WorldWideScience

Sample records for rheinische fachhochschule kln

  1. KLN theorem and infinite statistics

    International Nuclear Information System (INIS)

    Grandou, T.

    1992-01-01

    The possible extension of the Kinoshita-Lee-Nauenberg (KLN) theorem to the case of infinite statistics is examined. It is shown that it appears as a stable structure in a quantum field theory context. The extension is provided by working out the Fock space realization of a 'quantum algebra'. (author) 2 refs

  2. Crystal growth and structure of KLnP/sub 4/O/sub 12/

    International Nuclear Information System (INIS)

    Guangyan, H.; Shuzhen, L.; Shuying, Y.; Mingyu, C.

    1985-01-01

    Potassium rare earth tetraphosphates KLnP/sub 4/O/sub 12/ are a kind of polyphosphates of rare earths with unique properties and structures. KNdP/sub 4/O/sub 12/ is a high-Nd-concentration laser material with a non-centrosymmetric space group P2, yielding linear and nonlinear optical properties. α-KErP/sub 4/O/sub 12/ might be used as a material for engineering device purpose. KTbP/sub 4/O/sub 12/ can emit strong green fluorescence, it might be a kind of a new crystal material for laser or luminescence. In order to search for new crystal materials and to study the correlations among the composition, structures and the properties of rare earth compounds, the crystal growth of KLnP/sub 4/O/sub 12/ and their structures are studied in this paper

  3. The KLM plus KLN Auger electron spectrum of rubidium in different matrices

    Czech Academy of Sciences Publication Activity Database

    Inoyatov, A. K.; Kovalík, Alojz; Perevoshchikov, L. L.; Filosofov, D. V.; Vénos, Drahoslav; Lee, B. Q.; Ekman, J.; Baimukhanova, A.

    2017-01-01

    Roč. 50, č. 15 (2017), č. článku 155001. ISSN 0953-4075 R&D Projects: GA ČR(CZ) GAP203/12/1896; GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : Rb-85 * Sr-85 * KLM- * KLN-Auger transitions * atomic environment * chemical shift * multiconfiguration Dirac-Hartree-Fock calculations Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders OBOR OECD: Nuclear physics Impact factor: 1.792, year: 2016

  4. Sr2+ and Cs+ ion exchange properties of KLn(PO3)4: Ln = Ce and Eu

    International Nuclear Information System (INIS)

    Samatha, B.; Achary, S.N.; Tyagi, A.K.; Ramkumar, Jayshree; Chandramouleeswaran, S.

    2014-01-01

    With the aim to study the potential of layered phosphates as ion exchangers two stoichiometric compositions as KLn(PO 3 ) 4 with Ln = Ce and Eu were prepared by solid state reaction and characterized by powder X-ray diffraction method. The Cs + and Sr 2+ exchange properties of both materials were investigated using standard solutions of Sr 2 + or Cs + in low acidic aqueous medium

  5. CAE Application and Certification for Industrial and Educational Customers: The Case of University-Industry Cooperation between EPLAN and RFH

    Directory of Open Access Journals (Sweden)

    Duško Lukač

    2010-12-01

    Full Text Available The paper presents examples of the application of the currently most used CAE software for electrical engineering and project planning EPLAN Electric P8 as well as novel international certification model, of the so called Eplan Certified Engineer (ECE and EPLAN Certified Student, based on cooperation between Rheinische Fachhochschule Köln gGmbH – University of Applied Sciences in cooperation with EPLANSoftware and Service company, a market leader in development and training in electro CAE. It argues that the successful interface management, communication plan and the costumer oriented technical-didactical model of the concept has been essential for the viability and success of the courses. It concludes that cooperation between the industry and university enhances the university’s and firm’s reputation with consumers and environmental competitors and has had positive financial effects for the both parties. It concludes that on the whole, these joint certification programs have a convenient side effect, like to be the successful way for the development of high-quality training opportunities for the students.

  6. Polyacrylic acid grafted kaolinite via a facile ‘grafting to’ approach based on heterogeneous esterification and its adsorption for Cu2+

    Science.gov (United States)

    Zhao, Ping; Zhou, Qi; Yan, Chunjie; Luo, Wenjun

    2017-03-01

    Kaolinite (KLN) was successfully decorated by polyacrylic acid (PAA) brushes via a facile ‘one-step’ manner in this study. This process was achieved by heterogeneous esterification between carboxyl on the PAA chains and hydroxyl on the KLN in the presence of Al3+ as catalyst. The prepared composite (denoted as PAA-g-KLN) was characterized by Fourier transform infrared spectroscopy (FTIR), x-ray diffraction pattern (XRD), Field emission scanning electron microscopy (FE-SEM) and thermogravimetry (TG) to confirm the successful grafting of PAA brushes on the surface of KLN. Subsequently, the PAA-g-KLN was used as adsorbent for the removal of Cu2+ from wastewater. Due to the introduction of abundant and highly accessible carboxyl groups on the surface of kaolinite, PAA-g-KLN exhibited an enhanced adsorption performance than raw kaolinite, which could be up to 32.45 mg·g-1 at 45 °C with a fast adsorption kinetic. Theoretical models analysis revealed that Langmuir isotherm model and the pseudo second-order model were more suitable for well elucidation of the experimental data. In addition, the regeneration experiment showed that the PAA-g-KLN could still keep a satisfactory adsorption capacity (>65%) by being reused for 6 consecutive cycles. The study provides an easy and rapid method for surface polyelectrolyte modification on inorganic mineral as a promising adsorbent to remove Cu2+ from aqueous solution.

  7. Kaolinite Nanocomposite Platelets Synthesized by Intercalation and Imidization of Poly(styrene-co-maleic anhydride

    Directory of Open Access Journals (Sweden)

    Pieter Samyn

    2015-07-01

    Full Text Available A synthesis route is presented for the subsequent intercalation, exfoliation and surface modification of kaolinite (Kln by an imidization reaction of high-molecular weight poly(styrene-co-maleic anhydride or SMA in the presence of ammonium hydroxide. In a first step, the intercalation of ammonolyzed SMA by guest displacement of intercalated dimethylsulfoxide has been proven. In a second step, the imidization of ammonolyzed SMA at 160 °C results in exfoliation of the kaolinite layers and deposition of poly(styrene-co-maleimide or SMI nanoparticles onto the kaolinite surfaces. Compared with a physical mixture of Kln/SMI, the chemically reacted Kln/SMI provides more efficient exfoliation and hydrogen bonding between the nanoparticles and the kaolinite. The kaolinite nanocomposite particles are synthesized in aqueous dispersion with solid content of 65 wt %. The intercalation and exfoliation are optimized for a concentration ratio of Kln/SMI = 70:30, resulting in maximum intercalation and interlayer distance in combination with highest imide content. After thermal curing at 135 °C, the imidization proceeds towards a maximum conversion of the intermediate amic acid moieties. The changes in O–H stretching and kaolinite lattice vibrations have been illustrated by infrared and FT-Raman spectroscopy, which allow for a good quantification of concentration and imidization effects.

  8. Pi-pi Stacking Mediated Cooperative Mechanism for Human Cytochrome P450 3A4

    Directory of Open Access Journals (Sweden)

    Botao Fa

    2015-04-01

    Full Text Available Human Cytochrome P450 3A4 (CYP3A4 is an important member of the cytochrome P450 superfamily with responsibility for metabolizing ~50% of clinical drugs. Experimental evidence showed that CYP3A4 can adopt multiple substrates in its active site to form a cooperative binding model, accelerating substrate metabolism efficiency. In the current study, we constructed both normal and cooperative binding models of human CYP3A4 with antifungal drug ketoconazoles (KLN. Molecular dynamics simulation and free energy calculation were then carried out to study the cooperative binding mechanism. Our simulation showed that the second KLN in the cooperative binding model had a positive impact on the first one binding in the active site by two significant pi-pi stacking interactions. The first one was formed by Phe215, functioning to position the first KLN in a favorable orientation in the active site for further metabolism reactions. The second one was contributed by Phe304. This pi-pi stacking was enhanced in the cooperative binding model by the parallel conformation between the aromatic rings in Phe304 and the dioxolan moiety of the first KLN. These findings can provide an atomic insight into the cooperative binding in CYP3A4, revealing a novel pi-pi stacking mechanism for drug-drug interactions.

  9. Power corrections in QCD: A matter of energy resolution

    International Nuclear Information System (INIS)

    Akhoury, R.; Zakharov, V.I.

    1996-01-01

    We consider powerlike corrections in QCD which can be viewed as power suppressed infrared singularities. We argue that the presence of these singularities depends crucially on the energy resolution. In the case of poor energy resolution, i.e., inclusive cross sections, there are constraints on infrared singularities expressed by the Kinoshita-Lee-Nauenberg (KLN) theorem. We rewrite the theorem in covariant notations and argue that the KLN theorem implies the extension of the Bloch-Nordsieck cancellation of logarithmic singularities to the case of linear corrections. copyright 1996 The American Physical Society

  10. Evaluation of the photovoltaic power plant of the GridLab

    OpenAIRE

    Wyer, Kevin; Genoud, Dominique

    2016-01-01

    In der vorliegenden Bachelorarbeit wird eine Software beziehungsweise ein Überwa- chungssystem für die Fachhochschule HES-SO in Sion implementiert. Mithilfe dieses Über-wachungssystems kann die produzierte Energie der Photovoltaikanlage am Gebäude der HES-SO Sion grafisch angezeigt werden.

  11. German visits to CERN

    CERN Multimedia

    2007-01-01

    State secretary to Germany's Federal Ministry of Education and Research, Frieder Meyer-Krahmer, with CERN's Director-General Robert Aymar.On 21 February, Professor Frieder Meyer-Krahmer, State Secretary to Germany's Federal Ministry of Education and Research, came to CERN. He visited the ALICE and ATLAS experiments and the computing centre before meeting the CERN's Director-General, some German physicists and members of the top management. The Minister of Science, Research and the Arts of the Baden-Württemberg regional government, Peter Frankenberg, and CERN's Director-General, Robert Aymar, signing an agreement on education. In the background: Sigurd Lettow, CERN's Director of Finance and Human Resources, and Karl-Heinz Meisel, Rector of the Fachhochschule Karlsruhe. The Minister of Science, Research and the Arts of the Baden-Württemberg regional government, Prof. Peter Frankenberg, visited CERN on 23 February. He was accompanied by the Rector of the Fachhochschule Karlsruhe, Prof. Karl-Heinz Meisel, and b...

  12. 300 W polymer electrolyte fuel cell generators for educational purposes

    Energy Technology Data Exchange (ETDEWEB)

    Tsukada, A; Buechi, F N; Scherer, G G; Haas, O [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Popelis, I [Fachhochschule Solothurn Nordwestschweiz (Switzerland)

    1999-08-01

    A 300 W fuel cell power pack has been developed for educational purposes in close collaboration with the Fachhochschule Solothurn Nordwestschweiz. The project was initiated and financed by the Swiss Federal Office of Energy. The outlay and the performance of the power pack are described. (author) 3 figs.

  13. Planning games for the electricity supply industry

    International Nuclear Information System (INIS)

    Weber, K.

    1977-01-01

    The author shows the main differences between the electricity supply planning game for the Bernische Kraftwerke AG (PEW-1) and that for the Rheinisch-Westfaelische Elektrizitaetswerke AG (PEW-2). (orig.) [de

  14. Combination use of lentinan with x-ray therapy in mouse experimental tumor system, (3). Combination effect on the metastatic tumors

    Energy Technology Data Exchange (ETDEWEB)

    Shiio, Tsuyoshi; Ohishi, Kazuo; Niitsu, Iwayasu; Hayashibara, Hiromi; Tsuchiya, Yoshiharu; Yoshihama, Takashi; Moriyuki, Hirobumi

    1988-03-01

    Combination effect of lentinan with X-ray irradiation on the metastatic mouse tumors, L1210, KLN205 and Lewis lung carcinoma were studied. Combination use of lentinan with X-ray therapy prolonged the life of BDF/sub 1/ mice bearing L1210 leukemia in the suitable combination conditions. Combination effects of lentinan with X-ray therapy were also observed on the suppression of the growth of KLN205 squamus cell carcinoma and on the suppression of the metastasis of Lewis lung carcinoma. Especially, in the case that lentinan was administered before or after X-ray local irradiation in the pulmorary metastasis system of Lewis lung carcinoma, a marked suppressin of pulmonary metastasis was observed and 2 to 4 mice among 8 tested mice were tumor free.

  15. Combination use of lentinan with x-ray therapy in mouse experimental tumor system, (3)

    International Nuclear Information System (INIS)

    Shiio, Tsuyoshi; Ohishi, Kazuo; Niitsu, Iwayasu; Hayashibara, Hiromi; Tsuchiya, Yoshiharu; Yoshihama, Takashi; Moriyuki, Hirobumi

    1988-01-01

    Combination effect of lentinan with X-ray irradiation on the metastatic mouse tumors, L1210, KLN205 and Lewis lung carcinoma were studied. Combination use of lentinan with X-ray therapy prolonged the life of BDF 1 mice bearing L1210 leukemia in the suitable combination conditions. Combination effects of lentinan with X-ray therapy were also observed on the suppression of the growth of KLN205 squamus cell carcinoma and on the suppression of the metastasis of Lewis lung carcinoma. Especially, in the case that lentinan was administered before or after X-ray local irradiation in the pulmorary metastasis system of Lewis lung carcinoma, a marked suppressin of pulmonary metastasis was observed and 2 to 4 mice among 8 tested mice were tumor free. (author)

  16. Newcomers on the Dutch energy market. Part 3. Tractebel and RWE

    International Nuclear Information System (INIS)

    Van Gelder, J.W.

    2000-01-01

    In a series of articles, a close look is taken at some foreign newcomers on the Dutch energy market. The third article features Tractebel in Belgium and RWE ('Rheinisch Westfaelisches Elektrizitaetswerk') from Germany

  17. Dicty_cDB: SFJ471 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mes) Frame A: inkfittnifvrlnlvlickyikktplspslkkki*kkiiinphkxsnnkkkxx*xkxix kxxxxxxxxexslk--- ---sxxxlplxkxklvxxxxqxxspxxsxxswxxxxlxxx...sxxlxxsgxxxlxxigxxxg xigxxxf*gxxxxxlpxxsfxxxxnkfxkxkkkxfqxkk*iiiiiiktk* Frame B: li...nllqrifl*dliwy*fvni*kkplspplskkkykkkl**iptxvviikkkxxxekx*x xfxxxx*xxkxx*k--- ---pxxxyxwxx*nwfxxx...cxrxplxxplxlgxxxlwxxxqxx*xfrdxxxwxxldxxlx xlexxpfrgxxxxxcpkxxfxxxxinfxkxkkxnsxkknk******kln F

  18. Download this PDF file

    African Journals Online (AJOL)

    Image

    ICT. This has been done by showing how Kiswahili, an indigenous African language and a linguistic .... shows and animation effects. ... which is a complete Swahili adaptation of Tux – Paint, a drawing program for children (klnX. 2004). This is ...

