Journals (Sweden)

    Wood Scott A


    Full Text Available To understand the aqueous species important for transport of rhenium under supercritical conditions, we conducted a series of solubility experiments on the Re–ReO2 buffer assemblage and ReS2. In these experiments, pH was buffered by the K–feldspar–muscovite–quartz assemblage; in sulfur-free systems was buffered by the Re–ReO2 assemblage; and and in sulfur-containing systems were buffered by the magnetite–pyrite–pyrrhotite assemblage. Our experimental studies indicate that the species ReCl40 is dominant at 400°C in slightly acidic to near-neutral, and chloride-rich (total chloride concentrations ranging from 0.5 to 1.0 M environments, and ReCl3+ may predominate at 500°C in a solution with total chloride concentrations ranging from 0.5 to 1.5 M. The results also demonstrate that the solubility of ReS2 is about two orders of magnitude less than that of ReO2. This finding not only suggests that ReS2 (or a ReS2 component in molybdenite is the solubility-controlling phase in sulfur-containing, reducing environments but also implies that a mixing process involving an oxidized, rhenium-containing solution and a solution with reduced sulfur is one of the most effective mechanisms for deposition of rhenium. In analogy with Re, TcS2 may be the stable Tc-bearing phase in deep geological repositories of radioactive wastes.

  6. High-resolution metallic magnetic calorimeters for {beta}-spectroscopy on {sup 187}rhenium and position resolved X-ray spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Porst, Jan-Patrick


    This thesis describes the development of metallic magnetic calorimeters (MMCs) for high resolution spectroscopy. MMCs are energy dispersive particle detectors based on the calorimetric principle which are typically operated at temperatures below 100 mK. The detectors make use of a paramagnetic temperature sensor to transform the temperature rise upon the absorption of a particle in the detector into a measurable magnetic flux change in a dc-SQUID. The application of MMCs for neutrino mass measurements and their advantages with respect to other approaches are discussed. In view of this application the development of an MMC optimized for {beta}-endpoint spectroscopy on {sup 187}rhenium is presented. A fully micro-fabricated X-ray detector is characterized and performs close to design values. Furthermore, a new technique to more efficiently couple rhenium absorbers mechanically and thermally to the sensor was developed and successfully tested. By employing a metallic contact, signal rise times faster than 5 {mu}s could be observed with superconducting rhenium absorbers. In addition to the single pixel detectors, an alternative approach of reading out multiple pixels was developed in this work, too. Here, the individual absorbers have a different thermal coupling to only one temperature sensor resulting in a distribution of different pulse shapes. Straightforward position discrimination by means of rise time analysis is demonstrated for a four pixel MMC and a thermal model of the detector is provided. Unprecedented so far, an energy resolution of less than {delta}E{sub FWHM}<5 eV for 5.9 keV X-rays was achieved across all absorbers. (orig.)

  7. Thermal decomposition of rhenium (5) complexes with 1,2,4-triazole. Termicheskoe razlozhenie kompleksov reniya (5) s 1,2,4-triazolom

    Energy Technology Data Exchange (ETDEWEB)

    Amindzhanov, A A; Gagieva, S Ch; Kotegov, K V [Tadzhikskij Gosudarstvennyj Univ., Dushanbe (Tajikistan)


    Processes of thermal decomposition of rhenium (5) complexes with 1,2,4-triazole were studied. Thermolysis products were identified on the basis of data of the element analysis, IR spectra, conductometry and other methods. It is ascertained that at the first stage of thermolysis of hydroxyl-containing monomer complexes removal of water molecules occurs, and at the second one - dimerization process with formation of Re-O-Re group. It is shown that the nature of halide ion practically does not affect the temperature of the start of intensive thermal decomposition of the complexes.

  8. Photodetectors: Broad Detection Range Rhenium Diselenide Photodetector Enhanced by (3-Aminopropyl)Triethoxysilane and Triphenylphosphine Treatment (Adv. Mater. 31/2016). (United States)

    Jo, Seo-Hyeon; Park, Hyung-Youl; Kang, Dong-Ho; Shim, Jaewoo; Jeon, Jaeho; Choi, Seunghyuk; Kim, Minwoo; Park, Yongkook; Lee, Jaehyeong; Song, Young Jae; Lee, Sungjoo; Park, Jin-Hong


    The effects of triphenylphosphine (PPh3 ) and (3-amino-propyl)triethoxysilane (APTES) on a rhenium diselenide (ReSe2 ) photodetector are systematically studied by J.-H. Park and co-workers on page 6711 in comparison with a conventional MoS2 device. A very high performance ReSe2 photodetector is demonstrated, which has a broad photodetection range, high photoresponsivity (1.18 × 10(6) A W(-1) ), and fast photoswitching speed (rising/decaying time: 58/263 ms). © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Radiolabeling and biotinylation of internalizing monoclonal antibody chimeric BR96: Potential use of extracorporeal immunoadsorption with enhanced tumor radioactivity retention of Iodine, Indium and Rhenium

    International Nuclear Information System (INIS)

    Chen, JianQing.


    In this thesis, methodology of radiolabeling and simultaneous biotinylation for internalizing monoclonal antibody chimeric BR96 have been investigated by using three element groups of potential therapeutic radionuclides iodine, indium and rhenium, and their different labeling methods. The biodistribution and kinetics of biotinylated and radiolabeled chiBR96 have been studied in colon carcinoma isografted rats. The potential use of ECIA, based on the biotin-avidin concept, has been evaluated and compared with the approach of avidin 'chase' in the same animal tumor model with respect to an enhancement of tumor-to-normal tissue (T/N) activity ratio. 131 refs

  10. Radiolabeling and biotinylation of internalizing monoclonal antibody chimeric BR96: Potential use of extracorporeal immunoadsorption with enhanced tumor radioactivity retention of Iodine, Indium and Rhenium

    Energy Technology Data Exchange (ETDEWEB)

    Chen, JianQing


    In this thesis, methodology of radiolabeling and simultaneous biotinylation for internalizing monoclonal antibody chimeric BR96 have been investigated by using three element groups of potential therapeutic radionuclides iodine, indium and rhenium, and their different labeling methods. The biodistribution and kinetics of biotinylated and radiolabeled chiBR96 have been studied in colon carcinoma isografted rats. The potential use of ECIA, based on the biotin-avidin concept, has been evaluated and compared with the approach of avidin `chase` in the same animal tumor model with respect to an enhancement of tumor-to-normal tissue (T/N) activity ratio. 131 refs.

  11. Lump Kinetic Analysis of Syngas Composition Effect on Fischer-Tropsch Synthesis over Cobalt and Cobalt-Rhenium Alumina Supported Catalyst

    Directory of Open Access Journals (Sweden)

    Dewi Tristantini


    Received: 10th November 2015; Revised: 10th February 2016; Accepted: 16th February 2016 How to Cite: Tristantini, D., Suwignjo, R.K. (2016. Lump Kinetic Analysis of Syngas Composition Effect on Fischer-Tropsch Synthesis over Cobalt and Cobalt-Rhenium Alumina Supported Catalyst. Bulletin of Chemical Reaction Engineering & Catalysis, 11 (1: 84-92. (doi:10.9767/bcrec.11.1.424.84-92 Permalink/DOI:

  12. Effect of heat-treatment on microstructure and high-temperature deformation behavior of a low rhenium-containing single crystal nickel-based superalloy

    International Nuclear Information System (INIS)

    Sun, Nairong; Zhang, Lanting; Li, Zhigang; Shan, Aidang


    A low rhenium-containing [001] oriented single crystal nickel-based superalloy with different γ′ morphologies induced by various aging treatments was compressed from room temperature to 1000 °C. All the single crystal samples with different γ′ morphologies exhibit anomalous yield behavior. The sample first aged at 1180 °C has the widest anomalous temperature domain and highest yield strengths. The sample first aged at 1000 °C has the highest anomalous peak stress temperature

  13. Ultra-small rhenium nanoparticles immobilized on DNA scaffolds: An excellent material for surface enhanced Raman scattering and catalysis studies. (United States)

    Anantharaj, S; Sakthikumar, K; Elangovan, Ayyapan; Ravi, G; Karthik, T; Kundu, Subrata


    Highly Sensitive and ultra-small Rhenium (Re) metal nanoparticles (NPs) were successfully stabilized in water by the staging and fencing action of the versatile biomolecule DNA that resulted in two distinct aggregated chain-like morphologies with average grain sizes of 1.1±0.1nm and 0.7±0.1nm for the very first time within a minute of reaction time. Re NPs are formed by the borohydride reduction of ammonium perrhenate (NH4ReO4) in the presence of DNA at room temperature (RT) under stirring. The morphologies were controlled by carefully monitoring the molar ratio of NH4ReO4 and DNA. The synthesized material was employed in two potential applications: as a substrate for surface enhanced Raman scattering (SERS) studies and as a catalyst for the reduction of aromatic nitro compounds. SERS study was carried out by taking methylene blue (MB) as the probe and the highest SERS enhancement factor (EF) of 2.07×10(7) was found for the aggregated chain-like having average grain size of 0.7±0.1nm. Catalytic reduction of 4-nitro phenol (4-NP), 2-nitro phenol (2-NP) and 4-nitroaniline (4-NA) with a rate constant value of 6×10(-2)min(-1), 33.83×10(-2)min(-1) and 37.4×10(-2)min(-1) have testified the excellent catalytic performance of our Re NPs immobilized on DNA. The overall study have revealed the capability of DNA in stabilizing the highly reactive Re metal at nanoscale and made them applicable in practice. The present route can also be extended to prepare one dimensional (1-D), self-assembled NPs of other reactive metals, mixed metals or even metal oxides for specific applications in water based solutions. Copyright © 2016 Elsevier Inc. All rights reserved.

  14. Dissimilar behavior of technetium and rhenium in borosilicatewaste glass as determined by X-ray absorption spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Lukens, Wayne W.; McKeown, David A.; Buechele, Andrew C.; Muller,Isabelle S.; Shuh, David K.; Pegg, Ian L.


    Technetium-99 is an abundant, long-lived (t1/2 = 213,000 yr)fission product that creates challenges for the safe, long-term disposalof nuclear waste. While 99Tc receives attention largely due to its highenvironmental mobility, it also causes problems during its incorporationinto nuclear waste glass due to the volatility of Tc(VII) compounds. Thisvolatility decreases the amount of 99Tc stabilized in the waste glass andcauses contamination of the waste glass melter and off-gas system. Theapproach to decrease the volatility of 99Tc that has received the mostattention is reduction of the volatile Tc(VII) species to less volatileTc(IV) species in the glass melt. On engineering scale experiments,rhenium is often used as a non-radioactive surrogate for 99Tc to avoidthe radioactive contamination problems caused by volatile 99Tc compounds.However, Re(VII) is more stable towards reduction than Tc(VII), so morereducing conditions would be required in the glass melt to produceRe(IV). To better understand the redox behavior of Tc and Re in nuclearwaste glass, a series of glasses were prepared under different redoxconditions. The speciation of Tc and Re in the resulting glasses wasdetermined by X-ray absorption fine structure spectroscopy. Surprisingly,Re and Tc do not behave similarly in the glass melt. Although Tc(0),Tc(IV), and Tc(VII) were observed in these samples, only Re(0) andRe(VII) were found. In no case was Re(IV) (or Re(VI))observed.

  15. Lateral Root Development in Potato Is Mediated by Stu-mi164 Regulation of NAC Transcription Factor

    Directory of Open Access Journals (Sweden)

    Li Zhang


    Full Text Available The NAC designation is derived from petunia (Petunia hybrida gene NO APICAL MERISTEM (NAM and Arabidopsis genes ATAF1/ATAF2 and CUP-SHAPED COTYLEDON2 (CUC2, which belongs to the family of plant-specific transcription factors (TFs, and plays important role in plant development processes, such as response to biotic and abiotic stress, and hormone signaling. MicroRNAs (miRNAs are a class of small, non-coding endogenous RNAs which play versatile and significant role in plant stress response and development via negatively affecting gene expression at a post-transcriptional level. Here, we showed that Stu-mi164 had a complementary sequence in the CDS sequence of potato NAC TFs, and that NAC expression exhibited significant differences under osmotic stress. We measured expression levels of the Stu-mi164 target gene StNAC262 between control and PEG-treated plants using real-time PCR, and the results demonstrated that they had inverse relationship. We suggested that Stu-miR164 might drive overexpression of NAC gene under osmotic stress in potato. To confirm the regulation of NAC TFs by Stu-mi164, we developed transgenic plants, using Agrobacterium tumefaciens–mediated transformation, of the potato cultivars “Gannongshu 2” and “Kexin 3” overexpressing the Stu-mi164 or the TF StNAC262. Real-time PCR analysis of transgenic potato plants under osmotic (PEG stress, showed that potato plants overexpressing Stu-mi164 had reduced expression of StNAC262 and their osmotic resistance decreased. Furthermore, these plants had low number of lateral roots although the same length as the control. Our findings support the regulatory role of Stu-miRNAs in controlling plant response to osmotic stress via StNAC262.

  16. Thermal transformations of oxohalide complexes of rhenium(5) and molybdenum(5) with diazo-18-crown-6 in solid phase. Termicheskie prevrashcheniya oksogalogenidnykh kompleksov reniya(5) i molibdena(5) s diaza-18-kraun-6 v tverdoj faze

    Energy Technology Data Exchange (ETDEWEB)

    Ashurova, N Kh; Yakubov, K G [Tadzhikskij Gosudarstvennyj Univ., Dushanbe (Tajikistan)


    Methods for synthesis and separation in solid state of the rhenium(5) and molybdenum(5) onium complexes with diaza-18-crown-6(L), the content of which according to the data of elementary analysis, IRS in the close and remote areas, thermogravimetry, conductometry and potentiometry corresponds to the (H[sub 2]L)[EOX[sub 5

  17. Ultrafast Excited-State Dynamics of Rhenium(I) Photosensitizers [Re(Cl)(CO)3(N,N)] and [Re(imidazole)(CO)3(N,N)]+: Diimine Effects

    Czech Academy of Sciences Publication Activity Database

    Nahhas, A. E.; Consani, C.; Blanco-Rodríguez, A. M.; Lancaster, K. M.; Braem, O.; Cannizzo, A.; Towrie, M.; Clark, I. P.; Záliš, Stanislav; Chergui, M.; Vlček, Antonín


    Roč. 50, č. 7 (2011), s. 2932-2943 ISSN 0020-1669 R&D Projects: GA MŠk(CZ) ME10124; GA MŠk(CZ) LD11082 Institutional research plan: CEZ:AV0Z40400503 Keywords : rhenium * photosynthesis * diimine effects Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.601, year: 2011

  18. β(2) -adrenergic receptor Thr164IIe polymorphism, blood pressure and ischaemic heart disease in 66 750 individuals

    DEFF Research Database (Denmark)

    Thomsen, M; Dahl, Morten; Tybjærg-Hansen, Anne


    Abstract. Thomsen M, Dahl M, Tybjaerg-Hansen A, Nordestgaard BG (Copenhagen University Hospital, Copenhagen; University of Copenhagen, Copenhagen, Denmark). ß(2) -adrenergic receptor Thr164IIe polymorphism, blood pressure and ischaemic heart disease in 66 750 individuals. J Intern Med 2011; doi: 10.......1111/j.1365-2796.2011.02447.x Objectives. The ß(2) -adrenergic receptor (ADRB2) is located on smooth muscle cells and is an important regulator of smooth muscle tone. The Thr164Ile polymorphism (rs1800888) in the ADRB2 gene is rare but has profound functional consequences on receptor function and could...

  19. A novel white spot syndrome virus protein WSSV164 controls prophenoloxidases, PmproPOs in shrimp melanization cascade. (United States)

    Sangsuriya, Pakkakul; Charoensapsri, Walaiporn; Sutthangkul, Jantiwan; Senapin, Saengchan; Hirono, Ikuo; Tassanakajon, Anchalee; Amparyup, Piti


    Melanization, mediated by the prophenoloxidase (proPO)-activating system, is an important innate immune response in invertebrates. The implication of the proPO system in antiviral response and the suppression of host proPO activation by the viral protein have previously been demonstrated in shrimp. However, the molecular mechanism of viral-host interactions in the proPO cascade remains largely unexplored. Here, we characterized the viral protein, namely, WSSV164, which was initially identified from the forward suppression subtractive hybridization (SSH) cDNA library of the PmproPO1/2 co-silenced black tiger shrimp Penaeus monodon that was challenged with white spot syndrome virus (WSSV). Using the yeast two-hybrid system, WSSV164 was found to interact with the PmproPO2 protein. The subsequent validation assay by co-immunoprecipitation revealed that WSSV164 directly bound to both PmproPO1 and PmproPO2. The gene silencing experiment was carried out to explore the role of WSSV164 in the control of the proPO pathway in shrimp, and the results showed that suppression of WSSV164 can restore PO activity in WSSV-infected shrimp hemolymph. The recombinant proteins of PmproPO1 and PmproPO2 were produced in Sf-9 cells and were shown to be successfully activated by exogenous trypsin and endogenous serine proteinases from shrimp hemocyte lysate supernatant (HLS), yielding PO activity in vitro. Moreover, the activated PO activity in shrimp HLS was dose-dependently reduced by the recombinant WSSV164 protein, suggesting that WSSV164 may interfere with the activation of the proPO system in shrimp. Taken together, these results suggest an alternative infection route of WSSV through the encoded viral protein WSSV164 that binds to the PmproPO1 and PmproPO2 proteins, interfering with the activation of the melanization cascade in shrimp. Copyright © 2018 Elsevier Ltd. All rights reserved.

  20. Transfer and breakup reactions in 16O + CsI at 16.4 MeV/n

    Directory of Open Access Journals (Sweden)

    M.J. Murphy


    Full Text Available A streamer-chamber particle-telescope system has been used to observe ejectile charge, energy, and associated charged particle multiplicity in the reaction of 16O + CsI at 16.4 MeV/n. The measurement provides relative probabilities for transfer and projectile breakup as a function of ejectile charge, and spectra for the heavy ejectiles from transfer and breakup events. The results show that the interaction energy of 16.4 MeV/n is near the threshold for breakup reactions in heavy-ion collisions.

  1. Studies on the preparation and isomeric composition of [sup 186]Re- and [sup 188]Re-pentavalent rhenium dimercaptosuccinic acid complex

    Energy Technology Data Exchange (ETDEWEB)

    Singh, J. (Canterbury Univ. (United Kingdom). Biological Lab.); Reghebi, K.; Lazarus, C.R.; Clarke, S.E.M. (Guy' s Hospital, London (United Kingdom)); Callahan, A.P.; Knapp, F.F. Jr. (Oak Ridge National Lab., TN (United States)); Blower, P.J. (Kent and Canterbury Hospital (United Kingdom))


    The preparative conditions for [sup 186]Re(V)DMSA and [sup 188]Re(V)DMSA (DMSA = meso-dimercaptosuccinic acid), [beta]-emitting radiopharmaceuticals that have been shown to localize in medullary thyroid carcinoma, require modification depending on the amount of carrier rhenium and the chemical form and medium in which the rhenium is supplied. Preparative conditions are described for use with carrier-free [sup 188]ReO[sub 4][sup -] in saline, and for use with [sup 186]ReO[sub 4][sup -] in saline, sodium hydroxide or nitric acid. Preparation of [sup 186]Re(V)DMSA (carrier present up to 2 mg per 2.5 ml reaction volume) requires a DMSA:SnCl[sub 2]:Re ratio of 10:5:1 at 100[sup o]C for 30 min. Addition of excess nitric acid or hydrochloric acid up to a concentration of 155 mM does not reduce the yield from 100%. A commercial DMSA kit vial (e.g. Amerscan DMSA) can be used for preparation of [sup 188]Re(V)DMSA (carrier free) provided the required is in a volume of less than 1 ml per vial. A convenient method of concentrating the [sup 188]Re generator eluate to the required volume is described. (Author).

  2. In-situ field-ion microscope study of the recovery behavior of heavy metal ion-irradiated tungsten, tungsten (rhenium) alloys and molybdenum

    International Nuclear Information System (INIS)

    Nielsen, C.H.


    Three field ion microscope (FIM) experiments were carried out to study the annealing behavior of heavy ion irradiated tungsten, tungsten (rhenium) alloys and molybdenum. The first experiment dealt with the stage I long-range migration of tungsten self interstitial atoms (SIAs) in high purity tungsten of resistivity ratio, R = 24,000 (R = rho 300 /rho 4 . 2 , where rho 300 and rho 4 . 2 are the room temperature and 0 0 C resistivities). The FIM specimens were irradiated in situ at 18 K with 30 keV W + ions to an average dose of 5 x 10 12 ions cm -2 and subsequently examined by the pulsed-field evaporation technique. The second experiment dealt with the phenomenon of impurity atom trapping of SIAs during long-range migration. It was shown that rhenium atoms in a tungsten matrix tend to capture tungsten SIAs and remain bound up to temperatures as high as 390 K. The final experiment was concerned with the low temperature annealing kinetics of irradiated molybdenum. High purity molybdenum of resistivity ratio R = 5700 was irradiated at 10 K with 30 keV Mo + ions to a dose of approximately 5 x 10 12 ions cm -2 . The results indicated that the electric field has only a minimal effect on the SIA annealing kinetics. This tends to strengthen the contention that the molybdenum SIA becomes mobile at 32 K

  3. Lysine residue 185 of Rad1 is a topological but not a functional counterpart of lysine residue 164 of PCNA.

    Directory of Open Access Journals (Sweden)

    Niek Wit

    Full Text Available Monoubiquitylation of the homotrimeric DNA sliding clamp PCNA at lysine residue 164 (PCNA(K164 is a highly conserved, DNA damage-inducible process that is mediated by the E2/E3 complex Rad6/Rad18. This ubiquitylation event recruits translesion synthesis (TLS polymerases capable of replicating across damaged DNA templates. Besides PCNA, the Rad6/Rad18 complex was recently shown in yeast to ubiquitylate also 9-1-1, a heterotrimeric DNA sliding clamp composed of Rad9, Rad1, and Hus1 in a DNA damage-inducible manner. Based on the highly similar crystal structures of PCNA and 9-1-1, K185 of Rad1 (Rad1(K185 was identified as the only topological equivalent of PCNA(K164. To investigate a potential role of posttranslational modifications of Rad1(K185 in DNA damage management, we here generated a mouse model with a conditional deletable Rad1(K185R allele. The Rad1(K185 residue was found to be dispensable for Chk1 activation, DNA damage survival, and class switch recombination of immunoglobulin genes as well as recruitment of TLS polymerases during somatic hypermutation of immunoglobulin genes. Our data indicate that Rad1(K185 is not a functional counterpart of PCNA(K164.

  4. 17 CFR 1.64 - Composition of various self-regulatory organization governing boards and major disciplinary... (United States)


    ... ACT Miscellaneous § 1.64 Composition of various self-regulatory organization governing boards and major disciplinary committees. (a) Definitions. For purposes of this section: (1) Self-regulatory organization means “self-regulatory organization” as defined in § 1.3(ee), not including a “clearing...

  5. Evaluation of technetium-99m/rhenium labelled nucleoside analogues as potential radiotracers in oncology[Dissertation 17173

    Energy Technology Data Exchange (ETDEWEB)

    Desbouis, D


    }M). This compound also exhibited a mixed inhibition of the hTK1 with K{sub ic} = 73 {+-} 20 {mu}M. When tested in vitro for cell uptake in transfected cancer cells this technetium thymidine complex revealed a low internalisation of 0.03 {+-} 0.01%ID/(mg/mL). Under the same conditions the [{sup 3}H]thymidine exhibited an uptake of 1.50 {+-} 0.02%lD/(mg/mL). In order to gain potency and selectivity for HSV1-TK, the corresponding 5'-carboxamide 5-ethyl-2', 5'-dideoxyuridine was synthesized. The synthesis of the ligand was performed in seven steps from 2'-deoxyuridine. This ligand was then successfully labelled with the fac-M(CO){sub 3}-core (M = {sup 99m}Tc, Re). The rhenium complex was found to be a selective competitive inhibitor of HSV1-TK (K{sub i} = 4.56 {+-} 0.11 {mu}M). Although the cellular uptake of the technetium 2'-deoxyurine complex (0.10 {+-} 0.01%ID/(mg/mL)) was better than its corresponding technetium thymidine complex, it is still very low compared to thymidine uptake. The second aspect of this work was to develop nucleoside derivatives labelled with technetium-99m/rhenium tricarbonyl core capable of acting as substrates for human cytosolic thymidine kinase (hTKl). hTKl is a target of choice to evaluate cell proliferation due to its overexpression in a variety of cancer cells. [{sup 18}F]Fluorothymidine [{sup 18}F]FLT), which acts as a hTKl substrate, has emerged as a very efficient PET tracer for the monitoring of cell proliferation. Our aim was to develop a SPET tracer with the same mode of action as [{sup 18}F]FLT. We prepared a set of technetium-99m/rhenium complexes of N3 thymidine derivatives with different overall charges (+1, 0 and -1) and variable spacer lengths. The complexes with different overall charges had the same spacer length between chelating system and thymidine moiety (two carbons spacer) while the complexes with different spacer lengths (2, 3, 5 and 10) were all neutral. These compounds were tested for their

  6. A model for the oceanic mass balance of rhenium and implications for the extent of Proterozoic ocean anoxia (United States)

    Sheen, Alex I.; Kendall, Brian; Reinhard, Christopher T.; Creaser, Robert A.; Lyons, Timothy W.; Bekker, Andrey; Poulton, Simon W.; Anbar, Ariel D.


    Emerging geochemical evidence suggests that the atmosphere-ocean system underwent a significant decrease in O2 content following the Great Oxidation Event (GOE), leading to a mid-Proterozoic ocean (ca. 2.0-0.8 Ga) with oxygenated surface waters and predominantly anoxic deep waters. The extent of mid-Proterozoic seafloor anoxia has been recently estimated using mass-balance models based on molybdenum (Mo), uranium (U), and chromium (Cr) enrichments in organic-rich mudrocks (ORM). Here, we use a temporal compilation of concentrations for the redox-sensitive trace metal rhenium (Re) in ORM to provide an independent constraint on the global extent of mid-Proterozoic ocean anoxia and as a tool for more generally exploring how the marine geochemical cycle of Re has changed through time. The compilation reveals that mid-Proterozoic ORM are dominated by low Re concentrations that overall are only mildly higher than those of Archean ORM and significantly lower than many ORM deposited during the ca. 2.22-2.06 Ga Lomagundi Event and during the Phanerozoic Eon. These temporal trends are consistent with a decrease in the oceanic Re inventory in response to an expansion of anoxia after an interval of increased oxygenation during the Lomagundi Event. Mass-balance modeling of the marine Re geochemical cycle indicates that the mid-Proterozoic ORM with low Re enrichments are consistent with extensive seafloor anoxia. Beyond this agreement, these new data bring added value because Re, like the other metals, responds generally to low-oxygen conditions but has its own distinct sensitivity to the varying environmental controls. Thus, we can broaden our capacity to infer nuanced spatiotemporal patterns in ancient redox landscapes. For example, despite the still small number of data, some mid-Proterozoic ORM units have higher Re enrichments that may reflect a larger oceanic Re inventory during transient episodes of ocean oxygenation. An improved understanding of the modern oceanic Re

  7. The role of peu-miR164 and its target PeNAC genes in response to abiotic stress in Populus euphratica. (United States)

    Lu, Xin; Dun, Hui; Lian, Conglong; Zhang, Xiaofei; Yin, Weilun; Xia, Xinli


    Plant miR164 family is highly conserved and miR164 members regulate conserved targets belonging to NAC transcription factors. Our previous studies have revealed that peu-miR164a-e and its target gene POPTR_0007s08420 participate in abiotic stress response in Populus euphratica according to deep sequencing and degradome sequencing. In this study, miR164 family comprises six members that generate two mature products (miR164a-e and miR164f) and target seven NAC genes in P. euphratica. Co-expression in Nicotiana benthamiana and 5' RACE confirmed that peu-miR164 directs PeNAC070, PeNAC012 and PeNAC028 mRNAs cleavage. Expression profiles of primary peu-miR164 a/b/c/d/e bear similarity to those of peu-miR164a-e, whereas PeNAC070 and PeNAC081 showed inverse expression patterns with peu-miR164a-e under abiotic stresses. Existence of cis-acting elements in PeNAC070 promoter (ABRE,MBs, Box-W1, GC-motif, and W-box) and in peu-MIR164b promoter (HSE) further confirmed different responses of peu-miR164 and PeNAC070 to abiotic stresses. Histochemical β-glucuronidase (GUS) staining revealed that GUS activities increased when Pro PeNAC070 ::GUS transgenic Arabidopsis plants were exposed to NaCl, mannitol and abscisic acid (ABA), whereas GUS activity of Pro peu-MIR164b ::GUS plants decreased under ABA treatment. Subcellular localization and transactivation assays showed that PeNAC070 protein was localized to the nucleus and exhibited transactivation activity at the C-terminal. Overexpression of PeNAC070 in Arabidopsis promoted lateral root development, delayed stem elongation, and increased sensitivity of transgenic plants to drought and salt stresses. This study aids in understanding the adaptability of P. euphratica to extreme drought and salt environment by analysing tissue-specific expression patterns of miR164-regulated and specific promoter-regulated PeNAC genes. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  8. Comparative study of the anchorage and the catalytic properties of nanoporous TiO2 films modified with ruthenium (II) and rhenium (I) carbonyl complexes (United States)

    Oyarzún, Diego P.; Chardon-Noblat, Sylvie; Linarez Pérez, Omar E.; López Teijelo, Manuel; Zúñiga, César; Zarate, Ximena; Shott, Eduardo; Carreño, Alexander; Arratia-Perez, Ramiro


    In this article we study the anchoring of cis-[Ru(bpyC4pyr)(CO)2(CH3CN)2]2+, cis-[Ru(bpy)2(CO)2]2+ and cis-[Ru(bpyac)(CO)2Cl2], onto nanoporous TiO2 employing electropolymerization, electrostatic interaction and chemical bonding. Also, the [Re(bpyac)(CO)3Cl] rhenium(I) complex for chemical anchorage was analyzed. The characterization of TiO2/Ru(II) and TiO2/Re(I) nanocomposite films was performed by field emission scanning electron microscopy (FESEM), electron dispersive X-ray spectroscopy (EDS) and Raman spectroscopy. In addition, for the more stable nanocomposites obtained, the catalytic properties (solar energy conversion and CO2 reduction) were evaluated. The efficiency improvement in redox process derived from the (photo)electrochemical evidence indicates that modified nanoporous TiO2 structures enhance the rate of charge transfer reactions.

