WorldWideScience

Sample records for retained antigen-binding activity

  1. Autologous peptides constitutively occupy the antigen binding site on Ia

    DEFF Research Database (Denmark)

    Buus, S; Sette, A; Colon, S M

    1988-01-01

    Low molecular weight material associated with affinity-purified class II major histocompatibility complex (MHC) molecules of mouse (Ia) had the expected properties of peptides bound to the antigen binding site of Ia. Thus, the low molecular weight material derived from the I-Ad isotype...

  2. Antigen-binding radioimmunoassays for human IgG antibodies to bovine ν-lactoglobulin

    International Nuclear Information System (INIS)

    Turner, M.W.; Paganelli, R.; Levinsky, R.J.; Williams, A.

    1983-01-01

    A double antibody antigen-binding assay for the detection of human IgG antibodies to the bovine milk allergen ν-lactoglobulin is described. The levels of such antibodies in patients with established cows' milk protein intolerance were significantly higher than the levels observed in a healthy control group (P<0.01). The assay showed excellent correlation with a solid phase antigen binding assay (rsub(s) = 0.8, P<0.001). (Auth.)

  3. Platelets retain high levels of active plasminogen activator inhibitor 1.

    Directory of Open Access Journals (Sweden)

    Helén Brogren

    Full Text Available The vascular fibrinolytic system is crucial for spontaneous lysis of blood clots. Plasminogen activator inhibitor 1 (PAI-1, the principal inhibitor of the key fibrinolytic enzyme tissue-type plasminogen activator (tPA, is present in platelets at high concentrations. However, the majority of PAI-1 stored in platelets has been considered to be inactive. Our recent finding (Brogren H, et al. Blood 2004 that PAI-1 de novo synthesized in platelets remained active for over 24 h, suggested that PAI-1 stored in the α-granules might be active to a larger extent than previously reported. To re-evaluate this issue, we performed experiments where the fraction of active PAI-1 was estimated by analyzing the tPA-PAI-1 complex formation. In these experiments platelets were lysed with Triton X-100 in the presence of serial dilutions of tPA and subsequently the tPA-PAI-1 complex was evaluated by Western blot. Also, using a non-immunologic assay, tPA was labeled with (125I, and (125I-tPA and (125I-tPA-PAI-1 was quantified by scintigraphy. Interestingly, both methods demonstrated that the majority (>50% of platelet PAI-1 is active. Further analyses suggested that pre-analytical procedures used in previous studies (sonication or freezing/thawing may have substantially reduced the activity of platelet PAI-1, which has lead to an underestimation of the proportion of active PAI-1. Our in vitro results are more compatible with the role of PAI-1 in clot stabilization as demonstrated in physiological and pathophysiological studies.

  4. Computational identification of antigen-binding antibody fragments.

    Science.gov (United States)

    Burkovitz, Anat; Leiderman, Olga; Sela-Culang, Inbal; Byk, Gerardo; Ofran, Yanay

    2013-03-01

    Determining which parts of the Ab are essential for Ag recognition and binding is crucial for understanding B cell-mediated immunity. Identification of fragments of Abs that maintain specificity to the Ag will also allow for the development of improved Ab-based therapy and diagnostics. In this article, we show that structural analysis of Ab-Ag complexes reveals which fragments of the Ab may bind the Ag on their own. In particular, it is possible to predict whether a given CDR is likely to bind the Ag as a peptide by analyzing the energetic contribution of each CDR to Ag binding and by assessing to what extent the interaction between that CDR and the Ag depends on other CDRs. To demonstrate this, we analyzed five Ab-Ag complexes and predicted for each of them which of the CDRs may bind the Ag on its own as a peptide. We then show that these predictions are in agreement with our experimental analysis and with previously published experimental results. These findings promote our understanding of the modular nature of Ab-Ag interactions and lay the foundation for the rational design of active CDR-derived peptides.