  19. Rheinbraun's Australian uranium business

    International Nuclear Information System (INIS)

    Kirschbaum, S.

    1989-01-01

    The leaflet argues against the mining activities of the Rheinische Braunkohlenwerke AG in Germany and especially against uranium mining in Australia. The ethno-ecological impact on flora and fauna, aborigines and miners are pointed out. Uranium mining and lignite mining are compared. (HSCH) [de

  20. Elliptic flow from non-equilibrium initial condition with a saturation scale

    International Nuclear Information System (INIS)

    Ruggieri, M.; Scardina, F.; Plumari, S.; Greco, V.

    2013-01-01

    A current goal of relativistic heavy-ion collisions experiments is the search for a Color Glass Condensate (CGC) as the limiting state of QCD matter at very high density. In viscous hydrodynamics simulations, a standard Glauber initial condition leads to estimate 4πη/s∼1, while employing the Kharzeev–Levin–Nardi (KLN) modeling of the glasma leads to at least a factor of 2 larger η/s. Within a kinetic theory approach based on a relativistic Boltzmann-like transport simulation, our main result is that the out-of-equilibrium initial distribution reduces the efficiency in building-up the elliptic flow. At RHIC energy we find the available data on v 2 are in agreement with a 4πη/s∼1 also for KLN initial conditions. More generally, our study shows that the initial non-equilibrium in p-space can have a significant impact on the build-up of anisotropic flow

  1. Event-by-event gluon multiplicity, energy density, and eccentricities in ultrarelativistic heavy-ion collisions

    Science.gov (United States)

    Schenke, Björn; Tribedy, Prithwish; Venugopalan, Raju

    2012-09-01

    The event-by-event multiplicity distribution, the energy densities and energy density weighted eccentricity moments ɛn (up to n=6) at early times in heavy-ion collisions at both the BNL Relativistic Heavy Ion Collider (RHIC) (s=200GeV) and the CERN Large Hardron Collider (LHC) (s=2.76TeV) are computed in the IP-Glasma model. This framework combines the impact parameter dependent saturation model (IP-Sat) for nucleon parton distributions (constrained by HERA deeply inelastic scattering data) with an event-by-event classical Yang-Mills description of early-time gluon fields in heavy-ion collisions. The model produces multiplicity distributions that are convolutions of negative binomial distributions without further assumptions or parameters. In the limit of large dense systems, the n-particle gluon distribution predicted by the Glasma-flux tube model is demonstrated to be nonperturbatively robust. In the general case, the effect of additional geometrical fluctuations is quantified. The eccentricity moments are compared to the MC-KLN model; a noteworthy feature is that fluctuation dominated odd moments are consistently larger than in the MC-KLN model.

  2. Experiences with a small scale Solar/Wind pilot installation for basic electrification in the chilean altiplano

    Energy Technology Data Exchange (ETDEWEB)

    Sapiain, Raul; Ovalle, Ricardo; Torres, Ariel; Brockmeyer, Ricarda; Schmidt, Reinhold [Centro de Energias Renovables/Universidad de Tarapaca, Arica, (Chile); Meer, Andreas V. [Solar Institute, Juelich (Germany)

    1997-12-31

    Basic rural electrification programmes are already carried out in the rural areas of northern Chile by local communities and local governments using photovoltaic systems. Solar Home Systems, 12 VDC are installed for individual households while systems for schools, public lighting etc. are realized with bigger systems, 220 VAC. Within a cooperation with the Solar Institute of the Fachhochschule Juelich, Germany, the Renewable Energy Center of the University of Tarapaca designed, installed and evaluated the first solar/wind hybrid installation for basic electrification in northern Chile, realized in Colpitas, a typical small village in the chilean altiplano. The following paper presents results and experiences of this first pilot installation. [Espanol] Ya se estan llevando a cabo programas de electrificacion rural basica en las areas rurales del Norte de Chile por las comunidades y los gobiernos locales, usando sistemas fotovoltaicos. Se instalan Sistemas Domesticos Solares de 12VDC para casas-habitacion individuales, mientras que los sistemas para escuelas, alumbrado publico, etc., se ejecutan con sistemas mas grandes de 220VAC. Con la coperacion del Instituto Solar de la Fachhochschule en Julich, Alemania, el Centro de Energia Renovable de la Universidad de Tarapaca, diseno, instalo y evaluo, la primera instalacion hibrida solar/viento para electrificacion basica en el Norte de Chile, realizado en Colpitas, un pueblo tipico pequeno del altiplano chileno. El siguiete articulo presenta los resultados y experiencias de esta primera instalacion piloto.

  3. Experiences with a small scale Solar/Wind pilot installation for basic electrification in the chilean altiplano

    Energy Technology Data Exchange (ETDEWEB)

    Sapiain, Raul; Ovalle, Ricardo; Torres, Ariel; Brockmeyer, Ricarda; Schmidt, Reinhold [Centro de Energias Renovables/Universidad de Tarapaca, Arica, (Chile); Meer, Andreas V [Solar Institute, Juelich (Germany)

    1998-12-31

    Basic rural electrification programmes are already carried out in the rural areas of northern Chile by local communities and local governments using photovoltaic systems. Solar Home Systems, 12 VDC are installed for individual households while systems for schools, public lighting etc. are realized with bigger systems, 220 VAC. Within a cooperation with the Solar Institute of the Fachhochschule Juelich, Germany, the Renewable Energy Center of the University of Tarapaca designed, installed and evaluated the first solar/wind hybrid installation for basic electrification in northern Chile, realized in Colpitas, a typical small village in the chilean altiplano. The following paper presents results and experiences of this first pilot installation. [Espanol] Ya se estan llevando a cabo programas de electrificacion rural basica en las areas rurales del Norte de Chile por las comunidades y los gobiernos locales, usando sistemas fotovoltaicos. Se instalan Sistemas Domesticos Solares de 12VDC para casas-habitacion individuales, mientras que los sistemas para escuelas, alumbrado publico, etc., se ejecutan con sistemas mas grandes de 220VAC. Con la coperacion del Instituto Solar de la Fachhochschule en Julich, Alemania, el Centro de Energia Renovable de la Universidad de Tarapaca, diseno, instalo y evaluo, la primera instalacion hibrida solar/viento para electrificacion basica en el Norte de Chile, realizado en Colpitas, un pueblo tipico pequeno del altiplano chileno. El siguiete articulo presenta los resultados y experiencias de esta primera instalacion piloto.

  4. Two energy-efficient alternatives; Zwei energieeffiziente Alternativen. Solaranlagen und Blockheizkraftwerke im Vergleich

    Energy Technology Data Exchange (ETDEWEB)

    Schmalschlaeger, T. [Stadtwerke Muenchen GmbH (Germany). Energieservice; Heiser, G.

    1998-10-01

    The potential of solar systems and cogeneration systems for heat supply to large-size domestic buildings was compared in a dissertation at Munich Technical University. [Deutsch] Solaranlagen und Blockheizkraftwerke (BHKW) sind anerkannte Moeglichkeiten, um Energie einzusparen und die Umwelt zu schonen. Waehrend gasmotorische Kleinblockheizkraftwerke meist im Gewerbe Einsatz finden, stellen heizungsunterstuetzende Solaranlagen bisher eine sinnvolle Ergaenzung von Heizzentralen kleiner Wohngebaeude dar. In einer Diplomarbeit, entstanden an der Fachhochschule Muenchen in Zusammenarbeit mit dem Energieservice der Stadtwerke Muenchen, wurden beide Waermeerzeugungsmoeglichkeiten zur Versorgung grosser Wohngebaeude miteinander verglichen. (orig.)

  5. Divergence of Cs-137 sources fluence used in brachytherapy

    International Nuclear Information System (INIS)

    Vianello, E.A.; Almeida, C.E. de

    1998-01-01

    In this work the experimental determination of correction factor for fluence divergence (kln) of linear Cs-137 sources CDCS J4, with Farmer ionization chamber model 2571 in a central and perpendicular plan to source axis, for distances range from 1 to 7 cm., has been presented. The experimental results were compared to calculating by Kondo and Randolph (1960) isotropic theory and Bielajew (1990) anisotropic theory. (Author)

  6. Divergence of Cs-137 sources fluence used in brachytherapy; Divergencia da fluencia de fontes de Cs-137 usadas em braquiterapia

    Energy Technology Data Exchange (ETDEWEB)

    Vianello, E.A.; Almeida, C.E. de [Laboratorio de Ciencias Radiologicas- LCR-DBB (UERJ). R. Sao Francisco Xavier, 524- Pav. HLC, sala 136 terreo- CEP 20.550- 013. Rio de Janeiro (Brazil)

    1998-12-31

    In this work the experimental determination of correction factor for fluence divergence (kln) of linear Cs-137 sources CDCS J4, with Farmer ionization chamber model 2571 in a central and perpendicular plan to source axis, for distances range from 1 to 7 cm., has been presented. The experimental results were compared to calculating by Kondo and Randolph (1960) isotropic theory and Bielajew (1990) anisotropic theory. (Author)

  7. United States Air Force Faculty Research Program 1989. Program Technical Report. Volume 4

    Science.gov (United States)

    1989-12-01

    Psychophysiology Systems, Processes and Applications, The Guilford Press, NY, pp. 354-377, 1986. Somsen, R., M. van der Molen , D. Boosma and J. Orlebeke. Phasic...June 1989. 5. Petri, C. A., "Kommiunikation mit Automaten," Schrifte des Rheinisch- Westfalischen Institutes fur instrumentelle Mathematik an der ...Psychophysiology of Cardiovascular Control. Orlebeke, J., G. Mulder and L. van Doornen (eds.), Plenum Press, NY, pp. 583-598, 1984. Wientjes, Kees. personal

  8. Development of preventive maintenance procedures and schedules

    International Nuclear Information System (INIS)

    Schlenker, H.V.; Hammel, J.

    1977-01-01

    An outline of the procedures and schedules developed for preventive maintenance in power stations within the Rheinisch-Westfaelisches Elektrizitaetswerk (RWE) is presented. After an introduction of maintenance in general the different kinds of preventive maintenance activities are described. This includes also the prerequisite identification systems. The aims of preventive maintenance and the measures are explained that have to be taken, if these aims are to be achieved. A number of examples from actual practice are cited. (orig.) [de

  9. Evidence of cyclic climatic changes recorded in clay mineral assemblages from a continental Paleocene-Eocene sequence, northwestern Argentina

    Science.gov (United States)

    Do Campo, Margarita; Bauluz, Blanca; del Papa, Cecilia; White, Timothy; Yuste, Alfonso; Mayayo, Maria Jose

    2018-06-01

    The continental Paleocene-Eocene sequence investigated in this study belongs to the Salta Group, deposited in an intracontinental rift, the Salta Basin (NW Argentina), that evolved from the lower Cretaceous to the middle Paleogene, and is subdivided into the Pirgua, the Balbuena and the Santa Barbara Subgroups. The Maíz Gordo Formation (200 m thick) is the middle unit of the Santa Bárbara Subgroup, deposited during late post-rift sedimentation. We studied the mineralogy of fine-grained horizons of this formation by X-ray diffraction and Scanning Electron Microscopy (SEM) in order to examine the connection between vertical changes in clay mineralogy in alluvial sediments and paleosols, and global paleoclimatic changes registered during the Paleogene. Paleosols vary from calcic vertisols in the lowermost levels, to inseptisols and gleysols in intermediate positions, to gleyed oxisols in the upper section, indicating increased chemical weathering through time. Clay mineral relative abundances vary with a general increase in kaolinite content from bottom to top. However, at one site there are significant variations in kaolinite/muscovite (Kln/Ms) that define five cycles of kaolinite abundance and Kln/Ms. that indicate cyclic patterns of paleoprecipitation and paleotemperature. These are interpreted as several short-lived hyperthermals during the Paleocene-early Eocene in the Southern Hemisphere, which correlate with well-established episodes of warmth documented from the Northern Hemisphere.

  10. Quantitative research for pollution levels in marine sediments of Ha Long Bay by nuclear technique

    International Nuclear Information System (INIS)

    Nguyen Quang Long; Tran Thi Tuyet Mai; Pham Ngoc Khai; Nguyen Trung Thanh; Nguyen Van Phuc; Doan Thuy Hau; Duong Van Thang; Ha Lan Anh; Vo Thi Anh; Nguyen Thi Thu Ha

    2013-01-01

    Under the theme of Quantitative study of pollution levels in marine sediments of Halong bay by nuclear techniques conducted from June 2011 to June 2013, the authors conducted monitoring, sediment samples collected in the bay below the sediment column at 8 locations, in which 7 columns located at the estuary near Tuan Chau Island and 1 column at the area near the harbor of Cam Pha. The column samples were taken to the laboratory, cut slices with a distance of 2 cm in the form of frozen and conduct tests of radioactive Pb-210 to determine the rate of sediment in the survey area. Evaluation results based on the method by determining 210 Pb, the sediment rate showed speed in the survey area ranged from 0.3 cm.a -1 to 1.2 cm.a -1 and an average of 1.0 cm.a -1 . The slices of sediment samples (110 samples) were analyzed heavy metals (KLN) and As elemental by ICP-MS method. These sediment sample also were analyzed for simultaneous determination of N and P and total organic carbon (TOC). Results showed that heavy metal concentrations and As is smaller than the value specified in the National Technical Regulation on Sediment Quality of Vietnam (QCVN), phosphorus concentration less than that can cause harmful effects, but the concentration of total nitrogen and organic carbon that may exceed be harmful as directed by Canadian standards (Persuad et al. 1992). The concentration data in the Halong bay sediment were processed by statistical software SPSS-18, results showed high correlation between the quality TOC, N, P, K and correlation the majority of KLN, this proves the origin of sediments is part of the natural soil components and parts (TOC, N, P, K) is due to the activity of human activity as well as by agricultural fertilizers. The average content of elements in sediments Halong be compared with other data published works of sediment Quang Ninh area, the results show the correlation figures are also high. However, the results of the analysis of KLN and As in Halong

  11. Safety parameter display system for Kalinin NPP

    International Nuclear Information System (INIS)

    Andreev, V.I.; Videneev, E.N.; Tissot, J.C.; Joonekindt, D.; Davidenko, N.N.; Shaftan, G.I.; Dounaev, V.G.; Neboyan, V.T.