  9. The extreme blazar AO 0235+164 as seen by extensive ground and space radio observations (United States)

    Kutkin, A. M.; Pashchenko, I. N.; Lisakov, M. M.; Voytsik, P. A.; Sokolovsky, K. V.; Kovalev, Y. Y.; Lobanov, A. P.; Ipatov, A. V.; Aller, M. F.; Aller, H. D.; Lahteenmaki, A.; Tornikoski, M.; Gurvits, L. I.


    Clues to the physical conditions in radio cores of blazars come from measurements of brightness temperatures as well as effects produced by intrinsic opacity. We study the properties of the ultra-compact blazar AO 0235+164 with RadioAstron ground-space radio interferometer, multifrequency VLBA, EVN, and single-dish radio observations. We employ visibility modelling and image stacking for deriving structure and kinematics of the source, and use Gaussian process regression to find the relative multiband time delays of the flares. The multifrequency core size and time lags support prevailing synchrotron self-absorption. The intrinsic brightness temperature of the core derived from ground-based very long baseline interferometry (VLBI) is close to the equipartition regime value. In the same time, there is evidence for ultra-compact features of the size of less than 10 μas in the source, which might be responsible for the extreme apparent brightness temperatures of up to 1014 K as measured by RadioAstron. In 2007-2016 the VLBI components in the source at 43 GHz are found predominantly in two directions, suggesting a bend of the outflow from southern to northern direction. The apparent opening angle of the jet seen in the stacked image at 43 GHz is two times wider than that at 15 GHz, indicating a collimation of the flow within the central 1.5 mas. We estimate the Lorentz factor Γ = 14, the Doppler factor δ = 21, and the viewing angle θ = 1.7° of the apparent jet base, derive the gradients of magnetic field strength and electron density in the outflow, and the distance between jet apex and the core at each frequency.

  10. Clinical studies on the lymph flow of the esophagus by injecting sup(99m)Tc-rhenium colloid into the esophageal wall

    International Nuclear Information System (INIS)

    Baba, Masamichi; Tanabe, Gen; Nishi, Mitsumasa


    Using 29 operative cases lymph flow of the esophagus was investigated by injecting endoscopically sup(99m)Tc-Rhenium colloid. Rhenium colloid lymphoscintigraphy was made, and 30 -- 32 hours after injection RI up take (cpm/g) of resected lymph nodes was counted by scintillation counter. 1. RI up take of resected lymph nodes correspond with the lymphoscintigraphy of resected lymph nodes therefore, RI up take count was available to study the extra-mural lymph flow of the esophagus. 2. In the cases injected at upper part of the esophagus, the high counted RI up take was noted in bifurcation lymph nodes, upper mediastinal lymph nodes and bilateral supraclavicular lymph nodes. In the cases injected at middle part of the esophagus, bilateral supraclavicular lymph nodes, upper mediastinal lymph nodes and left gastric artery lymph nodes revealed the high RI up takes. In the cases injected at lower part of the esophagus, RI up take was highly noted in bifurcation lymph nodes, left gastric artery lymph nodes and celiac axis lymph nodes. In the cases injected at esophago-gastric junction, the high counted RI up take was noted in left gastric artery lymph nodes, celiac axis lymph nodes and the lymph nodes around the left renal vein. 3. In the cases injected at upper, middle parts of the esophagus, bilateral supraclavicular lymph nodes revealed the high RI up take. Some of these lymph nodes are regarded as directly connected with the extra-mural lymph vessls of the esophagus. Therefore, it was suggested that existence of ''direct lymph flow'' from which upper, middle intrathoracic esophagus directly connected to right supraclavicular lymph nodes. 4. It is important to perform bilateral modified neck dissection in case of upper, middle intrathoracic esophageal cancer and is important to dissect the lymph nodes around the left renal vein in case of esophago-gastric cancer and lower intrathoracic esophageal cancer. (J.P.N.)

  11. Rhenium(5) and molybdenum(5) complexes with 4',4[sup (]5[sup )]-divaleryldibenzo-18-crown-6. Kompleksnye soedineniya reniya(5) i molibdena(5) s 4',4[sup (]5[sup )]-divalerildibenzo-18-kraun-6

    Energy Technology Data Exchange (ETDEWEB)

    Ashurova, N Kh; Yakubov, K G; Tashmukhamedova, A K; Basitova, S M [Tadzhikskij Gosudarstvennyj Univ., Dushanbe (Tajikistan)


    Methods for synthesizing oxohalide complexes of rhenium and molybdenum with +5 oxidation degree with 4',4[sup (5)]-divaleryldibenzo-18-crown-6 were developed. Content and composition of prepared compounds were investigated by the methods of element analysis, crystal optics, conductometry, IR spectroscopy in the near and far regions, thermogravimetry. Oxidation degree of the complex-forming metal was determined. It was established that composition of the compounds coressponded to the general formula MOLX [sub [center dot

  12. Rhenium (5) and molybdenum (5) complexes with 4',4''(5'')-ditretbutyldibenzo-24-crown-8. Kompleksnye soedineniya reniya (5) i molibdena (5) s 4',4''(5'')-ditretbutildibenzo-24-kraun-8

    Energy Technology Data Exchange (ETDEWEB)

    Ashurova, N Kh; Yakubov, K G; Basitova, S M; Tashmukhamedova, A K; Sajfullina, N Zh [Tadzhikskij Gosudarstvennyj Univ., Dushanbe (USSR)


    Rhenium and molybdenum complexes in +5 oxidation degree with 4',4''(5'')-ditretbutyldibenzo-24-crown-8 (L) are synthesized with 75-95 % yield. Composition and structure of compounds produced are investigated using element analysis, conductometry, IR spectroscopy, thermogravimetry methods. Oxidation degree of complexer metal is determined. It is ascertained that the compound composition corresponds to the MOLX{sub 3} formula, where M-Re, Mo; X-Cl{sup -}, Br{sup -}.

  13. Fatty acid 16:4(n-3) stimulates a GPR120-induced signaling cascade in splenic macrophages to promote chemotherapy resistance

    DEFF Research Database (Denmark)

    Houthuijzen, Julia M; Oosterom, Ilse; Hudson, Brian D


    Although chemotherapy is designed to eradicate tumor cells, it also has significant effects on normal tissues. The platinum-induced fatty acid 16:4(n-3) (hexadeca-4,7,10,13-tetraenoic acid) induces systemic resistance to a broad range of DNA-damaging chemotherapeutics. We show that 16:4(n-3) exerts....... M., Peeper, D. S., Jafari Sadatmand, S., Roodhart, J. M. L., van de Lest, C. H. A., Ulven, T., Ishihara, K., Milligan, G., Voest, E. E. Fatty acid 16:4(n-3) stimulates a GPR120-induced signaling cascade in splenic macrophages to promote chemotherapy resistance....


    DEFF Research Database (Denmark)

    Rasmussen, Søren; Vægter, Christian Bjerggaard; Cha, J

    In this study we have established methods for visualization and tracking of the dopamine transporter (DAT) in cultured dopaminergic neurons in real time using a fluorescent cocaine analogue JHC 1-64 and confocal fluorescence microscopy. The initial binding experiments in HEK 293 cells stably...... 1-64 was prevented by excess concentrations of dopamine, cocaine, mazindol, or RTI-55, whereas the norepinephrine and/or serotonin transporter specific inhibitors desmethylimipramine and citalopram did not affect fluorescent labeling of the neurons. This strongly supports that JHC 1-64 specifically...

  15. Rhenium-188 - advantages and clinical potential for use of a readily available, cost effective therapeutic radioisotope for applications in nuclear medicine, oncology and interventional cardiology

    International Nuclear Information System (INIS)

    Knapp, F.F. jr.


    Full text: Carrier-free rhenium-188 (Re-188) is readily available from the alumina-based tungsten-188/rhenium-188 generator system and has many attractive properties for a wide variety of therapeutic applications. The 16.9 h half-life, emission of the 2.2 MeV beta particle and versatile chemistry make Re-188 an important candidate for applications where high radiation penetration is required. In addition, emission of a gamma photon (155 KeV, 15 %) permits evaluation of biodistribution, pharmacokinetics and dosimetry estimates. The long physical half-life of the tungsten-188 (W-188) parent (t 1/2 69 days) and consistent generator performance - with high Re-188 yields and low W-188 parent breakthrough - result in an indefinite shelf-life of several months, dependent on the levels of Re-188 required. Post generator elution in-growth of 62 % of Re-188 after 24 hours in combination with high elution yields (75-85 %) result in 50 % daily yields of the maximal Re-188 available. In addition to research being conducted for the development of a wide variety of new therapeutic radiopharmaceuticals and devices, Re-188 is also being evaluated in physician-sponsored clinical trials in over 15 countries, with applications in nuclear medicine, oncology and interventional cardiology. One major current clinical application involves post-angiographic treatment of arterial segments following PTCA using Re-188 perrhenate or MAG3 liquid-filled balloons as an effective and cost-effective approach for inhibition of the hyperplastic response to vessel damage, which delivers uniform dose to the vessel wall. Re-188-HEDP is being used for palliation of metastatic bone pain palliation. This agent is readily prepared from a simple 'kit' and provides pain palliation as effective as other commercially available agents. The use of the Re-188-labeled Anti-NCA-95 antibody (BW 50/183; CD66 a,b,c,e) in conjunction which external beam irradiation and chemotherapy is an effective method for

  16. Active and passive vectorization of technetium{sup 99m} and {sup 188}rhenium radiopharmaceuticals for medical imaging and radiotherapy; Vectorisations active et passive de radiopharmaceutiques du technetium-99m et du rhenium-188 pour l'imagerie medicale et la therapie

    Energy Technology Data Exchange (ETDEWEB)

    Lepareur, N


    Research for new molecules for nuclear medicine is a field in constant development. Over the past few years, development of new radiopharmaceuticals for radiotherapy has renewed interest for rhenium chemistry. Indeed, its two isotopes {sup 186}Re and {sup 188}Re, owing to their ideal properties and their similitude with {sup 99m}Tc, which is widely used as a radiotracer for diagnostic imaging, seem very promising for the preparation of radiopharmaceuticals. In the first part of this manuscript, the synthesis of rhenium and technetium-99 complexes, [M(RPhCS3)2(RPhCS2)] (M = Re, Tc), is described. The preparation of technetium{sup 99m} based radiopharmaceuticals, analogues to the pondered complexes, is also described. The stability/reactivity of these complexes has been studied by exchange reactions with potential ligands, specially dithiocarbamates, and also by UV-visible absorption spectroscopy and thermogravimetry. The reactivity of the complexes towards dithiocarbamates leads to the possibility to bind biomolecules to the metallic core, via the dithiocarbamate moiety. This method represents a potential alternative to current ones using the so-called bifunctional approach. In the second part of this manuscript, a new kit formulation for the {sup 188}Re labeling of lipiodol is described, using a complex analogous to those described in the previous part. The labeled oil is a potential cure for hepatocellular carcinoma. The in vitro and in vivo stability of this {sup 188}Re-SSS lipiodol and of its analogue {sup 99m}Tc-SSS lipiodol has been studied, and also their in vivo behavior in healthy pigs. This study has shown the quasi-exclusive hepatic fixation of the radiopharmaceutical, and has proven its good stability. Its selectivity for tumors remains to be shown before trying it on humans. (author)

  17. Active and passive vectorization of technetium{sup 99m} and {sup 188}rhenium radiopharmaceuticals for medical imaging and radiotherapy; Vectorisations active et passive de radiopharmaceutiques du technetium-99m et du rhenium-188 pour l'imagerie medicale et la therapie

    Energy Technology Data Exchange (ETDEWEB)

    Lepareur, N


    Research for new molecules for nuclear medicine is a field in constant development. Over the past few years, development of new radiopharmaceuticals for radiotherapy has renewed interest for rhenium chemistry. Indeed, its two isotopes {sup 186}Re and {sup 188}Re, owing to their ideal properties and their similitude with {sup 99m}Tc, which is widely used as a radiotracer for diagnostic imaging, seem very promising for the preparation of radiopharmaceuticals. In the first part of this manuscript, the synthesis of rhenium and technetium-99 complexes, [M(RPhCS3)2(RPhCS2)] (M = Re, Tc), is described. The preparation of technetium{sup 99m} based radiopharmaceuticals, analogues to the pondered complexes, is also described. The stability/reactivity of these complexes has been studied by exchange reactions with potential ligands, specially dithiocarbamates, and also by UV-visible absorption spectroscopy and thermogravimetry. The reactivity of the complexes towards dithiocarbamates leads to the possibility to bind biomolecules to the metallic core, via the dithiocarbamate moiety. This method represents a potential alternative to current ones using the so-called bifunctional approach. In the second part of this manuscript, a new kit formulation for the {sup 188}Re labeling of lipiodol is described, using a complex analogous to those described in the previous part. The labeled oil is a potential cure for hepatocellular carcinoma. The in vitro and in vivo stability of this {sup 188}Re-SSS lipiodol and of its analogue {sup 99m}Tc-SSS lipiodol has been studied, and also their in vivo behavior in healthy pigs. This study has shown the quasi-exclusive hepatic fixation of the radiopharmaceutical, and has proven its good stability. Its selectivity for tumors remains to be shown before trying it on humans. (author)

  18. Recoil-distance lifetime measurements of the ground-state band in 164Dy, 170Er, and 174Yb

    International Nuclear Information System (INIS)

    Sie, S.H.; Gebbie, D.W.


    Mean-lives of the 4 + , 6 + and 8 + levels of the ground-state band in 164 Dy, 170 Er and 174 Yb have been measured by the recoil-distance technique following multiple Coulomb excitation with 32 S projectiles of energy 120-140 MeV. The gamma-rays were detected in coincidence with backscattered particles. The results are compared with theoretical predictions of the adiabatic rotor model. The 6 + and 8 + lifetimes in 164 Dy are found to correspond to a slight reduction in B(E2) values over the rotational model prediction, while for for the 4 + state a 12% reduction was observed. In 170 Er and 174 Yb the lifetimes are consistent with rotational model predictions with a slight enhancement of B(E2) values at higher spins. Comparison with other results from Doppler broadened lineshape analysis confirms the need to adjust the electronic stopping powers of Northcliffe and Schilling in the lineshape calculations. (Author)

  19. Determination of rhenium content in molybdenite by ICP-MS after separation of the major matrix by solvent extraction with N-benzoyl-N-phenylhydroxalamine. (United States)

    Li, Jie; Zhong, Li-feng; Tu, Xiang-lin; Liang, Xi-rong; Xu, Ji-feng


    A simple and rapid analytical method for determining the concentration of rhenium in molybdenite for Re-Os dating was developed. The method used isotope dilution-inductively coupled plasma-mass spectrometry (ID-ICP-MS) after the removal of major matrix elements (e.g., Mo, Fe, and W) from Re by solvent extraction with N-benzoyl-N-phenylhydroxylamine (BPHA) in chloroform solution. The effect on extraction efficiency of parameters such as pH (HCl concentration), BPHA concentration, and extraction time were also assessed. Under the optimal experimental conditions, the validity of the separation method was accessed by measuring (187)Re/(185)Re values for a molybdenite reference material (JDC). The obtained values were in good agreement with previously measured values of the Re standard. The proposed method was applied to replicate Re-Os dating of JDC and seven samples of molybdenite from the Yuanzhuding large Cu-Mo porphyry deposit. The results demonstrate good precision and accuracy for the proposed method. The advantages of the method (i.e., simplicity, efficiency, short analysis time, and low cost) make it suitable for routine analysis.

  20. Study of technetium behaviour in radiopharmaceuticals. Characterization of sup(99m)Tc-pyrophosphate, sup(99m)Tc-dimercaptosuccinate, sup(99m)Tc-diethylenetriaminepentaacetate complexes and sup(99m)Tc-colloidal rhenium sulphide

    International Nuclear Information System (INIS)

    Saccavini, J.-C.


    The chemistry of technetium in extremely dilute solution was approached through the study of three complexing agents and a colloid. By the application of high-performance chromatographic techniques to the analysis of (Tc-pyro), (Tc-DTPA), (Tc-DMSA) complexes it was possible to isolate one or more chelates from a single complexing agent. Addition of pertechnetates to a solution of sodium pyrophosphates and stannous chloride at neutral pH leads to the formation of two complexes, both highly osteotropic. By the use of sup(117m)Sn it was shown that tin employed as reducing agent enters into the composition of one of the two complexes, either of which may be obtained preferentially by varying the (Sn)/(pyro) ratio. With technetium at acid pH (2.5) DMSA gives one or more chelates according to the concentration of the reagents present. DTPA with technetium at neutral pH gives a single complex for which a structure is proposed. The addition of calcium, indispensable for DTPA injection, leads to the appearance of a second bimetallic complex in very much smaller proportions than the first. The size distribution of some colloids was studied by ultrafiltration and permeation on gel. The preparation of colloidal rhenium sulphide and the technetium labelling conditions needed to obtain a very fine colloid were developed. The behaviour of technetium in the presence of colloidal rhenium sulphide and tin pyrophosphate was followed by sup(99m)Tc - sup(186)Re and sup(99m)Tc - sup(117m)Sn double-labelling tests. One reduced technetium fraction associates with the hydrolysed tin, the other follows the rhenium sulphide [fr

  1. A Novel Locus Harbouring a Functional CD164 Nonsense Mutation Identified in a Large Danish Family with Nonsyndromic Hearing Impairment

    DEFF Research Database (Denmark)

    Nyegaard, Mette; Rendtorff, Nanna D; Nielsen, Morten S


    Nonsyndromic hearing impairment (NSHI) is a highly heterogeneous condition with more than eighty known causative genes. However, in the clinical setting, a large number of NSHI families have unexplained etiology, suggesting that there are many more genes to be identified. In this study we used SNP......-based linkage analysis and follow up microsatellite markers to identify a novel locus (DFNA66) on chromosome 6q15-21 (LOD 5.1) in a large Danish family with dominantly inherited NSHI. By locus specific capture and next-generation sequencing, we identified a c.574C>T heterozygous nonsense mutation (p.R192......-genome and exome sequence data. The predicted effect of the mutation was a truncation of the last six C-terminal residues of the cytoplasmic tail of CD164, including a highly conserved canonical sorting motif (YXX phi). In whole blood from an affected individual, we found by RT-PCR both the wild...

  2. Determination of the size of the dust torus in H0507+164 through optical and infrared monitoring (United States)

    Mandal, Amit Kumar; Rakshit, Suvendu; Kurian, Kshama S.; Stalin, C. S.; Mathew, Blesson; Hoenig, Sebastian; Gandhi, Poshak; Sagar, Ram; Pandge, M. B.


    The time delay between flux variations in different wavelength bands can be used to probe the inner regions of active galactic nuclei (AGNs). Here, we present the first measurements of the time delay between optical and near-infrared (NIR) flux variations in H0507+164, a nearby Seyfert 1.5 galaxy at z = 0.018. The observations in the optical V-band and NIR J, H, and Ks bands carried over 35 epochs during the period 2016 October to 2017 April were used to estimate the inner radius of the dusty torus. From a careful reduction and analysis of the data using cross-correlation techniques, we found delayed responses of the J, H, and Ks light curves to the V-band light curve. In the rest frame of the source, the lags between optical and NIR bands are found to be 27.1^{+13.5}_{-12.0} d (V versus J), 30.4^{+13.9}_{-12.0} d (V versus H) and 34.6^{+12.1}_{-9.6} d (V versus Ks). The lags between the optical and different NIR bands are thus consistent with each other. The measured lags indicate that the inner edge of dust torus is located at a distance of 0.029 pc from the central ultraviolet/optical AGN continuum. This is larger than the radius of the broad line region of this object determined from spectroscopic monitoring observations thereby supporting the unification model of AGN. The location of H0507+164 in the τ-MV plane indicates that our results are in excellent agreement with the now known lag-luminosity scaling relationship for dust in AGN.

  3. A randomised, phase II study of repeated rhenium-188-HEDP combined with docetaxel and prednisone versus docetaxel and prednisone alone in castration-resistant prostate cancer (CRPC) metastatic to bone; the Taxium II trial

    Energy Technology Data Exchange (ETDEWEB)

    Dodewaard-de Jong, Joyce M. van [VU University Medical Centre, Department of Medical Oncology, Amsterdam (Netherlands); Meander Medical Centre, Department of Medical Oncology, Amersfoort (Netherlands); Klerk, John M.H. de [Meander Medical Centre, Department of Nuclear Medicine, Amersfoort (Netherlands); Bloemendal, Haiko J. [Meander Medical Centre, Department of Medical Oncology, Amersfoort (Netherlands); University Medical Centre Utrecht, Department of Medical Oncology, Utrecht (Netherlands); Oprea-Lager, Daniela E.; Hoekstra, Otto S. [VU University Medical Centre, Department of Radiology and Nuclear Medicine, Amsterdam (Netherlands); Berg, H.P. van den [Tergooi Medical Hospital, Department of Medical Oncology, Hilversum (Netherlands); Los, Maartje [St Antonius Hospital Utrecht, Department of Medical Oncology, Utrecht (Netherlands); Beeker, Aart [Spaarne Gasthuis, Department of Medical Oncology, Hoofddorp (Netherlands); Jonker, Marianne A. [VU University Medical Centre, Department of Epidemiology and Biostatistics, Amsterdam (Netherlands); O' Sullivan, Joe M. [Queen' s University Belfast, Centre for Cancer Research and Cell Biology, Belfast, Northern Ireland (United Kingdom); Verheul, Henk M.W.; Eertwegh, Alfons J.M. van den [VU University Medical Centre, Department of Medical Oncology, Amsterdam (Netherlands)


    Rhenium-188-HEDP is a beta-emitting radiopharmaceutical used for palliation of metastatic bone pain. We investigated whether the addition of rhenium-188-HEDP to docetaxel/prednisone improved efficacy of chemotherapy in patients with CRPC. Patients with progressive CRPC and osteoblastic bone metastases were randomised for first-line docetaxel 75 mg/m{sup 2} 3-weekly plus prednisone with or without 2 injections of rhenium-188-HEDP after the third (40 MBq/kg) and after the sixth (20 MBq/kg) cycle of docetaxel. Primary endpoint was progression-free survival (PFS), defined as either PSA, radiographic or clinical progression. Patients were stratified by extent of bone metastases and hospital. Forty-two patients were randomised for standard treatment and 46 patients for combination therapy. Median number of cycles of docetaxel was 9 in the control group and 8 in the experimental group. Median follow-up was 18.4 months. Two patients from the experimental group did not start treatment after randomisation. In the intention to treat analysis no differences in PFS, survival and PSA became apparent between the two groups. In an exploratory per-protocol analysis median overall survival was significantly longer in the experimental group (33.8 months (95%CI 31.75-35.85)) than in the control group (21.0 months (95%CI 13.61-28.39); p 0.012). Also median PFS in patients with a baseline phosphatase >220U/L was significantly better with combination treatment (9.0 months (95%CI 3.92-14.08) versus 6.2 months (95%CI 3.08-9.32); log rank p 0.005). As expected, thrombocytopenia (grade I/II) was reported more frequently in the experimental group (25% versus 0%). Combined treatment with rhenium-188-HEDP and docetaxel did not prolong PFS in patients with CRPC. The observed survival benefit in the per-protocol analysis warrants further studies in the combined treatment of chemotherapy and radiopharmaceuticals. (orig.)

  4. Crystal structures of a manganese(I and a rhenium(I complex of a bipyridine ligand with a non-coordinating benzoic acid moiety

    Directory of Open Access Journals (Sweden)

    Sheri Lense


    Full Text Available The structures of two facially coordinated Group VII metal complexes are reported, namely: fac-bromido[2-(2,2′-bipyridin-6-ylbenzoic acid-κ2N,N′]tricarbonylmanganese(I tetrahydrofuran monosolvate, [MnBr(C17H12N2O2(CO3]·C4H8O, I, and fac-[2-(2,2′-bipyridin-6-ylbenzoic acid-κ2N,N′]tricarbonylchloridorhenium(I tetrahydrofuran monosolvate, [ReCl(C17H12N2O2(CO3]·C4H8O, II. In both complexes, the metal ion is coordinated by three carbonyl ligands, a halide ion, and a 2-(2,2′-bipyridin-6-ylbenzoic acid ligand, in a distorted octahedral geometry. In manganese complex I, the tetrahydrofuran (THF solvent molecule could not be refined due to disorder. The benzoic acid fragment is also disordered over two positions, such that the carboxylic acid group is either positioned near to the bromide ligand or to the axial carbonyl ligand. In the crystal of I, the complex molecules are linked by a pair of C—H...Br hydrogen bonds, forming inversion dimers that stack up the a-axis direction. In the rhenium complex II, there is hydrogen bonding between the benzoic acid moiety and a disordered co-crystallized THF molecule. In the crystal, the molecules are linked by C—H...Cl hydrogen bonds, forming layers parallel to (100 separated by layers of THF solvent molecules.

  5. The chemistry on a subnanometer scale of radiation-induced precipitation and segregation in fast-neutron irradiated tungsten-rhenium alloys

    International Nuclear Information System (INIS)

    Hershitz, R.; Seidman, D.N.