  5. Syntehsis and antiproliferative activities of chloropyridazine derivatives retain alkylsulfonyl moiety

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Chae Won; Park, Myung Sook [College of Pharmacy, Duksung Women' s University, Seoul (Korea, Republic of)

    2016-11-15

    Some chloropyridazine derivatives have shown interesting pharmacodynamics properties in terms of antioxidant and anti-human rotavirus (HRV) activities (Figure 1). To date, however, no study has evaluated the antiproliferative effects of chloropyridazines in other types of human cancer cells. In conclusion, we designed and synthesized a total of five groups of alkoxy-(or alkylthio-, alkylselenyl-, alkylsufinyl alkylsulfonyl-)chloropyridazines, and their antiproliferative activity was evaluated in the human cancer cell lines. IC{sub 50} values showed that the alkylsulfonylchloropyridazine compounds exhibited more active than the other four groups having alkoxy, alkylthio, alkylselenyl, alkylsulfinyl moieties against MCF-7 and Hep2B Cells.

  6. Syntehsis and antiproliferative activities of chloropyridazine derivatives retain alkylsulfonyl moiety

    International Nuclear Information System (INIS)

    Kim, Chae Won; Park, Myung Sook

    2016-01-01

    Some chloropyridazine derivatives have shown interesting pharmacodynamics properties in terms of antioxidant and anti-human rotavirus (HRV) activities (Figure 1). To date, however, no study has evaluated the antiproliferative effects of chloropyridazines in other types of human cancer cells. In conclusion, we designed and synthesized a total of five groups of alkoxy-(or alkylthio-, alkylselenyl-, alkylsufinyl alkylsulfonyl-)chloropyridazines, and their antiproliferative activity was evaluated in the human cancer cell lines. IC_5_0 values showed that the alkylsulfonylchloropyridazine compounds exhibited more active than the other four groups having alkoxy, alkylthio, alkylselenyl, alkylsulfinyl moieties against MCF-7 and Hep2B Cells

  7. Development and validation of an antigen-binding capture ELISA for native and putrescine-modified anti-tetanus F(ab')2 fragments for the assessment of the cellular uptake and plasma kinetics of the antibodies.

    Science.gov (United States)

    Welfringer, Frédéric; d'Athis, Philippe; Scherrmann, Jean-Michel; Hervé, Françoise

    2005-12-20

    Cationization is a strategy to enhance the permeability of antibodies to physiological membranes for potential therapeutic and diagnostic applications of these proteins, with one of its crucial points being the retention of antigen binding activity. Here, we describe the cationization of horse polyclonal anti-tetanus F(ab')(2) fragments and the development and validation of an ELISA for quantitative measurements of the binding activity of the native and cationized F(ab')(2) in cell lysates and rat plasma samples, assessing the cellular uptake and plasma kinetics of these antibodies, respectively. The method used tetanus anatoxin coated on microtitre plates as capture antigen to bind sample or standard F(ab')(2), the amount of antibody binding being quantified using, first, a secondary biotinylated anti-horse antibody/streptavidin-alkaline phosphatase complex in situ and then a measurement of the substrate product. Cationization of the F(ab')(2) was performed with putrescine at pH 4.5 using soluble carbodiimide as carboxyl activator. The average substitution ratio was determined at 3 putrescine molecules per F(ab')(2) molecule. The cationized F(ab')(2) retained roughly 80% of the initial antigen binding activity and was stable over a 1 year period of storage at -20 degrees C. The ELISA validation data showed that the method was linear for both the native and cationized F(ab')(2) using Hanks' balanced saline solution with 0.2% bovine serum albumin as assay diluent for the cell lysate samples. The useful F(ab')(2) concentration range was 2.5-25 ng/ml and the limit of quantification was 2.5 ng/ml. With rat blank plasma used as assay diluent for the rat plasma samples the useful F(ab')(2) concentration range was 3.5-25 ng/ml and the limit of quantification was 3.5 ng/ml. Specific requirements for the limits of quantification were fulfilled: precision tetanus F(ab')(2) in an HL 60 cell model, and of plasma kinetics after i.v. administration to rats.

  8. Anticandida Activity Is Retained in P-113, a 12-Amino-Acid Fragment of Histatin 5

    OpenAIRE

    Rothstein, David M.; Spacciapoli, Peter; Tran, Linh T.; Xu, Tao; Roberts, F. Donald; Dalla Serra, Mauro; Buxton, Deborah K.; Oppenheim, Frank G.; Friden, Phillip

    2001-01-01

    Through the analysis of a series of 25 peptides composed of various portions of the histatin 5 sequence, we have identified P-113, a 12-amino-acid fragment of histatin 5, as the smallest fragment that retains anticandidal activity comparable to that of the parent compound. Amidation of the P-113 C terminus increased the anticandidal activity of P-113 approximately twofold. The three histidine residues could be exchanged for three hydrophobic residues, with the fragment retaining anticandidal ...