    1995-01-01

    The paper discusses the safety parameter display system (SPDS), which is being designed for Kalinin NPP. The assessment of the safety status of the plant is done by the continuous monitoring of six critical safety functions and the corresponding status trees. Besides, a number of additional functions are realized within the scope of KlnNPP, aimed at providing the operator and the safety engineer in the main control room with more detailed information in accidental situation as well as during the normal operation. In particular, these functions are: archiving, data logs and alarm handling, safety actions monitoring, mnemonic diagrams indicating the state of main technological equipment and basic plant parameters, reference data, etc. As compared with the traditional scope of functions of this kind of systems, the functionality of KlnNPP SPDS is significantly expanded due to the inclusion in it the operator support function ''computerized procedures''. The basic SPDS implementation platform is ADACS of SEMA GROUP design. The system architecture includes two workstations in the main control room: one is for reactor operator and the other one for safety engineer. Every station has two CRT screens which ensures computerized procedures implementation and provides for extra services for the operator. Also, the information from the SPDS is transmitted to the local crisis center and to the crisis center of the State utility organization concern ''Rosenergoatom''. (author). 3 refs, 6 figs, 1 tab

  12. Cancellation of soft and collinear divergences in noncommutative QED

    International Nuclear Information System (INIS)

    Mirza, B.; Zarei, M.

    2006-01-01

    In this paper, we investigate the behavior of noncommutative IR divergences and will also discuss their cancellation in the physical cross sections. The commutative IR (soft) divergences existing in the nonplanar diagrams will be examined in order to prove an all-order cancellation of these divergences using the Weinberg's method. In noncommutative QED, collinear divergences due to triple photon splitting vertex, were encountered, which are shown to be canceled out by the noncommutative version of KLN theorem. This guarantees that there is no mixing between the Collinear, soft divergences and noncommutative IR divergences

  13. Is there a signal of quark confinement from perturbation theory

    International Nuclear Information System (INIS)

    Poggio, E.C.

    1977-01-01

    The question of whether the presence of the large infrared logarithms affects in any sense the determination of physical amplitudes involving quarks and gluons is considered in a report of results from previous investigations. Global impressions of their nature and of what they mean as far as the confinement issue is concerned. A comparison is made with analogous quantum electrodynamic processes, where the corresponding infrared aspects are completely understood. Quark form factor behavior, quark-antiquark scattering, the weak and the strong KLN theorems, and perturbation theory and confinement are treated. 26 references

  14. X-ray spectroscopic measurements of dielectronic recombination of highly charged krypton ions

    International Nuclear Information System (INIS)

    Biedermann, C.; Fuchs, T.; Liebisch, P.; Radtke, R.; Behar, E.; Doron, R.

    1999-01-01

    We have performed X-ray spectroscopic measurements of the dielectronic recombination (DR) resonance strengths for the KLn (n = 2, .., 5) series of He-, Li-, and Be-like krypton ions. The ions were produced with an electron beam ion trap, and the strengths were obtained from a fit procedure that compares the experimental excitation function for DR to theory. The results agree well with the predictions. By looking at the KLL resonance, the time evolution of different krypton charge states was measured with this technique and compared with a model of the trap inventory. (orig.)

  15. Entropy and Computation: The Landauer-Bennett Thesis Reexamined

    Directory of Open Access Journals (Sweden)

    Orly Shenker

    2013-08-01

    Full Text Available The so-called Landauer-Bennett thesis says that logically irreversible operations (physically implemented such as erasure necessarily involve dissipation by at least kln2 per bit of lost information. We identify the physical conditions that are necessary and sufficient for erasure and show that the thesis does not follow from the principles of classical mechanics. In particular, we show that even if one assumes that information processing is constrained by the laws of classical mechanics, it need not be constrained by the Second Law of thermodynamics.

  16. Hydrogeochemie von Eisenausfällungen an Grundwasseraustritten der Abraumkippe Berrenrath (Rheinisches Braunkohlenrevier)

    Science.gov (United States)

    Lenk, Stephan; Wisotzky, Frank; Cremer, Nils

    2013-03-01

    Groundwater at the abandoned lignite mine in Berrenrath (Germany) is acidic and highly mineralised. Average iron concentrations of 588 mg/l indicate a high potential for acidification. Furthermore, investigations revealed a complete depletion of the carbonate buffer capacity (CaCO3 and HCO3-) during chemical groundwater evolution. Over the next few decades, no decrease of dissolved pyrite oxidation products is expected. On the contrary, within the drainage ditches at the edges of the dump, an intense precipitation of iron oxides is occurring. However, despite oxygen saturation, precipitation of iron oxides is incomplete due to strong acidification of the surface water (pH<3.0). The main contamination of the iron sludge is caused by high nickel concentrations. This element is only loosely bound to the iron oxides and is easily mobilised. Because of high nickel- and sulphate-concentrations, the excavated material has to be deposited in a controlled landfill (German dump category of 2 to 3).

  17. Icosahedral cationic framework in the structures of MR2F7 fluorides

    International Nuclear Information System (INIS)

    Golubev, A.M.; Maksimov, B.A.; Rastsvetaeva, R.K.

    1997-01-01

    Cationic icosahedral frame formed by BiCs 6 Bi 6 icosahedrons is detected in C 5 Bi 2 F 7 structure. Similarity of cationic motives of CsBi 2 F 7 and β-KEr 2 F 7 structure types is determined, occurrence of a similar motive in RbEr 2 F 7 structure is assumed. Cationic motives of MR 2 F 7 fluorides (R=Y, Ln) are studied and dependence of cationic frame type on the ratio of metal ion radii is shown using KLn 2 F 7 fluorides as an example. 12 refs.; 4 figs.; 1 tab

  18. Cartography (and Geoinformation in Education in Austria

    Directory of Open Access Journals (Sweden)

    Mirjanka Lechthaler

    2006-08-01

    Full Text Available The basic task of cartography lies in efficient and impeccable transfer of spatial information via cartographic models of geospace. Wired and wireless communication networks serve this purpose. They offer new media possibilities of saving and transferring cartographic information and cartographic models, and therefore their use. This is related to the emphasis of research work and education, which is equally oriented toward theoretical issues and those concerning applied cartography. The paper features a review of cartographic education and accomplished qualifications at universities and professional schools (Fachhochschule in Austria and a review of newly introduced study programs of Bachelor and Master studies according to guidelines of the Bologna Declaration. The education plan for the instruction of cartography for both studies at the Vienna University of Technology is presented in detail.

  19. Heat transport the cold way

    International Nuclear Information System (INIS)

    Anon.

    1981-01-01

    A novel system for long-distance heat transport is being born in the 'Kernforschungsanlage Juelich' with the project being called 'Nukleare Fernenergie' (nuclear district energy). The project is also known as 'EVA/ADAM' [EVA = Einzelrohr-Versuchs-Anlage (single tube test facility); ADAM = Anlage mit Drei Adiabaten Methanisierungsreaktoren (plant provided with three adiabate methanising reactors)] and is based in principle on transport of energy in chemical bond within a closed loop. In the 60ies already this development was discussed both in the 'Kernforschungsanlage Juelich' and in the 'Rheinische Braunkohlenwerke' independent of each other. In 1975 these two organizations concluded a co-operation contract. (orig.) [de

  20. Monitoring of the cogeneration agreement from 19th December 2003 for the partition combined heat and power. Reporting period 2010 (Fourth and last report); Monitoring der Kraft-Waerme-Kopplungs-Vereinbarung vom 19. Dezember 2003 fuer den Teilbereich Kraft-Waerme-Kopplung. Berichtszeitraum 2010 (Vierter und letzter Bericht)

    Energy Technology Data Exchange (ETDEWEB)

    Gores, Sabine; Harthan, Ralph O.

    2012-06-04

    Beside the obligation to implement the agreed measures, also the attendance of the 'Agreement between the Government of the Federal Republic of Germany and the German economy on the climate precaution, on the reduction of the CO{sub 2} emissions and on the promotion of the cogeneration in supplement to the climate agreement from 9th November, 2000' by a continuous was initiated. The Rheinisch-Westfaelisches Institut fuer Wirtschaftsforschung (Essen, Bundesrepublik Deutschland) was commissioned with the monitoring of the cogeneration agreement. The monitoring report under consideration is based on the monitoring reports and the relevant official statistics as well as data for the power generation from renewable energy sources.

  1. Establishment, maintenance and application of failure statistics as a basis for availability optimization

    International Nuclear Information System (INIS)

    Poll, H.

    1989-01-01

    The purpose of failure statistics is to obtain hints on weak points due to operation and design. The present failure statistics of Rheinisch-Westfaelisches Elektrizitaetswerk (RWE) is based on reducing availability of power station units. If damage or trouble occurs with a unit, data will be recorded in order to calculate the unavailability and to describe the occurence, the extent, and the removal of damage. Following a survey of the most important data, a short explanation is given on updating of failure statistics and some problems of this job are mentioned. Finally some examples are given, how failure statistics can be used for analyses. (orig.) [de

  2. Simulation model for man-machine systems in nuclear power plants. Vol. 4

    Energy Technology Data Exchange (ETDEWEB)

    Falk, A

    1981-01-01

    At first, volume 4 was to describe the EDP-bound simulation model in the final programme version. This problem was tackled as a development project, however, it could not be solved because of the difficult time schedule and the commissioning of the new computing centre at the Fachhochschule Flensburg. The assignment described in volume 3, chapter 2, already contains the optimization stages planned for 1981 but still uses a special programming language 'Prozess-FORTRAN' for older digital computers. That is why the development of a new version of the programming system in Standard-FORTRAN should be postponed. It should also include a more comprehensive practical data bank for nuclear power plants. The present short report as well as the following more comprehensive final report lay more emphasis on the presentation of a functional range of application of the simulation model.

  3. Origin and diversification of hoverflies: a revision of the genera Asarkina and Allobaccha – A BIG4 Consortium PhD project

    Directory of Open Access Journals (Sweden)

    Trevor Burt

    2017-08-01

    Full Text Available This BIG4 PhD project involves the overall taxonomic revision of the genera Allobaccha Curran and Asarkina Macquart (Diptera: Syrphidae. The revisions will be divided by biogeographic region (Afrotropical and Indomalayan and published accordingly. The publications will be collated as a thesis for submission to the University of Bonn (Rheinische Friedrich-Wilhelms-Universität Bonn, Germany doctoral program of biology. The goal of this project is to resolve alpha taxonomy and to infer the phylogenetic placement of these genera within the Syrphidae using Next-Generation Sequencing and Anchored Hybrid Enrichment techniques. The techniques undertaken in this project will be applied to future systematic problems in Diptera and testing future phylogenetic hypotheses.

  4. Special method of coal winning in Hambach open-cast mine in 1987 using large machines in tandem operation

    Energy Technology Data Exchange (ETDEWEB)

    Krug, M; Muellensiefen, K

    1988-05-01

    In 1987 an additional 1,75 Mt coal, which were only overlain by slight layers of overburden, were won from the marginal batter system at Hambach open-cast mine by using a bucket wheel dredger with a daily output of 240 000 m/sup 3/ (solid) and at the same time bringing up the inside dump. During this working method the dredger and the spreader operated with a common belt conveyor in so-called tandem operation. Thanks to the efficient co-operation of the head planning department, field mining department, opencast mine surveying department and rock and soil mechanics department of the head office of the Rheinische Braunkohlenwerke AG, this special coal winning operation could be completed successfully.

  5. Characterization of Squalene Epoxidase of Saccharomyces cerevisiae by Applying Terbinafine-Sensitive Variants▿

    Science.gov (United States)

    Ruckenstuhl, Christoph; Lang, Silvia; Poschenel, Andrea; Eidenberger, Armin; Baral, Pravas Kumar; Kohút, Peter; Hapala, Ivan; Gruber, Karl; Turnowsky, Friederike

    2007-01-01

    Squalene epoxidase (SE) is the target of terbinafine, which specifically inhibits the fungal enzyme in a noncompetitive manner. On the basis of functional homologies to p-hydroxybenzoate hydroxylase (PHBH) from Pseudomonas fluorescens, the Erg1 protein contains two flavin adenine dinucleotide (FAD) domains and one nucleotide binding (NB) site. By in vitro mutagenesis of the ERG1 gene, which codes for the Saccharomyces cerevisiae SE, we isolated erg1 alleles that conferred increased terbinafine sensitivity or that showed a lethal phenotype when they were expressed in erg1-knockout strain KLN1. All but one of the amino acid substitutions affected conserved FAD/nucleotide binding sites. The G25S, D335X (W, F, P), and G210A substitutions in the FADI, FADII, and NB sites, respectively, rendered the SE variants nonfunctional. The G30S and L37P variants exhibited decreased enzymatic activity, accompanied by a sevenfold increase in erg1 mRNA levels and an altered sterol composition, and rendered KLN1 more sensitive not only to allylamines (10 to 25 times) but also to other ergosterol biosynthesis inhibitors. The R269G variant exhibited moderately reduced SE activity and a 5- to 10-fold increase in allylamine sensitivity but no cross-sensitivity to the other ergosterol biosynthesis inhibitors. To further elucidate the roles of specific amino acids in SE function and inhibitor interaction, a homology model of Erg1p was built on the basis of the crystal structure of PHBH. All experimental data obtained with the sensitive Erg1 variants support this model. In addition, the amino acids responsible for terbinafine resistance, although they are distributed along the sequence of Erg1p, cluster on the surface of the Erg1p model, giving rise to a putative binding site for allylamines. PMID:17043127

  6. Cocombustion of secondary fuels with Rhenish brown coal; Mitverbrennung von Sekundaerbrennstoffen mit rheinischer Braunkohle

    Energy Technology Data Exchange (ETDEWEB)

    Gerhardt, Alexander; Kull, Rene; Zepf, Eva; Fuller, Aaron; Maier, Joerg; Scheffknecht, Guenter [Stuttgart Univ. (Germany). Inst. fuer Verfahrenstechnik und Dampfkesselwesen; Jong, Martin de [KEMA Nederland B.V. (Netherlands); Glorius, Thomas [REMONDIS Trade and Sales GmbH (Germany)

    2008-07-01

    The Institute of Combustion and Power Plant of Technology of the University of Stuttgart (Stuttgart, Federal Republic of Germany) performs scientific research within the range of solid firings. The cocombustion of secondary fuels in coal-fired power stations as well as the production of secondary fuels are examined in the project RECOFUEL. The production of secondary fuels is performed from harmless house wastes and commercial wastes as well as from biological residues from forestry and agriculture. Secondary fuels offer an alternative to fossil fuels for the power production in different branches of industry and reduce the emission of carbon dioxide from fossil sources. For the attempts in two power stations of RWE Power AG (Essen, Federal Republic of Germany) the quality-certified secondary fuel SBS1 registered of the company Remondis GmbH (Luenen, Federal Republic of Germany) was used. This secondary fuel was developed and subjected to an intensive analysis. Experiments in a pulverized fuel furnace and in a fluidised bed were performed at the power stations Weisweiler and Berrenrath in order to examine different aspects of the cocombustion.