    The phenomena of radiation-induced precipitation and segregation have been investigated in W-10 at.% Re and W-25 at.% Re alloys, employing the atom-probe field-ion-microscope technique. The specimens had been irradiated to a fast-neutron fluence of approx.4x10 22 neutrons cm -2 (e>0.1 MeV) at 575, 625 and 675 deg C. This corresponds to 8.6 dpa and an average displacement rate, for the two year irradiation time of 1.4x10 -7 dpa s -1 . In the W-10 at.% Re alloy, coherent, semicoherent and possibly incoherent precipitates with the composition approx.WRe and a disc-shaped morphology -- one or two atomic planes thick -- were detected at a number density of approx.10 16 cm -3 , and a mean diameter of approx.57 A. In the W-25 at.% Re alloy the same precipitates with the composition approx.WRe 3 were detected at a number density of approx.10 17 cm -3 and a mean diameter of 40 A. The semicoherent WRe 3 precipitates were associated with 4 He atoms; that is, they may have been heterogeneously nucleated. None of the other precipitates were associated with either line or planar defects or with any impurity atoms. Therefore, a true homogeneous radiation-induced precipitation occurs in these alloys. In the W-25 at.% Re alloy a two dimensional WRe 3 phase has been observed at a grain boundary. The nucleation of both precipitates in the vicinity of displacement cascades might be produced by primary knock-on atoms. In both cases, the first step in the nucleation is due to the formation of tightly-bound mobile mixed dumbbells which react to form an immobile di-rhenium cluster. Point-defect mechanisms for all the other observations are also discussed

  6. Rhenium(V) oxo complexes relevant to technetium renal imaging agents derived from mercaptoacetylglycylglycylaminobenzoic acid isomers. Structural and molecular mechanics studies

    International Nuclear Information System (INIS)

    Hansen, L.; Taylor, A. Jr; Marzilli, L.G.; Cini, R.


    The synthesis and characterization of three rhenium(V) oxo complexes derived from isomers of mercaptoacetylglycylglycylaminobenzoic acid (MAG 2 -ABAH 5 ) are reported. The isomers were synthesized from o-, m- and p-aminobenzoic acid and differed in the position of the terminal carboxyl group. The anions of 8-10, [ReO(MAG 2 -*ABAH)] - (* = para (8), meta (9), ortho (10)), contained the tetraanionic form of the ligands with the carboxyl group protonated. Compounds 8,9, and 10 were synthesized by exchange reactions of ReOCl 3 (Me 2 SO)(Ph 3 P) under moderate conditions and were isolated as [Ph 4 P] + , [Bu 4 N] + , and [Ph 4 P] + salts, respectively. The structures of 8 and 10 were determined by X-ray diffraction methods; except for the location of the carboxyl group, the structures are similar. The coordination geometry is pseudo square pyramidal, with nitrogen and sulfur donor atoms forming a square base and the oxo ligand at the apex. The orientation of the carboxyl group in 10 is anti to the Re double-bond O group. Since the carboxyl groups are protonated in 8 and 10 and in other relevant structures from this class of radiopharmaceuticals including [Ph 4 As][TcO(MAG 3 H)] (MAG 3 H = tetraanionic form of mercaptoacetyltriglycine), the authors developed molecular mechanics parameters that allowed them to calculate the structures of 8, 10, and [TcO(MAG 3 H)] - . They then extended the calculations to all three isomeric complexes in their deprotonated forms and to [TcO(MAG 3 )] 2- in order to approximate their solution phase structures. They conclude that the [TcO(MAG 3 )] 2- species is conformationally flexible, and they have made an initial assessment of structures vs renal clearance

  7. Magnetic interactions in rhenium-containing rare earth double perovskites Sr{sub 2}LnReO{sub 6} (Ln=rare earths)

    Energy Technology Data Exchange (ETDEWEB)

    Nishiyama, Atsuhide; Doi, Yoshihiro; Hinatsu, Yukio, E-mail:


    The perovskite-type compounds containing both rare earth and rhenium Sr{sub 2}LnReO{sub 6} (Ln=Y, Tb-Lu) have been prepared. Powder X-ray diffraction measurements and Rietveld analysis show that Ln{sup 3+} and Re{sup 5+} ions are structurally ordered at the B site of the perovskite SrBO{sub 3}. Magnetic anomalies are found in their magnetic susceptibility and specific heat measurements at 2.6–20 K for Ln=Y, Tb, Dy, Yb, Lu compounds. They are due to magnetic interactions between Re{sup 5+} ions. The results of the magnetic hysteresis and remnant magnetization measurements for Sr{sub 2}YReO{sub 6} and Sr{sub 2}LuReO{sub 6} indicate that the antiferromagnetic interactions between Re{sup 5+} ions below transition temperatures have a weak ferromagnetic component. The analysis of the magnetic specific heat data for Sr{sub 2}YbReO{sub 6} shows that both the Yb{sup 3+} and Re{sup 5+} ions magnetically order at 20 K. For the case of Sr{sub 2}DyReO{sub 6}, magnetic ordering of the Re{sup 5+} moments occurs at 93 K, and with decreasing temperature, the moments of Dy{sup 3+} ferromagnetically order at 5 K from the measurements of magnetic susceptibility and specific heat. - Graphical abstract: Crystal structure of double perovskite Sr{sub 2}LnReO{sub 6}. Red and black lines show cubic and monoclinic unit cells, respectively. - Highlights: • Double perovskites Sr{sub 2}LnReO{sub 6} (Ln=rare earths) were prepared. • They show an antiferromagnetic transition at 2.6–20 K. • In Sr{sub 2}DyReO{sub 6}, Dy and Re moments magnetically order at 5 and 93 K, respectively.

  8. Synthesis and investigation of CrB{sub 4}, MnB{sub 4} and new ternary chromium and rhenium manganese borides; Synthese und Untersuchung von CrB{sub 4}, MnB{sub 4} sowie neuen ternaeren Chrom- und Rheniummanganboriden

    Energy Technology Data Exchange (ETDEWEB)

    Knappschneider, Arno


    In the present work single crystals of the tetraborides of chromium and manganese have been grown and allowed a structure refinement of the compounds. Furthermore the physical characteristics for example hardness, electronic properties and magnetism were been determined. Also the ternary tetraboride phase of chromium and manganese was synthesized and a new ternary rhenium manganese diboride could be obtained.

  9. 40 CFR 164.21 - Contents of a denial of registration, notice of intent to cancel a registration, or notice of... (United States)


    ..., notice of intent to cancel a registration, or notice of intent to change a classification. 164.21 Section... denial of registration, notice of intent to cancel a registration, or notice of intent to change a classification. (a) Contents. The denial of registration or a notice of intent to cancel a registration or to...

  10. A whole-genome scan in 164 Dutch sib pairs with attention-deficit/hyperactivity disorder : Suggestive evidence for linkage on chromosomes 7p and 15q

    NARCIS (Netherlands)

    Bakker, SC; van der Meulen, EM; Buitelaar, JK; Sandkuijl, LA; Pauls, DL; Monsuur, AJ; van't Slot, R; Minderaa, RB; Gunning, WB; Pearson, PL; Sinke, RJ

    A genome scan was performed on 164 Dutch affected sib pairs (ASPs) with attention-deficit/hyperactivity disorder (ADHD). All subjects were white and of Dutch descent and were phenotyped according to criteria set out in the Diagnostic and Statistical Manual Of Mental Disorders, 4th edition.

  11. 164Ile allele in the beta2-Adrenergic receptor gene is associated with risk of elevated blood pressure in women. The Copenhagen City Heart Study

    DEFF Research Database (Denmark)

    Sethi, AA; Tybjærg-Hansen, A; Jensen, Gorm Boje


    Since beta2-adrenergic receptors are important regulators of blood pressure, genetic variation in this receptor could explain risk of elevated blood pressure in selected individuals. We tested the hypothesis that Gly16Arg, Gln27Glu, and Thr164Ile in the beta2-adrenergic receptor gene associated w...

  12. In vivo high angular resolution diffusion-weighted imaging of mouse brain at 16.4 Tesla.

    Directory of Open Access Journals (Sweden)

    Othman I Alomair

    Full Text Available Magnetic Resonance Imaging (MRI of the rodent brain at ultra-high magnetic fields (> 9.4 Tesla offers a higher signal-to-noise ratio that can be exploited to reduce image acquisition time or provide higher spatial resolution. However, significant challenges are presented due to a combination of longer T1 and shorter T2/T2* relaxation times and increased sensitivity to magnetic susceptibility resulting in severe local-field inhomogeneity artefacts from air pockets and bone/brain interfaces. The Stejskal-Tanner spin echo diffusion-weighted imaging (DWI sequence is often used in high-field rodent brain MRI due to its immunity to these artefacts. To accurately determine diffusion-tensor or fibre-orientation distribution, high angular resolution diffusion imaging (HARDI with strong diffusion weighting (b >3000 s/mm2 and at least 30 diffusion-encoding directions are required. However, this results in long image acquisition times unsuitable for live animal imaging. In this study, we describe the optimization of HARDI acquisition parameters at 16.4T using a Stejskal-Tanner sequence with echo-planar imaging (EPI readout. EPI segmentation and partial Fourier encoding acceleration were applied to reduce the echo time (TE, thereby minimizing signal decay and distortion artefacts while maintaining a reasonably short acquisition time. The final HARDI acquisition protocol was achieved with the following parameters: 4 shot EPI, b = 3000 s/mm2, 64 diffusion-encoding directions, 125×150 μm2 in-plane resolution, 0.6 mm slice thickness, and 2h acquisition time. This protocol was used to image a cohort of adult C57BL/6 male mice, whereby the quality of the acquired data was assessed and diffusion tensor imaging (DTI derived parameters were measured. High-quality images with high spatial and angular resolution, low distortion and low variability in DTI-derived parameters were obtained, indicating that EPI-DWI is feasible at 16.4T to study animal models of white


    African Journals Online (AJOL)


    Methods: A review of laboratory records of requests and collected reports of malaria parasite, urine microscopy, culture and sensitivity, ... indicator of quality clinical laboratory services (1,4). .... Monitoring glycaemic control: is there evidence for.

  14. 164 -168_Zhigila

    African Journals Online (AJOL)



    Dec 2, 2014 ... 2Applied Plant Anatomy and Wood Technology Laboratory, Department Of Plant Biology, University Of Ilorin, ... Fresh flowers of five species of Amaranthus were studied and documented in detail using light ... problems related to the origin and evolution of many taxa (Nair, 1980) and provide classification of.

  15. Effort-Reward Imbalance at Work and Incident Coronary Heart Disease: A Multicohort Study of 90,164 Individuals. (United States)

    Dragano, Nico; Siegrist, Johannes; Nyberg, Solja T; Lunau, Thorsten; Fransson, Eleonor I; Alfredsson, Lars; Bjorner, Jakob B; Borritz, Marianne; Burr, Hermann; Erbel, Raimund; Fahlén, Göran; Goldberg, Marcel; Hamer, Mark; Heikkilä, Katriina; Jöckel, Karl-Heinz; Knutsson, Anders; Madsen, Ida E H; Nielsen, Martin L; Nordin, Maria; Oksanen, Tuula; Pejtersen, Jan H; Pentti, Jaana; Rugulies, Reiner; Salo, Paula; Schupp, Jürgen; Singh-Manoux, Archana; Steptoe, Andrew; Theorell, Töres; Vahtera, Jussi; Westerholm, Peter J M; Westerlund, Hugo; Virtanen, Marianna; Zins, Marie; Batty, G David; Kivimäki, Mika


    Epidemiologic evidence for work stress as a risk factor for coronary heart disease is mostly based on a single measure of stressful work known as job strain, a combination of high demands and low job control. We examined whether a complementary stress measure that assesses an imbalance between efforts spent at work and rewards received predicted coronary heart disease. This multicohort study (the "IPD-Work" consortium) was based on harmonized individual-level data from 11 European prospective cohort studies. Stressful work in 90,164 men and women without coronary heart disease at baseline was assessed by validated effort-reward imbalance and job strain questionnaires. We defined incident coronary heart disease as the first nonfatal myocardial infarction or coronary death. Study-specific estimates were pooled by random effects meta-analysis. At baseline, 31.7% of study members reported effort-reward imbalance at work and 15.9% reported job strain. During a mean follow-up of 9.8 years, 1,078 coronary events were recorded. After adjustment for potential confounders, a hazard ratio of 1.16 (95% confidence interval, 1.00-1.35) was observed for effort-reward imbalance compared with no imbalance. The hazard ratio was 1.16 (1.01-1.34) for having either effort-reward imbalance or job strain and 1.41 (1.12-1.76) for having both these stressors compared to having neither effort-reward imbalance nor job strain. Individuals with effort-reward imbalance at work have an increased risk of coronary heart disease, and this appears to be independent of job strain experienced. These findings support expanding focus beyond just job strain in future research on work stress.

  16. The investigation of the decay of the deformed 167Yb, 164Tm, 225Ac, 221Fr nuclei. Beta-spectrograph with positional-sensitive detector

    International Nuclear Information System (INIS)

    Butabaev, Yu.S.


    The decay of the deformed 167 Yb, 164 Tm, 225 Ac, 221 Fr nuclei is investigated in this work. For 167 Yb and 164 Tm decays the specters of the conversion electrons were measured. 32 γ-transitions were found for 167 Yb decay, 6 of which were found for the first time. The multipolarities for 9 γ-transitions were found. For 164 Tm decay 23 new γ-transitions were found. The theoretical investigations of the collective states in the nucleus were carried out. Octupole-rotatory line with k=1 - was found in the measurement of conversion electrons specters of the short-life nuclei. Device' nonlinearity was 0,04%. Resolution was Δβρ/βρ 0,11%. Effective light yield was 1-2 %. The decay of 225 Ac and 221 Fr nuclei were investigated. The investigations of α-γ -coincidence, α-γ - rays were carried out. 24 new γ -transitions for 225 Ac and 13 ones for 221 Fr were found. The new levels and their intensities were defined more precisely. Intensity balance calculations were carried out and the full populations of the nuclear levels were calculated. (author). 3 tabs.; 10 figs

  17. Synthesis and characterization of organohydrazino complexes of technetium, rhenium, and molybdenum with the [M(η1-HxNNR)(η2-HyNNR)] core and their relationship to radiolabeled organohydrazine-derivatives chemotactic peptides with diagnostic applications

    International Nuclear Information System (INIS)

    Rose, D.J.; Maresca, K.P.; Nicholson, T.


    In this paper, the authors present the details of the preparation of the imaging agent and its imaging properties. In order to define some structural possibilities for the coordination chemistry relevant to these reagents, they also present the results of investigations of the syntheses and structures of Tc, Mo, and Re complexes with hydrazinopyridine, which not only establish the formation of the robust unit, but also implicate chelate formation through the pyridine nitrogen as a significant structural determinant. The structures of the parent (bis)hydrazino-trichlorometalate core compounds are presented, allowing analysis of structural changes that occur when (2) protonation sites on the ligand change, (2) a different metal is employed, and (3) a different chelating hydrazine is utilized. The structures of the thiolate substitution products of these parent compounds are also presented. These derivatives demonstrate that rhenium and technetium have analogous substitution chemistry

  18. Electronic structures and properties of the rhenium alkoxy derivatives Re2O3(OMe)6, Re4O6(OMe)12, and ReMoO2(OMe)7

    International Nuclear Information System (INIS)

    Ermakov, A.I.; Belousov, V.V.; Drobot, D.V.; Shcheglov, P.A.


    The geometrical structures, charge distributions, dipole moments, frequencies of normal vibrations, NMR spectra, and total energies of the chemical bonds for the rhenium alkoxy derivatives Re 2 O 3 (OMe) 6 , Re 4 O 6 (OMe) 12 , and ReMoO 2 (OMe) 7 were calculated by the DFT-B3LYP and Hartree-Fock ab initio methods based on the effective core potential theory (LANL2DZ approximation) and the semiempirical PM3(tm) method. Two optimized structures of Re 2 O 3 (OMe) 6 with close energies were found to substantially differ in geometry, 1 H, 13 C, and 17 O NMR spectra, and dipole moment. Various characteristics of the electronic structures and the trans-effect of the ligands in the compounds under consideration were discussed [ru

  19. Pyrazole complexes of rhenium. Synthesis and crystal structure of trans-[Re(O)(OMe)L4]Br2 · L · 4H2O (L - 3,5-dimethylpyrazole)

    International Nuclear Information System (INIS)

    Sokolov, M.N.; Fedorova, N.Eh.; Fedorov, V.E.; Virovets, A.V.; Nun'es, P.


    The first rhenium (V) mononuclear complex featuring composition [Re(O)(OMe)L 4 ]Br 2 (L = 3,5-dimethylpyrazole), which is resistant to hydrolysis in neutral aqueous solution, along with its molecular adduct of the composition [Re(O)(OMe)L 4 ]Br 2 · L · 4H 2 O were synthesized. The reaction products were characterized by the methods of elementary analysis, absorption spectroscopy in visible, UV and IR ranges, mass spectrometry. Besides, the adduct structure was studied by the method of X-ray diffraction analysis. It was ascertained that the adduct is crystallized in tetragonal crystal system with unit cell parameters as follows: a = 14.912 (3), c = 17.108 (4) A, sp. gr. I4/m, Z = 4. In the complex molecule linear grouping Re(O)(OMe)] 2+ (Re-O-C angle being equal to 180 deg) is coordinated by four L ligand molecules [ru

  20. Efficacy of CT-guided biopsies of the spine in patients with spondylitis – an analysis of 164 procedures

    International Nuclear Information System (INIS)

    Heyer, Christoph M.; Brus, Lisa-Johanna; Peters, Soeren A.; Lemburg, Stefan P.


    Objective: To evaluate efficacy of CT-guided spinal biopsy (CTSB) in patients with spondylitis considering patient characteristics, technical issues, antibiotic therapy, histopathological, and microbiological findings. Materials and methods: All CTSB procedures performed between 1995 and 2009 in patients with proven spondylitis were re-evaluated. Patient sex and age, antibiotic treatment, biopsy approach, number of specimens, length of needle path, laboratory results (CRP, WBC), and histopathological/microbiological findings were documented and compared to the final diagnosis of spondylitis. Statistical analysis was performed using Chi-square test and Student's t-test. The p-value was set to 5%. Results: 164 CTSB procedures were performed in 159 patients (mean age 65 years, 60% men) in which spondylitis was histopathologically verified in 95%. Neither patient sex nor age, positioning, localization of the spinal lesion, bioptic approach, number of specimens, or depth of the needle showed significant impact on the rate of positive histopathological findings. A causative germ was identified in 40/127 biopsies (32%) with Staphylococcus aureus being identified in 50%. Tuberculous spondylitis was diagnosed in ten cases (6%). CRP significantly correlated with bacterial growth (13.3 ± 12.2 mg/dl versus 8.8 ± 7.6 mg/dl; p = .015) whereas administration of antibiotics did not show any significant impact on bacterial growth (29% versus 36% in patients without antibiotics; p = 0.428). Patients with histopathological signs of active spondylitis showed a significantly higher CRP (16.5 ± 15.8 mg/dl versus 8.9 ± 8.0 mg/dl, p < .001). Complication rate was 0.6% (one focal bleeding). Conclusion: CTSB of the spine in suspected spondylitis is an effective and safe procedure for establishing final histopathological diagnosis. However, microbiological yield is low regardless of technical issues and antibiotic therapy. Other than CRP values, laboratory investigations added little

  1. Design criteria for rhenium-reduced nickel-based single-crystal alloys. Identification and computer-assisted conversion; Designkriterien fuer rheniumreduzierte Nickelbasis-Einkristalllegierungen. Identifikation und rechnergestuetzte Umsetzung

    Energy Technology Data Exchange (ETDEWEB)

    Goehler, Thomas


    In the present work, design criteria and property models for the creep strength optimization of rhenium-free nickel based single crystal Superalloys are investigated. The study focuses on a typical load condition of 1050 C and 150 MPa, which is representative for flight engine applications. Thereby the key aspect is to link chemical composition, manufacturing processes, microstructure formation and mechanistic understanding of dislocation creep through a computational materials engineering approach. Beside the positive effect of rhenium on solid solution hardening, a second mechanism in which rhenium increases high temperature creep strength is identified. It indirectly stabilizes precipitation hardening by reducing the coarsening kinetics of γ'-rafting. Five 1st and 2nd generation technical Superalloys show a comparable microstructure evolution for up to 2 % plastic elongation, while creep times differ by a factor of five. The application of a microstructure sensitive creep model shows that these coarsening processes can activate γ-cutting and thus lead to an increasing creep rate. Based on these calculations a threshold value of φ{sub γ/γ'} > 2,5 at 150 MPa is estimated. This ratio of matrix channel to raft thickness has been proofed for multiple positions by microstructure analysis of interrupted creep tests. The mechanism described previously can be decelerated by the enrichment of the γ-matrix with slow diffusing elements. The same principle also increases the solid solution strength of the γ-matrix. Therefore, the present work delivers an additional mechanistic explanation why creep properties of single phase nickel based alloys can be transferred to two phase technical Superalloys with rafted γ'-structure. Following, the best way to substitute both rhenium fundamental properties, namely a slow diffusion coefficient and a small solubility in g', has been investigated by means of CALPHAD-modeling. Only molybdenum and especially

  2. Recovery from heat, salt and osmotic stress in Physcomitrella patens requires a functional small heat shock protein PpHsp16.4. (United States)

    Ruibal, Cecilia; Castro, Alexandra; Carballo, Valentina; Szabados, László; Vidal, Sabina


    Plant small heat shock proteins (sHsps) accumulate in response to various environmental stresses, including heat, drought, salt and oxidative stress. Numerous studies suggest a role for these proteins in stress tolerance by preventing stress-induced protein aggregation as well as by facilitating protein refolding by other chaperones. However, in vivo evidence for the involvement of sHsps in tolerance to different stress factors is still missing, mainly due to the lack of appropriate mutants in specific sHsp genes. In this study we characterized the function of a sHsp in abiotic stress tolerance in the moss Physcomitrella patens, a model for primitive land plants. Using suppression subtractive hybridization, we isolated an abscisic acid-upregulated gene from P. patens encoding a 16.4 kDa cytosolic class II sHsp. PpHsp16.4 was also induced by salicylic acid, dithiothreitol (DTT) and by exposure to various stimuli, including osmotic and salt stress, but not by oxidative stress-inducing compounds. Expression of the gene was maintained upon stress relief, suggesting a role for this protein in the recovery stage. PpHsp16.4 is encoded by two identical genes arranged in tandem in the genome. Targeted disruption of both genes resulted in the inability of plants to recover from heat, salt and osmotic stress. In vivo localization studies revealed that PpHsp16.4 localized in cytosolic granules in the vicinity of chloroplasts under non stress conditions, suggesting possible distinct roles for this protein under stress and optimal growth. We identified a member of the class II sHsp family that showed hormonal and abiotic stress gene regulation. Induction of the gene by DTT treatment suggests that damaged proteins may act as signals for the stress-induction of PpHsp16.4. The product of this gene was shown to localize in cytosolic granules near the chloroplasts, suggesting a role for the protein in association with these organelles. Our study provides the first direct genetic


    Directory of Open Access Journals (Sweden)

    Sergiu BRÎNZA


    Full Text Available Analiza efectuată în cadrul acestui articol are ca obiect caracteristicile juridico-penale ale infracţiunilor specificate la art.164 şi 166 CP RM. Se argumentează că, în cazul infracţiunii specificate la art.164 CP RM, constrângerea fizică se poate concretiza în: 1 vătămarea intenţionată gravă, medie sau uşoară a integrităţii corporale ori a sănătăţii; 2 violenţa care nu implică un prejudiciu cauzat sănătăţii. În continuare, se arată că oricare din tipurile de arme menţionate în Legea privind regimul armelor şi al muniţiilor cu destinaţie civilă pot fi aplicate ca mijloace de săvârşire a infracţiunii prevă-zute la lit.g alin.(2 art.164 CP RM. Or, legiuitorul nu a stabilit nicio limitare a tipurilor de arme ce pot fi aplicate la răpirea unei persoane. Contează doar ca armele să fie utilizabile în vederea anihilării unei persoane. Nu în ultimul rând, în legătură cu infracţiunile prevăzute la art.166 CP RM, se relevă că, în condiţiile Republicii Moldova, care se confruntă cu fenomenul separatismului, restrângerea libertăţii persoanei are un caracter ilegal şi atunci când este exercitată de autorităţile neconstituţionale care controlează partea de est a ţării.THE OFFENCES REFERRED TO AT ART.164. AND 166 PC RM: THEORETICAL AND PRACTICAL ASPECTS The analysis performed in this article covers the legal-penal characteristics of the offences specified in art.164 and 166 PC RM. It is argued that, with regard to the offence specified in art.164 PC RM, the physical constraint may result in: 1 intentional grave, ordinary or easy battery or health harm; 2 violence without any health harm. Further, it is shown that any of the types of weapons mentioned in Law on weapons and ammunition destined for civil usage can be applied as means of committing the offence referred to at lett.g par.(2 art.164 PC RM. Or, the legislature did not set any limitation on the types of weapons that can be

  4. Numerical simulation on vacuum solution heat treatment and gas quenching process of a low rhenium-containing Ni-based single crystal turbine blade

    Directory of Open Access Journals (Sweden)

    Zhe-xin Xu


    Full Text Available Numerical heat-transfer and turbulent flow model for an industrial high-pressure gas quenching vacuum furnace was established to simulate the heating, holding and gas fan quenching of a low rhenium-bearing Ni-based single crystal turbine blade. The mesh of simplified furnace model was built using finite volume method and the boundary conditions were set up according to the practical process. Simulation results show that the turbine blade geometry and the mutual shielding among blades have significant influence on the uniformity of the temperature distribution. The temperature distribution at sharp corner, thin wall and corner part is higher than that at thick wall part of blade during heating, and the isotherms show a toroidal line to the center of thick wall. The temperature of sheltered units is lower than that of the remaining part of blade. When there is no shelteration among multiple blades, the temperature distribution for all blades is almost identical. The fluid velocity field, temperature field and cooling curves of the single and multiple turbine blades during gas fan quenching were also simulated. Modeling results indicate that the loading tray, free outlet and the location of turbine blades have important influences on the flow field. The high-speed gas flows out from the nozzle is divided by loading tray, and the free outlet enhanced the two vortex flow at the end of the furnace door. The closer the blade is to the exhaust outlet and the nozzle, the greater the flow velocity is and the more adequate the flow is. The blade geometry has an effect on the cooling for single blade and multiple blades during gas fan quenching, and the effects in double layers differs from that in single layer. For single blade, the cooing rate at thin-walled part is lower than that at thick-walled part, the cooling rate at sharp corner is greater than that at tenon and blade platform, and the temperature at regions close to the internal position is

  5. Beta decay and rhenium cosmochronology

    International Nuclear Information System (INIS)

    Ashktorab, K.


    Among the problems which limit the use of the 187 Re/ 187 Os isobaric pair as a cosmochronometer for the age of the galaxy and the universe are the uncertainties in the partial half-lives of the continuum and bound state decays of 187 Re. While the total half-life of the decay is well established, the partial half-life for the continuum decay is uncertain, and several measurements are not compatible. A high temperature quartz proportional counter was used in this work to remeasure the continuum β - decay of 187 Re. The β endpoint energy for the decay of neutral 187 Re to singly ionized 187 Os of 2.75 ± 0.06 keV agrees with the earlier results. The corresponding half-life of (45 ± 3) x 10 9 years improves and agrees with the earlier measurement of Payne and Drever and refutes other measurements. Based on the new half-life for the continuum decay and a total half-life of (43.5 ± 1.3) x 10 9 years reported by Linder et al., the branching ratio for the bound state decay into discrete atomic states is estimated to be (3 ± 6)% in agreement with the most recent calculated theoretical branching ratio of approximately 1%. Anomalies in beta spectra reported by J.J. Simpson and others have been attributed to a 17 keV heavy-neutrino admixture. If confirmed, the implications from the existence of such a neutrino for particle and astrophysics would be significant. A multiwire open-quotes wall-lessclose quotes stainless steel proportional counter has been used in the present work to investigate the spectral shape of the β decay of 63 Ni. No anomalies in the spectral shape were observed which could be attributed to the presence of 17 keV heavy neutrino

  6. Phenomenological descriptions of the Yrast bands in sup(160,162,164,166)Yb nuclei band crossings and moments of inertia

    International Nuclear Information System (INIS)

    El Zaiki, M.I.; Nafie, H.O.; Abd El Mageed, K.E.