  9. Test of active coal capacity for retaining gaseous effluents contaminated by 131 I

    International Nuclear Information System (INIS)

    Campeanu, Catalina; Cruceru, Madalina; Neacsu, Elena

    1999-01-01

    The aim of this paper is to test the retaining capacity of the active coal of the filters for gaseous effluents contaminated by 131 I. The active coal filters are design for equipping ventilation installations of nuclear plants in which radioactive iodine and combination of it were produced and handled. Such active coal filters are provided also to sorbonnes for radiochemical and physical handling of radioactive iodine. Testing the retaining capacity of active coal for filters is an obvious step, particularly, when the material was stored long time after preparation

  10. Development and validation of an antigen-binding capture ELISA for native and putrescine-modified anti-tetanus F(ab')2 fragments for the assessment of the cellular uptake and plasma kinetics of the antibodies.

    OpenAIRE

    Welfringer, Frédéric; D'Athis, Philippe; Scherrmann, Jean-Michel; Hervé, Françoise

    2005-01-01

    International audience; Cationization is a strategy to enhance the permeability of antibodies to physiological membranes for potential therapeutic and diagnostic applications of these proteins, with one of its crucial points being the retention of antigen binding activity. Here, we describe the cationization of horse polyclonal anti-tetanus F(ab')(2) fragments and the development and validation of an ELISA for quantitative measurements of the binding activity of the native and cationized F(ab...

  11. Dynamics behind affinity maturation of an anti-HCMV antibody family influencing antigen binding

    KAUST Repository

    Di Palma, Francesco; Tramontano, Anna

    2017-01-01

    The investigation of antibody affinity maturation and its effects on antigen binding is important with respect to understanding the regulation of the immune response. To shed light on this crucial process, we analyzed two Igs neutralizing the human cytomegalovirus: the primary germline antibody M2J1 and its related mature antibody 8F9. Both antibodies target the AD-2S1 epitope of the gB envelope protein and are considered to establish similar interactions with the cognate antigen. We used molecular dynamics simulations to understand the effect of mutations on the antibody–antigen interactions. The results provide a qualitative explanation for the increased 8F9 peptide affinity compared with that of M2J1. The emerging atomistic-detailed description of these complexes reveals the molecular effects of the somatic hypermutations occurring during affinity maturation.

  12. Foreign or Domestic CARs: Receptor Ligands as Antigen-Binding Domains

    Directory of Open Access Journals (Sweden)

    Donald R. Shaffer

    2014-01-01

    Full Text Available Chimeric antigen receptors (CARs are increasingly being used in clinical trials to treat a variety of malignant conditions and recent results with CD19-specific CARs showing complete tumor regressions has sparked the interest of researchers and the public alike. Traditional CARs have been generated using single-chain variable fragments (scFv, often derived from murine monoclonal antibodies, for antigen specificity. As the clinical experience with CAR T cells grows, so does the potential for unwanted immune responses against the foreign transgene. Strategies that may reduce the immunogenicity of CAR T cells are humanization of the scFv and the use of naturally occurring receptor ligands as antigen-binding domains. Herein, we review the experience with alternatively designed CARs that contain receptor ligands rather than scFv. While most of the experiences have been in the pre-clinical setting, clinical data is also emerging.

  13. Dynamics behind affinity maturation of an anti-HCMV antibody family influencing antigen binding

    KAUST Repository

    Di Palma, Francesco

    2017-08-03

    The investigation of antibody affinity maturation and its effects on antigen binding is important with respect to understanding the regulation of the immune response. To shed light on this crucial process, we analyzed two Igs neutralizing the human cytomegalovirus: the primary germline antibody M2J1 and its related mature antibody 8F9. Both antibodies target the AD-2S1 epitope of the gB envelope protein and are considered to establish similar interactions with the cognate antigen. We used molecular dynamics simulations to understand the effect of mutations on the antibody–antigen interactions. The results provide a qualitative explanation for the increased 8F9 peptide affinity compared with that of M2J1. The emerging atomistic-detailed description of these complexes reveals the molecular effects of the somatic hypermutations occurring during affinity maturation.