  7. A multi state simulation model of the maintenance for a power generating station

    International Nuclear Information System (INIS)

    Karlsson, B.O.

    1980-09-01

    A multistate simulation model for a thermal power generating station is described. The performance is modelled as a function of the system structure, the component reliability, the number of repair crews, the repair times and the availability of spare parts. Each component can be in either of four states: failed, working, postponed, or standby. A component will be in the postponed state, if due to failures in other components it is turned off. Two different types of failures are assumed: minor and severe. Evaluation of the system state is performed by repeated use of four elementary system functions: series, parallel, k-out-of-n, and standby k/l/n. Numerical results for a case study are presented. (author)

  8. Ar-ion etching effects on the XPS spectra of the ferroelectric potassium lithium niobate crystal

    International Nuclear Information System (INIS)

    Jun, Byeong-Eog; Kim, Chung-Sik; Kim, Hyung-Kook; Kim, Jung-Nam; Hwang, Yoon-Hwae; Chae, Jong-Suk

    2005-01-01

    Ar + -ion-sputtered surface of KLN crystal was studied by X-ray photoelectron spectroscopy in order to investigate the oxidation states and chemical environments of K, Li, Nb and O ions. As Ar + -sputtering time increased, the decreasing binding energy of Nb 3d and the peak broadening of mixed Nb 4s and Li 1s (namely Nb* 4s) levels were observed. Also, the binding-energy difference between O 1s and Nb* 4s increased as Ar + -ion-sputtering time increased. The broad peak of Nb* 4s was considered to be related to the site occupancy of Li ion in A1 and C in tetragonal tungsten-bronze structure.

  9. Electric power generation

    International Nuclear Information System (INIS)

    Pinske, J.D.

    1981-01-01

    Apart from discussing some principles of power industry the present text deals with the different ways of electric power generation. Both the conventional methods of energy conversion in heating and water power stations and the facilities for utilizing regenerative energy sources (sun, wind, ground heat, tidal power) are considered. The script represents the essentials of the lecture of the same name which is offered to the students of the special subject 'electric power engineering' at the Fachhochschule Hamburg. It does not require any special preliminary knowledge except for the general principles of electrical engineering. It is addressing students of electrical engineering who have passed their preliminary examination at technical colleges and universities. Moreover, it shall also be of use for engineers who want to obtain a quick survey of the structure and the operating characteristics of the extremely different technical methods of power generation. (orig.) [de

  10. Alter(n – ein vielschichtiger Begriff

    Directory of Open Access Journals (Sweden)

    Nicole Maly-Lukas

    2005-07-01

    Full Text Available Diese Veröffentlichung, die aus einer Vortragsreihe an der katholischen Fachhochschule Freiburg entstanden ist, führt die Leserinnen und Leser in die verschiedenen Sichtweisen des Alter(ns in der modernen Gesellschaft ein. Es handelt sich um eine gelungene Zusammenstellung von Beiträgen aus unterschiedlichen Disziplinen, die sich alle aus ihrer Sicht dem Thema Alter(n widmen. Die einzelnen Artikel sind zwischen 8 und 38 Seiten lang und recht schnell und einfach zu lesen. Je nach Hintergrund und Interessen werden die einzelnen Leserinnen und Leser dabei sicher unterschiedliche Beiträge favorisieren. Schade ist nur, dass durch die ungleichen Längen der Beiträge bestimmte thematische Schwerpunkte – ob gewollt oder nicht – gesetzt werden. Dies sollte die Leserinnen und Leser, die offen für unterschiedlichste Sichtweisen des Alter(ns sind, jedoch nicht davon abhalten, dieses Buch zu lesen.

  11. A Model for Systemic Change Management in Education

    Directory of Open Access Journals (Sweden)

    Marylu Menchaca

    2004-02-01

    Full Text Available Based on an understanding of systems thinking as practiced by successful learning organizations and derived from large-scale projects in technology-assisted teaching and learning in Mexico and Germany, we have developed a model that offers guidance to educational institutions and organizations to support their transition from lecture-based, face-to-face teaching to interactive learner-centered eLearning. As the basis for the model, we analyzed the systemic change processes of two major educational institutions: the largest private institution of higher education in Latin America, Instituto Tecnologico de Estudios Superiores de Monterrey (ITESM, a leading nationwide educational system of international scope with 33 branches in 27 cities throughout Mexico, and the federal flagship project in Germany, Virtuelle Fachhochschule (VFH, the Virtual University of Applied Sciences, a virtual organization with decentralized and distributed management and participants from twelve universities of applied sciences, two universities, the federal employers

  12. Kinoshita-Lee-Nauenberg theorem and soft radiation in gauge theories: Abelian case

    International Nuclear Information System (INIS)

    Akhoury, R.; Sotiropoulos, M.G.; Zakharov, V.I.

    1997-01-01

    We present a covariant formulation of the Kinoshita-Lee-Nauenberg (KLN) theorem for processes involving the radiation of soft particles. The role of the disconnected diagrams is explored and a rearrangement of the perturbation theory is performed such that the purely disconnected diagrams are factored out. The remaining effect of the disconnected diagrams results in a simple modification of the usual Feynman rules for the S-matrix elements. As an application, we show that, when combined with the Low theorem, this leads to a proof of the absence of the 1/Q corrections to inclusive processes (such as the Drell-Yan process). In this paper the Abelian case is discussed to all orders in the coupling. copyright 1997 The American Physical Society

  13. Wechsel des Bibliothekssystems in die Cloud

    Directory of Open Access Journals (Sweden)

    Vanessa Kauke

    2015-12-01

    Full Text Available Cloudbasierte Bibliothekssysteme stellen die neue Generation der Bibliothekssysteme dar. Sie ermöglichen ein gemeinsames Management von Print- und elektronischen Medien. Da in der Hochschulbibliothek der Fachhochschule Münster die elektronischen Ressourcen entscheidend zur Literaturversorgung von Lehrenden und Studierenden beitragen, beschäftigt sich ein Projektteam seit Ende 2014 mit der Evaluation des Systems WorldShare Management Services (WMS der Firma OCLC. Die ersten Ergebnisse und einige weitere Überlegungen zur Migration des Systems werden in diesem Beitrag vorgestellt. Cloud-based library systems are the next generation of library systems. They offer a joint management of print and electronic media. At the library of the University of Applied Sciences Münster, electronic resources are an important part of the literature provision for staff and students. Therefore, a project team has been evaluating OCLC’s system WorldShare Management Services (WMS since the autumn of 2014. The paper presents first results and discusses a possible migration.

  14. Cosmic ray physics goes to school

    CERN Multimedia

    2002-01-01

    With the help of a CERN physicist, German Schools bring the Largest Cosmic Ray Detector in Europe one step closer to reality   Eric Berthier and Robert Porret (CERN, ST/HM), Frej Torp and Christian Antfolk from the Polytechnics Arcada in Finland, and Karsten Eggert, physicist at CERN who initiated this project, during the installation of cosmic ray detectors in the Pays de Gex, at point 4. Niina Patrikainen and Frej Torp, Finnish students from Rovaniemi and Arcada Polytechnics, installing cosmic ray counters at the Fachhochschule in Duesseldorf. The science of cosmic ray detection is growing, literally. Cosmic rays, energetic particles from space, strike our planet all the time. They collide with the air molecules in our upper atmosphere and initiate large showers of elementary particles (mainly electrons, photons, hadrons and muons) which rain down upon the earth. The shower size and the particle density in the showers reflect the initial energy of the cosmic ray particle, a detail which makes d...

  15. Line ratios and wavelengths of helium-like argon n=2 satellite transitions and resonance lines

    International Nuclear Information System (INIS)

    Biedermann, C.; Radtke, R.; Fournier, K.

    2003-01-01

    The characteristic X-ray emission from helium-like argon was investigated as a mean to diagnose hot plasmas. We have measured the radiation from n=2-1 parent lines and from KLn dielectronic recombination satellites with high wavelength resolution as function of the excitation energy using the Berlin Electron Beam Ion Trap. Values of wavelength relative to the resonance and forbidden line are tabulated and compared with references. The line intensity observed over a wide range of excitation energies is weighted with a Maxwellian electron-energy distribution to analyze line ratios as function of plasma temperature. Line ratios (j+z)/w and k/w compare nicely with theoretical predictions and demonstrate their applicability as temperature diagnostic. The ratio z/(x+y) shows not to depend on the electron density

  16. Optical and structural properties of RE.sup.3+./sup.-doped KLnS.sub.2./sub. compounds

    Czech Academy of Sciences Publication Activity Database

    Jarý, Vítězslav; Havlák, Lubomír; Bárta, J.; Mihóková, Eva; Nikl, Martin

    2014-01-01

    Roč. 61, č. 1 (2014), s. 385-389 ISSN 0018-9499 R&D Projects: GA ČR GA13-09876S; GA TA ČR TA01011017 Institutional support: RVO:68378271 Keywords : luminescence * scintillator * sulfides * white LED Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.283, year: 2014

  17. The RWE utility - a beaming giant

    International Nuclear Information System (INIS)

    Hoefer-Bosse, T.; Mez, L.; Moeller, F.; Osnowski, R.; Rebentisch, M.; Theissen, A.; Uka, W.

    1984-01-01

    West Germany's biggest electric utility has become the subject of gossip. Formerly only known - if ever - as the sender of electricity bills, the Rheinisch-Westfaelisches Elektrizitaetswerk (RWE) now is talked about and brought in for controversial issues in the field of energy and environmental policy. The book deals with the history of the RWE utility, developing from a municipal utility to the Federal Republic's biggest electricity supplier, the people that have given guidance and support to RWE, the highly interesting system of owner-ship rights, the role of RWE as a contributor to environmental pollution, the interlockings and manifold interests, the utility's behaviour and attitude in the nuclear business, the ingenious business policy at the taxpayers' expense, chances of exerting an impact on, or developing means of resistance against, the business policy of RWE. (orig./HP) [de

  18. The RWE utility - a beaming giant. RWE - ein Riese mit Ausstrahlung

    Energy Technology Data Exchange (ETDEWEB)

    Hoefer-Bosse, T.; Mez, L.; Moeller, F.; Osnowski, R.; Rebentisch, M.; Theissen, A.; Uka, W.

    1984-01-01

    West Germany's biggest electric utility has become the subject of gossip. Formerly only known - if ever - as the sender of electricity bills, the Rheinisch-Westfaelisches Elektrizitaetswerk (RWE) now is talked about and brought in for controversial issues in the field of energy and environmental policy. The book deals with the history of the RWE utility, developing from a municipal utility to the Federal Republic's biggest electricity supplier, the people that have given guidance and support to RWE, the highly interesting system of owner-ship rights, the role of RWE as a contributor to environmental pollution, the interlockings and manifold interests, the utility's behaviour and attitude in the nuclear business, the ingenious business policy at the taxpayers' expense, chances of exerting an impact on, or developing means of resistance against, the business policy of RWE. (orig./HP).

  19. Basic lay-out, arrangement and design criteria of heat components of the ''nuclear coal gasification prototype plant (PNP)''

    International Nuclear Information System (INIS)

    Pruschek, R.

    1980-01-01

    Since 1975, the companies Bergbau-Forschung GmbH, GHT Gesellschaft fuer Hochtemperaturreaktor-Technik mbH, Hochtemperatur-Reaktorbau GmbH, Kernforschungsanlage Juelich GmbH und Rheinische Braunkohlenwerke AG are working jointly on the Project ''Prototype Plant Nuclear Process Heat (PNP)'', with promotion of the ''Bundesminister fuer Forschung und Technologie'' and of the ''Minister fuer Wirtschaft, Mittelstand und Verkehr des Landes Nordrhein-Westfalen''. The objectives of the project are the development of a high-temperature reactor, with a core outlet temperature of 950 0 C, suitable for various process heat applications, and the development and testing of the appropriate coal gasification technology. The applied gasifications methods comprise endothermal and exothermal reactions. Therefore, various heat transfer components are to be developed. In the context of this Specialists Meeting, only those components will be discussed by which heat is transferred from primary helium to secondary helium or from helium to the working or process fluid

  20. People and things. CERN Courier, Apr 1986, v. 26(3)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1986-04-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A Summer Study to be held in Snowmass, Colorado, from 23 June to 11 July will allow the US particle physics community to critically evaluate all aspects of the proposed US Superconducting Super Collider (SSC) in the light of conceptual design, progress in accelerator technology, new developments in collider physics, and innovations in instrumentation. Organized jointly by the European Committee for Future Accelerators (ECFA) and the Rheinisch-Westfälische Technische Hochschule in Aachen, a 'LEP 200' Workshop is being arranged from 29 September to 1 October to work out the physics objectives and experimental requirements for running LEP at around 100 GeV per beam. A four-day practical course on microelectronics is being hosted by CERN and the International School of Geneva.

  1. Dose received during work in the active zone of the BIBLIS power plant, instalment A, 1977

    International Nuclear Information System (INIS)

    Kallmeyer, D.; Ambros, R.; Schroeder, H.J.; Kausch, S.

    1978-01-01

    In the Biblis station, instalment A, of the Rheinisch-Wesfaelisches-Elektrizitaetswerk, a study was conducted in 1977 to determine the doses received as a function of work carried out. The aim was to establish in a general study the dose which appears in each case during work on systems (or components of systems) in the active zone. An attempt was made as far as possible to relate the doses to specific occupations. This correlation is governed in two ways by conditions inherent in the organisation of the Biblis station a) maintenance and repair work are carried out under work contracts; the dose can be related to this work by the order number of the contract in question. b) Some activities, apart from maintenance and repair may be carried out without a contract. The dose which then appears is related to the type of activity concerned

  2. Kinetics of gasification and combustion of residues, biomass and coal in a bubbling fluidized bed; Die Kinetik der Vergasung und Verbrennung unterschiedlicher Abfaelle, Biomassen und Kohlen in der blasenbildenden Wirbelschicht

    Energy Technology Data Exchange (ETDEWEB)

    Hamel, S; Krumm, W [Siegen Univ. (Gesamthochschule) (Germany). Lehrstuhl fuer Energie- und Umweltverfahrenstechnik

    1998-09-01

    The combustion and gasification characteristics of Rhenish brown coal, domestic waste, waste plastics, wood and sewage sludge were investigated in a bubbling atmospheric fluidized bed in the laboratory scale. The materials were pyrolyzed in the fluidized bed in a nitrogen atmosphere. The residual coke was combuted in the presence of oxygen with varying operating parameters or else gasified in the presence of carbon dioxide. The different materials were characterized by global combustion rates, and kinetic parameters were determined for residual coke combustion. (orig.) [Deutsch] Das Verbrennungs- und Vergasungsverhalten von Rheinischer Braunkohle, Hausmuell, Restkunststoff, Holz und Klaerschlamm wurde in einer blasenbildenden, atmosphaerischen Laborwirbelschicht untersucht. Die Einsatzstoffe wurden in der mit Stickstoff fluidisierten Wirbelschicht pyrolysiert. Der verbleibende Restkoks wurde anschliessend unter Variation der Betriebsparameter mit Sauerstoff verbrannt oder mit Kohlendioxid vergast. Die unterschiedlichen Einsatzstoffe wurden durch globale Vebrennungsraten charakterisiert. Fuer die Restkoksverbrennung wurden kinetische Parameter ermittelt. (orig.)