    Two methods of calculations have been used to fit the previously presented data on rotationally aligned quasiparticle bands in sup(160,162,164,166)Yb. Backbendings of moment of inertia of the Yrast states can be reproduced reasonably well. The energy levels and the effective moment of inertia for both gs and s-band are calculated and compared with the experimental data. Band crossing interpretations are discussed for each nucleus. The interaction strength calculations are presented. (author). 17 refs., 7 figs., 4 tabs

  7. Surface structure determination of group 11 metals adsorbed on a rhenium(10 anti 10) surface by low-energy electron diffraction

    Energy Technology Data Exchange (ETDEWEB)

    Messahel, Lyria


    This thesis deals with the computational surface determination of various long-range ordered phases formed by thin films of copper, silver, and gold adsorbed on the rhenium- (10 anti 10) surface. It is based upon LEED-I,V curves for these phases that were recorded in the course of detailed experimental investigations of the respective films carried out in our group (using techniques such as LEED, MEED, and TPD). In order to solve the intricate puzzle of surface structural analysis, the electron elastic scattering behaviour of the investigated coinage metal phases was calculated using the Erlangen TensErLEED program package. Thereby first a set of theoretical LEED-I,V curves is derived for a guessed reference structure. Subsequently its structural input parameters are varied in a trial-and-error procedure until optimal agreement between experiment and theory is attained. The (1 x 1) phases formed by the deposited metals were tackled first to establish an absolute coverage calibration and to elucidate the respective growth modes on the Re(10 anti 10) surface. In all three cases the (1 x 1) structure is developed best at a coverage {Theta}{sub Cu,Ag,Au}=2 ML=1 BL. Extension of the investigation to experimental I,V curves for higher Cu coverages revealed that this element continues to grow bilayerwise, thereby retaining the Re hcp morphology. Ag, in contrast to Cu and Au, happens not to grow as homogeneously, and the TPD data suggest that Ag films exhibit the so-called simultaneous-multilayer (SM) growth mode. The following analysis of the sub-bilayer coverage range shows that the three systems exhibit considerable differences. While Cu, having a negative lattice misfit compared to Re, shows no long-range ordered superstructures, Ag and Au with a similar positive misfit form a couple of such phases. Ag features both a (1 x 4) phase, stable at ambient temperatures, that upon heating transforms into a c(2 x 2) phase that only exists at elevated temperatures. The

  8. Surface structure determination of group 11 metals adsorbed on a rhenium(10 anti 10) surface by low-energy electron diffraction

    International Nuclear Information System (INIS)

    Messahel, Lyria


    This thesis deals with the computational surface determination of various long-range ordered phases formed by thin films of copper, silver, and gold adsorbed on the rhenium- (10 anti 10) surface. It is based upon LEED-I,V curves for these phases that were recorded in the course of detailed experimental investigations of the respective films carried out in our group (using techniques such as LEED, MEED, and TPD). In order to solve the intricate puzzle of surface structural analysis, the electron elastic scattering behaviour of the investigated coinage metal phases was calculated using the Erlangen TensErLEED program package. Thereby first a set of theoretical LEED-I,V curves is derived for a guessed reference structure. Subsequently its structural input parameters are varied in a trial-and-error procedure until optimal agreement between experiment and theory is attained. The (1 x 1) phases formed by the deposited metals were tackled first to establish an absolute coverage calibration and to elucidate the respective growth modes on the Re(10 anti 10) surface. In all three cases the (1 x 1) structure is developed best at a coverage Θ Cu,Ag,Au =2 ML=1 BL. Extension of the investigation to experimental I,V curves for higher Cu coverages revealed that this element continues to grow bilayerwise, thereby retaining the Re hcp morphology. Ag, in contrast to Cu and Au, happens not to grow as homogeneously, and the TPD data suggest that Ag films exhibit the so-called simultaneous-multilayer (SM) growth mode. The following analysis of the sub-bilayer coverage range shows that the three systems exhibit considerable differences. While Cu, having a negative lattice misfit compared to Re, shows no long-range ordered superstructures, Ag and Au with a similar positive misfit form a couple of such phases. Ag features both a (1 x 4) phase, stable at ambient temperatures, that upon heating transforms into a c(2 x 2) phase that only exists at elevated temperatures. The structure

  9. 16.4 W laser output at 1.34 μm with twin Nd:YVO4 crystals and double-end-pumping structure

    International Nuclear Information System (INIS)

    Lu, C; Gong, M; Liu, Q; Huang, L; He, F


    High-power high-beam-quality 1.34 μm continuous-wave laser with twin Nd:YVO 4 crystals pumped by four fiber-coupled laser diodes, which constructed a double-end-pumping structure, is reported. With total 60 W pumping power incident, the highest 16.4 W output laser power was generated, the slope efficiency and optical efficiency were measured as better than 30.0% and 27.3%, respectively. With 12 W laser output, the beam quality was measured to be better than two times diffraction-limit and the instability of laser output was determined to be better than 1% over an hour time

  10. Normalization of Hepatic Homeostasis in the Npc1nmf164 Mouse Model of Niemann-Pick Type C Disease Treated with the Histone Deacetylase Inhibitor Vorinostat. (United States)

    Munkacsi, Andrew B; Hammond, Natalie; Schneider, Remy T; Senanayake, Dinindu S; Higaki, Katsumi; Lagutin, Kirill; Bloor, Stephen J; Ory, Daniel S; Maue, Robert A; Chen, Fannie W; Hernandez-Ono, Antonio; Dahlson, Nicole; Repa, Joyce J; Ginsberg, Henry N; Ioannou, Yiannis A; Sturley, Stephen L


    Niemann-Pick type C (NP-C) disease is a fatal genetic lipidosis for which there is no Food and Drug Administration (FDA)-approved therapy. Vorinostat, an FDA-approved inhibitor of histone deacetylases, ameliorates lysosomal lipid accumulation in cultured NP-C patient fibroblasts. To assess the therapeutic potential of histone deacetylase inhibition, we pursued these in vitro observations in two murine models of NP-C disease. Npc1 nmf164 mice, which express a missense mutation in the Npc1 gene, were treated intraperitoneally, from weaning, with the maximum tolerated dose of vorinostat (150 mg/kg, 5 days/week). Disease progression was measured via gene expression, liver function and pathology, serum and tissue lipid levels, body weight, and life span. Transcriptome analyses of treated livers indicated multiple changes consistent with reversal of liver dysfunction that typifies NP-C disease. Significant improvements in liver pathology and function were achieved by this treatment regimen; however, NPC1 protein maturation and levels, disease progression, weight loss, and animal morbidity were not detectably altered. Vorinostat concentrations were >200 μm in the plasma compartment of treated animals but were almost 100-fold lower in brain tissue. Apolipoprotein B metabolism and the expression of key components of lipid homeostasis in primary hepatocytes from null ( Npc1 -/- ) and missense ( Npc1 nmf164 ) mutant mice were altered by vorinostat treatment, consistent with a response by these cells independent of the status of the Npc1 locus. These results suggest that HDAC inhibitors have utility to treat visceral NP-C disease. However, it is clear that improved blood-brain barrier penetration will be required to alleviate the neurological symptoms of human NP-C disease. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  11. Normalization of Hepatic Homeostasis in the Npc1nmf164 Mouse Model of Niemann-Pick Type C Disease Treated with the Histone Deacetylase Inhibitor Vorinostat* (United States)

    Munkacsi, Andrew B.; Hammond, Natalie; Schneider, Remy T.; Senanayake, Dinindu S.; Higaki, Katsumi; Lagutin, Kirill; Bloor, Stephen J.; Ory, Daniel S.; Maue, Robert A.; Chen, Fannie W.; Hernandez-Ono, Antonio; Dahlson, Nicole; Repa, Joyce J.; Ginsberg, Henry N.; Ioannou, Yiannis A.; Sturley, Stephen L.


    Niemann-Pick type C (NP-C) disease is a fatal genetic lipidosis for which there is no Food and Drug Administration (FDA)-approved therapy. Vorinostat, an FDA-approved inhibitor of histone deacetylases, ameliorates lysosomal lipid accumulation in cultured NP-C patient fibroblasts. To assess the therapeutic potential of histone deacetylase inhibition, we pursued these in vitro observations in two murine models of NP-C disease. Npc1nmf164 mice, which express a missense mutation in the Npc1 gene, were treated intraperitoneally, from weaning, with the maximum tolerated dose of vorinostat (150 mg/kg, 5 days/week). Disease progression was measured via gene expression, liver function and pathology, serum and tissue lipid levels, body weight, and life span. Transcriptome analyses of treated livers indicated multiple changes consistent with reversal of liver dysfunction that typifies NP-C disease. Significant improvements in liver pathology and function were achieved by this treatment regimen; however, NPC1 protein maturation and levels, disease progression, weight loss, and animal morbidity were not detectably altered. Vorinostat concentrations were >200 μm in the plasma compartment of treated animals but were almost 100-fold lower in brain tissue. Apolipoprotein B metabolism and the expression of key components of lipid homeostasis in primary hepatocytes from null (Npc1−/−) and missense (Npc1nmf164) mutant mice were altered by vorinostat treatment, consistent with a response by these cells independent of the status of the Npc1 locus. These results suggest that HDAC inhibitors have utility to treat visceral NP-C disease. However, it is clear that improved blood-brain barrier penetration will be required to alleviate the neurological symptoms of human NP-C disease. PMID:28031458

  12. Six-year clinical follow-up after treatment of diffuse in-stent restenosis with cutting balloon angioplasty followed by intracoronary brachytherapy with liquid rhenium-188-filled balloon via transradial approach

    International Nuclear Information System (INIS)

    Hang Chiling; Wu Chiungjen; Hsieh Bortsung


    Long-term follow-up studies revealed a significant decline in the benefits of intracoronary radiation for in-stent restenosis. A total of 25 study and 25 contemporaneous control patients with diffuse in-stent restenosis who underwent cutting balloon angioplasty (CBA) transradially, followed by subsequent intracoronary irradiation with a liquid β-emitter Rhenium-188 ( 188 Re)-filled balloon were enrolled in the study. The mean clinical follow-up durations were 64.9±13.0 and 66.3±13.8 months for the irradiated and control patients, respectively. Six-month angiographic restenosis was observed in 16% (4 of 25) of the patients in the irradiated group and 48% (12 of 25) of the patients in the control groups (P=0.03). The 6-month major adverse cardiac events (MACE) rate was 12% and 44%, respectively (P=0.025). The 3-year follow-up angiography was performed in 16 of 21 (76%) irradiated patients and in 4 of 13 (31%) control patients who had no significant restenosis at the 6-month angiographic follow-up. Restenosis occurred in 1 of 16 (7%) irradiated patients and 2 of 4 (50%) control patients. Late target lesion revascularization was performed in 1 irradiated and 2 control patients. The MACE rate within 6 years was significantly reduced in the irradiated group (20% vs. 56%, P=0.019). Brachytherapy using 188 Re-filled balloon following CBA for diffuse in-stent restenotic native coronary arteries is effective in reducing target lesion restenosis and improving long-term outcomes. (author)

  13. Radio and γ -Ray Variability in the BL Lac PKS 0219−164: Detection of Quasi-periodic Oscillations in the Radio Light Curve

    Energy Technology Data Exchange (ETDEWEB)

    Bhatta, Gopal, E-mail: [Astronomical Observatory of the Jagiellonian University, ul. Orla 171, 30-244 Kraków (Poland); Mt. Suhora Observatory, Pedagogical University, ul. Podchorazych 2, 30-084 Kraków (Poland)


    In this work, we explore the long-term variability properties of the blazar PKS 0219−164 in the radio and the γ -ray regime, utilizing the OVRO 15 GHz and the Fermi /LAT observations from the period 2008–2017. We found that γ -ray emission is more variable than the radio emission implying that γ -ray emission possibly originated in more compact regions while the radio emission represented continuum emission from the large-scale jets. Also, in the γ -ray, the source exhibited spectral variability, characterized by the softer-when-brighter trend, a less frequently observed feature in the high-energy emission by BL Lacs. In radio, using Lomb–Scargle periodogram and weighted wavelet z -transform, we detected a strong signal of quasi-periodic oscillation (QPO) with a periodicity of 270 ± 26 days with possible harmonics of 550 ± 42 and 1150 ± 157 day periods. At a time when detections of QPOs in blazars are still under debate, the observed QPO with high statistical significance (∼97%–99% global significance over underlying red-noise processes) and persistent over nearly 10 oscillations could make one of the strongest cases for the detection of QPOs in blazar light curves. We discuss various blazar models that might lead to the γ -ray and radio variability, QPO, and the achromatic behavior seen in the high-energy emission from the source.

  14. Support for smoke-free cars when children are present: a secondary analysis of 164,819 U.S. adults in 2010/2011. (United States)

    Agaku, Israel T; Odukoya, Oluwakemi O; Olufajo, Olubode; Filippidis, Filippos T; Vardavas, Constantine I


    Comprehensive smoke-free legislations prohibiting smoking in indoor areas of workplaces, bars, and restaurants have been adopted in most of the USA; however, limited efforts have focused on regulating secondhand smoke (SHS) exposure in the family car. The objective of this study was to identify the determinants and national/state-specific population support for smoke-free cars, in the presence of any occupant in general, but particularly when children are present. National data of US adults aged ≥18 years (n = 164,819) were obtained from the 2010/2011 Tobacco Use Supplement of the Current Population Survey. Among all US adults, a significantly greater proportion supported smoke-free cars when it was specified that the occupant was a child compared to when not specified (93.4 vs. 73.7 %, p race/ethnicity, gender, current tobacco use, marital status, and the existence of household smoke-free regulations all mediated population support for smoke-free cars. While differences within the US population were noted, this study however showed overwhelming support for smoke-free car policies, particularly when children are present. Policies which prohibit smoking in indoor or confined areas such as cars may benefit public health by protecting nonsmoking children and adults from involuntary SHS exposure.

  15. Lipopolysaccharide (LPS) stimulates fresh human monocytes to lyse actinomycin D-treated WEHI-164 target cells via increased secretion of a monokine similar to tumor necrosis factor

    International Nuclear Information System (INIS)

    Chen, A.R.; McKinnon, K.P.; Koren, H.S.


    The effects of lipopolysaccharide (LPS) on tumoricidal activity of human monocytes freshly isolated from peripheral blood were studied. Actinomycin D-treated WEHI-164 cells were used as targets because they are NK insensitive and are lysed rapidly by monocytes in 6-hr 51 Cr-release assays. Monocytes exhibited significant spontaneous activity without endotoxin. Monocytes either pretreated for 1 hr with LPS or assayed in the presence of LPS exhibited 100- to 1000-fold increased cytolytic activity. Cytolytic activity was heat labile and trypsin sensitive, and was recovered from Sepharose S-200 columns in a single peak with an apparent m.w. between 25,000 and 40,000. Actinomycin D or cycloheximide treatment of monocytes before the addition of LPS inhibited cytolytic monokine production. Cytolytic monokine activity was practically neutralized by specific rabbit antisera to human tumor necrosis factor (TNF). It was concluded that, although fresh human monocytes exhibit spontaneous tumoricidal activity, LPS is a potent activating agent. Its stimulatory effects depend on new transcription and translation and are mediated by enhanced secretion of a cytolytic monokine similar to TNF

  16. Elastic and inelastic scattering of π+ and π- from 12C and 14C measured at T/sub π/ = 164 MeV

    International Nuclear Information System (INIS)

    Harvey, C.J.


    Detailed angular distributions of the differential cross sections for π/sup +/-/ scattering from 12 C and 14 C have been measured from theta/sub LAB/ = 20 0 to 91 0 at T/sub π/ = 164 MeV. The elastic and inelastic cross sections were determined in an experiment performed at the Los Alamos Meson Physics Facility (LAMPF). These are the first 14 C pion cross sections to be measured near the Δ 33 resonance. Many new states have been identified in the 14 C excitation energy spectrum and their spin and parities assigned through the pion data. Three of the states discovered from a trio with the same 4 - stretched-state configuration. Optical model predictions have been made for the 14 C elastic cross sections with both a coordinate-space and momentum-space interpretation. Pauli blocking, NN correlations, and binding effects have been included in the parameter-free momentum-space calculation. The coordinate-space model, on the other hand, used parameters taken from a global fit to other nuclei at the same energy. Optical calculations were also performed for the 12 C data obtained. However, significant differences were observed between the LAMPF-determined 12 C cross sections at this energy (of which a data set in agreement with the cross sections reported here already existed) and corresponding measurements made at the Swiss Institute for Nuclear Research; differences that increased nearly linearly with scattering angle. Discrepancies as large as those found (up to 50%) make it impossible to distinguish between various formulations of the π-nucleus interaction with such data

  17. On the Location of the gamma-Ray Outburst Emission in the BL Lacertae Object AO 0235 + 164 Through Observations Across the Electromagnetic Spectrum (United States)

    Agudo, Ivan; Marscher, Alan P.; Jorstad, Svetlana G.; Larionov, Valeri M.; Gomez, Jose L.; Laehteenmaeki, Anne; Smith, Paul S.; Nilsson, Kari; Readhead, Anthony C. S.; Aller, Margo F.; hide


    We present observations of a major outburst at centimeter, millimeter, optical, X-ray, and gamma-ray wavelengths of the BL Lacertae object AO 0235+164. We analyze the timing of multi-waveband variations in the flux and linear polarization, as well as changes in Very Long Baseline Array images at A = 7 mm with approx.0.15 milliarcsec resolution. The association of the events at different wavebands is confirmed at high statistical significance by probability arguments and Monte Carlo simulations. A series of sharp peaks in optical linear polarization, as well as a pronounced maximum in the 7 mm polarization of a superluminal jet knot, indicate rapid fluctuations in the degree of ordering of the magnetic field. These results lead us to conclude that the outburst occurred in the jet both in the quasi-stationary "core" and in the superluminal knot, both parsecs downstream of the supermassive black hole. We interpret the outburst as a consequence of the propagation of a disturbance, elongated along the line of sight by light-travel time delays, that passes through a standing recollimation shock in the core and propagates down the jet to create the superluminal knot. The multi-wavelength light curves vary together on long timescales (months/ years), but the correspondence is poorer on shorter timescales. This, as well as the variability of the polarization and the dual location of the outburst, agrees with the expectations of a multi-zone emission model in which turbulence plays a major role in modulating the synchrotron and inverse Compton fluxes.


    Energy Technology Data Exchange (ETDEWEB)

    Shinn, Jong-Ho; Lee, Jae-Joon; Chun, Moo-Young; Lyo, A.-Ran; Moon, Dae-Sik; Kyeong, Jaemann; Park, Byeong-Gon [Korea Astronomy and Space Science Institute, 776 Daeduk-daero, Yuseong-gu, Daejeon 305-348 (Korea, Republic of); Pyo, Tae-Soo [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A' ohōkū Place, Hilo, HI 96720 (United States); Lee, Ho-Gyu [Department of Astronomy, Graduate School of Science, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Kim, Hyun-Jeong; Koo, Bon-Chul; Lee, Yong-Hyun [Department of Physics and Astronomy, Seoul National University, 599 Gwanangno, Gwanak-gu, Seoul 151-747 (Korea, Republic of); Sung, Hwankyung; Hur, Hyeonoh, E-mail: [Department of Astronomy and Space Science, Sejong University, 98 Kunja-dong, Kwangjin-gu, Seoul 143-747 (Korea, Republic of)


    We present [Fe II] 1.64 μm imaging observations for jets and outflows from young stellar objects (YSOs) over the northern part (∼24' × 45') of the Carina Nebula, a massive star-forming region. The observations were performed with IRIS2 of the Anglo-Australian Telescope and the seeing was ∼1.''5 ± 0.''5. Eleven jet and outflow features are detected at eight different regions and are termed ionized Fe objects (IFOs). One Herbig-Haro candidate that was missed in Hubble Space Telescope Hα observations is newly identified as HHc-16, referring to our [Fe II] images. IFOs have knotty or longish shapes, and the detection rate of IFOs against previously identified YSOs is 1.4%, which should be treated as a lower limit. Four IFOs show anti-correlated peak intensities in [Fe II] and Hα, where the ratio I([Fe II])/I(Hα) is higher for longish IFOs than for knotty IFOs. We estimate the outflow mass loss rate from the [Fe II] flux using two different methods. The jet-driving objects are identified for three IFOs (IFO-2, -4, and -7) for which we study the relations between the outflow mass loss rate and the YSO physical parameters from the radiative transfer model fitting. The ratios of the outflow mass loss rate over the disk accretion rate for IFO-4 and -7 are consistent with the previously reported values (10{sup –2}-10{sup +1}), while the ratio is higher for IFO-2. This excess may result from underestimating the disk accretion rate. The jet-driving objects are likely to be low- or intermediate-mass stars. Other YSO physical parameters, such as luminosity and age, show reasonable relations or trends.

  19. Shortening of the Lactobacillus paracasei subsp. paracasei BGNJ1-64 AggLb protein switches its activity from auto-aggregation to biofilm formation

    Directory of Open Access Journals (Sweden)

    Marija Miljković


    Full Text Available AggLb is the largest (318.6 kDa aggregation-promoting protein of Lactobacillus paracasei subsp. paracasei BGNJ1-64 responsible for forming large cell aggregates, which causes auto-aggregation, collagen binding and pathogen exclusion in vitro. It contains an N-terminus leader peptide, followed by six successive collagen binding domains, 20 successive repeats (CnaB-like domains and an LPXTG sorting signal at the C-terminus for cell wall anchoring. Experimental information about the roles of the domains of AggLb is currently unknown. To define the domain that confers cell aggregation and the key domains for interactions of specific affinity between AggLb and components of the extracellular matrix (ECM, we constructed a series of variants of the aggLb gene and expressed them in Lactococcus lactis subsp. lactis BGKP1-20 using a lactococcal promoter. All of the variants contained a leader peptide, an inter collagen binding-CnaB domain region (used to raise an anti-AggLb antibody, an anchor domain and a different number of collagen binding and CnaB-like domains. The role of the collagen binding repeats of the N-terminus in auto-aggregation and binding to collagen and fibronectin was confirmed. Deletion of the collagen binding repeats II, III and IV resulted in a loss of the strong auto-aggregation, collagen and fibronectin binding abilities whereas the biofilm formation capability was increased. The strong auto-aggregation, collagen and fibronectin binding abilities of AggLb were negatively correlated to biofilm formation.

  20. Development of novel strategy for the synthesis of organometallic compounds usable as protein ligands: application to the human cyclophilin hCyp-18; Developpement de ligands de proteines par assemblage combinatoire autour d'un coeur de rhenium{sup V}: application a la cyclophiline hCyp-18

    Energy Technology Data Exchange (ETDEWEB)

    Clavaud, C


    This thesis describes a new strategy for the development of bioactive organometallic compounds, basing on the combinatorial assembly of sub-chemical libraries (A and B) independent but complementary and able to coordinate a metallic heart M to form A-M-B complex potential ligands of biomolecules. The coordination of metals, well adapted to the production of molecular variety is usually used in medicinal chemistry, in diagnostic and therapeutic nuclear medicine. Among the useful elements, the rhenium and the technetium are metals of choice for the development of the assembly strategy because of their chemical and radiochemical properties and of the structure analogy of their complexes. This strategy was validated in vitro. The protein chosen for this purpose was the cyclophilin hCyp-18. (N.C.)

  1. Molybdenum-rhenium superconducting suspended nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    Aziz, Mohsin; Christopher Hudson, David; Russo, Saverio [Centre for Graphene Science, College of Engineering, Mathematics and Physical Sciences, University of Exeter, Exeter EX4 4QF (United Kingdom)


    Suspended superconducting nanostructures of MoRe 50%/50% by weight are fabricated employing commonly used fabrication steps in micro- and nano-meter scale devices followed by wet-etching with Hydro-fluoric acid of a SiO{sub 2} sacrificial layer. Suspended superconducting channels as narrow as 50 nm and length 3 μm have a critical temperature of ≈6.5 K, which can increase by 0.5 K upon annealing at 400 °C. A detailed study of the dependence of the superconducting critical current and critical temperature upon annealing and in devices with different channel widths reveals that desorption of contaminants is responsible for the improved superconducting properties. These findings pave the way for the development of superconducting electromechanical devices using standard fabrication techniques.

  2. The Electrodeposition of Rhenium and Its Alloys (United States)


    did not have benefit. A combination of vanillin, sodium lauryl sulfate, and gelatin , and equal concentrations of Ni2+ and ReO4 - yielded a coating...substrate, thus facilitating good bonding between the coating and substrate. Similar phenomenon would occur between a silver substrate and...electrodeposited metal coating. Historically, this is why most successful electroplating process used copper, brass (copper-zinc alloy), and silver as substrates

  3. Stability of rhenium-188 labeled antibody

    International Nuclear Information System (INIS)

    Lim, B. K.; Jung, J. M.; Jung, J. K.; Lee, D. S.; Lee, M. C.


    For clinical application of beta-emitter labeled antibody, high specific activity is important. Carrier-free Re-188 from W-188/Re-188 generator is an ideal radionuclide for this purpose. However, low stability of Re-188 labeled antibody, especially in high specific activity, due to radiolytic decomposition by high energy (2.1 MeV) beta ray was problem. We studied the stability of Re-188 labeled antibody, and stabilizing effect of several nontoxic radical-quenching agents. Pre-reduced monoclonal antibody (CEA79.4) was labeled with Re-188 by incubating with generator-eluted Re-188-perrhenate in the presence of stannous tartrate for 2 hr at room temperature. Radiochemical purity of each preparation was determined by chromatography (ITLC-SG/acetone, ITLC-SG/Umezawa, Whatman No.1/saline). Human serum albumin was added to the labeled antibodies(2%). Stability of Re-188-CEA79.4 was investigated in the presence of vitamin C, ethanol, or Tween 80 as radical-quenching agents. Specific activities of 4.29∼5.11 MBq/μg were obtained. Labeling efficiencies were 88±4%(n=12). Very low stability after removal of stannous tartrate from the preparation was observed. If stored after purging with N 2 , all the preparations were stable for 10 hr. However, if contacted with air, stability decreased. Perrhenate and Re-188-tartrate was major impurity in declined preparation (12∼47 and 9∼38% each, after 10 hr). Colloid-formation was not a significant problem in all cases. Addition of vitamin C stabilized the labeled antibodies either under N 2 or under air by reducing the formation of perrhenate. High specific activity Re-188 labeled antibody is unstable, especially, in the presence of oxygen. Addition of vitamin C increased the stability

  4. Unusual Metalloporphyrin Complexes of Rhenium and Technetium (United States)


    vitamin 8216,17). Changes or modification of general porphyrin metabolism are associated with cancer, drug metabolism, 18and specific disease syndromes ...D. Adler, F. R. Longo, J. D. Finarelli, J. Goldmacher, J. Assour, and L. Korsakoff , J. Org. Chem., 32; 476 (1967). 67. G. H. Barnett, M. F. Hudson

  5. On rhenium (7) state in aqueous solutions

    International Nuclear Information System (INIS)

    Sinyakova, G.S.


    The methods of spectrophotometry, electric conductivity and potentiometric titration have been used in studying the interaction in the system Re(7)-H 3 O + -H 2 O. It has been found that sodium perrhenate and perrhenic acid dissociate on dilution but not the way typical of binary electrolytes. Perrhenic acid is a mixture of the acids HReO 4 and H 5 ReO 6 . The two acids do not undergo differential titration. The conventional ionization constant, as calculated from the data of potentiometric titration, K 1 =(2.34+-0.52)x10 -2 . A step-wise dissociation of the H 4 ReO 6 - anion has been found, K 2 =(2.04+-0.30)x10 -8 , K 3 =(4.90+-0.20)x10 -12

  6. A triad of rhenium-mediated transformations

    Indian Academy of Sciences (India)


    Gangopadhyay J, Sengupta S, Bhattacharyya S, Chakraborty I and Chakravorty A 2002 Inorg. Chem. 41 2616. 9. Geldard J F and Lions F 1965 J. Org. Chem. 30 318. 10. Kliegman J M and Barnes R K 1970 Tetrahedron 26 2555. 11. Bhattacharyya S, Chakraborty I, Dirghangi B K and Chakravorty A 2001 Inorg. Chem.40286.