  14. The Effect of Displacement Mode of Rigid Retaining Walls on Shearing Bands by Active Earth Pressure

    Directory of Open Access Journals (Sweden)

    A. Sekkel

    2013-10-01

    Full Text Available This work treats the physical modeling of failure mechanisms by active earth pressure. This last is developed by retaining wall movement. A lot of research showed that wall displacement has a significant effect on active earth pressure. A good comprehension of active earth pressure phenomenon and its failure mechanisms help us to better conceive retaining walls. The conception of a small-scale model allowed the realization of active earth pressure tests, while displacing the mobile wall toward the outside of the massif. The studied material is that of Schneebeli; light two-dimensional material made of cylindrical plastic rollers, simulating granular non-cohesive soil. The evolution of shearing zones under continuous and discontinuous displacement modes of mobile walls by correlation pictures allows the investigation of the localization of deformations and failure mechanisms.

  15. A novel method for radiolabeling antigen-binding receptors of lymphocytes

    International Nuclear Information System (INIS)

    Choi, Y.S.; Lee, M.S.; Rosenspire, A.J.

    1983-01-01

    Antigen-binding receptor (ABR) molecules have been selectively radiolabeled and isolated from immunized chicken spleen cells. The specific radiolabeling of the receptors has been accomplished by utilizing a novel technique employing lactoperoxidase (LPO) covalently linked to antigen (Ag) for which human gammaglobulin was used. The cell surface ABRs were first bound to the Ag-LPO conjugates through specific recognition sites on the Ag portion of the conjugates. The bound LPO portions were then allowed to catalyze the radioiodination of the ABRs. After radiolabeling, cells were solubilized with detergents, ABRs still bound to Ag-LPO conjugates were directly isolated from the lysates via immunoaffinity chromatography utilizing an immunoaffinity reagent directed toward the antigen portion of the ABR-Ag-LPO complex. The radioactive materials were then analyzed via SDS-PAGE under reducing conditions. Most of the specifically-labeled and isolated materials were immunoglobulin (Ig). Both the membrane-bound form of the heavy chain as well as the secreted form were detected, along with the light chain. An additional polypeptide was also selectively labeled and isolated along with the Ig. This may be a molecule closely associated with the membrane immunoglobulin on the B-cell surface. (author)

  16. Polyphenol-Retaining Decaffeinated Cocoa Powder Obtained by Supercritical Carbon Dioxide Extraction and Its Antioxidant Activity.

    Science.gov (United States)

    Kobori, Kinji; Maruta, Yuto; Mineo, Shigeru; Shigematsu, Toru; Hirayama, Masao

    2013-10-14

    Cocoa beans contain many functional ingredients such as theobromine and polyphenols, but also contain a relatively high amount of caffeine, which can negatively impact human health. It is therefore desirable to reduce caffeine levels in cocoa powder used to make chocolate or cocoa beverages while retaining functional ingredients. We have established conditions for supercritical carbon dioxide (SCCO₂) extraction that remove 80.1% of the caffeine from cocoa powder while retaining theobromine (94.1%) and polyphenols (84.7%). The antioxidant activity of the decaffeinated cocoa powder (DCP) made with this optimized SCCO₂ extraction method was 85.3% that of non-processed cocoa powder. The total procyanidin and total polyphenol concentrations of the DCPs resulting from various SCCO₂ extractions showed a significant positive correlation with oxygen radical absorbance capacity (ORAC). The correlation coefficient between total polyphenols and ORAC was higher than that between total procyanidins and ORAC; thus, the concentration of total polyphenols might be a greater factor in the antioxidant activity of DCP. These results indicate that we could remove large quantities of caffeine from conventional high-cocoa products while retaining the functional benefits of high polyphenol content. This SCCO₂ extraction method is expected to be applicable high-cocoa products, such as dark chocolate.