  3. People and things. CERN Courier, Apr 1986, v. 26(3)

    International Nuclear Information System (INIS)

    Anon.

    1986-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A Summer Study to be held in Snowmass, Colorado, from 23 June to 11 July will allow the US particle physics community to critically evaluate all aspects of the proposed US Superconducting Super Collider (SSC) in the light of conceptual design, progress in accelerator technology, new developments in collider physics, and innovations in instrumentation. Organized jointly by the European Committee for Future Accelerators (ECFA) and the Rheinisch-Westfälische Technische Hochschule in Aachen, a 'LEP 200' Workshop is being arranged from 29 September to 1 October to work out the physics objectives and experimental requirements for running LEP at around 100 GeV per beam. A four-day practical course on microelectronics is being hosted by CERN and the International School of Geneva

  4. Investigação de parâmetros hiperfinos dos óxidos semicondutores $SnO_{2}$ e $TiO_{2}$ puros e dopados com metais de transição 3d pela espectroscopia de correlação angular gama-gama perturbada

    CERN Document Server

    Schell, Juliana

    This study aimed the use of nuclear technique Perturbed γ-γ Angular Correlation Spectroccopy (PAC) to measure the hyperfine interactions in thin films and powder samples of SnO2 and TiO2 pure and doped with transition metals to obtain a systematic investigation of defects and magnetism from an atomic point of view with the main motivation the application in spintronics. The work also focused on the preparation and characterization of samples by conventional techniques such as X-ray diffraction, scanning electron microscopy, energy dispersive spectroscopy and magnetization measurements. Pure samples of the films were measured by the systematic variation of thermal treatment and applied magnetic field. These measurements were performed in HISKP at the University of Bonn (Rheinische Friedrich-Wilhelms-Universität Bonn) using 111In(111Cd) or 181Hf (181Ta); at IPEN, in turn, these measurements were performed after the diffusion of the same probe nuclei. Another part of PAC measurements were carried out using 11...

  5. Papers about coated particles, graphitic and metallic materials for progressive high-temperature reactors at the Reactor Meeting 1978

    International Nuclear Information System (INIS)

    Rottmann, J.

    1978-09-01

    In the contributions, questions on the development, the radiation and the high-temperature behaviour and the characterization of fuel element particles are treated. Furthermore the resistance and radiation behaviour of graphitic materials are discussed. Finally, questions on the choice of high-temperature alloys for nuclear process heat facilities are discussed and the testing-equipment of the Nuclear Research Centre as well as first results of the long-time experiments are presented. The work was performed within the frame of the projects 'HTR-Fuel Element Cycle' and 'Prototype Nuclear Process Heat', which are sponsored by the Federal Ministry of Research and Technology of the Federal Republic of Germany and of the state of North-Rhine-Westfalia. Partner firms, who participate in the two projects are Gelsenberg AG, Gesellschaft fuer Hochtemperaturreaktor-Technik mbH, Hochtemperaturreaktor-Brennelement GmbH, Hochtemperatur-Reaktorbau GmbH, Kernforschungsanlage Juelich GmbH, NUKEM GmbH, SIGRI Elektrographit GmbH/Ringsdorff-Werke GmbH, Bergbauforschung GmbH und Rheinische Braunkohlenwerke AG. (orig./UA) [de

  6. Presence of the glycogen synthase 1 (GYS1) mutation causing type 1 polysaccharide storage myopathy in continental European draught horse breeds.

    Science.gov (United States)

    Baird, J D; Valberg, S J; Anderson, S M; McCue, M E; Mickelson, J R

    2010-11-13

    The purpose of this study was to determine which continental European draught horse breeds harbour a mutation in the glycogen synthase 1 gene (GYS1) that is known to be responsible for type 1 polysaccharide storage myopathy in quarter horses and North American draught horses. Of a non-random selection of continental European draught horses belonging to 13 breeds, 62 per cent (250 of 403) tested were found to carry the mutant allele. The horses were located in Belgium, France, Germany, The Netherlands, Spain and Sweden. The mutation was identified in animals from each of the breeds examined. In the breeds in which more than 15 animals were available for testing, the highest percentages of GYS1-positive horses were found in the Belgian trekpaard (92 per cent; 35 of 38 horses tested), Comtois (80 per cent; 70 of 88), Netherlands trekpaard (74 per cent; 17 of 23), Rheinisch-Deutsches kaltblut (68 per cent; 30 of 44) and Breton (64 per cent; 32 of 51).

  7. Preventive maintenance-A countermeasure to plant aging

    International Nuclear Information System (INIS)

    Hlubek, W.

    1985-01-01

    The aging of power plants is caused by manifold and different influences. For instance, mechanical and thermal stress, radiation exposure, denting or wastage can considerably affect the aging of plant components and thus cause premature failures of components. In this presentation, the term 'Plant Aging' in nuclear power plants is to be understood more comprehensively than wear on components and material fatigue. In addition, nuclear power plants are to be adjusted to the advancing state of the science and technology (state-of-the-art) in order to guarantee safe operation at all times. The preventive maintenance - as a countermeasure to plant aging - comprises the systematic checks and servicing of the plant systems in operation and follows aging by inspection and tests. Experience with Rheinisch-Westfaelisches Elektrizitaetswerk AG (RWE) preventive maintenance program at the Biblis NNP (1300 MW, PWR) is discussed. The concept of an 'Integrated Maintenance System' as a means to avoid 'Plant Aging' is presented

  8. Integrated disturbance analysis (IDA): A basis for expert systems in nuclear power plants

    International Nuclear Information System (INIS)

    Bastl, W.

    1987-01-01

    In the framework of a project sponsored by the Bundesminister fur Forschung und Technologie (BMFT) and the Rheinisch-Westfalisches Elektrizitatswerk AG (RWE) the concept of Integrated Disturbance Analysis (IDA) has been developed and applied to the Biblis Unit B Nuclear Power Plant. Rather than using the classical approach, which aims at finding the cause of a plant disturbance, the main goal was to make transparent to the operator what it really means for the process, when a set of parameters begins to deviate from its normal state. Therefore the goal was to help the operator to combine the information on the individual process parameters to the complete picture of the evolving transient, thus facilitating the decision about the importance of a disturbance for operational safety. Considering this goal the most important subjects taken care of were: to extend event sequence analysis by means of analog information; to provide adequate modelling of time dependent processes and feedback loops; to integrate IDA information effectively into the existing control room environment

  9. Contributions for the third international carbon conference CARBON '80

    International Nuclear Information System (INIS)

    Delle, W.

    1980-05-01

    This report is a compilation of 8 papers prepared by KFA Juelich GmbH for the International Carbon Conference carbon 80 in Baden-Baden. The contributions deal mainly with materials problems which arise from the application of graphite and silicon carbide in High-Temperature Gas-Cooled Reactors, HTR. Most of the results described were obtained in the framework of the HTR Projects ''Hochtemperaturreaktor-Brennstoffkreislauf'' (High Temperature Reactor Fuel Cycle), HBK, that includes the partners Gesellschaft fuer Hochtemperaturreaktor-Technik mbH, Hochtemperaturreaktor-Brennelement GmbH, Hochtemperatur-Reaktorbau GmbH, Kernforschungsanlage Juelich GmbH, NUKEM GmbH and Sigri Elektrographit GmbH/Ringsdorff-Werke GmbH and ''Prototyp Nukleare Prozesswaerme'' (Prototype Nuclear Heat), PNP, for the development of procedures for the conversion of solid fossil raw materials by means of heat from High Temperature Gas-Cooled Reactors, that includes the partners Bergbau-Forschung GmbH, Gesellschaft fuer Hochtemperaturreaktor-Technik mbH, Hochtemperatur-Reaktorbau GmbH, Kernforschungsanlage Juelich GmbH and Rheinische Braunkohlenwerke AG. Both projects are financed by the Federal Ministry for Research and Technology and the State of North Rhine-Westphalia. (orig./IHOE) [de

  10. Data processing systems for clinical nuclear medicine

    International Nuclear Information System (INIS)

    Winkler, C.; Knopp, R.

    1975-01-01

    The model studies on the above mentioned data processing demonstration systems have shown that the development of a modular process computer with an applicable operation system makes it possible to meet the special demands of any nuclear-medical clinical centre corresponding to its capacity and finances. The respective first draft of the compact system described was discussed by a major circle of competent specialists at the DP-meeting of the Rheinisch-Westfaelische Gesellschaft fuer Nuklearmedizin in 1974. The positive response which the draft was met with confirmes our opinion that in the future equipment of the nuclear-medical institutions with DP-systems the universal applicability of these systems in operation with several participants and the implementation of clinically tested user's software should have priority over all other things. The development of the compact system, which is being carried out with the help of the Federal Ministry for Research and Technology will be instrumental in creating the preconditions necessary. It will be fully available in 1977 and is even expected to be completed in its partial functions (such as camera scanning, renal clearance, evaluation of laboratory data) in 1976 already. (orig.) [de

  11. [Surveying a zoological facility through satellite-based geodesy].

    Science.gov (United States)

    Böer, M; Thien, W; Tölke, D

    2000-06-01

    In the course of a thesis submitted for a diploma degree within the Fachhochschule Oldenburg the Serengeti Safaripark was surveyed in autumn and winter 1996/97 laying in the planning foundations for the application for licences from the controlling authorities. Taking into consideration the special way of keeping animals in the Serengeti Safaripark (game ranching, spacious walk-through-facilities) the intention was to employ the outstanding satellite based geodesy. This technology relies on special aerials receiving signals from 24 satellites which circle around the globe. These data are being gathered and examined. This examination produces the exact position of this aerial in a system of coordinates which allows depicting this point on a map. This procedure was used stationary (from a strictly defined point) as well as in the movement (in a moving car). Additionally conventional procedures were used when the satellite based geodesy came to its limits. Finally a detailed map of the Serengeti Safaripark was created which shows the position and size of stables and enclosures as well as wood and water areas and the sectors of the leisure park. Furthermore the established areas of the enclosures together with an already existing animal databank have flown into an information system with the help of which the stock of animals can be managed enclosure-orientated.

  12. Plagiatsprävention als Herausforderung für die Schreibdidaktik. Ein Erfahrungsbericht aus dem Schreibzentrum der FHWien, der Fachhochschule der Wiener Wirtschaftskammer (WKW

    Directory of Open Access Journals (Sweden)

    Fenzl, Regina

    2015-08-01

    Full Text Available Plagiarism could be defined as the unlawful use of the intellectual property of others, e.g. when the original source of literature is not correctly cited in a paper. Colleges and universities are obliged to sanction plagiarism. Moreover they have the duty to prevent plagiarism in the first place.The focus of the academic writing center of the FHWien of the Viennese Economic Chamber is to prevent students from the temptations and risks of plagiarism. The center provides assistance for the efficient work with scientific literature and its correct quotation and is one of the main contact points for students’ questions related to academic writing. Thus plagiarism prevention is a core duty of the writing center. So, what needs to be done to keep students on the right track and how to avoid plagiarism in the tertiary education sector? These and other related questions will be addressed in this article with comments on various forms of plagiarism, followed by assessing the students’ point of view and their possible motives to commit plagiarism. Finally we will present several services of the writing center to prevent students from plagiarism.

  13. Maintenance program, organization and procedures

    International Nuclear Information System (INIS)

    Schegk, J.R.R.

    1986-01-01

    The Rheinisch-Westfaelisches Elektrizitaetswerk AG (RWE) operates two pressurized water reactors (PWR) with 1.200 MW and 1.300 MW and two boiling water reactors (BWR) with an electrical output of 1.300 MW each. The PWR were commissioned in 1975 and 1977 respectively and have so far achieved a cumulative availability of 72%. The BWR started operating in 1984 and 1985. Since than they have been generating with a cumulative availability of 88%. The reliability of the nuclear power stations resulted in a trouble-free operation. For the last two years, the unscheduled non-availability amounted to 3,7% and 6,5% for the PWR and the BWR respectively. These favourable operating results derive inter alia from systematic preventive maintenance and consistent outage management. Apart from the personnel structure in the power stations the functional sequence of planning, control, performance as well as evaluation of maintenance results constitute a closed cycle. In order to ensure and support an effective cooperation of the above mentioned four functional sequences of a cycle, uniform and computer-assisted information and planning aids have been introduced such as task lists, job ordering, time scheduling and materials management. As a result of this preventive maintenance system the average refueling outage period is 35 to 42 days. (orig.)

  14. Shock tubes and waves; Proceedings of the Sixteenth International Symposium, Rheinisch-Westfaelische Technische Hochschule, Aachen, Federal Republic of Germany, July 26-31, 1987

    Science.gov (United States)

    Groenig, Hans

    Topics discussed in this volume include shock wave structure, propagation, and interaction; shocks in condensed matter, dusty gases, and multiphase media; chemical processes and related combustion and detonation phenomena; shock wave reflection, diffraction, and focusing; computational fluid dynamic code development and shock wave application; blast and detonation waves; advanced shock tube technology and measuring technique; and shock wave applications. Papers are presented on dust explosions, the dynamics of shock waves in certain dense gases, studies of condensation kinetics behind incident shock waves, the autoignition mechanism of n-butane behind a reflected shock wave, and a numerical simulation of the focusing process of reflected shock waves. Attention is also given to the equilibrium shock tube flow of real gases, blast waves generated by planar detonations, modern diagnostic methods for high-speed flows, and interaction between induced waves and electric discharge in a very high repetition rate excimer laser.

  15. Do Brothers Affect Their Sisters' Chances to Graduate? An Analysis of Sibling Sex Composition Effects on Graduation from a University or a "Fachhochschule" in Germany

    Science.gov (United States)

    Jacob, Marita

    2011-01-01

    In a recent paper on gender inequality in higher education Buchman and DiPrete (2006) assume that the decrease in the gender gap in college completion in the US can partly be explained by changes in the allocation of familial resources in favour of women. However, they do not test this hypothesis empirically. In this paper I examine the effects of…

  16. Innovation in technology and energy economy. Economic and socio-ethical problem formulations. Innovationen in Technik und Energiewirtschaft. Oekonomische und sozialethische Fragestellungen

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, K; Spangenberger, M [eds.