  7. Study of a new magnetic dipole mode in the heavy deformed nuclei 154Sm, 156Gd, 158Gd, 164Dy, 168Er, and 174Yb by high-resolution electron spectroscopy

    International Nuclear Information System (INIS)

    Bohle, D.


    By inelastic electron scattering with high energy resolution a new magnetic dipole mode in heavy, deformed nuclei could be detected. For this the nuclei 154 Sm, 156 Gd, 158 Gd, 164 Dy, 168 Er, and 174 Yb were studied at the Darmstadt electron linear accelerator (DALINAC) at small momentum transfer q ≤ 0.6 fm -1 and low excitation energies. A collective magnetic dipole excitation could be discovered in all nuclei at an excitation energy of E x ≅ 66 δA -1/3 MeV whereby δ means the mass deformation. The transition strength extends in the mean to B(M1)↑ ≅ 1.3 μ N 2 . A systematic study of the nucleus 156 Gd yielded hints to a strong fragmentation of the magnetic dipole strength. A comparison of electron scattering, proton scattering, and nuclear resonance fluorescence experiments shows that the new mode is a pure orbital mode. (orig./HSI) [de

  8. Cervical carcinoma and sexual behavior: collaborative reanalysis of individual data on 15,461 women with cervical carcinoma and 29,164 women without cervical carcinoma from 21 epidemiological studies

    DEFF Research Database (Denmark)

    Kjær, Susanne Krüger


    of sexual partners and age at first sexual intercourse from 21 studies, or groups of studies, including 10,773 women with invasive cervical carcinoma, 4,688 women with cervical intraepithelial neoplasia grade 3 (CIN3)/carcinoma in situ, and 29,164 women without cervical carcinoma. Relative risks......High-risk human papillomavirus (HPV) types cause most cervical carcinomas and are sexually transmitted. Sexual behavior therefore affects HPV exposure and its cancer sequelae. The International Collaboration of Epidemiological Studies of Cervical Cancer has combined data on lifetime number...... for invasive cancer and CIN3 were estimated by conditional logistic regression. Risk of invasive cervical carcinoma increased with lifetime number of sexual partners (P for linear trend or =6 versus 1 partner, conditioned on age, study, and age at first intercourse, was 2...

  9. Volatility literature of chlorine, iodine, cesium, strontium, technetium, and rhenium; technetium and rhenium volatility testing

    International Nuclear Information System (INIS)

    Langowski, M.H.; Darab, J.G.; Smith, P.A.


    A literature review pertaining to the volatilization of Sr, Cs, Tc (and its surrogate Re), Cl, I and other related species during the vitrification of Hanford Low Level Waste (LLW) streams has been performed and the relevant information summarized. For many of these species, the chemistry which occurs in solution prior to the waste stream entering the melter is important in dictating their loss at higher temperatures. In addition, the interactive effects between the species being lost was found to be important. A review of the chemistries of Tc and Re was also performed. It was suggested that Re would indeed act as an excellent surrogate for Tc in non-radioactive materials testing. Experimental results on Tc and Re loss from sodium aluminoborosilicate melts of temperatures ranging from 900--1350 degrees C performed at PNL are reported and confirm that Re behaves in a nearly identical manner to that of technetium

  10. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from MOORING_M2_164W_57N in the Bering Sea from 2013-05-06 to 2014-10-19 (NCEI Accession 0157599) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0157599 includes chemical, meteorological, physical and time series data collected from MOORING_M2_164W_57N in the Bering Sea from 2013-05-06 to...

  11. Magnetic field cycling effect on the non-linear current-voltage characteristics and magnetic field induced negative differential resistance in α-Fe1.64Ga0.36O3 oxide (United States)

    Bhowmik, R. N.; Vijayasri, G.


    We have studied current-voltage (I-V) characteristics of α-Fe1.64Ga0.36O3, a typical canted ferromagnetic semiconductor. The sample showed a transformation of the I-V curves from linear to non-linear character with the increase of bias voltage. The I-V curves showed irreversible features with hysteresis loop and bi-stable electronic states for up and down modes of voltage sweep. We report positive magnetoresistance and magnetic field induced negative differential resistance as the first time observed phenomena in metal doped hematite system. The magnitudes of critical voltage at which I-V curve showed peak and corresponding peak current are affected by magnetic field cycling. The shift of the peak voltage with magnetic field showed a step-wise jump between two discrete voltage levels with least gap (ΔVP) 0.345(± 0.001) V. The magnetic spin dependent electronic charge transport in this new class of magnetic semiconductor opens a wide scope for tuning large electroresistance (˜500-700%), magnetoresistance (70-135 %) and charge-spin dependent conductivity under suitable control of electric and magnetic fields. The electric and magnetic field controlled charge-spin transport is interesting for applications of the magnetic materials in spintronics, e.g., magnetic sensor, memory devices and digital switching.

  12. Magnetic field cycling effect on the non-linear current-voltage characteristics and magnetic field induced negative differential resistance in α-Fe{sub 1.64}Ga{sub 0.36}O{sub 3} oxide

    Energy Technology Data Exchange (ETDEWEB)

    Bhowmik, R. N., E-mail:; Vijayasri, G. [Department of Physics, Pondicherry University, R.Venkataraman Nagar, Kalapet, Puducherry - 605 014 (India)


    We have studied current-voltage (I-V) characteristics of α-Fe{sub 1.64}Ga{sub 0.36}O{sub 3}, a typical canted ferromagnetic semiconductor. The sample showed a transformation of the I-V curves from linear to non-linear character with the increase of bias voltage. The I-V curves showed irreversible features with hysteresis loop and bi-stable electronic states for up and down modes of voltage sweep. We report positive magnetoresistance and magnetic field induced negative differential resistance as the first time observed phenomena in metal doped hematite system. The magnitudes of critical voltage at which I-V curve showed peak and corresponding peak current are affected by magnetic field cycling. The shift of the peak voltage with magnetic field showed a step-wise jump between two discrete voltage levels with least gap (ΔV{sub P}) 0.345(± 0.001) V. The magnetic spin dependent electronic charge transport in this new class of magnetic semiconductor opens a wide scope for tuning large electroresistance (∼500-700%), magnetoresistance (70-135 %) and charge-spin dependent conductivity under suitable control of electric and magnetic fields. The electric and magnetic field controlled charge-spin transport is interesting for applications of the magnetic materials in spintronics, e.g., magnetic sensor, memory devices and digital switching.

  13. Magnetic field cycling effect on the non-linear current-voltage characteristics and magnetic field induced negative differential resistance in α-Fe1.64Ga0.36O3 oxide

    Directory of Open Access Journals (Sweden)

    R. N. Bhowmik


    Full Text Available We have studied current-voltage (I-V characteristics of α-Fe1.64Ga0.36O3, a typical canted ferromagnetic semiconductor. The sample showed a transformation of the I-V curves from linear to non-linear character with the increase of bias voltage. The I-V curves showed irreversible features with hysteresis loop and bi-stable electronic states for up and down modes of voltage sweep. We report positive magnetoresistance and magnetic field induced negative differential resistance as the first time observed phenomena in metal doped hematite system. The magnitudes of critical voltage at which I-V curve showed peak and corresponding peak current are affected by magnetic field cycling. The shift of the peak voltage with magnetic field showed a step-wise jump between two discrete voltage levels with least gap (ΔVP 0.345(± 0.001 V. The magnetic spin dependent electronic charge transport in this new class of magnetic semiconductor opens a wide scope for tuning large electroresistance (∼500-700%, magnetoresistance (70-135 % and charge-spin dependent conductivity under suitable control of electric and magnetic fields. The electric and magnetic field controlled charge-spin transport is interesting for applications of the magnetic materials in spintronics, e.g., magnetic sensor, memory devices and digital switching.

  14. Crystal structure of a silver-, cobalt- and iron-based phosphate with an alluaudite-like structure: Ag1.655Co1.64Fe1.36(PO43

    Directory of Open Access Journals (Sweden)

    Adam Bouraima


    Full Text Available The new silver-, cobalt- and iron-based phosphate, silver cobalt iron tris(orthophosphate, Ag1.655Co1.64Fe1.36(PO43, was synthesized by solid-state reactions. Its structure is isotypic to that of Na2Co2Fe(PO43, and belongs to the alluaudite family, with a partial cationic disorder, the AgI atoms being located on an inversion centre and twofold rotation axis sites (Wyckoff positions 4a and 4e, with partial occupancies of 0.885 (2 and 0.7688 (19, respectively. One of the two P atoms in the asymmetric unit completely fills one 4e site while the Co and Fe atoms fill another 4e site, with partial occupancies of 0.86 (5 and 0.14 (5, respectively. The remaining Co2+ and Fe3+ cations are distributed on a general position, 8f, in a 0.39 (4:0.61 (4 ratio. All O atoms and the other P atoms are in general positions. The structure is built up from zigzag chains of edge-sharing [MO6] (M = Fe/Co octahedra stacked parallel to [101]. These chains are linked together through PO4 tetrahedra, forming polyhedral sheets perpendicular to [010]. The resulting framework displays two types of channels running along [001], in which the AgI atoms (coordination number eight are located.

  15. 7 CFR 983.164 - Reports. (United States)


    ... test failure. (b) ACP-3, Failed Lot Disposition and Rework Report. Each handler who reworks a failing... days after the rework is completed. If rework is not selected as a remedy, the handler shall submit the...

  16. 21 CFR 164.110 - Mixed nuts. (United States)


    ... to in paragraph (a) of this section are: (1) Almonds, black walnuts, Brazil nuts, cashews, English... the Spanish, Valencia, Virginia, or similar varieties, or any combination of two or more such varieties. (c) The optional nonnut ingredients referred to in paragraph (a) of this section consist of...

  17. 12 CFR 250.164 - Bankers' acceptances. (United States)


    .... The legislative history of the BESA indicates no intent to change this domestic acceptance limitation... financial statements prepared in accordance with local accounting practices and an explanation of the accounting terminology and the major features of the accounting standards used in the preparation of the...

  18. 40 CFR 164.81 - Evidence. (United States)


    ... determined by its reliability and probative value. In all hearings the testimony of witnesses shall be taken.... Objections to the report may also be made part of the record and go to the weight of its evidentiary value...

  19. 45 CFR 164.314 - Organizational requirements. (United States)


    ... REQUIREMENTS SECURITY AND PRIVACY Security Standards for the Protection of Electronic Protected Health... business associate that constituted a material breach or violation of the business associate's obligation... breach or end the violation, as applicable, and, if such steps were unsuccessful— (A) Terminated the...

  20. Publications | Page 164 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of ... However, there is a growing funding gap for support of strategies for ... Feasibility and projections for selected earmarked taxes as a source of health ...

  1. 21 CFR 133.164 - Nuworld cheese. (United States)


    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... cheese having the same physical and chemical properties. It is characterized by the presence of creamy... this section may be warmed and is subjected to the action of a lactic acid-producing bacterial culture...

  2. Search Results | Page 164 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    It is difficult to feed research-based evidence into policy and practice. Research in Action. Disease control Health systems Gender. CASE STUDY: New weapons in the war on malaria. Research in Action. Food security LIVESTOCK Urban agriculture Gender. CASE STUDY: Kampala, Uganda — From the ground up: Urban ...

  3. 40 CFR 63.164 - Standards: Compressors. (United States)


    ... from the compressor drive shaft seal back to a process or a fuel gas system or to a control device that... compressor shall be equipped with a seal system that includes a barrier fluid system and that prevents... paragraphs (h) and (i) of this section. (b) Each compressor seal system as required in paragraph (a) of this...

  4. 45 CFR 164.103 - Definitions. (United States)


    ... officer or employee of any agency or authority of the United States, a State, a territory, a political... criminal, civil, or administrative proceeding arising from an alleged violation of law. Plan sponsor is...

  5. 45 CFR 164.402 - Definitions. (United States)


    ... information means poses a significant risk of financial, reputational, or other harm to the individual. (ii) A... of a technology or methodology specified by the Secretary in the guidance issued under section 13402(h)(2) of Public Law 111-5 on the HHS Web site. ...

  6. 21 CFR 164.150 - Peanut butter. (United States)


    ... may not be included. (2) Unblanched peanuts, including the skins and germ. (c) The seasoning and... are regarded as suitable, except that artificial flavorings, artificial sweeteners, chemical... stabilizing ingredients shall be hydrogenated vegetable oils. For the purposes of this section, hydrogenated...

  7. 164 original article profile of institutional infrastructure

    African Journals Online (AJOL)

    Dr Oboro VO

    At this level is the most critical health services delivery point, with an ... Methods: The objectives of this study were to assess the universal precaution profile of primary health care .... Availability of safety training and monitoring schedule.

  8. Gender | Page 164 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ​Why do cities with similar conditions of social exclusion experience different levels of violence? ... webcasts, and a much larger audience took part through Twitter and other social media. ... Does having children make a difference?

  9. Publications | Page 164 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local ... It triggered a deep-seated desire for change and has brought about profound. ... For two months in mid-2012, Khechen spent time in Cairo researching how ...

  10. 32 CFR 552.164 - General. (United States)


    ...), and Director of Engineering and Housing (DEH). If the event can be supported, DPTM will advise the organization to contact the Director of Engineering and Housing Real Property Branch. Requests for such... the appropriate Installation Range Regulations. (f) Non-DoD personnel in transit. Individuals in...

  11. 45 CFR 164.501 - Definitions. (United States)


    ... under a grant of authority from or contract with such public agency, including the employees or agents...) Date of birth; (C) Social security number; (D) Payment history; (E) Account number; and (F) Name and... contents of conversation during a private counseling session or a group, joint, or family counseling...


    International Nuclear Information System (INIS)

    Colina, L.; Pereira-Santaella, M.; Alonso-Herrero, A.; Arribas, S.; Bedregal, A. G.


    Spatially resolved near-IR and X-ray imaging of the central region of the luminous infrared galaxy (LIRG) NGC 5135 is presented. The kinematical signatures of strong outflows are detected in the [Fe II] 1.64 μm emission line in a compact region at 0.9 kpc from the nucleus. The derived mechanical energy release is consistent with a supernova rate of 0.05-0.1 yr –1 . The apex of the outflowing gas spatially coincides with the strongest [Fe II] emission peak and with the dominant component of the extranuclear hard X-ray emission. All these features provide evidence for a plausible direct physical link between supernova-driven outflows and the hard X-ray emitting gas in an LIRG. This result is consistent with model predictions of starbursts concentrated in small volumes and with high thermalization efficiencies. A single high-mass X-ray binary (HMXB) as the major source of the hard X-ray emission, although not favored, cannot be ruled out. Outside the active galactic nucleus, the hard X-ray emission in NGC 5135 appears to be dominated by the hot interstellar medium produced by supernova explosions in a compact star-forming region, and not by the emission due to HMXBs. If this scenario is common to (ultra)luminous infrared galaxies, the hard X-rays would only trace the most compact (≤100 pc) regions with high supernova and star formation densities, therefore a lower limit to their integrated star formation. The star formation rate derived in NGC 5135 based on its hard X-ray luminosity is a factor of two and four lower than the values obtained from the 24 μm and soft X-ray luminosities, respectively.

  13. Transverse water relaxation in whole blood and erythrocytes at 3T, 7T, 9.4T, 11.7T and 16.4T; determination of intracellular hemoglobin and extracellular albumin relaxivities. (United States)

    Grgac, Ksenija; Li, Wenbo; Huang, Alan; Qin, Qin; van Zijl, Peter C M


    Blood is a physiological substance with multiple water compartments, which contain water-binding proteins such as hemoglobin in erythrocytes and albumin in plasma. Knowing the water transverse (R 2 ) relaxation rates from these different blood compartments is a prerequisite for quantifying the blood oxygenation level-dependent (BOLD) effect. Here, we report the Carr-Purcell-Meiboom-Gill (CPMG) based transverse (R 2CPMG ) relaxation rates of water in bovine blood samples circulated in a perfusion system at physiological temperature in order to mimic blood perfusion in humans. R 2CPMG values of blood plasma, lysed packed erythrocytes, lysed plasma/erythrocyte mixtures, and whole blood at 3 T, 7 T, 9.4 T, 11.7 T and 16.4 T were measured as a function of hematocrit or hemoglobin concentration, oxygenation, and CPMG inter-echo spacing (τ cp ). R 2CPMG in lysed cells showed a small τ cp dependence, attributed to the water exchange rate between free and hemoglobin-bound water to be much faster than τ cp . This was contrary to the tangential dependence in whole blood, where a much slower exchange between cells and blood plasma applies. Whole blood data were fitted as a function of τ cp using a general tangential correlation time model applicable for exchange as well as diffusion contributions to R 2CPMG , and the intercept R 20blood at infinitely short τ cp was determined. The R 20blood values at different hematocrit and the R 2CPMG values of lysed erythrocyte/plasma mixtures at different hemoglobin concentration were used to determine the relaxivity of hemoglobin inside the erythrocyte (r 2Hb ) and albumin (r 2Alb ) in plasma. The r 2Hb values obtained from lysed erythrocytes and whole blood were comparable at full oxygenation. However, while r 2Hb determined from lysed cells showed a linear dependence on oxygenation, this dependence became quadratic in whole blood. This possibly suggests an additional relaxation effect inside intact cells, perhaps due to hemoglobin

  14. Effects of Inlet Modification and Rocket-Rack Extension on the Longitudinal Trim and Low-Lift Drag of the Douglas F5D-1 Airplane as Obtained with a 0.125-Scale Rocket-Boosted Model Between Mach Numbers of 0.81 and 1.64: TED No. NACA AD 399 (United States)

    Hastings, Earl C., Jr.; Dickens, Waldo L.


    A flight investigation was conducted to determine the effects of inlet modification and rocket-rack extension on the longitudinal trim and low-lift drag of the Douglas F5D-1 airplane. The investigation was conducted with a 0.125-scale rocket-boosted model between Mach Numbers of 0.81 and 1.64. This paper presents the changes in trim angle of attack, trim lift coefficient, and low-lift drag caused by the modified inlets alone over a small part of the test Mach number range and by a combination of the modified inlets and extended rocket racks throughout the remainder of the test.

  15. Structure of rhenium (5) complexes with petroleum organic sulfur compounds

    International Nuclear Information System (INIS)

    Akhmadieva, R.G.; Yusupova, N.A.; Numanov, N.U.; Basitova, S.M.


    Structure of Re(5) complexes with petroleum sulfides (L) of ReOCl 3 (L) 2 composition is studied by the UV- and IR-spectroscopy method in a short-wave and long-wave ranges. It is shown that Re(5) complex with L are of the form of flattened octahedron,where three Cl atoms and one L molecule are arranged in the plane around Re atom. The structure is analogous to structure of Re complexes with synthetic cyclic sulfides

  16. Technetium and rhenium tracers with metabolizable ester functions

    International Nuclear Information System (INIS)

    Syhre, R.; Seifert, S.; Schneider, F.; Pietzsch, H.J.; Spies, H.; Johannsen, B.


    Re-DMSA (dimercaptosuccinic acid) ester complexes were prepored by ligand exchange reactions. To determine whether the ester band in Re-DMSA ester complexes is susceptible to cleavage by esterases, incubation experiments with tissue homogenates and plasma were carried out. (BBR)

  17. Comparative electrochemistry of technetium (V) and rhenium (V) dioxo complexes

    International Nuclear Information System (INIS)

    Kremer, C.; Kremer, E.; Dominguez, S.; Mederos, A.


    The heavy use of 99m Tc in nuclear medicine and the recent development of 188 Re radiopharmaceuticals have encouraged the comparative study of Tc and Re coordination compounds. In this work, the electrochemistry of [M v O 2 (amine) 2 ] + (M = Tc, Re; amine = ethylenediamine, 1,3-diaminopropane, diethylenetriamine, triethylenetetramine) complexes is studied by cyclic voltammetry and the results are compared. The voltammograms of these compounds, obtained at different pH values, show that [ReO 2 (amine) 2 + cations are thermodynamically stable even when protonated. On the other hand, analogous Tc compounds are not so stable and easily decompose if existing as [TcO (OH) (amine) 2 ] 2+ . (author). 17 refs., 3 figs., 1 tab

  18. Rhenium-Catalyzed Deoxydehydration of Diols and Polyols

    DEFF Research Database (Denmark)

    Dethlefsen, Johannes Rytter; Fristrup, Peter


    The substitution of platform chemicals of fossil origin by biomass-derived analogues requires the development of chemicaltransformations capable of reducing the very high oxygen contentof biomass. One such reaction, which has received increasingattention within the past five years, is the heniumc......The substitution of platform chemicals of fossil origin by biomass-derived analogues requires the development of chemicaltransformations capable of reducing the very high oxygen contentof biomass. One such reaction, which has received increasingattention within the past five years...... systems that have been developed withemphasis on the nature of the reductant, the substrate scope,and mechanistic investigations....

  19. Tertiary phosphine complexes of rhenium: a spectroscopic study

    International Nuclear Information System (INIS)

    Fergusson, J.E.; Heveldt, P.F.


    Complexes of the type ReOX 3 L 2 , ReNX 2 L 3 , ReX 3 (NO)L 2 and ReX 2 (NO)L 3 have been studied using, UV visible, IR and H 1 , C 13 NMR spectroscopy. (X is a halogen, Cl, Br, I and L is a tertiary phosphine Et 3 P and Et 2 PhP). Evidence obtained on the blue cis isomer ReOCl 3 L 2 suggests that the halogens are arranged on a face of the octahedral complex. Assignments of ν(Re-X) and ν(Re-P) vibrations have been made. Three complexes of technetium, [TcCl 4 (Ph 3 P) 2 ], [TcCl 3 (Et 2 PhP) 3 ] and [TcCl 3 (NO)(Et 2 PhP) 2 ] have been isolated. (author)

  20. Rhenium and Manganese-Catalyzed Selective Alkenylation of Indoles

    KAUST Repository

    Wang, Chengming


    An efficient rhenium‐catalyzed regioselective C‐H bond alkenylation of indoles is reported. The protocol operates well for internal as well as terminal alkynes, affording products in good to excellent yields. Furthermore, a manganese catalyzed, acid free, regioselective C2‐alkenylation of indoles with internal alkynes is described. The directing groups can be easily removed after the reaction and the resulting products can be used as valuable building blocks for the synthesis of diverse heterocyclic compounds.

  1. Bone uptake by di and tetraphosphonates labeled with Rhenium-188

    International Nuclear Information System (INIS)

    Faintuch, B.L.; Osso, J.A. Jr.; Muramoto, E.; Faintuch, S.


    MDP (methylenediphosphonate) and HEDP (hydroxyethylidenediphosphonate), both diphosphonates, and EDTMP (ethylenediamine tetramethylene phosphonic acid) a tetraphosphonate ligand, have been labeled with 188 Re for use in metastatic bone-pain palliation. The aim of this study was a comparison between the three complexes 188 Re-MDP, 188 Re-HEDP and 188 Re-EDTMP concerning the complexation conditions, in order to achieve maximum yield, stability and bone uptake. Methods: MDP was dissolved in water and HEDP and EDTMP were dissolved in NaOH 1N followed by decreasing pH with HCl 1N. To all mixtures stannous chloride and 188 ReO 4 were added in a nitrogen atmosphere. The preparations were heated in a boiling water bath for 15 min. The yields as well as the radiochemical stability were estimated by ITLC. Different concentrations of phosphonates and stannous chloride were evaluated. Biodistribution studies in swiss mice were done for the three 188 Re-phosphonates that presented the best radiochemical yield. Results: For 188 Re-MDP and 188 Re-HEDP the optimal ligand concentration for maximum complexation was 30 mg whereas for 188 Re-EDTMP, it was 40 mg. The best amount of SnCl 2 .2H 2 O was 2 mg/mL for MDP, 3 mg/mL for HEDP and 1 mg/mL for EDTMP. In these conditions the three complexes showed a complexation yield above 95%. All of them presented 4-hour radiochemical stability without the need for ascorbic acid solution, but for 24 hours this stability existed only in the presence of that substance otherwise re-oxidation of 188 Re occurred. All products showed a great uptake by the kidneys. 188 Re-EDTMP had the greatest uptake by the bone (3.13 ± 0.18% ID/g) followed by 188 Re-MDP (1.18 ± 0.05%ID/g) and 188 Re-HEDP (1.03 ± 0.12 %ID/g), 4 hour postinjection. 188 Re-EDTMP displayed a bone/muscle ratio of 28.5, 188 Re-MDP 4.9 and 188 Re-HEDP 4.9. Conclusion: 188 Re-EDTMP demonstrated the best potential as a radiopharmaceutical for bone cancer pain relief, encouraging further dosimetric studies and clinical trials

  2. Gamma bands in doubly odd rhenium and iridium nuclei

    Directory of Open Access Journals (Sweden)

    Balodis M.


    Full Text Available Structure of the |K ± 2| bands in doubly-odd nuclei belonging to the transitional deformation region at A∼190 is discussed. Relation of these quasi gamma-bands with the non-axial deformation of the parent two-quasiparticle configurations is studied. Using available experimental information, new tentative |K ± 2| bands are proposed in 188Re, and 192,194Ir nuclei. Coexistence of two-quasiparticle states with different deformation modes is considered in the case of 188Re and 194Ir.

  3. Mitochondria Targeting with Luminescent Rhenium(I) Complexes. (United States)

    Skiba, Joanna; Bernaś, Tytus; Trzybiński, Damian; Woźniak, Krzysztof; Ferraro, Giarita; Marasco, Daniela; Merlino, Antonello; Shafikov, Marsel Z; Czerwieniec, Rafał; Kowalski, Konrad


    Two new neutral fac -[Re(CO)₃(phen)L] compounds ( 1 , 2 ), with phen = 1,10-phenanthroline and L = O₂C(CH₂)₅CH₃ or O₂C(CH₂)₄C≡CH, were synthetized in one-pot procedures from fac -[Re(CO)₃(phen)Cl] and the corresponding carboxylic acids, and were fully characterized by IR and UV-Vis absorption spectroscopy, ¹H- and 13 C-NMR, mass spectrometry and X-ray crystallography. The compounds, which display orange luminescence, were used as probes for living cancer HeLa cell staining. Confocal microscopy revealed accumulation of both dyes in mitochondria. To investigate the mechanism of mitochondrial staining, a new non-emissive compound, fac -[Re(CO)₃(phen)L], with L = O₂C(CH₂)₃((C₅H₅)Fe(C₅H₄), i.e., containing a ferrocenyl moiety, was synthetized and characterized ( 3 ). 3 shows the same mitochondrial accumulation pattern as 1 and 2 . Emission of 3 can only be possible when ferrocene-containing ligand dissociates from the metal center to produce a species containing the luminescent fac -[Re(CO)₃(phen)]⁺ core. The release of ligands from the Re center was verified in vitro through the conjugation with model proteins. These findings suggest that the mitochondria accumulation of compounds 1 - 3 is due to the formation of luminescent fac -[Re(CO)₃(phen)]⁺ products, which react with cellular matrix molecules giving secondary products and are uptaken into the negatively charged mitochondrial membranes. Thus, reported compounds feature a rare dissociation-driven mechanism of action with great potential for biological applications.

  4. Mitochondria Targeting with Luminescent Rhenium(I Complexes

    Directory of Open Access Journals (Sweden)

    Joanna Skiba


    Full Text Available Two new neutral fac-[Re(CO3(phenL] compounds (1,2, with phen = 1,10-phenanthroline and L = O2C(CH25CH3 or O2C(CH24C≡CH, were synthetized in one-pot procedures from fac-[Re(CO3(phenCl] and the corresponding carboxylic acids, and were fully characterized by IR and UV-Vis absorption spectroscopy, 1H- and 13C-NMR, mass spectrometry and X-ray crystallography. The compounds, which display orange luminescence, were used as probes for living cancer HeLa cell staining. Confocal microscopy revealed accumulation of both dyes in mitochondria. To investigate the mechanism of mitochondrial staining, a new non-emissive compound, fac-[Re(CO3(phenL], with L = O2C(CH23((C5H5Fe(C5H4, i.e., containing a ferrocenyl moiety, was synthetized and characterized (3. 3 shows the same mitochondrial accumulation pattern as 1 and 2. Emission of 3 can only be possible when ferrocene-containing ligand dissociates from the metal center to produce a species containing the luminescent fac­[Re(CO3(phen]+ core. The release of ligands from the Re center was verified in vitro through the conjugation with model proteins. These findings suggest that the mitochondria accumulation of compounds 1–3 is due to the formation of luminescent fac-[Re(CO3(phen]+ products, which react with cellular matrix molecules giving secondary products and are uptaken into the negatively charged mitochondrial membranes. Thus, reported compounds feature a rare dissociation-driven mechanism of action with great potential for biological applications.