  17. Polyphenol-Retaining Decaffeinated Cocoa Powder Obtained by Supercritical Carbon Dioxide Extraction and Its Antioxidant Activity

    Directory of Open Access Journals (Sweden)

    Kinji Kobori

    2013-10-01

    Full Text Available Cocoa beans contain many functional ingredients such as theobromine and polyphenols, but also contain a relatively high amount of caffeine, which can negatively impact human health. It is therefore desirable to reduce caffeine levels in cocoa powder used to make chocolate or cocoa beverages while retaining functional ingredients. We have established conditions for supercritical carbon dioxide (SCCO2 extraction that remove 80.1% of the caffeine from cocoa powder while retaining theobromine (94.1% and polyphenols (84.7%. The antioxidant activity of the decaffeinated cocoa powder (DCP made with this optimized SCCO2 extraction method was 85.3% that of non-processed cocoa powder. The total procyanidin and total polyphenol concentrations of the DCPs resulting from various SCCO2 extractions showed a significant positive correlation with oxygen radical absorbance capacity (ORAC. The correlation coefficient between total polyphenols and ORAC was higher than that between total procyanidins and ORAC; thus, the concentration of total polyphenols might be a greater factor in the antioxidant activity of DCP. These results indicate that we could remove large quantities of caffeine from conventional high-cocoa products while retaining the functional benefits of high polyphenol content. This SCCO2 extraction method is expected to be applicable high-cocoa products, such as dark chocolate.

  18. Physical activity is associated with retained muscle metabolism in human myotubes challenged with palmitate

    DEFF Research Database (Denmark)

    Green, C J; Bunprajun, T; Pedersen, B K

    2013-01-01

    in satellite cells challenged with palmitate. Although the benefits of physical activity on whole body physiology have been well investigated, this paper presents novel findings that both diet and exercise impact satellite cells directly. Given the fact that satellite cells are important for muscle maintenance......  The aim of this study was to investigate whether physical activity is associated with preserved muscle metabolism in human myotubes challenged with saturated fatty acids. Human muscle satellite cells were isolated from sedentary or active individuals and differentiated into myocytes in culture...... and correlated positively to JNK phosphorylation. In conclusion, muscle satellite cells retain metabolic differences associated with physical activity. Physical activity partially protects myocytes from fatty acid-induced insulin resistance and inactivity is associated with dysregulation of metabolism...

  19. A computational method for identification of vaccine targets from protein regions of conserved human leukocyte antigen binding

    DEFF Research Database (Denmark)

    Olsen, Lars Rønn; Simon, Christian; Kudahl, Ulrich J.

    2015-01-01

    Background: Computational methods for T cell-based vaccine target discovery focus on selection of highly conserved peptides identified across pathogen variants, followed by prediction of their binding of human leukocyte antigen molecules. However, experimental studies have shown that T cells ofte...... or proteome using human leukocyte antigen binding predictions and made a web-accessible software implementation freely available at http://met-hilab.cbs.dtu.dk/blockcons/....

  20. Light-chain residue 95 is critical for antigen binding and multispecificity of monoclonal antibody G2.

    Science.gov (United States)

    Usui, Daiki; Inaba, Satomi; Kamatari, Yuji O; Ishiguro, Naotaka; Oda, Masayuki

    2017-09-02

    The monoclonal antibody, G2, specifically binds to the immunogen peptide derived from the chicken prion protein, Pep18mer, and two chicken proteins derived peptides, Pep8 and Pep395; G2 binds with equal affinity to Pep18mer. The amino acid sequences of the three peptides are completely different, and so the recognition mechanism of G2 is unique and interesting. We generated a single-chain Fv (scFv) antibody of G2, and demonstrated its correct folding with an antigen binding function similar to intact G2 antibody. We also generated a Pro containing mutant of G2 scFv at residue 95 of the light chain, and analyzed its antigen binding using a surface plasmon biosensor. The mutant lost its binding ability to Pep18mer, but remained those to Pep8 and Pep395. The results clearly indicate residue 95 as being critical for multispecific antigen binding of G2 at the site generated from the junctional diversity introduced at the joints between the V and J gene segments. Copyright © 2017 Elsevier Inc. All rights reserved.

  1. Functional antigen binding by the defective B cells of CBA/N mice.

    Science.gov (United States)