    1986-01-01

    Hardly any other topic has been the object of so much public discussion in recent years as the environment. A discussion, by the way, that is not infrequently governed by strong emotions, broadens into ideological controversy, and is characterized by lack of knowledge of the technical and economic dimensions of this theme. But technology and economy are not all that this, so controversial, topic of 'environment' encompasses. Increasingly, ethical and social questions are gaining importance and demonstrating the need for a comprehensive view of problems. At the same time one can neither deny the scope of a responsibility extending to future generations, nor must the attempt be dispensed with to view the problem complex in its relation to anthropology. The conference, organized by the 'Rheinisch-Westfaelisches Elektrizitaetswerk' (RWE) in cooperation with the Catholic Central Institute of Social Sciences and the Institute of German Economy, was to give insight into the concrete ecological problems associated with energy generation. By a direct approach, fields of experience were to be demonstrated and ecological measures presented. The concrete approach was to go along with theoretical reflection and the discussion of problem areas even including international aspects. The aim of this book is, on the one hand, to document the event, and on the other hand, to stimulate great interest in these questions also in future.

  17. Implementation of safety parameter display system on Russian NPPs with WWER reactors

    International Nuclear Information System (INIS)

    Dounaev, V.G.; Neboyan, V.T.

    1996-01-01

    This report gives a short overview of the status of safety parameter display systems (SPDS) implementation on Russian NPPs with WWER reactors and also discusses the SPDS, which is being developed for Kalinin NPP. The assessment of the safety status of the plant is done by the continuous monitoring of six critical safety functions and the corresponding status trees. Besides, a number of additional functions are realized within the scope of KlnNPP, aimed at providing the operator and the safety engineer in the main control room with more detailed information in accidental situation as well as during the normal operation. In particular, these functions are: archiving, data logs and alarm handling, safety actions monitoring, mnemonic diagrams indicating the state of main technological equipment and basic plant parameters, reference data, etc. Also, the operator support function ''computerized procedures'' is included in the scope of SPDS. The basic SPDS implementation platform is ADACS of SEMA GROUP design. The system architecture includes two workstations in the main control room: one is for reactor operator and the other one for safety engineer. Every station has two CRT screens which ensures computerized procedures implementation and provides for extra services for the operator. Also, the information from the SPDS is transmitted to the local crisis centre and to the crisis centre of the State utility organization concern ''Rosenergoatom''. (author). 3 refs

  18. Prototype plant for nuclear process heat (PNP) - operation of the pilot plant for hydrogasification of coal

    International Nuclear Information System (INIS)

    Bruengel, N.; Dehms, G.; Fiedler, P.; Gerigk, H.P.; Ruddeck, W.; Schrader, L.; Schumacher, H.J.

    1988-04-01

    The Rheinische Braunkohlenwerke AG developed the process of hydrogasification of coal in a fluidized bed for generation of SNG. On basis of test results obtained in a semi-technical pilot plant of a through-put of 250 kg/h dried coal a large pilot plant was erected processing 10 t/h dried brown coal. This plant was on stream for about 14700 h, of which about 7800 h were with gasifier operation; during this time about 38000 t of dried brown coal of the Rhenish district were processed containing 4 to 25% of ash. At pressures of 60 to 120 bar and temperatures of 800 to 935 0 C carbon conversion rates up to 81 percent and methane amounts of 5000 m 3 (STP)/h were reached. The decisive parameter for methane generation was the hydrogen/coal-ratio. Even at high moisture contents, usually diminishing the methane yield from the coal essentially, by high hydrogen/coal-ratios high methane yields could be obtained. The gasifier itself caused no troubles during the total time operation. Difficulties with the original design of the residual char cooler could be overcome by change-over from water injection to liquid carbon dioxide. The design of the heat recovery system proved well. Alltogether so the size increasement of the gasifier from the semi-technical to the large pilot plant as well as the harmonization of gas generation and gas refining was proved. (orig.) With 20 refs., 20 tabs., 81 figs [de

  19. Does the Boltzmann Principle Need a Dynamical Correction?

    Science.gov (United States)

    Adib, Artur B.

    2004-11-01

    In an attempt to derive thermodynamics from classical mechanics, an approximate expression for the equilibrium temperature of a finite system has been derived (M. Bianucci, R. Mannella, B. J. West and P. Grigolini, Phys. Rev. E 51: 3002 (1995)) which differs from the one that follows from the Boltzmann principle S = kln Ω( E) via the thermodynamic relation 1/ T=∂ S / ∂ E by additional terms of "dynamical" character, which are argued to correct and generalize the Boltzmann principle for small systems (here Ω( E) is the area of the constant-energy surface). In the present work, the underlying definition of temperature in the Fokker-Planck formalism of Bianucci et al., is investigated and shown to coincide with an approximate form of the equipartition temperature. Its exact form, however, is strictly related to the "volume" entropy S = k ln Ф( E) via the thermodynamic relation above for systems of any number of degrees of freedom ( Ф( E) is the phase space volume enclosed by the constant-energy surface). This observation explains and clarifies the numerical results of Bianucci et al., and shows that a dynamical correction for either the temperature or the entropy is unnecessary, at least within the class of systems considered by those authors. Explicit analytical and numerical results for a particle coupled to a small chain ( N~10) of quartic oscillators are also provided to further illustrate these facts.

  20. Performance analysis of electricity generation by the medium temperature geothermal resources: Velika Ciglena case study

    International Nuclear Information System (INIS)

    Rašković, Predrag; Guzović, Zvonimir; Cvetković, Svetislav

    2013-01-01

    During the last decade, a design of an energy efficient and cost effective geothermal plant represents a significant and on-going technical challenge in all the Western Balkan countries. In the Republic of Croatia, the geothermal field Velika Ciglena is identified as one of the most valuable geothermal heat sources and probably the location where the first geothermal plant in the Western Balkan area will be built. The purpose of this work is the conceptual design and performance analysis of the binary plants–the one which operates under the Organic Rankine Cycle (ORC) and the other under Kalina (KLN) cycle–which can be used for geothermal energy utilization in Velika Ciglena. A conceptual plant design is performed by the equation-oriented modelling approach and supported by the two steady-state spreadsheet simulators. The performance analysis of all design solutions is conducted through energy and exergy analysis, and by the estimated total cost of operating units in the plant. The results of the analysis indicate that the plant design based on the ORC cycle has a higher thermodynamic efficiency and lower cost of equipment, and consequently, it is more suitable for the future geothermal plant in Velika Ciglena. - Highlights: ► Paper presents the analysis of binary geothermal plant for the utilization of recourses in Velika Ciglena field (Croatia). ► Thermodynamic and economical parameters of both cycles are calculated by the spreadsheet simulation software. ► The results of performance analysis indicate the advantage of electricity production based on ORC cycle

  1. Investigation of hyperfine parameters of semiconductor oxides SnO2 and TiO2 pure and doped with 3d transition methods using spectroscopy of perturbed gamma-gamma angular correlation

    International Nuclear Information System (INIS)

    Schell, Juliana

    2015-01-01

    This study aimed the use of nuclear technique Perturbed γ-γ Angular Correlation Spectroscopy (PAC) to measure the hyperfine interactions in thin films and powder samples of SnO 2 and TiO 2 pure and doped with transition metals to obtain a systematic investigation of defects and magnetism from an atomic point of view with the main motivation the application in spintronics. The work also focused on the preparation and characterization of samples by conventional techniques such as X-ray diffraction, scanning electron microscopy, energy dispersive spectroscopy and magnetization measurements. Pure samples of the films were measured by the systematic variation of thermal treatment and applied magnetic field. These measurements were performed in HISKP at the University of Bonn (Rheinische Friedrich-Wilhelms-Universität Bonn) using 111 In( 111 Cd) or 181 Hf ( 181 Ta); at IPEN, in turn, these measurements were performed after the diffusion of the same probe nuclei. Another part of PAC measurements were carried out using 111 mCd( 111 Cd) and 117 Cd ( 117 In) in Isotope Mass Separator On-Line (ISOLDE) at Centre Européen Recherche Nucléaire (CERN). The measurements were performed from 8 K to 1173 K. After comparing results from macroscopic techniques with those from PAC, it was concluded that there is a correlation between the defects, magnetism and the mobility of charge carriers in semiconductors studied here. A step forward in the search for semiconductors, whose magnetic ordering allows its use in electronics based on spin. Some results have been published, including results obtained at the University of Bonn for the sandwich doctorate period [1-7]. (author)

  2. Pilot plant for hydrogasification of coal with nuclear heat

    International Nuclear Information System (INIS)

    Falkenhain, G.; Velling, G.

    1976-01-01

    In the framework of a research and development programme sponsored by the Ministry of Research and Technology of the Federal Republic of Germany, two process variants for hydrogasification of coal by means of nuclear heat have been developed by the Rheinische Braunkohlenwerke AG, Cologne. For testing these process variants a semi-technical pilot plant for gasification of coal under pressure in a fluidized bed was constructed. The pilot plant, in which the gasification of lignite and hard coal is planned, is designed for a throughput of 100kg carbon per hour corresponding to 400kg raw lignite per hour or 150kg hard coal per hour. The plant should provide data on the influence of the most essential process parameters (pressure, temperature, residence time of gas and coal, type and pre-treatment of feed coal) on the performance of gasification and raw gas composition. Different plant components will also be tested. Since the pilot plant will permit testing of both process variants of hydrogasification, it was designed in such a way that it is possible to vary a great number of process parameters. Thus, for instance, the pressure can be chosen in a range up to 100 bar and pure hydrogen or mixtures of hydrogen, carbon monoxide and steam can be applied as gasification agents. The gasifier is an internally insulated fluidized bed reactor with an inner diameter of 200mm and a height of about 8m, to which an internally insulated cyclone for separation of the entrained fines is attached. The raw gas is then cooled down by direct water scrubbing. (author)

  3. Electrosensitization Increases Antitumor Effectiveness of Nanosecond Pulsed Electric Fields In Vivo.

    Science.gov (United States)

    Muratori, Claudia; Pakhomov, Andrei G; Heller, Loree; Casciola, Maura; Gianulis, Elena; Grigoryev, Sergey; Xiao, Shu; Pakhomova, O N

    2017-01-01

    Nanosecond pulsed electric fields are emerging as a new modality for tissue and tumor ablation. We previously reported that cells exposed to pulsed electric fields develop hypersensitivity to subsequent pulsed electric field applications. This phenomenon, named electrosensitization, is evoked by splitting the pulsed electric field treatment in fractions (split-dose treatments) and causes in vitro a 2- to 3-fold increase in cytotoxicity. The aim of this study was to show the benefit of split-dose treatments for in vivo tumor ablation by nanosecond pulsed electric field. KLN 205 squamous carcinoma cells were embedded in an agarose gel or grown subcutaneously as tumors in mice. Nanosecond pulsed electric field ablations were produced using a 2-needle probe with a 6.5-mm interelectrode distance. In agarose gel, splitting a pulsed electric field dose of 300, 300-ns pulses (20 Hz, 4.4-6.4 kV) in 2 equal fractions increased cell death up to 3-fold compared to single-train treatments. We then compared the antitumor effectiveness of these treatments in vivo. At 24 hours after treatment, sensitizing tumors by a split-dose pulsed electric field exposure (150 + 150, 300-ns pulses, 20 Hz, 6.4 kV) caused a 4- and 2-fold tumor volume reduction as compared to sham and single-train treatments, respectively. Tumor volume reduction that exceeds 75% was 43% for split-dose-treated animals compared to only 12% for single-dose treatments. The difference between the 2 experimental groups remained statistically significant for at least 1 week after the treatment. The results show that electrosensitization occurs in vivo and can be exploited to assist in vivo cancer ablation.

  4. Investigation of hyperfine parameters of semiconductor oxides SnO{sub 2} and TiO{sub 2} pure and doped with 3d transition methods using spectroscopy of perturbed gamma-gamma angular correlation; Investigacao de parametros hiperfinos dos oxidos semicondutores SnO{sub 2} and TiO{sub 2} puros e dopados com metais de transicao 3d pela espectroscopia de correlacao angular gama-gama perturbada

    Energy Technology Data Exchange (ETDEWEB)

    Schell, Juliana

    2015-09-01

    This study aimed the use of nuclear technique Perturbed γ-γ Angular Correlation Spectroscopy (PAC) to measure the hyperfine interactions in thin films and powder samples of SnO{sub 2} and TiO{sub 2} pure and doped with transition metals to obtain a systematic investigation of defects and magnetism from an atomic point of view with the main motivation the application in spintronics. The work also focused on the preparation and characterization of samples by conventional techniques such as X-ray diffraction, scanning electron microscopy, energy dispersive spectroscopy and magnetization measurements. Pure samples of the films were measured by the systematic variation of thermal treatment and applied magnetic field. These measurements were performed in HISKP at the University of Bonn (Rheinische Friedrich-Wilhelms-Universität Bonn) using {sup 111}In({sup 111}Cd) or {sup 181}Hf ({sup 181}Ta); at IPEN, in turn, these measurements were performed after the diffusion of the same probe nuclei. Another part of PAC measurements were carried out using {sup 111}mCd({sup 111}Cd) and {sup 117}Cd ({sup 117}In) in Isotope Mass Separator On-Line (ISOLDE) at Centre Européen Recherche Nucléaire (CERN). The measurements were performed from 8 K to 1173 K. After comparing results from macroscopic techniques with those from PAC, it was concluded that there is a correlation between the defects, magnetism and the mobility of charge carriers in semiconductors studied here. A step forward in the search for semiconductors, whose magnetic ordering allows its use in electronics based on spin. Some results have been published, including results obtained at the University of Bonn for the sandwich doctorate period [1-7]. (author)

  5. EURATOM's Programme of Participation in Power Reactor Construction; Le programme de participation d'Euratom aux reacteurs de puissance; Programma uchastiya v razrabotke ehnergeticheskikh reaktorov Evratoma; El programa de participacion de la Euratom en la construccion y explotacion de reactores de potencia

    Energy Technology Data Exchange (ETDEWEB)

    Ramadier, R. C.; Parker, E. [Communaute Europoenne de l' Energie Atomique, Bruxelles (Belgium)

    1963-10-15

    One of the means used by the Commission of EURATOM to promote the development of a European nuclear industry is a programme of ''Community participation'', under which the Commission will participate in power reactor construction up to a total expenditure of 32 million European Monetary Agreement units of account. The return for this will be the acquisition of information on the design, construction, start-up and operation of such reactors. So far, proposals from three companies have resulted in the signing of contracts. These companies are: (a) The Societa Elettronucleare Nazionale (SENN), which is constructing a station of 150 MW(e) net in Italy, equipped with a double-cycle boiling-water reactor; (b) The Societa Italiana Meridionale Energia Atomica (SIMEA), which has undertaken to construct a station f 200 MW(e) net in Italy, equipped with a natural uranium-graphite-CO{sub 2} reactor; (c) The Societe d'Energie Nucleaire Franco-Belge des Ardennes (SENA), which has undertaken to construct, on the French-Belgian border, a station which will be equipped with a pressurized-water reactor and whose output will reach, and probably exceed, 242 MW(e) net. Further, the Commission has been requested by the Rheinisch-Westfalisches Elektrizitatswerk - Bayernwerke (RWE-BW) group and the N.V. Samenwerkende Electriciteits-Productiebedrijve to take part in the construction o f two other power reactors - the first a 237 MW(e) double-cycle boiling-water reactor, and the second a 50 MW(e) single-cycle, natural-circulation boiling-water reactor. Community participation can take various forms, one of them being the sharing of any deficit that might result from the production of electricity by the stations during their first years of operation. The effect of EURATOM's participation has been to encourage the construction of some of these nuclear power stations. Moreover, it has resulted in the gathering of extremely useful information and w ill continue to do so in the years to come

  6. Determination of the germanium detector efficiency for measurements of the radionuclide activity contained in a radioactive waste drum

    International Nuclear Information System (INIS)

    Rodenas, J.; Gallardo, S.; Ballester, S.; Hoyler, F.