    E.A.Salakhova*1, D.B.Tagiyev2, P.E.Kalantarova3 and A.M.Askerova4


    The formation of the triple alloys Re-Te-Cu on the platinum electrode at volt amperemetric cycling has been studied. The investigation was carried out from chloride acidic solution containing tellurium acid, potassium perrhenate, chloride copper. The kinetics of the processes was controlled using the measurements by the method of cyclic volt-amperometry on the device İVİUMSTAT. For the analysis of composition and structure the methods of XRD (X-ray diffraction analysis) were used, and the inv...

  6. Inorganic heterocycles with two manganes or rhenium carbonyl units

    International Nuclear Information System (INIS)

    Kuellmer, V.; Vahrenkamp, H.


    From the reactive complexes [(CO) 4 M-E-Sn(CH 3 ) 3 ] 2 (M = Mn,Re; E = S,Se) with (CH 3 ) 2 PCl via the non-isolable four-membered ring intermediates [(CO) 4 M-E-P(CH 3 ) 2 ] 2 the six-membered heterocycles[-(CO) 4 M-P(CH 3 ) 2 -E-] 2 are formed. By use of (CH 3 ) 2 AsCl both the four-membered ring intermediates and the six-membered ring products can be isolated. The six-membered heterocycles can be opened by trimethylphosphine. (orig./HK) [de

  7. Quadrupole interactions in pionic and muonic tantalum and rhenium

    International Nuclear Information System (INIS)

    Konijn, J.; Doesburg, W. van; Ewan, G.T; Johansson, T.; Tibell, G.


    The hyperfine splitting of pionic and muonic X-rays in natural Re has been studied using the known ratio (accurate to 1.6 parts in 10 5 ) of the quadrupole moments of the two naturally occurring 185 Re and 187 Re isotopes. From the hyperfine splitting of the 5g → 4f and 4f → 3d pionic X-rays the effective quadrupole hyperfine constants were determined to be 187 A 2 sup(e)sup(f)sup(f) (4f) = 1.163 +- 0.010 keV and 187 A 2 sup(e)sup(f)sup(f) (3d) = 5.39 +- 0.63 keV, giving strong interaction quadrupole shifts epsilon 2 (4f) = 46 +- 10 eV and epsilon 2 (3d) = 1.3 +- 0.6 keV. The strong interaction monopole shifts epsilon 0 and widths GAMMA 0 of the 5g, 4f and 3d levels have also been measured. For the two higher orbits, standard optical-potential calculations fit the measured shifts and widths quite well. The observed deeper-lying 3d state, however, has shifts and widths that differ by a factor of 2 or more from the predictions. From the measured quadrupole hyperfine constants of the 4f level we calculate the spectroscopic quadrupole moments to be 187 Qsup(μ) = 2.09 +- 0.04 b, 187 Qsup(π) = 2.07 +- 0.02 b, 185 Qsup(μ) = 2.21 +- 0.04 b, and 185 Qsup(π) = 2.18 +- 0.02 b. In addition, muonic X-rays from 181 Ta were observed; using the same methods for determining the quadrupole moments as above, a value of 181 Qsup(μ) = 3.28 +- 0.06 b was obtained, in good agreement with earlier published data. (orig.)

  8. Fundamental and Applied Bioorganometallic Chemistry of Technetium and Rhenium

    International Nuclear Information System (INIS)

    Alberto, R.; Braband, H.; Benz, M.; Can, D.; Imstepf, S.; Felber, M.; Spingler, B.


    Site directed accumulation is the base for therapy and imaging with inorganic medicinal compounds. To match selectively the structural properties of receptors, the topology of targeting complexes must be flexible and easily adaptable. For in vivo application, kinetic stability is desirable and in an advanced design, the complex itself can become part of the structure to be recognized by the receptor (3D structural space occupation concept).1 To match these requirements, we introduced the fac-{99mTcI(CO)3}+ building block many years ago. Many different complexes with this core were subjected to targeting studies and the organometallic chemistry of Tc developed rapidly beyond designs for molecular imaging. Some prominent examples will give insight into their structures and activities for molecular imaging. For complementing the fac-{99mTcI(CO)3}+ tag, we switched from low- to high-valent complexes. The isolobal fac-{99mTcVII(O)3}+ building block was introduced.2 Preparation of TcVII complexes is an example about how research is translated to routinely applicable conditions. For proceeding towards theranostics, homologous complexes with Re for therapy and with 99mTc complexes for imaging are mandatory. A new synthetic approach enabled the preparation of cyclopentadienyl complexes of both elements and based on pharmaceutically active lead structures.3 Newly introduced bis-arene complexes scopes at using these structures in analogy to ferrocene.4 The presentation exemplifies how questions from, ultimately practical, application lead to basic developments. Unexpected results in turn influence the discovery of new imaging and therapeutic agents.5 (1) Meggers, E. Curr. Opin. Chem. Biol. 2007, 11, 287. (2) Braband, H.; Tooyama, Y.; Fox, T.; Alberto, R. Chem. Eur. J. 2009, 15, 633. (3) Can, D.; Spingler, B.; Schmutz, P.; Mendes, F.; Raposinho, P.; Fernandes, C.; Carta, F.; Innocenti, A.; Santos, I.; Supuran, C. T.; Alberto, R. Angew. Chem. Int. Edit. 2012, 51, 3354. (4) Benz, M.; Braband, H.; Schmutz, P.; Halter, J.; Alberto, R. Chem. Sci. 2015, 6, 165. (5) S. Imstepf, S.; Pierroz, V.; Raposinho, P.; Bauwens, M.; Felber, M.; Fox, T.; Shapiro, A.B:; Freudenberg, R.; Fernandes, C.; Gama, S.; Gasser, G.; Motthagy, F.; Santos, I.R.; Alberto R. Bioconjugate Chem. 2015, DOI: 10.1021/acs.bioconjchem.5b00466 (author)

  9. Homogeneous deuterium exchange using rhenium and platinum chloride catalysts

    International Nuclear Information System (INIS)

    Fawdry, R.M.


    Previous studies of homogeneous hydrogen isotope exchange are mostly confined to one catalyst, the tetrachloroplatinite salt. Recent reports have indicated that chloride salts of iridium and rhodium may also be homogeneous exchange catalysts similar to the tetrachloroplatinite, but with much lower activities. Exchange by these homogeneous catalysts is frequently accompanied by metal precipitation with the termination of homogeneous exchange, particularly in the case of alkane exchange. The studies presented in this thesis describe two different approaches to overcome this limitation of homogeneous hydrogen isotope exchange catalysts. The first approach was to improve the stability of an existing homogeneous catalyst and the second was to develop a new homogeneous exchange catalyst which is free of the instability limitation

  10. Rhenium Uptake as Analogue 96Tc by Steel Corrosion Products

    International Nuclear Information System (INIS)

    K.M. Krupka; C.F. Brown; H. Todd Schaef; S. M. Heald; M. M. Valenta; B. W. Arey


    Static batch experiments were used to examine the sorption of dissolved perrhenate [Re(VII)], as a surrogate for pertechnetate [Tc(VII)], on corrosion products of A-516 carbon steel coupons contacted with synthetic groundwater or dilute water. After 109 days of contact time, the concentration of dissolved Re(VII) in the synthetic groundwater matrix decreased by approximately 26%; the dilute water matrix experienced a 99% decrease in dissolved Re(VII) over the same time period. Bulk x-ray diffraction (XRD) results for the corroded steel coupons showed that the corrosion products consisted primarily of maghemite, lepidocrocite, and goethite. Analyses of the coupons by scanning electron microscopy/energy dispersive spectroscopy (SEM/EDS) indicated that Re was present with the morphologically complex assemblages of Fe oxide/hydroxide corrosion products for samples spiked with the highest dissolved Re(VII) concentration (1.0 mmol/L) used for these experiments. Analyses of corroded steel coupons contacted with solutions containing 1.0 mmol/L Re(VII) by synchrotron-based methods confirmed the presence of Re sorbed with the corrosion product on the steel coupons. Analyses showed that the Re sorbed on these corroded coupons was in the +7 oxidation state, suggesting that the Re(VII) uptake mechanism did not involve reduction of Re to a lower oxidation state, such as +4. The results of our studies using Re(VII) as an analogue for 99 Tc(VII) suggest that 99 Tc(VII) would also be sorbed with steel corrosion products and that the inventory of 99 Tc(VII) released from breached waste packages would be lower than what is now conservatively estimated

  11. Nanostructured Tungsten Rhenium Components for Propulsion Systems, Phase I (United States)

    National Aeronautics and Space Administration — Revolutionizing the space propulsion industry through innovative, relatively low-cost, manufacturing techniques is extremely needed. Specifically, advancements are...

  12. New ternary oxides with rhenium(4) of the perovskite structure

    Energy Technology Data Exchange (ETDEWEB)

    Jezowska-Trzebiatowska, B; Nowakowski, T; Mrozinski, J [Wroclaw Univ. (Poland)


    A series of ternary oxides described by general formula CaIrsub(x)Resub(1-x)O/sub 3/, where x 0.25; 0.33; 0.66; 0.75, has been obtained. The X-ray investigations have shown, that these compounds have a distorted perovskite structure. The proximal coordination sphere of Re/sup 4 +/ and Ir/sup 4 +/ ions constituted by an octahedron of oxide ions was confirmed by the IR spectra.


    Energy Technology Data Exchange (ETDEWEB)

    Setyawan, Wahyu; Nandipati, Giridhar; Roche, Kenneth J.; Kurtz, Richard J.; Wirth, Brian D.


    Density functional theory was employed to explore the energetic properties of clusters up to size 2 of Re in W. While WW<111> is the most stable intrinsic dumbbell, ReW<110> is more stable than ReW<111>. However, when they are trapped by a substitutional Re (Re_s), ReW<111> becomes more stable than ReW<110>. In this case, the most stable configuration forms a ReWRe crowdion with the W atom in between the Re atoms. Simulations of a ReW[111] (dumbbell’s vector is from Re to W) approaching a Re_s along [111] indicate that the binding energy decreases from 0.83 eV at the first nearest neighbor (NN1) to 0.10 eV at NN3 and ~0 at NN4. In addition, while ReW<111> and ReW<110> are stable near a Re_s at NN1, the ReW<100> instantaneously rotates toward ReW<111>.

  14. Preparation of rhenium-186 tin colloid as radio synovectomy agent

    International Nuclear Information System (INIS)

    Cecep T Rustendi; Martalena Ramli; M Subur


    Radio synovectomy is an alternative therapy besides surgery whereby a beta-emitting radiopharmaceutical is delivered into the affected synovial compartment in order to threat rheumatoid arthritis. One of radiopharmaceuticals that could be applied as radio synovectomy agent is 186 Re-Sn colloid. Preparation of 186 Re-Sn colloid has been carried out by searching the best condition of the reaction to obtain a high labeling efficiency (>95%), appropriate particle size and stable at room temperature. Preparation of 186 Re-Sn colloid has been done successfully using a mol ratio of Sn to Re with value 1000:1 (~50 mg SnCl 2 .2H 2 O) by heating for 90 minutes and resulting >95% labeling efficiency. Stability of 186 Re-Sn colloid was found to be good enough when it was stored at room temperature for 24 hours. The 186 Re-Sn colloid was also found to have an appropriate particle size for radiopharmaceutical agent for radio synovectomy. (author)

  15. Rhenium and Manganese-Catalyzed Selective Alkenylation of Indoles

    KAUST Repository

    Wang, Chengming; Rueping, Magnus


    An efficient rhenium‐catalyzed regioselective C‐H bond alkenylation of indoles is reported. The protocol operates well for internal as well as terminal alkynes, affording products in good to excellent yields. Furthermore, a manganese catalyzed, acid free, regioselective C2‐alkenylation of indoles with internal alkynes is described. The directing groups can be easily removed after the reaction and the resulting products can be used as valuable building blocks for the synthesis of diverse heterocyclic compounds.

  16. Surface-Cycling of Rhenium and its Isotopes (United States)


    25.20 40.6861 -74.0386 Profile 2, 2006/06/06 † Station 1 8.7 8.8 1.69 27000 1,450 41.0437 -73.8807 Station 2 8.2 7.1 1.15 18400 1,000 41.0840 -73.8840...Birck, J. L., Herzig, P. M., and Hofmann, A. W. (1998), Os iso - topic composition and Os and Re distributions in the active mound of the TAG

  17. Rhenium(V) Complexes Containing Mono- and Tridentate Imido ...

    African Journals Online (AJOL)


    via the imido nitrogen and deprotonated acetoxy oxygen.8. We have now .... tronic energy gaps between the filled and empty orbitals have been obtained with the ..... for 1 and 2 and these were optimized in a singlet state with the. B3LYP and ...

  18. Liposomes as carriers of the beta-emitters rhenium-186 and rhenium-188 for use in radiotherapy

    International Nuclear Information System (INIS)

    Haefeli, U.


    The two radioisotopes Re-186 and Re-188 are highly favoured as therapeutic nuclides in nuclear medicine due to their unique radiation characteristics. For application in future (e.g. radiosynoviorthesis of the knee) we have chosen liposomes as biodegradable and non-irriting carriers. They were filled with radioactive Re in therapeutic doses of >370 MBq (10 mCi). 1. Small unilamellar liposomes (SUV's) of an average size of 28 nm were prepared by ultrasonic irradiation. They encapsulated only 0.64% of the perrhenate. 2. Liposomes carrying DTPA-SA in their bilayer (SA=octadecylamine) were produced in order to form a complex with Tc and Re. Technetium was complexed in high yield and the Tc-DTPA-liposome bindings were found to be stable when tested by dialysis. Similar attempts to complex Re were not successful because the amount of Sn(+II) required for the reduction was so high that the liposomes were destroyed. 3. Methylthiosemicarbazide (mts) was coupled covalently to aminomethylpolystyrene. These spheres were used as a very convenient and simple model for testing the labelling-yield and the stability of the Re-mts-complex. 4. Two isomers of the complex ReO(OEt)Cl 2 (PPh 3 ) 2 (Rephos) were characterized. These highly lipid-soluble inactive complexes were irradiated by neutrons and then used to prepare a mixed micelle with egg yolk lecithin and the detergent sodium deoxycholate. Liposomes were produced in a size of 60-80 nm in a very simple way by gelfiltration. Up to 53.5% of the radioactive Rephos was incorporated. Monitoring the stability by dialysis an initial loss of 10-15% and subsequent linear decrease were observed. The daily loss could be reduced to 1.0% by the addition of ascorbic acid. After 8 days, 82% of the initial activity still remained in the vesicles. 5. [ReO 2 (en) 2 ]Cl.2H 2 O and [ReO 2 (1,4,8,11-tetraazaundecane)]Cl were synthesized and characterized. 6. A direct enzymatic method to determine the remaining cholate in liposomes was developed, requiring only a simple dilution step. (author) 17 figs., 19 tabs., 111 refs

  19. Rhenium and technetium: application of organometallic rhenium and technetium complexes in radiopharmacy. Evaluation of optimal anchor groups

    International Nuclear Information System (INIS)

    Alberto, R.; Schibli, R.; Egli, A.; Schaffland, A.; Rattat, D.; Mueller, J.; Iftimia, M.; Berke, H.; Kaden, T.A.; Abram, U.


    The coordinative properties of the '[fac-M(CO) 3 ] + ' moiety (M= 188 Re, Re, 99 Tc and 99m Tc) have been investigated in water and organic solvents in order to evaluate the anchor group attached to antibodies, small peptides and biologically active molecules. The preparation of [M(OH 2 ) 3 (CO) 3 ] + has been improved in a way that this complex can be prepared from a Kit formulation. The '[fac-M(CO) 3 ] + ' has been transformed to the '[fac-M(NO)(CO) 2 ] 2+ ' moiety to achieve higher direct labelling yields and faster incorporation kinetics. (author) 5 figs

  20. Effects of Inlet Modification and Rocket-Rack Extension on the Longitudinal Trim and Low-Lift Drag of the Douglas F5D-1 Airplane as Obtained with a 0.125-Scale Rocket-Boosted Model between Mach Numbers of 0.81 and 1.64, TED No. NACA AD 399 (United States)

    Hastings, Earl C., Jr.; Dickens, Waldo L.


    A flight investigation was conducted to determine the effects of an inlet modification and rocket-rack extension on the longitudinal trim and low-lift drag of the Douglas F5D-1 airplane. The investigation was conducted with a 0.125-scale rocket-boosted model which was flight tested at the Langley Pilotless Aircraft Research Station at Wallops Island, Va. Results indicate that the combined effects of the modified inlet and fully extended rocket racks on the trim lift coefficient and trim angle of attack were small between Mach numbers of 0.94 and 1.57. Between Mach numbers of 1.10 and 1.57 there was an average increase in drag coefficient of about o,005 for the model with modified inlet and extended rocket racks. The change in drag coefficient due to the inlet modification alone is small between Mach numbers of 1.59 and 1.64

  1. 26 CFR 1.164-1 - Deduction for taxes. (United States)


    ... thereto, during the taxable year even though the taxpayer uses the accrual method of accounting for other... the taxable year within which paid or accrued, according to the method of accounting used in computing... to section 6362 (c)), an accrual method taxpayer shall use the cash receipts and disbursements method...

  2. 164th Symposium of the International Astronomical Union

    CERN Document Server

    Gilmore, G


    The concept of Stellar Populations has played a fundamental role in astronomy in the last few decades. It was introduced by Walter Baade after he was able to resolve the Andromeda Nebula and its companions into stars when he used red-sensitive plates and realised that there were two fundamentally different Herzsprung-Russell diagrams in our and these nearby galaxies (common stars in the solar neighborhood versus globular clusters). This result was published in two papers in 1944 in volume 100 of the Astrophysical Journal. Subsequent research gave the concept a much firmer basis and at the famous Vatican Symposium of 1957 resulted in a general scheme of the concept and a working hypothesis for idea's on the formation and evolution of the Galaxy. This has been a guiding principle of studies of our and other galaxies for decades. Some years ago it seemed to us appropriate to commemorate Baade's seminal work in 1994, when it would have its 50-th anniversary, and to review its present status and also its role in c...

  3. Publications | Page 164 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    African Urban Harvest : Agriculture in the Cities of Cameroon, Kenya and Uganda ... le temple et le marché : Réflexions à la croisée de la science, de la religion et ... Modern and Traditional Irrigation Technologies in the Eastern Mediterranean.

  4. People’s Republic of China Scientific Abstracts No. 164. (United States)


    of these articles. CONTENTS PAGE K’ O-HSUEH SHIH-YEN /SCIENTIFIC EXPERIMENT/ No 8, Äug 76 1 CHIH-WU HSUEH-PAO /ÄCTA BOTANICA SINICA/ Vol 18, No...AUTHOR: None ORG: Digital Control Teaching Group, Shanghai Sparetime Industrial University TITLE: "On the Principles of Digital Machine Tool Control...8217 College" SOURCE: Peking CHIH-WU HSUEH-PAO [AGTA BOTANICA SINICA] Vol 18 No 3, Sep 76 pp 198-201 EXCERPT OF ENGLISH ABSTRACT: The May-7 Agricultural

  5. 164 Meaning and Thematic Roles in the Igbo Language Chukwuma ...

    African Journals Online (AJOL)

    Ike Odimegwu

    Chukwuma O. Okeke*. Abstract. Semantics is ... syntactic level of words, phrases, sentences, and even larger units of discourse ... Semantics has been defined as a level of linguistics which studies meaning. ..... English Language. New York: ...

  6. 33 CFR 164.80 - Tests, inspections, and voyage planning. (United States)


    ... searchlights. (5) Terminal gear. Visual inspection of tackle; of connections of bridle and towing pendant, if.... (2) Terminal gear. Visual inspection of tackle; of connections of bridle and towing pendant, if... under-keel and vertical clearances (air-gaps) for all bridges, ports, and berthing areas; (v) Pre...

  7. What we do | Page 164 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Public Accountability Institutions in Pakistan and their Macroeconomic Impacts. Corruption is the single most important impediment to governance and the functioning of the economy in Pakistan. Central Asia, Far East Asia, South Asia, Pakistan. PROJECT ...

  8. 46 CFR 164.006-4 - Inspection and testing. (United States)


    ..., 30, and 60 minutes. (3) Excessive cracking, buckling, or disintegration may be considered cause for... finished product so as to meet the requirements of this specification, and any other conditions outlined on... tests, but the results shall be binding upon the approval of his product. The manufacturer will be...

  9. 33 CFR 157.164 - Use of inert gas system. (United States)


    ...) POLLUTION RULES FOR THE PROTECTION OF THE MARINE ENVIRONMENT RELATING TO TANK VESSELS CARRYING OIL IN BULK... oxygen content of 8 percent or less by volume. (ii) A positive atmospheric pressure. (5) During COW... instrumentation has an alarm that sounds in the cargo control room when the oxygen content exceeds 8 percent by...

  10. 45 CFR 164.410 - Notification by a business associate. (United States)


    ... RELATED REQUIREMENTS SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured Protected Health..., following the discovery of a breach of unsecured protected health information, notify the covered entity of such breach. (2) Breaches treated as discovered. For purposes of paragraph (1) of this section, a...

  11. 45 CFR 164.404 - Notification to individuals. (United States)


    ... REQUIREMENTS SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured Protected Health Information... the discovery of a breach of unsecured protected health information, notify each individual whose... been, accessed, acquired, used, or disclosed as a result of such breach. (2) Breaches treated as...

  12. 45 CFR 164.504 - Uses and disclosures: Organizational requirements. (United States)


    ... STANDARDS AND RELATED REQUIREMENTS SECURITY AND PRIVACY Privacy of Individually Identifiable Health... practice of the business associate that constituted a material breach or violation of the business... steps to cure the breach or end the violation, as applicable, and, if such steps were unsuccessful: (A...

  13. Publications - GMC 164 | Alaska Division of Geological & Geophysical (United States)

    Staines St. 10-09-23, Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 , Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 (Orion #1), OCS Y-0334

  14. 155 - 164 Influence of Mineral Nitrogen and Potassium Fertilizers

    African Journals Online (AJOL)


    Therefore, a field experiment was conducted on the main campus of ... The results of the experiment revealed that nitrogen had ... construction, animal feed etc (Morris et al., 2007; Wogi ..... would be wasteful for ware potato production. Table 3.

  15. 19 CFR 191.164 - Return to Customs custody. (United States)


    ... TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not Conform... return to Customs custody of distilled spirits, wine, or beer subject to refund of taxes under the...

  16. 164----8 Dec 2009 [Final Version].indd

    African Journals Online (AJOL)


    Dec 8, 2009 ... the issues in such struggles for justice appear more straightforward to outsiders than they do to ... that produced them, as well as the idea of the gospels as mirrors simply reflecting the ..... such counter-cultural reading communities must never ... to point to the way in which hegemony limits the possibility of.

  17. What we do | Page 164 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Countries that have ratified or acceded to the Convention on the Elimination of All Forms of Discrimination against Women (CEDAW) and the International Covenant on Economic, Social and Cultural Rights (ICESCR) are legally bound to put their provisions into practice. Argentina, South America, Iran, Middle East, Kenya, ...

  18. 46 CFR 164.023-13 - Production tests and inspections. (United States)


    ... Constant Rate of Traverse tensile testing machine, capable of initial clamp separation of ten inches and a... production testing on a lot must meet the following criteria for the lot to be shipped as Coast Guard... the acceptance testing values but not less than the performance minimums. (2) Length/weight values...

  19. 2012 December_ Edition_Vol 16_4_article_16

    African Journals Online (AJOL)

    AJRH Managing Editor

    Il faut accorder l'attention aux femmes au foyer et aux ... unwise decisions that would expose them to serious difficulties affecting their ... affecting adolescent sexual behavior26 appear to dominate .... that are not immune to errors such as memory lapses and ..... the decision making autonomy of women as those working and ...

  20. South of Sahara | Page 164 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... into usable policies — with particular attention on governance and gender issues. ... They include advances in maternal and child health, climate change .... Data on brain drain in Africa is scarce and inconsistent; however, statistics show a ...

  1. 33 CFR 164.38 - Automatic radar plotting aids (ARPA). (United States)


    ... or graphic form which clearly indicates the target's predicted motion. In this regard: .1ARPA...; .2An ARPA which is capable of presenting target course and speed information in graphic form, should... other display means. The collision avoidance system shall be energized from the interior communications...

  2. 2012 December_ Edition_Vol 16_4_article_14

    African Journals Online (AJOL)

    AJRH Managing Editor

    This comparative analysis entails the need to enforce the standards of family planning services in Tanzania (Afr ... services are scaled-up in both private and public facilities particularly in ... service providers and procurement of contraceptives.

  3. 33 CFR 164.39 - Steering gear: Foreign tankers. (United States)


    ..., that— (1) Transfers oil at a port or place subject to the jurisdiction of the United States; or (2) Otherwise enters or operates in the navigable waters of the United States, except a vessel described by... tanker— (1) For which the building contract is placed on or after June 1, 1979; (2) In the absence of a...

  4. 26 CFR 1.164-3 - Definitions and special rules. (United States)


    ... States, or a political subdivision of any of the foregoing, or by the District of Columbia. (b) Real... qualify as ad valorem. For example, a motor vehicle tax based on weight, model year, and horsepower, or... foreign country. A tax-imposed by a political subdivision of a foreign country is considered to be imposed...

  5. 46 CFR 164.003-4 - Inspections and tests. (United States)


    ... hours. The test box shall be cylindrical in shape, and as nearly as practicable 1/3 cubic foot in volume... kapok, and dividing the remainder by the volume of the kapok expressed in cubic feet. (e) Kapok fiber...

  6. South of Sahara | Page 164 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    “In 25 years, Africa will be empty of brains.” That dire warning, from Dr Lalla Ben Barka of the UN Economic Commission for Africa (ECA), reflects the growing alarm over Africa's increasing exodus of human capital. Data on brain drain in Africa is scarce and inconsistent; however, statistics show a continent losing the very ...

  7. 2012 December_ Edition_Vol 16_4_article18

    African Journals Online (AJOL)

    AJRH Managing Editor

    provide a comprehensive picture of the varied HIV prevalence and their ... evidence to better target interventions that are ... Cultural Organization), Phindile Sithole-Spong ... had led her to work in the sector and to seek to ... naïve and lacking in the years of life experience ... concern for donor institutions is how to balance.

  8. 2012 December_ Edition_Vol 16_4._article_2

    African Journals Online (AJOL)

    AJRH Managing Editor

    insemination with husband sperm, embryo donation from couples who have been verified to be HIV negative, .... Adverse effects on the hypothalamo-pituitary ovarian axis and reduced ovarian reserve have also been .... Polymerase chain reaction (PCR) test for HIV ..... -1 load in blood, semen and saliva : evidence for.

  9. 33 CFR 164.35 - Equipment: All vessels. (United States)


    ... to alter course 90 degrees with maximum rudder angle and constant power settings, for either full and... communication for relaying headings to the emergency steering station. Also, each vessel of 500 gross tons and over and constructed on or after June 9, 1995 must be provided with arrangements for supplying visual...

  10. 46 CFR 164.019-13 - Production quality control requirements. (United States)


    ... establish procedures for maintaining quality control of the materials used in production, manufacturing... place of manufacture unless alternate procedures have been accepted by the Commandant. (c) Production... manufactured. A new lot must be started whenever any change is made in materials, design, or production method...

  11. 29 CFR 1952.164 - Final approval determination. (United States)


    ... engaged in egg, poultry, or red meat production, or the post-harvest processing of agricultural or... Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION....142, with respect to any agricultural establishment where employees are engaged in “agricultural...