    2006-01-01

    One of the features in the characterization of a drum containing radioactive wastes is to verify the activity of radionuclides contained in the drum. An H.P. Ge detector can be used for this measurement. However, it is necessary to perform an efficiency calibration for all geometries involved. In the framework of a joint project between the Departamento de Ingenieria Quimica y Nuclear (Universidad Politecnica de Valencia, Spain) and the Fachbereich Angewandte Naturwissenschaften und Technik (Fachhochschule Aachen, Abteilung Julich, Germany), different configurations for a drum containing radioactive sources have been implemented in the laboratory. A cylindrical drum of 850 mm height, a diameter equal to 560 mm and 3 mm of steel thickness has been used in the experimental measurements. The drum contains a clay ceramic matrix whose chemical composition is 55% SiO 2 , 40% of Al 2 O 3 and 5% of TiO 2 . Several vertical PVC tubes having a diameter of 30 mm are inserted in the drum at different distances from the central axis. In the experiment, a pack of point sources with 133 Ba, 60 Co and 137 Cs is introduced into each one of the tubes. A ring-shape distributed source is generated by rotating the drum around its axis during the measurement. The detector efficiency is determined experimentally for these configurations. On the other hand, a Monte Carlo model, using the M.C.N.P. code, has been developed to simulate the drum, the clay matrix and the PVC tubes. The effect of the drum spinning has been reproduced simulating a ring source with different diameters. The model also includes detailed detector geometry. Using this Monte Carlo model, the detector efficiency is calculated for each configuration implemented in the laboratory. Comparison of results from Monte Carlo simulation and experimental measurements should permit the validation of the M.C.N.P. model. Consequently it will be possible to obtain efficiency curves without experimental measurements. Therefore, these

  7. Structure determination of KScS.sub.2./sub., RbScS.sub.2./sub. and KLnS.sub.2./sub. (Ln = Nd, Sm, Tb, Dy, Ho, Er, Tm and Yb) and crystal-chemical discussion

    Czech Academy of Sciences Publication Activity Database

    Havlák, Lubomír; Fábry, Jan; Henriques, Margarida Isabel Sousa; Dušek, Michal

    2015-01-01

    Roč. 71, Jul (2015), 623-630 ISSN 2053-2296 R&D Projects: GA ČR(CZ) GAP204/11/0809; GA TA ČR TA04010135 Institutional support: RVO:68378271 Keywords : alkali rare earth sulfides * X-ray single-crystal structure determination * crystal chemistry Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.479, year: 2015

  8. Solar Radio Observation using Callisto Spectrometer at Sumedang West Java Indonesia: Current Status and Future Development Plan in Indonesia

    Science.gov (United States)

    Manik, T.; Sitompul, P.; Batubara, M.; Harjana, T.; Yatini, C. Y.; Monstein, C.

    2016-04-01

    Sumedang Observatory (6.91°S, 107,84°E) was established in 1975 and is one of the solar observation facilities of the Space Science Center of Indonesian National Institute of Aeronautics and Space (LAPAN), located around 40 km, east part of Bandung City, West Java, Indonesia. Several instrumentations for solar and space observation such as optical telescopes, radio solar spectrograph, flux gate magnetometer, etc. are operated there, together with an ionosphere sounding system (ionosonde) that was set up later. In July 2014, a standard Callisto (Compound Astronomical Low-cost Low-frequency Instrument for Spectroscopy and Transportable Observatory) spectrometer was installed at Sumedang Observatory for solar radio activity monitoring. Callisto has been developed in the framework of IHY2007 and ISWI, supported by UN and NASA. Callisto spectrometer has observation capability in the frequency range of 45-870 MHz. The Callisto spectrometer receives signal by using a set of 21 elements log-periodic antenna, model CLP5130-1N, pointed to the Sun and equipped with a low noise pre-amplifier. With respect to the Radio Frequency Interferences (RFI) measurements, the Callisto spectrometer is operated individually in frequency ranges of 45-80 MHz and 180-450 MHz. Observation status and data flow are monitored in on-line from center office located in Bandung. The data was transferred to central database at FHNW (Fachhochschule Nordwestschweiz) server every 15 minutes to appear on e-Callisto network subsequently. A real time data transfer and data processing based on Python software also has been developed successfully to be used as an input for Space Weather Information and Forecasting Services (SWIFtS) provided by LAPAN. On 5th November 2014, Callisto spectrometer at Sumedang observed the first clear solar radio event, a solar radio burst type II corresponding to a coronal mass ejection (CME), indicated by a strong X-ray event of M7.9 that was informed on by Space Weather

  9. Study on partitioning and transmutation (P and T) of high-level waste. Status of R and D. Final report; Studie zur Partitionierung und Transmutation (P and T) hochradioaktiver Abfaelle. Stand der Grundlagen- und technologischen Forschung. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Merk, Bruno; Glivici-Cotruta, Varvara

    2014-07-01

    The main project, where this sub project contributed to, has been structured into two modules: module A (funded by the federal ministry of economics, managed by KIT) and module B (funded by the federal ministry of education and research, managed by acatech). Partners in module A were DBE TECHNOLOGY GmbH, the Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH (GRS), the Helmholtz-Zentrum Dresden-Rossendorf (HZDR), the Karlsruher Institute of Technology (KIT) and the Rheinisch-Westfaelische Technische Hochschule (RWTH) Aachen, in co-operation with the Forschungszentrum Juelich (FZJ). Modul B has been executed by the Zentrum fuer Interdisziplinaere Risiko- und Innovationsforschung der Universitaet Stuttgart (ZIRIUS). The overall coordination has been carried out by the Deutsche Akademie der Technikwissenschaften (acatech). The social implications have been evaluated in module B based on the analysis of the scientific and technological aspects in module A. Recommendations for communication and actions to be taken for the future positioning of P and T have been developed. In the project part, coordinated by HZDR - status of R and D - an overview on the whole topic P and T is given. The topic is opened by a short description of reactor systems possible for transmutation. In the following the R and D status of separation technologies, safety technology, accelerator technology, liquid metal technology, spallation target development, transmutation fuel and structural material development, as well as waste conditioning is described. The topic is completed by the specifics of transmutation systems, the basic physics and core designs, the reactor physics, the simulation tools and the development of Safety Approaches. Additionally, the status of existing irradiation facilities with fast neutron spectrum is described. Based on the current R and D status, the research and technology gaps in the topics: separation and conditioning, accelerator and spallation target, and reactor

  10. Study on partitioning and transmutation (P and T) of high-level waste. Status of R and D. Final report

    International Nuclear Information System (INIS)

    Merk, Bruno; Glivici-Cotruta, Varvara

    2014-01-01

    The main project, where this sub project contributed to, has been structured into two modules: module A (funded by the federal ministry of economics, managed by KIT) and module B (funded by the federal ministry of education and research, managed by acatech). Partners in module A were DBE TECHNOLOGY GmbH, the Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH (GRS), the Helmholtz-Zentrum Dresden-Rossendorf (HZDR), the Karlsruher Institute of Technology (KIT) and the Rheinisch-Westfaelische Technische Hochschule (RWTH) Aachen, in co-operation with the Forschungszentrum Juelich (FZJ). Modul B has been executed by the Zentrum fuer Interdisziplinaere Risiko- und Innovationsforschung der Universitaet Stuttgart (ZIRIUS). The overall coordination has been carried out by the Deutsche Akademie der Technikwissenschaften (acatech). The social implications have been evaluated in module B based on the analysis of the scientific and technological aspects in module A. Recommendations for communication and actions to be taken for the future positioning of P and T have been developed. In the project part, coordinated by HZDR - status of R and D - an overview on the whole topic P and T is given. The topic is opened by a short description of reactor systems possible for transmutation. In the following the R and D status of separation technologies, safety technology, accelerator technology, liquid metal technology, spallation target development, transmutation fuel and structural material development, as well as waste conditioning is described. The topic is completed by the specifics of transmutation systems, the basic physics and core designs, the reactor physics, the simulation tools and the development of Safety Approaches. Additionally, the status of existing irradiation facilities with fast neutron spectrum is described. Based on the current R and D status, the research and technology gaps in the topics: separation and conditioning, accelerator and spallation target, and reactor

  11. Status and development programme of the fast breeder reactor system in the Federal Republic of Germany

    International Nuclear Information System (INIS)

    Daeunert, U.; Kessler, G.

    1977-01-01

    The Federal Republic of Germany depends on imports of raw materials for energy purposes, and special importance is therefore given to nuclear energy for reasons of energy policy. Against the background of a nuclear power station capacity amounting to 24,000MW(e) in 1976 (power stations being either on order, under construction or actually in operation), the fast breeder reactor (FBR) is outstandingly significant in the Federal Republic for the economic use both of the uranium and the plutonium accumulating in light-water reactors (LWRs). Work in this sector started in the FRG in 1960. Important stages in development were: the initial activities on the plutonium critical SNEAK at Karlsruhe; successful operation of the KNK 20-MW(e) experimental reactor (sodium-cooled) with the KNK II (plutonium core) follow-up stage; costruction of the 300-MW(e) FBR prototype nuclear power station at Kalkar; and initial planning carried out for a 1300-MW(e) FBR demonstration nuclear power station. A viable infrastructure for safety assessment must go hand in hand with the development of new reactor systems. Prototype reactors in the FRG are therefore already subjected to the same strict licensing procedures under nuclear legislation as are commercial nuclear power stations. Several years' practical experience have shown that this was the right approach. It was recognized in the FRG early on that major long-term technological projects could no longer be implemented by unaided single nations. The SNR-300 FBR prototype project combines the efforts of the governments, power supply companies, reactor manufacturers and nuclear research centres of the FRG, Belgium and the Netherlands. The agreement signed in 1971 by the Rheinisch-Westfaelische Elektrizitaetswerke AG (FRG), Ente Nazionale per l'Energia Elettrica (Italy) and Electricite de France (France) power supply companies on the joint construction of the Super-Phenix and SNR-2 FBR demonstration nuclear power stations, and the German

  12. A systemic study of stepwise chlorination-chemical vapor transport characteristics of pure rare earth oxides from Sc2O3 to Lu2O3 mediated by alkaline chlorides as complex former

    International Nuclear Information System (INIS)

    Sun Yanhui; He Peng; Chen Huani

    2007-01-01

    A systematic study has been carried out for the stepwise chlorination-chemical vapor transport (SC-CVT) characteristics of pure rare earth oxides from Sc 2 O 3 to Lu 2 O 3 mediated by the vapor complexes KLnCl 4 and NaLnCl 4 (Ln = Sc, Y and La-Lu) used NaCl and KCl as complex former, respectively. The results showed that the SC-CVT characteristics are similarly for NaCl and KCl as complex former, the main deposition temperature of the rare earth chlorides LnCl 3 is in the increasing order ScCl 3 3 3 , and then with a systematically decreasing trend from the early lanthanide chlorides to the end one. The results also showed that the total transported amount of the produced chlorides is YCl 3 > ScCl 3 , and they are much higher than that of most lanthanoid chlorides. For lanthanoids, the total transported amount of chloride increases systematically from the early lanthanoid chlorides to the end one except for EuCl 3 and GdCl 3 mediated by KCl and NaCl as complex former, respectively, which showed the divergence effect of Gd in the total transport efficiency. But there are some differences in SC-CVT characteristics of pure rare earth oxide mediated by KCl and NaCl as complex former, that is the main deposition temperature region for the same rare earth element was lower for KCl than that for NaCl as complex former except for LaCl 3 , CeCl 3 , YbCl 3 and LuCl 3 , while the total transport amount of rare earth chloride for KCl as complex former is higher than that for NaCl except for LaCl 3 and EuCl 3 . More over, the discussion was carried out for Sc and Y on the one hand and the lanthanides contain 4f electron as another hand based on the 4f electron hybridization assumption. Further more, the transport characteristics of rare earth oxides with alkaline chlorides as complex former in this study were compared to that with AlCl 3 as complex former

  13. Nuclear new-build - Status and Outlook from a German utility perspective

    International Nuclear Information System (INIS)

    Koenig, Ruediger; Lefhalm, Cord-H.

    2009-01-01

    Full text: As one of the Top 5 utilities in Europe, Rheinisch-Westfaelisches Elektrizitaetswerk AG, FWB: RW, RWE, operates a diversified generating capacity of about 45 GW; RWE Power alone generates over 30 GW. Besides a share of approximately 20% nuclear power, a large proportion of the generating base is in lignite and hard coal. RWE has an ambitious, Euro10 bn newbuild program of about 10 GW modern fossil fired plants and further expansion plans across Europe. By 2012, RWE intends to invest between Euro 15 and 20 bn outside Germany.The European Union has a challenging policy to increase the share of renewables, improve energy efficiency, and reduce greenhouse gases by 2020. At the same time, ageing power plants need to be replaced. This requires an enormous investment program across Europe. Nuclear power therefore, as a proven technology with low lifecycle carbon emissions and reasonable lifecycle cost, is a crucial contributor to achieve Europe's 2020 goals. Accordingly, most European countries have started or are planning to expand their nuclear generating base by lifetime extension, capacity upgrades, and newbuild projects. Germany is one of the few countries where the Government has not yet adopted a pro-nuclear policy. Instead, the law of the land still forces early plant closures. Against this background, RWE is determined to reduce its CO 2 exposure and grow internationally; work towards preserving nuclear energy in Germany; expand its nuclear energy-based generation portfolio in other markets, especially UK and CSEE. As a pioneer in the civilian nuclear industry, RWE can build on a wealth of experience for engaging in new nuclear projects. We have established a set of strict guidelines with which we evaluate project opportunities, starting with the fundamental requirement that, beyond any regulatory requirements, safety must be guaranteed according to RWE's high standards. On this basis, RWE has been successfully able to engage in two of the first

  14. Assessing exergy of forest ecosystem using airborne and satellite data

    Science.gov (United States)

    Brovkina, Olga; Fabianek, Tomas; Lukes, Petr; Zemek, Frantisek

    2017-04-01

    Interactions of the energy flows of forest ecosystem with environment are formed by a suite of forest structure, functions and pathways of self-control. According to recent thermodynamic theory for open systems, concept of exergy of solar radiation has been applied to estimate energy consumptions on evapotranspiration and biomass production in forest ecosystem or to indicate forest decline and human land use impact on ecosystem stability. However, most of the methods for exergy estimation in forest ecosystem is not stable and its physical meaning remains on the surface. This study was aimed to contribute to understanding the exergy of forest ecosystem using combination of remote sensing (RS) and eddy covariance technologies, specifically: 1/to explore exergy of solar radiation depending on structure of solar spectrum (number of spectral bands of RS data), and 2/to explore the relationship between exergy and flux tower eddy covariance measurements. Two study forest sites were located in Western Beskids in the Czech Republic. The first site was dominated by young Norway spruce, the second site was dominated by mature European beech. Airborne hyperspectral data in VNIR, SWIR and TIR spectral regions were acquired 9 times for study sites during a vegetation periods in 2015-2016. Radiometric, geometric and atmospheric corrections of airborne data were performed. Satellite multispectral Landsat-8 cloud-free 21 scenes were downloaded and atmospherically corrected for the period from April to November 2015-2016. Evapotranspiration and latent heat fluxes were collected from operating flux towers located on study sites according to date and time of remote sensing data acquisition. Exergy was calculated for each satellite and airborne scene using various combinations of spectral bands as: Ex=E^out (K+ln E^out/E^in )+R, where Ein is the incoming solar energy, Eout is the reflected solar energy, R = Ein-Eout is absorbed energy, Eout/Ein is albedo and K is the Kullback increment

  15. Trigeneration plants in a field test: Enhancement of control and hydraulics; KWKK-Anlagen im Feldtest. Verbesserung ihrer Regelung und Hydraulik. Projekt ''Praxistest und Kombiregler einer KWKK-Anlage''

    Energy Technology Data Exchange (ETDEWEB)

    Backes, Klaus; Adam, Mario; Gottschald, Jonas [Fachhochschule Duesseldorf (Germany). Arbeitsgruppe E2 - Erneuerbare Energien und Energieeffizienz; Faber, Christian; Henneboehl, Fred; Lanz, Marco; Anthrakidis, Anette [Fachhochschule Aachen, Juelich (Germany). Solar-Institut Juelich

    2011-07-01

    Energiebereitstellung im Vergleich zur ueblichen Einzel-Erzeugung von Strom, Waerme und Kaelte. Allerdings sind die Einzelkomponenten kleiner KWKK-Anlagen in der Praxis oft zu wenig abgestimmt, somit Verbesserungen an Regelung und Hydraulik wuenschenswert. Insbesondere der Strombedarf fuer Pumpen und Rueckkuehler soll niedrig bleiben. Die FH Duesseldorf und die FH Aachen untersuchen dazu drei Anlagen mit den Mini-BHKW der Firmen SenerTec und PowerPlus Technologies und der Adsorptionskaeltemaschine der Fa. SorTech AG. Zwei der Anlagen sind ''klassische'' Feldtests bei einem Kunden (Blumenhaus und Ingenieurbuero), die dritte ist ein innovativer Hardware-in-the-Loop-Pruefstand ''HiL'' an der Fachhochschule Duesseldorf. Der HiL-Pruefstand enthaelt zwar BHKW, Speicher und Kaeltemaschine als reale Geraete, die restlichen Systemkomponenten wie Rueckkuehler, Gebaeude und Fancoils sind aber durch Simulationsmodelle unter Matlab/Simulink mit den Toolboxen Carnot und Stateflow ersetzt. Dynamische Echtzeitsimulation und reale Geraete sind ueber den automatisierten HiL-Pruefstand miteinander verbunden, wodurch die Geraete wie in einer realen Einbausituation betrieben werden. Randbedingungen wie Groesse des Gebaeudes, Standort, Wetter, Nutzerverhalten und Hydraulik der Waerme- und Kaelteverteilung sind leicht am Rechner aenderbar. So koennen - die vorgeschlagenen Regelungs-Optimierungen realistisch getestet, - der Anlagenbetrieb unter allen Bedingungen abgesichert und - Kundenprobleme und kritische Betriebszustaende einzeln untersucht werden. Dargestellt werden die Kunden-Feldtestanlagen, die HiL-Pruefstandstechnik und die Ergebnisse der ''Feldtests im Labor''. Konkret untersuchte Fragestellungen sind z.B.: - Wie sich der Betrieb der einzelnen Komponenten im KWKK-System sinnvoll aufeinander abstimmen laesst. - Wie sich bei sinkender Kaeltelast die Kaelteleistung der Kaeltemaschine mit der groessten Energieeinsparung drosseln laesst. - Ob

  16. Archaeometrical analyses demonstrates that humans excavated clay from mardels on the Luxembourger Gutland plateau to produce ceramics.

    Science.gov (United States)

    Vanmourik, Jan; Braekmans, Dennis

    2017-04-01

    sediments must have been used, most probably for the production of ceramics. If we can find relicts of ceramics in the vicinity of mardels we can compare the composition of these ceramics with mardel clay. We could collect finds of Roman tile-works on the Lias marls (Kalefeld) and of Roman pottery on the Keuper marls (Biischtert) in the vicinity of mardels. Provenance analysis (XRF) demonstrated the similarity of chemical composition of mardel clay and ceramics. This indicates that the mardels on the Gutland plateau developed initially as natural depressions (sediment traps), on Strassen marls related to soil subsidence, caused by joints in the underlying Luxembourger sandstone, on Keuper marls to subsidence after soil subsurface dissolving of gypsum veins. The colluvial clay was used by the Romans for the production of ceramics. Due to the excavation reached the actual seizes. Colluvial clay accumulation restarted in the abandoned quarries. • Slotboom, R.T. (1963) Comparative geomorphological and palynological investigation of the pingos (Viviers) in the Haute Fagnes (Belgium) and the Mardellen in the Gutland (Luxembourg). Zeitschrift für Geomorphologie 7: 193-231. • Schmalen, C. (2002) Einige Mardellen Luxemburgs auf den Keuper-und Liasschichten des Forstamtbezirks Zentrum. Diplomarbeit in Studiengang Umweltplannung an der Fachhochschule Trier, Standort Birkenfeld, 2002. • Etienne, D., Ruffaldi, P., Goepp, S., Ritz, F., Georges-Leroy, M., Pollier, B., Dambrine, E. (2011) The origin of closed depressions in Northeastern France: A new assessment. Geomorphology 126: 121-131. • Slotboom, R.T., van Mourik, J.M. (2015) Pollen records of mardel deposits; the effects of climatic oscillations and land management on soil erosion in Gutland, Luxembourg. Catena 132 (2015) 72-88.

  17. Strukturell-organisatorische Entwicklung und Etablierung eines interdisziplinären Trainingszentrums für klinisch-praktische Fertigkeiten [Structural and organizational development and establishment of an interdisciplinary Skills Lab

    Directory of Open Access Journals (Sweden)

    Dott, Wolfgang

    2010-02-01

    rztliche Handeln essentiell sind. Im Juli 2005 begann der Aufbau eines interdisziplinären Trainingszentrums an der medizinischen Fakultät der Rheinisch-Westfälischen Technischen Hochschule Aachen, genannt „AIXTRA“ (Aachener interdisziplinäres Trainingszentrum für medizinische Ausbildung. Sach- und Personalmittel zur strukturellen und methodischen Etablierung des sog. Skillslab wurden zunächst aus einem fakultätsinternen Förderprogramm für innovative Lehrkonzepte, im weiteren Verlauf zum überwiegenden Teil aus Studienbeiträgen zur Verfügung gestellt. Methodik: Im Vorfeld wurden die folgenden notwendigen Schritte eines Projektmanagements erarbeitet: Entwicklung eines methodischen Rahmenkonzeptes, Definition der inhaltlichen Ausrichtung und Auswahl der Fertigkeiten, Schaffung infrastruktureller Voraussetzungen (Räume, Unterrichtsmaterial, Personal, Konzeptionierung von „Pilot-Kursen“, Realisierung repräsentabler „Meilensteine“, Gewinnung weiterer potenter fakultätsinterner Partner für zukünftigen Ausbau, Implementierung Kursangebot in laufende Curricula, Evaluation der Einzel-Kurse und des Gesamtkonzeptes. Ergebnis: Die vorab festgelegten Teilschritte des Projektmanagements erwiesen sich als zielführend bei der Umsetzung des Projektes. Eine „Minimal“-Infrastruktur in Bezug auf räumliche und personelle Ressourcen wurde etabliert, das methodische Konzept umgesetzt. Im Sommersemester 2008 besuchten insgesamt 709 Teilnehmer in 133 fakultativen Kursen und ca. 900 Studierende in curricularen Veranstaltungen das Skillslab „AIXTRA“. Schlussfolgerung: Nach drei Jahren wird im interdisziplinären Trainingszentrum eine breite Palette von Kursen angeboten, in denen Studierende praktische Fertigkeiten erlernen, trainieren und optimieren können. Die bisher gewonnenen Erfahrungen in der Konzeptionierung und Organisation des Kursprogramms sind essentielle Grundlage für den weiteren strukturellen und methodisch-didaktischen Ausbau des Skillslab.

  18. First Temperate Exoplanet Sized Up

    Science.gov (United States)

    2010-03-01

    (Hawaii), the Isaac Newton Telescope (Roque de los Muchachos Observatory), Wise Observatory (Israel), the Faulkes North Telescope of the Las Cumbres Observatory Global Telescope Network (Hawaii) and the ESO 3.6-metre telescope (Chile). More information This research was presented in a paper published this week in Nature ("A transiting giant planet with a temperature between 250 K and 430 K"), by H. J. Deeg et al. The team is composed of H.J. Deeg, B. Tingley, J.M. Almenara, and M. Rabus (Instituto de Astrofısica de Canarias, Tenerife, Spain), C. Moutou, P. Barge, A. S. Bonomo, M. Deleuil, J.-C. Gazzano, L. Jorda, and A. Llebaria (Laboratoire d'Astrophysique de Marseille, Université de Provence, CNRS, OAMP, France), A. Erikson, Sz. Csizmadia, J. Cabrera, P. Kabath, H. Rauer (Institute of Planetary Research, German Aerospace Center, Berlin, Germany), H. Bruntt, M. Auvergne, A. Baglin, D. Rouan, and J. Schneider (Observatoire de Paris-Meudon, France), S. Aigrain and F. Pont (University of Exeter, UK), R. Alonso, C. Lovis, M. Mayor, F. Pepe, D. Queloz, and S. Udry (Observatoire de l'Université de Genève, Switzerland), M. Barbieri (Università di Padova, Italia), W. Benz (Universität Bern, Switzerland), P. Bordé, A. Léger, M. Ollivier, and B. Samuel (Institut d'Astrophysique Spatiale, Université Paris XI, Orsay, France), F. Bouchy and G. Hébrard (IAP, Paris, France), L. Carone and M. Pätzold (Rheinisches Institut für Umweltforschung an der Universität zu Köln, Germany), S. Carpano, M. Fridlund, P. Gondoin, and R. den Hartog (ESTEC/ESA, Noordwijk, The Netherlands), D. Ciardi (NASA Exoplanet Science Institute/Caltech, USA), R. Dvorak (University of Vienna, Austria), S. Ferraz-Mello (Universidade de São Paulo, Brasil), D. Gandolfi, E. Guenther, A. Hatzes, G. Wuchterl, B. Stecklum (Thüringer Landessternwarte, Tautenburg, Germany), M. Gillon (University of Liège, Belgium), T. Guillot and M. Havel (Observatoire de la Côte d' Azur, Nice, France), M. Hidas, T. Lister

  19. Operating Experience in Nuclear Power Plants with Boiling-Water Reactors; Experience acquise dans l'exploitation des reacteurs a eau bouillante; Opyt ehkspluatatsii kipyashchago reaktora; Experiencia adquirida con la explotacion de reactores de agua hirviente

    Energy Technology Data Exchange (ETDEWEB)

    Ascherl, R. J. [General Electric Company, San Jose, CA (United States)

    1963-10-15

    Asignificant amount of operating experience has now been accumulated by boiling-water-reactor power plants. By the end of 1962, over 2200 million kWh of electricity have been generated by three plants operating on utility.system - Dresden Nuclear Power Station, Commonwealth Edison Company, Morris, Illinois; Vallecitos Atomic Power Plant, Pacific Gas and Electric Company and General Electric Company, Pleasanton, California; and Kahl Nuclear Power Station, Rheinisch Westfaelisches Elektrizitaetswerk and Bayernwerk, Kahl-am-Main, West Germany. Boiling-water-reactor power-plant performance, under routine electric-utility operating conditions, has been excellent. Reactor and plant availability and capacity factor provide a sound basis for anticipation of continuing reliable performance from boiling-water-reactor power stations. During 1963, four additional boiling-water-reactor plants will begin power operation: Big Rock Point Nuclear Plant, Consumers Power Company, Charlevoix, Michigan; Humboldt Bay Plant Nuclear Unit, Pacific Gas and Electric Company, Eureka, California; Garigliano Nuclear Power Station, Societa Elettronucleare Nazionale, Scauri, Italy; and Japan Power Demonstration Reactor, Japan Atomic Energy Research Institute, Tokai Mura, Japan. The start-up and initial operation of these plants confirms the expectation of reliable performance established by Dresden, Kahl, and Vallecitos. Performance records of Dresden, Kahl and Vallecitos have clearly proved the stability and safety of boiling-water reactors. Additionally, radiation levels within the plant and in the environs have been significantly below limits established by operating licences. Simplicity and ease of operation of boiling-water reactors has been confirmed. Load following characteristics of the Dresden dual-cycle boiling-water reactor have been excellent. Major and minor maintenance and repair work can be accomplished by ordinary craft unions, and without undue hardship or time limits caused by