  12. 46 CFR 164.015-1 - Applicable specifications and standards. (United States)


    ..., CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL MATERIALS Plastic Foam, Unicellular, Buoyant, Sheet... following specification and standard, of the issue in effect on the date the plastic foam material is...) ASTM D4986-98, Standard Test Method for Horizontal Burning Characteristics of Cellular Polymeric...

  13. Vegetation - Suisun Marsh, Change 1999 to 2003 [ds164 (United States)

    California Natural Resource Agency — This vegetation mapping project of Suisun Marsh blends ground-based classification, aerial photo interpretation, and GIS editing and processing. The method is based...


    African Journals Online (AJOL)

    analyesd for iron concentrations as it affect the quality of drinking water as prescribed by WHO standards. ... exposed to direct solar radition leading to high evaporation making .... by handpumped borehole system. Water samples ... rocks and soils, use of galvanized hand pump fittings and ... irrigation with reference to Sub-.

  15. 164 Causes and Architectural Solution to Heat and Non- conducive ...

    African Journals Online (AJOL)

    Nekky Umera

    A cool roof, or green roof in addition to a radiant barrier (Ceiling) can help prevent .... Note greenhouse effect where frequencies generated by the sun (a hot object) can penetrate glass, after which they are absorbed within interior building ...

  16. Dicty_cDB: SFK164 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available anslated Amino Acid sequence *lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqa mgdwqrklsdy*HSTNAF... Frame A: *lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqa mgdwqrklsdy*HSTNAFGFWVIPNNIADRGFIFDKS

  17. All projects related to | Page 164 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Nutrition and Food Security in Uplands of Vietnam and Thailand ... Topic: SOCIAL CONFLICTS, Governance, PEACE KEEPING, SAFETY, .... RURAL URBAN MIGRATION, MANUFACTURING, SOUTH ASIA, INFORMAL SECTOR, Gender.

  18. Structures of Pseudomonas aeruginosa β-ketoacyl-(acyl-carrier-protein) synthase II (FabF) and a C164Q mutant provide templates for antibacterial drug discovery and identify a buried potassium ion and a ligand-binding site that is an artefact of the crystal form

    Energy Technology Data Exchange (ETDEWEB)

    Baum, Bernhard [Johannes Gutenberg-Universität, Staudinger Weg 5, 55128 Mainz (Germany); Lecker, Laura S. M.; Zoltner, Martin [University of Dundee, Dundee DD1 4EH, Scotland (United Kingdom); Jaenicke, Elmar [Johannes Gutenberg-Universität, Jakob Welder Weg 26, 55128 Mainz (Germany); Schnell, Robert [Karolinska Institutet, 17 177 Stockholm (Sweden); Hunter, William N., E-mail: [University of Dundee, Dundee DD1 4EH, Scotland (United Kingdom); Brenk, Ruth, E-mail: [Johannes Gutenberg-Universität, Staudinger Weg 5, 55128 Mainz (Germany)


    Three crystal structures of recombinant P. aeruginosa FabF are reported: the apoenzyme, an active-site mutant and a complex with a fragment of a natural product inhibitor. The characterization provides reagents and new information to support antibacterial drug discovery. Bacterial infections remain a serious health concern, in particular causing life-threatening infections of hospitalized and immunocompromised patients. The situation is exacerbated by the rise in antibacterial drug resistance, and new treatments are urgently sought. In this endeavour, accurate structures of molecular targets can support early-stage drug discovery. Here, crystal structures, in three distinct forms, of recombinant Pseudomonas aeruginosa β-ketoacyl-(acyl-carrier-protein) synthase II (FabF) are presented. This enzyme, which is involved in fatty-acid biosynthesis, has been validated by genetic and chemical means as an antibiotic target in Gram-positive bacteria and represents a potential target in Gram-negative bacteria. The structures of apo FabF, of a C164Q mutant in which the binding site is altered to resemble the substrate-bound state and of a complex with 3-(benzoylamino)-2-hydroxybenzoic acid are reported. This compound mimics aspects of a known natural product inhibitor, platensimycin, and surprisingly was observed binding outside the active site, interacting with a symmetry-related molecule. An unusual feature is a completely buried potassium-binding site that was identified in all three structures. Comparisons suggest that this may represent a conserved structural feature of FabF relevant to fold stability. The new structures provide templates for structure-based ligand design and, together with the protocols and reagents, may underpin a target-based drug-discovery project for urgently needed antibacterials.

  19. Structures of Pseudomonas aeruginosa β-ketoacyl-(acyl-carrier-protein) synthase II (FabF) and a C164Q mutant provide templates for antibacterial drug discovery and identify a buried potassium ion and a ligand-binding site that is an artefact of the crystal form

    International Nuclear Information System (INIS)

    Baum, Bernhard; Lecker, Laura S. M.; Zoltner, Martin; Jaenicke, Elmar; Schnell, Robert; Hunter, William N.; Brenk, Ruth


    Three crystal structures of recombinant P. aeruginosa FabF are reported: the apoenzyme, an active-site mutant and a complex with a fragment of a natural product inhibitor. The characterization provides reagents and new information to support antibacterial drug discovery. Bacterial infections remain a serious health concern, in particular causing life-threatening infections of hospitalized and immunocompromised patients. The situation is exacerbated by the rise in antibacterial drug resistance, and new treatments are urgently sought. In this endeavour, accurate structures of molecular targets can support early-stage drug discovery. Here, crystal structures, in three distinct forms, of recombinant Pseudomonas aeruginosa β-ketoacyl-(acyl-carrier-protein) synthase II (FabF) are presented. This enzyme, which is involved in fatty-acid biosynthesis, has been validated by genetic and chemical means as an antibiotic target in Gram-positive bacteria and represents a potential target in Gram-negative bacteria. The structures of apo FabF, of a C164Q mutant in which the binding site is altered to resemble the substrate-bound state and of a complex with 3-(benzoylamino)-2-hydroxybenzoic acid are reported. This compound mimics aspects of a known natural product inhibitor, platensimycin, and surprisingly was observed binding outside the active site, interacting with a symmetry-related molecule. An unusual feature is a completely buried potassium-binding site that was identified in all three structures. Comparisons suggest that this may represent a conserved structural feature of FabF relevant to fold stability. The new structures provide templates for structure-based ligand design and, together with the protocols and reagents, may underpin a target-based drug-discovery project for urgently needed antibacterials

  20. Effect of rhenium injection methods on emission characteristics of metalloceramic alloys

    International Nuclear Information System (INIS)

    Ostach, E.M.; Redega, K.P.; Savranskaya, E.S.; Chapajkina, L.A.


    Ni-29% Re-3.6% BaBe 3 O 5 pseudoalloy prepared by chemical mixing had a higher secondary electron emission coefficient than the same alloy prepared by mechanical mixing. This is apparently due to more uniform distribution of Re and BaBe 3 O 5 in the former case. In the chemical mixing method, rhenic acid and Ni, Ba, and Be nitrates were the starting materials. The metals were precipitated by means of (NH 4 ) 2 CO 3 . The precipitate was filtered out, dried, and partially reduced in H to give a fine powder containing the desired amounts of Ni, Re, and uniformly dispersed BaBe 3 O 5 . In the mechanical mixing method, Ni powder (8-10 μm), coarse Re powder (40-60 μm) or fine Re powder ( 3 O 5 obtained by preliminary calcining of a mixture of BaCO 3 and BeO were mixed

  1. Chemical reactivity of analogous technetium(V) and rhenium(V) dioxo complexes

    International Nuclear Information System (INIS)

    Kremer, C.; Kremer, E.; Leon, A.


    All complexes of the series [MO 2 L 2 ] + (M = Tc, Re, L = ethylenediamine (en), 1,3-diaminopropane (1,3-dap)) have been synthesized and their chemical reactivities investigated. The following properties were studied: stability of the aqueous solutions at different pH values, substitution kinetics, lipophilicity and protein binding. The complexes show very similar reactivity in aqueous solution. From a radiopharmaceutical point of view, no significant difference in their in vivo behavior is expected. (author) 12 refs.; 1 fig.; 3 tabs

  2. Tungsten-188/carrier-free rhenium-188 perrhenic acid generator system

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.; Lisic, E.C.; Mirzadeh, S.; Callahan, A.P.


    A generator system for providing a carrier-free radioisotope in the form of an acid comprises a chromatography column in tandem fluid connection with an ion exchange column, the chromatography column containing a charge of a radioactive parent isotope. The chromatography column, charged with a parent isotope, is eluted with an alkali metal salt solution to generate the radioisotope in the form of an intermediate solution, which is passed through the ion-exchange column to convert the radioisotope to a carrier-free acid form

  3. Preliminary results of transarterial rhenium-188 HDD lipiodol in the treatment of inoperable primary hepatocellular carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Sundram, Felix [Nuclear Medicine Department (The PET Centre), Singapore General Hospital, Block 2 Basement 1, Outram Road, 169608 (Singapore); Chau, Tran Chi Minh [Nuclear Medicine Department, Cho Ray Hospital, Ho Chi Minh City (Viet Nam); Onkhuudai, Peljee [Nuclear Medicine Department, First Central University Hospital, Ulaanbatax (Mongolia); Bernal, Patricia [Nuclear Medicine Department, Fundacion Santa Fe, Bogota (Colombia); Padhy, Ajit Kumar [Division of Human Health, International Atomic Energy Agency, Vienna (Austria)


    The radioconjugate was prepared by using an HDD (4-hexadecyl 1-2,9,9-tetramethyl-4,7-diaza-1,10-decanethiol) kit, and lipiodol. Over a period of 18 months, 70 patients received at least one treatment of radioconjugate. Some patients were re-treated if there was no evidence of disease progression. The level of radioconjugate administered was based on radiation-absorbed dose to critical normal organs, calculated following a ''scout'' dose of radioconjugate. The organs at greatest risk for radiation toxicity are the normal liver, the lung and the bone marrow. An Excel spreadsheet was used to determine maximum tolerated activity (MTA), defined as the amount of radioactivity calculated to deliver no more than 12 Gy to lungs, or 30 Gy to liver, or 1.5 Gy to bone marrow. Patients were followed for at least 12 weeks after therapy, until recovery from all toxicity. The clinical parameters evaluated included toxicity, response as determined by contrast-enhanced CT, palliation of symptoms, overall survival, performance status (Karnofsky) and hepatic function (Child's classification). Liver function tests, serum {alpha}-fetoprotein (AFP) levels and complete blood counts were done at each follow-up visit. In the majority of patients, the scout dose studies indicated the radiation absorbed dose to normalliver to be the limiting factor to the treatment dose, while in a few patients dose to lung was the limiting factor. Radiation dose to bone marrow was negligible and was thus not a factor for the MTA calculations. Side-effects were minimal and usually presented as loss of appetite, right hypochondrial discomfort and low-grade fever, even at high levels of administered radioactivity. The symptoms resolved with simple supportive therapy within 3 days of onset. Liver function tests at 24 and 72 h showed no significant changes and complete blood counts at 1 week, 4 weeks and 12 weeks showed no changes (no bone marrow suppression). Sixteen patients were treated in the dose escalation phase of the study, when the activities administered started at 1.8 GBq (50 mCi) and rose to 7.7 GBq (206 mCi). In the efficacy phase of the study a further 54 patients were treated. Both groups of patients are included in this paper. The treatment activity of {sup 188}Re-lipiodol administered transarterially ranged from 1.8 to 9.8 GBq (50-265 mCi), with a mean activity of 4.6 GBq (124 mCi). Survival at 3 months was 90%, and at 6 months, 60%; 19% survived for 1 year. Mean survival after treatment in the total treated group of 70 patients was 9.5 months, with a range of 1-18 months. The results of the study show that {sup 188}Re-lipiodol is a safe and cost-effective method to treat primary HCC via the transarterial route. (orig.)

  4. Electrochemical properties of manganese and rhenium complexes with organic redox ligands

    Energy Technology Data Exchange (ETDEWEB)

    Bumberg, A.A.; Milaev, A.G.; Okhlobystin, O.Yu.


    Pyrilium salts, 4H-pyrans and phenols that contain sigma-bound groups M(CO)/sub 3/ (M=Mn, Re) are investigated using the methods of classic and commutated polarography, disc rotating electrode with a ring and cyclic voltamperometry. The first single electron stage of electrochemical reduction of pyrilium cations containing sigma-bound substitutuents ..pi..=C/sub 5/H/sub 4/M(CO/sub 3/) (M=Mn, Re) takes place without any rupture of metal-carbon bonds and brings about rather stable vacant, metal organic radicals. Electrochemical dehydration of appropriate 4H-pyrans takes place through a stage of formation of these vacant radicals and complexes with the formation of metal organic pyrilium cations. Electrochemical oxidation of spatially hindrance phenols containing in 4-th position ..pi..-C/sub 5/H/sub 4/Re(CO/sub 3/) and C/sub 5/H/sub 4/Mn(CO)/sub 2/P(Ph)/sub 3/ substitutes takes place with the formation of appropriate cation radicals as intermediates and brings about vacant phenoxyls that contain charged organometallic group.

  5. The Oxidation of Rhenium(III) by Dioxygen in the Presence of Tri ...

    African Journals Online (AJOL)


    Both compounds were characterized by 1H NMR and infrared spectroscopy, and ... Microanalyses were obtained on a Carlo Erba EA 1108 elemental .... Spectral Characterization ... of this signal so far downfield indicates the existence of the.

  6. Chemistry of rhenium and technetium. II. Schiff base complexes with polyfunctional amino acids

    International Nuclear Information System (INIS)

    Du Preez, J.G.H.; Gerber, T.I.A.; Fourie, P.J.; Van Wyk, A.J.


    Amino acid Schiff base technetium(V) complexes of salicylaldehyde with l-cysteine, l-serine, l-histodine, l-threonine, l-glutamic acid and l-tryptophan have been preapred by direct reaction and by constituent combination. The amino acid part of the ligands coordinates to the technetium through the carboxylate group, while the other available functional group of the amino acids plays a more minor role as blocking group or in intramolecular bonding. 3 tables

  7. Dehydrogenation of light alkanes over rhenium catalysts on conventional and mesoporous MFI supports

    DEFF Research Database (Denmark)

    Rovik, Anne Krogh; Hagen, Anke; Schmidt, I.


    Recently, Re/HZSM-5 (Si/Al = 15) was shown to be an efficient catalyst for ethane dehydrogenation and aromatization at 823 K and atmospheric pressure. In this reaction, the major initial products were benzene, toluene and xylene (BTX), but increasing amounts of ethene were produced with time...

  8. Octachloro- And Octabromoditechnetate(III) And Their Rhenium(III) Congeners

    International Nuclear Information System (INIS)

    Poineau, F.; Sattelberger, A.P.; Conradson, S.D.; Czerwinski, K.R.


    The compound (n-Bu 4 N) 2 Tc 2 Br 8 was prepared by the metathesis of (n-Bu 4 N) 2 Tc 2 Cl 8 with HBr (g) in dichloromethane and characterized by X-ray absorption fine structure spectroscopy and UV-vis spectroscopy. Analysis of the data gives a Tc-Tc distance of 2.16(1) (angstrom) and a Tc-Br distance of 2.48(1) (angstrom). The Tc(III) oxidation state was inferred by the position of the edge absorption, which reveals a shift of 12 eV between (n-Bu 4 N) 2 Tc 2 Br 8 and NH 4 TcO 4 . The analogous shift between (n-Bu 4 N) 2 Tc 2 Cl 8 and NH 4 TcO 4 is 11 eV. The UV-vis spectrum of Tc 2 Br 8 2- in dichloromethane exhibits the characteristic (delta) → (delta)* transition at 13717 cm -1 . The M 2 X 8 2- (M = Re, Tc; X = Cl, Br) UV-vis spectra are compared, and the position of the (delta) → (delta)* transition discussed

  9. The gas phase oxide and oxyhydroxide chemistry of trace amounts of rhenium

    International Nuclear Information System (INIS)

    Eichler, R.; Eichler, B.; Jost, D.T.; Dressler, R.; Tuerler, A.; Gaeggeler, H.W.


    In preparation of experiments to investigate the chemical properties of bohrium (Bh, element 107) the behaviour of Re, its lighter homologue in group 7, was studied in different oxidizing chemical systems. The adsorption data of Re oxide and oxyhydroxide compounds on quartz surfaces were evaluated from results of thermochromatography experiments and confirmed in isothermal gas chromatography experiments applying 1 cm as standard state for the simple gas adsorption process: X(g) ↔ X(ads) (X = ReO 3 , HReO 4 ) ΔH ads (ReO 3 ) = -190 ± 10 kJ/mol; ΔS ads (ReO 3 ) = -179±30 J/mol K; ΔH ads (HReO 4 ) = -77 ± 5 kJ/mol; ΔS ads (HReO 4 ) = -187±50 J/mol K. An on-line separation method for oxides and oxyhydroxides of short lived Re isotopes using isothermal high temperature gas-solid adsorption chromatography was developed. Separation yields and times of group 7 elements from lanthanides (model for actinides), polonium and bismuth were determined using the model isotopes 169,170,174,176 Re, 152-155 Er, 151-154 Ho, 218 Po, and 214 Bi. An updated correlation function between the microscopic adsorption enthalpy and the macroscopic sublimation enthalpy was calculated from the experimental adsorption data of this work and literature data. (orig.)

  10. Platinum–Rhenium synergy on reducible oxide supports in aqueous-phase glycerol reforming

    NARCIS (Netherlands)

    Ciftci, A.; Eren, S.; Ligthart, D.A.J.M.; Hensen, E.J.M.


    A significant support effect was observed for the aqueous-phase reforming (APR) of glycerol over a series of Pt- and PtRe-loaded ceria-, ceria–zirconia-, zirconia-, and titania-supported catalysts. Glycerol conversion rates decreased in the order Pt/TiO2>Pt/ZrO2>Pt/CeZrO2>Pt/CeO2. Upon addition of

  11. Impact of triaxiality on the rotational structure of neutron-rich rhenium isotopes

    Directory of Open Access Journals (Sweden)

    M.W. Reed


    Full Text Available A number of 3-quasiparticle isomers have been found and characterised in the odd-mass, neutron-rich, 187Re, 189Re and 191Re nuclei, the latter being four neutrons beyond stability. The decay of the isomers populates states in the rotational bands built upon the 9/2−[514] Nilsson orbital. These bands exhibit a degree of signature splitting that increases with neutron number. This splitting taken together with measurements of the M1/E2 mixing ratios and with the changes observed in the energy of the gamma-vibrational band coupled to the 9/2−[514] state, suggests an increase in triaxiality, with γ values of 5°, 18° and 25° deduced in the framework of a particle-rotor model.

  12. Preliminary results of transarterial rhenium-188 HDD lipiodol in the treatment of inoperable primary hepatocellular carcinoma

    International Nuclear Information System (INIS)

    Sundram, Felix; Chau, Tran Chi Minh; Onkhuudai, Peljee; Bernal, Patricia; Padhy, Ajit Kumar


    The radioconjugate was prepared by using an HDD (4-hexadecyl 1-2,9,9-tetramethyl-4,7-diaza-1,10-decanethiol) kit, and lipiodol. Over a period of 18 months, 70 patients received at least one treatment of radioconjugate. Some patients were re-treated if there was no evidence of disease progression. The level of radioconjugate administered was based on radiation-absorbed dose to critical normal organs, calculated following a ''scout'' dose of radioconjugate. The organs at greatest risk for radiation toxicity are the normal liver, the lung and the bone marrow. An Excel spreadsheet was used to determine maximum tolerated activity (MTA), defined as the amount of radioactivity calculated to deliver no more than 12 Gy to lungs, or 30 Gy to liver, or 1.5 Gy to bone marrow. Patients were followed for at least 12 weeks after therapy, until recovery from all toxicity. The clinical parameters evaluated included toxicity, response as determined by contrast-enhanced CT, palliation of symptoms, overall survival, performance status (Karnofsky) and hepatic function (Child's classification). Liver function tests, serum α-fetoprotein (AFP) levels and complete blood counts were done at each follow-up visit. In the majority of patients, the scout dose studies indicated the radiation absorbed dose to normalliver to be the limiting factor to the treatment dose, while in a few patients dose to lung was the limiting factor. Radiation dose to bone marrow was negligible and was thus not a factor for the MTA calculations. Side-effects were minimal and usually presented as loss of appetite, right hypochondrial discomfort and low-grade fever, even at high levels of administered radioactivity. The symptoms resolved with simple supportive therapy within 3 days of onset. Liver function tests at 24 and 72 h showed no significant changes and complete blood counts at 1 week, 4 weeks and 12 weeks showed no changes (no bone marrow suppression). Sixteen patients were treated in the dose escalation phase of the study, when the activities administered started at 1.8 GBq (50 mCi) and rose to 7.7 GBq (206 mCi). In the efficacy phase of the study a further 54 patients were treated. Both groups of patients are included in this paper. The treatment activity of 188 Re-lipiodol administered transarterially ranged from 1.8 to 9.8 GBq (50-265 mCi), with a mean activity of 4.6 GBq (124 mCi). Survival at 3 months was 90%, and at 6 months, 60%; 19% survived for 1 year. Mean survival after treatment in the total treated group of 70 patients was 9.5 months, with a range of 1-18 months. The results of the study show that 188 Re-lipiodol is a safe and cost-effective method to treat primary HCC via the transarterial route. (orig.)

  13. A new series of rhenium VII compounds: sodium-rare earth perrhenates

    International Nuclear Information System (INIS)

    Slimane, Z.A.A.; Silvestre, J.-P.; Freundlich, William


    Synthesis by solid state reaction or in aqueous solution and radiocrystallographical study of the hexagonal sodium-rare earth perrhenates NaLn(ReO 4 ) 4 (Ln=La, Nd, Sm, Eu, Gd, Er) and of the tetragonal tetrahydrates NaLn(ReO 4 ) 4 , 4H 2 O (Ln=Eu, Gd, Er, Lu) [fr

  14. Study of oxygenated compounds of rhenium VII: actinide perrhenates, molybdo- and tungstoperrhenates

    International Nuclear Information System (INIS)

    Silvestre, J.-P.


    Crystallographic data for the perrhenates of the actinides and their hydrates. Study of the thermal stability of the perrhenates of the actinides. Double perrhenates of thorium and monovalent elements: Th 5 M 2 (ReO 4 ) 22 , ThM(ReO 4 ) 5 , ThM 2 (ReO 4 ) 6 with M = Na, K, Rb, Cs and Tl; ThM 3 (ReO 4 ) 7 with M=K, Rb, Cs and Tl are showing up in the study of the systems Th(ReO 4 ) 4 -M(ReO 4 ). Study of the possibilities of substitution Re 7+ -Mo 6+ and Re 7+ -W 6+ : non stoechiometric cubic compounds Thsub(1/2-x/4)(Msub(1-x)Resub(x)O 4 ) with 1/6 3 (MO 4 )(ReO 4 ) (M = Mo, W) are disclosed [fr

  15. Tungsten-zirconium carbide-rhenium alloys with extraordinary thermal stability

    Energy Technology Data Exchange (ETDEWEB)

    Yang, X.D. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Xie, Z.M.; Miao, S. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Liu, R.; Jiang, W.B. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Zhang, T., E-mail: [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Wang, X.P., E-mail: [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Fang, Q.F. [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); University of Science and Technology of China, Hefei 230026 (China); Liu, C.S., E-mail: [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei 230031 (China); Luo, G.N. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Liu, X. [Southwest Institute of Plasma Physics, Chengdu (China)


    The low recrystallization temperature (1200 °C) of pure W is a serious limitation for application as facing plasma materials in fusion reactor. In this paper, W-0.5wt.%ZrC-1wt.%Re (WZR) alloy with recrystallization temperature up to 1800 °C was prepared by mechanical milling and spark plasma sintering. The grain size of WZR alloy is about 2.6 μm, smaller than that of pure W (4.4 μm), which keeps unchanged until the annealing temperature increases to 1800 °C. Tensile tests indicate that the WZR alloys exhibit excellent comprehensive properties: the ductile to brittle transition temperature of WZR is in the range from 400 °C to 500 °C, about 200 °C lower than that of pure W prepared by the same process; the total elongation (TE) of WZR at 600 °C is above 30%, which is about 2 times that of pure W (at 700 °C). Meanwhile its tensile strength keeps ∼450 MPa before and after 1800 °C annealing as well as its TE increases after annealing. WZR alloy exhibits higher hardness (489HV) than that of pure W (453HV) at room temperature. Microstructure analysis indicates that the strengthening of nano-sized ZrC particles dispersion and Re solid solution improve tensile properties and thermal stability of WZR alloy.

  16. Synergistic effect of rhenium and ruthenium in nickel-based single-crystal superalloys

    Energy Technology Data Exchange (ETDEWEB)

    Yu, X.X. [Department of Physics, Tsinghua University, Beijing 100084 (China); Department of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Wang, C.Y., E-mail: [Department of Physics, Tsinghua University, Beijing 100084 (China); Central Iron and Steel Research Institute, Beijing 100081 (China); Zhang, X.N. [Institute of Microstructure and Property of Advanced Materials, Beijing University of Technology, Beijing 100124 (China); Yan, P. [Central Iron and Steel Research Institute, Beijing 100081 (China); Zhang, Z., E-mail: [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China)


    Highlights: • Re and Ru synergistic effects in nickel-based superalloys are investigated. • The Al site occupation of Re atom in the γ′ phase is observed directly. • The addition of Ru results in the repartitioning of Re to γ phase. -- Abstract: The microstructures of ternary Ni–Al–Re and quaternary Ni–Al–Re–Ru single-crystal alloys were investigated at atomic and electronic levels to clarify the synergistic effect of Re and Ru in nickel-based single-crystal superalloys. In the Ni–Al–Re alloy, it was directly observed that Re atom occupied the Al site of γ′ phase. In the Ni–Al–Re–Ru alloy, the mechanisms of Re repartition between γ and γ′ phases were proposed. In the dendritic cores, high concentrations of Re exceeded the solubility limit of γ′ phase and partitioned to γ phase, which led to the homogenization. In the interdendritic regions, Ru resulted in the repartitioning of Re to γ phase which was proved by transmission electron microscopy and first-principles calculations.

  17. High temperature strengthening mechanism of hafnium carbide in a tungsten-rhenium matrix

    International Nuclear Information System (INIS)

    Luo, A.; Shin, K.S.; Jacobson, D.L.


    The interrelationship between the testing temperature and HfC strength increment of an arc-melted W-3.6Re-0.4HfC was determined from 1950 K to 2980 K in a vacuum of better than 1.3x10 -5 Pa (10 -7 torr). The present research was focused on the characteristic temperature at which the rapid coarsening of HfC particles occurred and the effect of the second-phase particle size on the high temperature strength properties of this material. It was found that the HfC particle strengthening was effective in a W-Re matrix up to a characteristic temperature of 2450 K in the short-term tensile test. Carbon was found to be the rate-limiting solute in the HfC particle growth. The strength of HfC strengthened alloy at temperature above 0.5 T m is proportional to the square root of particle volume fraction. The yield strengths of W-3.6Re-0.26HfC calculated based on the particle statistical distribution had good agreement with the experimental values from 1950 K to 2980 K. Besides, an addition of 0.26 percent HfC in tungsten resulted in about 28 percent increase in the activation energy of plastic deformation at high temperatures

  18. A rhenium complex doped in a silica molecular sieve for molecular oxygen sensing: Construction and characterization. (United States)

    Yang, Xiaozhou; Li, Yanxiao


    This paper reported a diamine ligand and its Re(I) complex for potential application in oxygen sensing. The novelty of this diamine ligand localized at its increased conjugation chain which had a typical electron-withdrawing group of 1,3,4-oxadiazole. Electronic distribution of excited electrons and their lifetime were supposed to be increased, favoring oxygen sensing collision. This hypothesis was confirmed by single crystal analysis, theoretical calculation and photophysical measurement. It was found that this Re(I) complex had a long-lived emission peaking at 545 nm, favoring sensing application. By doping this complex into a silica matrix MCM-41, oxygen sensing performance and mechanism of the resulting composites were discussed in detail. Non-linear Stern-Volmer working curves were observed with maximum sensitivity of 5.54 and short response time of ~6 s. Copyright © 2015 Elsevier B.V. All rights reserved.

  19. Melanoma Therapy with Rhenium-Cyclized Alpha Melanocyte Stimulating Hormone Peptide Analogs

    Energy Technology Data Exchange (ETDEWEB)

    Thomas P Quinn


    Malignant melanoma is the 6th most commonly diagnosed cancer with increasing incidence in the United States. It is estimated that 54,200 cases of malignant melanoma will be newly diagnosed and 7,600 cases of death will occur in the United States in the year 2003 (1). At the present time, more than 1.3% of Americans will develop malignant melanoma during their lifetime (2). The average survival for patients with metastatic melanoma is about 6-9 months (3). Moreover, metastatic melanoma deposits are resistant to conventional chemotherapy and external beam radiation therapy (3). Systematic chemotherapy is the primary therapeutic approach to treat patients with metastatic melanoma. Dacarbazine is the only single chemotherapy agent approved by FDA for metastatic melanoma treatment (5). However, the response rate to Dacarbazine is only approximately 20% (6). Therefore, there is a great need to develop novel treatment approaches for metastatic melanoma. The global goal of this research program is the rational design, characterization and validation of melanoma imaging and therapeutic radiopharmaceuticals. Significant progress has been made in the design and characterization of metal-cyclized radiolabeled alpha-melanocyte stimulating hormone peptides. Therapy studies with {sup 188}Re-CCMSH demonstrated the therapeutic efficacy of the receptor-targeted treatment in murine and human melanoma bearing mice (previous progress report). Dosimetry calculations, based on biodistribution data, indicated that a significant dose was delivered to the tumor. However, {sup 188}Re is a very energetic beta-particle emitter. The longer-range beta-particles theoretically would be better for larger tumors. In the treatment of melanoma, the larger primary tumor is usually surgically removed leaving metastatic disease as the focus of targeted radiotherapy. Isotopes with lower beta-energies and/or shorter particle lengths should be better suited for targeting metastases. The {sup 177}Lu-DOTA-Re(Arg11)CCMSH and {sup 212}Pb-DOTA-Re(Arg11)CCMSH complexes were developed and synthesized to investigate its ability to target and deliver an effective dose to small melanoma tumors and metastatic deposits. Dosimetry calculations for {sup 188}Re-CCMSH and {sup 212}Pb/{sup 212}Bi[DOTA]-Re(Arg11)CCMSH were compared in the B16/F1 mouse melanoma flank tumor model to analyze the delivered dose to tumor and normal organs.

  20. Melanome Therapy with Rhenium Cyclized Alpha Melanocyte Stimulating Hormone Peptide Analogs. Final report

    International Nuclear Information System (INIS)

    Quinn, Thomas P.


    Malignant melanoma is the 6th most commonly diagnosed cancer with increasing incidence in the United States. It is estimated that 54,200 cases of malignant melanoma will be newly diagnosed and 7,600 cases of death will occur in the United States in the year 2003 (1). At the present time, more than 1.3% of Americans will develop malignant melanoma during their lifetime (2). The average survival for patients with metastatic melanoma is about 6-9 months (3). Moreover, metastatic melanoma deposits are resistant to conventional chemotherapy and external beam radiation therapy (3). Systematic chemotherapy is the primary therapeutic approach to treat patients with metastatic melanoma. Dacarbazine is the only single chemotherapy agent approved by FDA for metastatic melanoma treatment (5). However, the response rate to Dacarbazine is only approximately 20% (6). Therefore, there is a great need to develop novel treatment approaches for metastatic melanoma. The global goal of this research program is the rational design, characterization and validation of melanoma imaging and therapeutic radiopharmaceuticals. Significant progress has been made in the design and characterization of metal-cyclized radiolabeled alpha-melanocyte stimulating hormone peptides. Therapy studies with 188 Re-CCMSH demonstrated the therapeutic efficacy of the receptor-targeted treatment in murine and human melanoma bearing mice (previous progress report). Dosimetry calculations, based on biodistribution data, indicated that a significant dose was delivered to the tumor. However, 188 Re is a very energetic beta-particle emitter. The longer-range beta-particles theoretically would be better for larger tumors. In the treatment of melanoma, the larger primary tumor is usually surgically removed leaving metastatic disease as the focus of targeted radiotherapy. Isotopes with lower beta-energies and/or shorter particle lengths should be better suited for targeting metastases. The 177 Lu-DOTA-Re(Arg11)CCMSH and 212 Pb-DOTA-Re(Arg11)CCMSH complexes were developed and synthesized to investigate its ability to target and deliver an effective dose to small melanoma tumors and metastatic deposits. Dosimetry calculations for 188 Re-CCMSH and 212 Pb/ 212 Bi[DOTA]-Re(Arg11)CCMSH were compared in the B16/F1 mouse melanoma flank tumor model to analyze the delivered dose to tumor and normal organs.

  1. Improved Rhenium Thrust Chambers for In-Space Propulsion, Phase II (United States)

    National Aeronautics and Space Administration — Radiation-cooled, bipropellant thrust chambers are being considered for the ascent/descent engines and reaction control systems for NASA missions such as Mars Sample...

  2. Synthesis and marking with technetium and rhenium of a new radiotracer from para-toluidine

    International Nuclear Information System (INIS)

    Laouini, Emna


    The development of nuclear medicine is based on the research of new radiotracers especially those which target the neuro degenerative diseases. In fact, the precocious diagnostic of these diseases using the radiopharmaceuticals is the only mean to defeat it. The biodistribution of a new cytectrene derivative from para-toluidine, having a lipophilic character and a low molecular weight, showed a new radiotracer which is able to clear the blood brain barrier and characterised with prolonged brain retention. The features of this complex contribute to make it a radiopharmaceutical to diagnostic aim in clinical use.

  3. Speciation of rhenium and radiogenic osmium in molybdenite by sensitive XAFS

    International Nuclear Information System (INIS)

    Takahashi, Y.


    For the speciation of trace elements in rocks and minerals, fluorescence XAFS using energy-dispersive Ge detector has been often used. By this method, however, high quality fluorescence XAFS cannot be obtained under intense scattering and/or fluorescence from other predominant elements in the samples. To deal with this problem, we developed a system for fluorescence XAFS using a bent crystal analyzer to selectively extract fluorescence x-rays of a target element. In this paper, speciation of Os in molybdenite has been studied as an example of the application. Radiometric dating using various radioactive decay systems has been widely applied to various terrestrial and extraterrestrial materials. Although the information is closely related to chemical stabilities of parent and daughter nuclides and the reliability of the radiometric dating, there have been few investigations on the direct identification of the chemical state of the daughter nuclides. In this study, we chose Re-Os system in molybdenite for the possible application of this idea, since initial abundance of Os in molybdenite is often negligible compared with radiogenic Os in molybdenite rich in Re. From XAFS spectra, we have investigated local structure of Re and Os in molybdenite. Details of the analyses will be given in the presentation. (author)

  4. Pharmacokinetics and normal organ dosimetry following intraperitoneal rhenium-186-labeled monoclonal antibody

    International Nuclear Information System (INIS)

    Breitz, H.B.; Durham, J.S.; Fisher, D.R.


    Pharmacokinetics, biodistribution and radiation dose estimates following intraperitoneal administration of a 186 Re-labeled murine antibody, NR-LU-10, were assessed in 27 patients with advanced ovarian cancer. Quantitative gamma camera imaging and gamma counting of serum and intraperitoneal fluid radioactivity were used to obtain data for dosimetry estimation. The MIRD intraperitoneal model was used to estimate dose to normal organs from radioactivity within the peritoneal cavity. The absorbed dose to normal peritoneum was estimated in two ways: from the gamma camera activity and peritoneal fluid samples. Serum activity peaked at 44 hr and depended on the concentration of radioactivity in the peritoneal fluid. Mean cumulative urinary excretion of 186 Re was 50% by 140 hr. Estimates of radiation absorbed dose to normal organs in rad/mCi administered (mean ± s.d.) were whole body 0.7 ± 0.3; marrow 0.4 ±0.1; liver 1.9 ±0.9; lungs 1.3 ± 0.7; kidneys 0.2 ± 0.2; intestine 0.2 ±0.2. Peritoneal surface dose estimates varied depending on the volume of fluid infused and the method of dose determination. Using gamma camera data, the peritoneal dose ranged for 7 to 36 rad/mCi. Using peritoneal fluid sample data, the dose ranged from 2 to 25 rad/mCi. Significant myelosuppression was observed at marrow doses above 100 rad. Noninvasive methods of dose estimation for intraperitoneal administration of radioimmunoconjugates provide reasonable estimates when compared with previously described methods. 31 refs., 6 figs., 2 tabs

  5. Dissociative chemisorption of N2 on Rhenium: Dynamics at high impact energies

    DEFF Research Database (Denmark)

    Henriksen, Niels Engholm; Billing, Gert D.; Hansen, Flemming Yssing


    forcing model. It is found that the energy transfer from the molecule to the phonons of the crystal is very significant. The smaller than unity dissociative sticking probability found experimentally even at the highest impact energies well above the barrier energy can be accounted for by the Landau...

  6. Therapeutic efficacy and dosimetric aspects of Rhenium-188-HEDP in bone pain palliation

    International Nuclear Information System (INIS)

    Liepe, Knut


    Full text: Bone metastases are a frequent complication of cancer, occurring in up 70% of patients suffering from advanced breast or prostate cancer and often present with severe bone pain. In this purpose the radionuclide therapy is a useful option for cancer patients. Different radionuclides are described, such as 89 Sr, 32 P, 153 Sm-EDTMP, 186 Re-HEDP, 131 I-BDP3, 90 Y, 117mSn-DTPA, 188 Re-HEDP and 188 Re-DMSA. The most experiences are available for 89 Sr. An indication for the treatment are patients with osteoblastic metastases, bone pain, sufficient bone marrow function and at least of three bone metastases visualized in bone scan. A bisphosphonate therapy, a chemotherapy with lower bone marrow toxicity or a local field external beam radiotherapy represent no contraindications, especially because the reported synergistic effects to the systemic radionuclide therapy. In 33 treated patients (breast and prostate cancer) we investigated the effect of 188 Re-HEDP on pain relief, analgesic intake and impairment of bone marrow function. There were an improvement on the Karnofsky performance scale from 74 7% to 85 9% 12 weeks after therapy (p= 0.001). The pain score showed a maximum decrease from 44 ± 18% to 27 ± 20% in the 3rd to the 8th week after therapy (p = .009) and 76% had a pain relief (20% were pain free). The maximal differences between the values of platelets and leukocytes before and after therapy were not statistically significant (p = 0.021 and p = 0.094). In 105 investigated patients treated with different radionuclides ( 89 Sr, 153 Sm-EDTMP, 186 Re-HEDP, 188 Re-HEDP and 89 Sr in combination with chemotherapy) no different therapeutic efficacy of the treatments were observed. In dose calculation of 188 Re-HEDP a radiation dose of 3.83 ± 2.01 mGy/MBq (12.6 Gy for 3300 MBq) for bone metastases and 0.61 ± 0.21 mGy/MBq (2 Gy for 3300 MBq) were found. With the introducing of radionuclide treatments with chemotherapy and repeated treatments, the calculation of bone marrow radiation-absorbed dose is more significant. But the dose calculation by MIRDOSE based on the hypothesis of a homogeneous distribution of the radiopharmaceutical in the bone metastases and a 50% uptake in the cortical and trabecular bone. For calculation of the uptake animals studies were developed to induce osteoblastic bone metastases by intra-ossaer administration of prostate cancer cells. In autoradiographic studies (BAS 500, Fuji; resolution of 0.5 μm) bone metastases and skeleton were investigated after 188 Re-HEDP. In the bone metastases a tumour to muscle ratio (T/M) of 48 ± 7 and a tumour to non-tumour ratio (T/NT) of 9.7 ± 1.5 (7.5 to 11.7) was found. The distribution in the metastases was inhomogeneous with a minimal T/NT of 7.0 ± 1.0 (4.9 to 8.5) and a maximal T/NT of 17.4 ± 2.7 (11.6 to 22.6). The ratio between the trabecular and cortical bone in non-tumour bone was 68.6 ± 7.2% to 31.4 ± 7.2 %. The inhomogeneous distribution could favour high beta energy radionuclides for a more homogeneous dose distribution in bone metastases. The MIRDOSE calculation underestimates the bone marrow dose; the uptake in the trabecular bone is higher than in the cortical part. The higher uptake in the trabecular bone decreases the hypothetic dose reducing effect of low beta energy radionuclides to the bone marrow. (author)

  7. Phosphorescent rhenium emitters based on two electron-withdrawing diamine ligands: Structure, characterization and electroluminescent performance

    Energy Technology Data Exchange (ETDEWEB)

    Rui, Mei, E-mail: [College of Science, Hebei North University, Zhangjiakou 075000, Hebei (China); Yuhong, Wang [College of Science, Hebei North University, Zhangjiakou 075000, Hebei (China); Yinting, Wang; Na, Zhang [Communication Training Base of The Headquarters of The General Staff, Zhangjiakou 075100, Hebei (China)


    In this paper, two diamine ligands having electron-withdrawing oxadiazole group and their corresponding Re(I) complexes were synthesized. Their geometric structure, electronic transition, photophysical property, thermal stability and electrochemical property were discussed in detail. Experimental data suggested that both complexes were promising yellow emitters with suited energy levels and good thermal stability for electroluminescent application. The correlation between emission performance and electron-withdrawing group was analyzed. It was found that electron-withdrawing group favored emission performance improvement. Their electroluminescence performance was also explored. Yellow electroluminescence was observed with maximum brightness of 1743 cd/m{sup 2}. - Highlights: • Oxadiazole derived diamine ligands and their Re(I) complexes were synthesized. • Their characters and properties were analyzed and compared in detail. • Electron-withdrawing group was proved to be positive for PL improvement. • Electroluminescence was obtained with maximum brightness of 1743 cd/m{sup 2}.

  8. Rhenium-osmium systematics of calcium-aluminium-rich inclusions in carbonaceous chondrites (United States)

    Becker, H.; Morgan, J.W.; Walker, R.J.; MacPherson, G.J.; Grossman, J.N.


    The Re-Os isotopic systematics of calcium-aluminium-rich inclusions (CAIs) in chondrites were investigated in order to shed light on the behavior of the Re-Os system in bulk chondrites, and to constrain the timing of chemical fractionation in primitive chondrites. CAIs with relatively unfractionated rare earth element (REE) patterns (groups I, III, V, VI) define a narrow range of 187Re/188Os (0.3764-0.4443) and 187Os/188Os (0.12599-0.12717), and high but variable Re and Os abundances (3209-41,820 ppb Os). In contrast, CAIs that show depletions in highly refractory elements and strongly fractionated REE patterns (group II) also show a much larger range in 187Re/188Os (0.409-0.535) and 187Os/188Os (0.12695-0.13770), and greater than an order of magnitude lower Re and Os abundances than other groups (e.g., 75.7-680.2 ppb Os). Sixteen bulk CAIs and CAI splits plot within analytical uncertainty of a 4558 Ga reference isochron, as is expected for materials of this antiquity. Eight samples, however, plot off the isochron. Several possible reasons for these deviations are discussed. Data for multiple splits of one CAI indicate that the nonisochronous behavior for at least this CAI is the result of Re-Os reequilibration at approximately 1.6 Ga. Thus, the most likely explanation for the deviations of most of the nonisochronous CAIs is late-stage open-system behavior of Re and Os in the asteroidal environment. The 187Os/188Os-Os systematics of CAIs are consistent with previous models that indicate group II CAIs are mixtures of components that lost the bulk of their highly refractory elements in a previous condensation event and a minor second component that provided refractory elements at chondritic relative proportions. The high Re/Os of group II CAIs relative to other CAIs and chondrite bulk rocks may have been caused by variable mobilization of Re and Os during medium- to low-temperature parent body alteration ??4.5 Ga ago. This model is favored over nebular models, which pose several difficulties. The narrow range of 187Os/188Os in group I, III, V, and VI bulk CAIs, and the agreement with 187Os/188Os of whole rock carbonaceous chondrites suggest that on a bulk inclusion scale, secondary alteration only modestly fractionated Re/Os in these CAIs. The average of 187Os/188Os for group I, III, V, and VI CAIs is indistinguishable from average CI chondrites, indicating a modern solar system value for 187Os/188Os of 0.12650, corresponding to a 187Re/188Os of 0.3964. Copyright ?? 2001 Elsevier Science Ltd.

  9. Development of the method of the preparation of albumin microspheres labelled 188-rhenium

    International Nuclear Information System (INIS)

    Dyomin, D.N.; Petriev, V.M.


    The basis of effective and wide usage of radioisotope methods in diagnostic and therapy of tumoral and not tumoral diseases is development of new radiopharmaceuticals, described by high functional value and safety. The efficiency and safety of radiopharmaceuticals are defined by the nuclear - physical characteristics of radionuclides, and also physicochemical and biological properties of carriers for selective delivery of radionuclides. Therefore an important direction in radiopharmacy is the search, the development and estimation of particular properties radiopharmaceuticals for radiotherapy of tumoral and not tumoral diseases, where the main thing is the choice of optimal carriers and radionuclides. At present time two types of carriers are used for delivery radionuclides: soluble preparations and insoluble so-called microparticles. (authors)

  10. Synthesis and structure of a rhenium(V) complex containing a ...

    African Journals Online (AJOL)

    methylphenyl) salicylideneimine) was prepared by the reaction of [NH4][ReO4] with H3mps in the presence of triphenylphosphine and hydrochloric acid in glacial acetic acid. Crystallization from acetonitrile gave the product 1.CH3CN.

  11. Adsorption properties of technetium and rhenium for hybrid microcapsules enclosing Toa extractant

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Y.; Mimura, H.; Niibori, Y. [Tohoku University, Graduate School of Engineering, Department of Quantum Science and Energy Engineering, Aramaki-Aza-Aoba 6-6-01-2, Aoba-ku, Sendai-shi, Miyagi-ken, 980-8579 Japan (Japan); Koyama, S.; Ohnishi, T., E-mail: [Japan Atomic Energy Agency, O-arai Research and Development Center, Fuels and Materials Department, Alpha-Gamma Section, Narita-cho 4002, O-arai-machi, Ibaraki, 311-1393 Japan (Japan)


    Special attention has been given to the separation and recovery of the VII-group elements Tc and Re, in relation to the partitioning of high-level liquid waste (HLLW) generated from the nuclear fuel reprocessing process. In this study, a tertiary amine (tri-n-octylamine Toa), which is effective for the extraction of oxo anions, was encapsulated in a calcium alginate gel polymer (CaALG), and the adsorption behaviours of TcO{sub 4} and ReO{sub 4}{sup -} in the presence of nitric acid and hydrochloric acid were examined by using calcium alginate microcapsules (M Cs) enclosing Toa extractant (Toa-CaALG M Cs). The order of the distribution coefficient K{sub d} for different oxo anions at 0.1 M HNO{sub 3} was ReO{sub 4}{sup -}> WO{sub 4}{sup 2-}> CrO{sub 4}{sup 2-} {approx} MoO{sub 4}{sup 2-}>> SeO{sub 3}{sup 2-}. Toa-CaALG still exhibited high uptake ability for ReO{sub 4}{sup -} even after irradiation with {sup 60}Co {gamma}-rays (dose: 17.6 kGy). Uptake of TcO{sub 4}{sup -} in the presence of 1 M HNO{sub 3} was readily attained within 3 h. Relatively large K{sub d} values above 10{sup 2} cm{sup 3}/g were obtained for Toa-CaALG in the presence of 0.01 {approx} 1 M HNO{sub 3}. All of the TcO{sub 4}{sup -} was successfully adsorbed by Toa-CaALG from the simulated HLLW. The adsorbed TcO{sub 4}{sup -} was then effectively eluted with 5 M or 7 M HNO{sub 3} solution. Further, the selective uptake of ReO{sub 4}{sup -} (a chemical analogue of TcO{sub 4}{sup -}) was confirmed by using actual HLLW (Fbr, Joyo, JAEA), and uptake (%) above 99% was obtained. Toa-CaALG was thus effective for the selective separation and recovery of TcO{sub 4}{sup -} and ReO{sub 4}{sup -} from waste solutions containing highly concentrated HNO{sub 3} and NaNO{sub 3}. Microencapsulation techniques with alginate gel polymer can be applied to other ion exchangers and extractants, and the M Cs immobilizing these adsorbents are effective for the advanced separation of various radionuclides, rare metals and toxic elements. (Author)

  12. Rhenium-Promoted C-C Bond-Cleavage Reactions of Internal Propargyl Alcohols. (United States)

    Lee, Kui Fun; Bai, Wei; Sung, Herman H Y; Williams, Ian D; Lin, Zhenyang; Jia, Guochen


    The first examples of C-C bond cleavage reactions of internal propargyl alcohols to give vinylidene complexes are described. Treatment of [Re(dppm) 3 ]I with RC≡CC(OH)R'R'' (R=aryl, alkyl; C(OH)R'R''=C(OH)Ph 2, C(OH)Me 2 , C(OH)HPh, C(OH)H 2 ) produced the vinylidene complexes ReI(=C=CHR)(dppm) 2 with the elimination of C(O)R'R''. Computational studies support that the reactions proceed through a β-alkynyl elimination of alkoxide intermediates Re{OC(R')(R'')C≡CR}(dppm) 2 . © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. RT 164: Design and Development Tools for the Systems Engineering Experience Accelerator - Part 3 (United States)


    is a multidisciplinary practice and is much of an art as it is a science. While a waterfall model of education can provide a background of domain...5 Simulation Modeler ...21 Simulation Model Development

  14. 45 CFR 164.508 - Uses and disclosures for which an authorization is required. (United States)


    ... is in the form of: (A) A face-to-face communication made by a covered entity to an individual; or (B... must obtain an authorization for any use or disclosure of psychotherapy notes, except: (i) To carry out... which students, trainees, or practitioners in mental health learn under supervision to practice or...

  15. SU-F-T-164: Investigation of PRESAGE Formulation On Signal Quenching in a Proton Beam

    International Nuclear Information System (INIS)

    Carroll, M; Alqathami, M; Ibbott, G


    Purpose: The radiochromic polyurethane PRESAGE by Heuris Pharma has had limited applications with protons because of a dose response dependence on LET resulting in signal quenching in the Bragg peak. This is due to the radical initiator, a halocarbon, radically recombining in high-LET irradiations. This study investigated the use of alternative halocarbons at various chemical concentrations to determine their significance in signal quenching. Methods: PRESAGE was manufactured in-house and cast in small volume cuvettes (1×1×4cm^3). Several compositions were evaluated to determine the influence of the radical initiator component. Mixtures contained one of two halocarbons, chloroform or bromoform, at concentrations of 5%/10%/15%(w/w). A large volume, cylindrical PRESAGE dosimeter made following the mixture described by Heuris Pharma, 4cm(D)×8.5cm(H), was irradiated with 200-MeV protons to study regions of low- and high-LET along a 10cm spread out Bragg peak isodose profile. Depths corresponding to regions of low quenching ( 20%) were determined. These depths were used for cuvette placement in a solid water phantom. Samples of each formulation were placed at each depth and irradiated to doses between 0 and 10Gy. Results: The cuvettes indicated different levels of quenching for different radical initiator types, concentrations, and total doses. Chloroform formulations showed reduced quenching from 29%(5%-w/w) to 21%(15%-w/w) while bromoform reduced quenching from 27%(5%-w/w) to 17%(15%-w/w). The reduction in quenching was found to be non-linear with concentration of radical initiator. A quenching dose-dependency was also found that changed with formulation. In all cases, quenching was relatively consistent from 0–5Gy but increased at 10Gy. The quenching decreased as concentrations of radical initiator increased. Conclusion: The radical initiator component in PRESAGE is correlated with the signal quenching observed in proton irradiations and formulation adjustments show promise as a method of reducing this quenching. Future work will further investigate concentration limits and optimize the formulation. Grant number 5RO1CA100835

  16. SU-F-T-164: Investigation of PRESAGE Formulation On Signal Quenching in a Proton Beam

    Energy Technology Data Exchange (ETDEWEB)

    Carroll, M; Alqathami, M; Ibbott, G [UT MD Anderson Cancer Center, Houston, TX (United States)


    Purpose: The radiochromic polyurethane PRESAGE by Heuris Pharma has had limited applications with protons because of a dose response dependence on LET resulting in signal quenching in the Bragg peak. This is due to the radical initiator, a halocarbon, radically recombining in high-LET irradiations. This study investigated the use of alternative halocarbons at various chemical concentrations to determine their significance in signal quenching. Methods: PRESAGE was manufactured in-house and cast in small volume cuvettes (1×1×4cm^3). Several compositions were evaluated to determine the influence of the radical initiator component. Mixtures contained one of two halocarbons, chloroform or bromoform, at concentrations of 5%/10%/15%(w/w). A large volume, cylindrical PRESAGE dosimeter made following the mixture described by Heuris Pharma, 4cm(D)×8.5cm(H), was irradiated with 200-MeV protons to study regions of low- and high-LET along a 10cm spread out Bragg peak isodose profile. Depths corresponding to regions of low quenching (<3%) and high quenching (>20%) were determined. These depths were used for cuvette placement in a solid water phantom. Samples of each formulation were placed at each depth and irradiated to doses between 0 and 10Gy. Results: The cuvettes indicated different levels of quenching for different radical initiator types, concentrations, and total doses. Chloroform formulations showed reduced quenching from 29%(5%-w/w) to 21%(15%-w/w) while bromoform reduced quenching from 27%(5%-w/w) to 17%(15%-w/w). The reduction in quenching was found to be non-linear with concentration of radical initiator. A quenching dose-dependency was also found that changed with formulation. In all cases, quenching was relatively consistent from 0–5Gy but increased at 10Gy. The quenching decreased as concentrations of radical initiator increased. Conclusion: The radical initiator component in PRESAGE is correlated with the signal quenching observed in proton irradiations and formulation adjustments show promise as a method of reducing this quenching. Future work will further investigate concentration limits and optimize the formulation. Grant number 5RO1CA100835.

  17. Selected translated abstracts of Russian-language climate-change publications, III aerosols: Issue 164

    Energy Technology Data Exchange (ETDEWEB)

    Razuvaev, V.N.; Ssivachok, S.G. [All-Russian Research Inst. of Hydrometeorological Information-World Data Center, Obninsk (Russian Federation)


    This report presents abstracts in Russian and translated into English of important Russian-language literature concerning aerosols as they relate to climate change. In addition to the bibliographic citations and abstracts translated into English, this report presents the original citations and abstracts in Russian. Author and title indexes are included to assist the reader in locating abstracts of particular interest.

  18. 164. Extracción endovascular de dispositivos cardíacos infectados


    Gutiérrez Carretero, E.; Hernández Fernández, A.; Borrego Domínguez, J.M.; Alarcón, A.; Eslava, J.; Bibiloni Lage, I.; Ruiz Solano, E.; Romero Rodríguez, N.


    La tasa de infección publicada en la literatura para implantes de marcapasos y desfibriladores es del 1-7%, siendo en nuestro hospital de 1,5% para marcapasos y 3% para desfibrilador automático implantable (DAI), con una mortalidad del 10%. En un estudio realizado por la Sociedad Andaluza de Enfermedades Infecciosas sobre seis hospitales andaluces, se han detectado 243 infecciones de MP/DAI entre 1998-2008, de las cuales un 44,5% han sido infecciones locales y en un 55,5% infecciones sistémic...

  19. 26 CFR 1.164-2 - Deduction denied in case of certain taxes. (United States)


    ... of 1939. (c) Estate and gift taxes. Estate, inheritance, legacy, succession, and gift taxes. (d.... (f) Federal duties and excise taxes. Federal import or tariff duties, business, license, privilege... in the conduct of any trade or business or, in the case of an individual for the production or...

  20. Dugway Proving Ground: Closure Plan Module 2, for SWMUs 20, 164, 166 and 170 (United States)


    fighting, and/or singing. If the condition persists, a mask-like face, retropulsion or propulsion and a Parkinson -like syndrome develop (Mena et al...include pharyngitis, dysphagia , abdominal pain, nausea and vomiting, bloody diarrhea, and shock. Later swelling of the salivary glands, stomatitis