    Snippe, H; Merchant, B; Lizzio, E F; Inman, J K

    1982-01-01

    CBA/N mice have an X-linked B cell defect which prevents them from responding to nonmitogenic thymic independent (TI-2) antigens such as dinitrophenylated DNP-Ficoll (1,2). The F1 male progeny of CBA/N female mice express the same defect. Spleen cell suspensions from such defective mice (CBA/N X C3H/HeN F1 males) could not respond to DNP-Ficoll following in vitro immunization and subsequent transfer into irradiated, syngeneic, F1 male recipients as expected. In contrast, normal CBA/N X C3H/HeN F1 female spleen cells could respond and effect a "rescue"; they mounted strong plaque-forming cell responses 7 days after in vitro exposure to DNP-Ficoll and subsequent transfer into irradiated F1 male recipients. Defective F1 male spleen cells, however, could bind significant quantities of 125I-DNP-Ficoll after in vitro exposure. Extensive washing of these spleen cells could not reverse this binding. Such DNP-Ficoll-exposed and washed F1 male spleen cells could, after transfer, aid normal untreated F1 female cells in their rescue function. The defective F1 male spleen cells could convey immunogenic quantities of DNP-Ficoll to the "rescuing" F1 female cells. Mitomycin treatment of F1 male cells did not interfere with their conveyor function. Goat anti-mouse mu serum impeded the passive antigen conveyor function of defective F1 male cells as did prior exposure to high concentrations of free DNP hapten. Our data support the view that the B cell defect of CBA/N X C3H/HeN F1 male mice does not relate to antigen binding, but rather to an inability to be effectively triggered by certain cell-bound polymeric antigens.

  2. Immobilization of inorganic pyrophosphatase on nanodiamond particles retaining its high enzymatic activity.

    Science.gov (United States)

    Rodina, Elena V; Valueva, Anastasiya V; Yakovlev, Ruslan Yu; Vorobyeva, Nataliya N; Kulakova, Inna I; Lisichkin, Georgy V; Leonidov, Nikolay B

    2015-12-21

    Nanodiamond (ND) particles are popular platforms for the immobilization of molecular species. In the present research, enzyme Escherichia coli inorganic pyrophosphatase (PPase) was immobilized on detonation ND through covalent or noncovalent bonding and its enzymatic activity was characterized. Factors affecting adsorption of PPase such as ND size and surface chemistry were studied. The obtained material is a submicron size association of ND particles and protein molecules in approximately equal amounts. Both covalently and noncovalently immobilized PPase retains a significant enzymatic activity (up to 95% of its soluble form) as well as thermostability. The obtained hybrid material has a very high enzyme loading capacity (∼1 mg mg(-1)) and may be considered as a promising delivery system of biologically active proteinaceous substances, particularly in the treatment of diseases such as calcium pyrophosphate crystal deposition disease and related pathologies. They can also be used as recoverable heterogeneous catalysts in the traditional uses of PPase.

  3. Retainer Positioner

    Directory of Open Access Journals (Sweden)

    Sanjeeb Kumar Sahu

    2012-01-01

    Full Text Available Several techniques are used to keep the retainer wire in the proper position during direct bonding, of lingual bonded retainers. Proper placement helps prevent occlusal wear of the composite over the retainer wire, thus reducing the risk of breakage. This article describes a new chairside time saving retainer positioner which allows accurate placement and direct bonding of all types of fixed lingual retainers, with solid or multistranded wires.

  4. Redistribution Principle Approach for Evaluation of Seismic Active Earth Pressure Behind Retaining Wall

    Science.gov (United States)

    Maskar, A. D.; Madhekar, S. N.; Phatak, D. R.

    2017-11-01

    The knowledge of seismic active earth pressure behind the rigid retaining wall is very essential in the design of retaining wall in earthquake prone regions. Commonly used Mononobe-Okabe (MO) method considers pseudo-static approach. Recently there are many pseudo-dynamic methods used to evaluate the seismic earth pressure. However, available pseudo-static and pseudo-dynamic methods do not incorporate the effect of wall movement on the earth pressure distribution. Dubrova (Interaction between soils and structures, Rechnoi Transport, Moscow, 1963) was the first, who considered such effect and till date, it is used for cohesionless soil, without considering the effect of seismicity. In this paper, Dubrova's model based on redistribution principle, considering the seismic effect has been developed. It is further used to compute the distribution of seismic active earth pressure, in a more realistic manner, by considering the effect of wall movement on the earth pressure, as it is displacement based method. The effects of a wide range of parameters like soil friction angle (ϕ), wall friction angle (δ), horizontal and vertical seismic acceleration coefficients (kh and kv); on seismic active earth pressure (Kae) have been studied. Results are presented for comparison of pseudo-static and pseudo-dynamic methods, to highlight the realistic, non-linearity of seismic active earth pressure distribution. The current study results in the variation of Kae with kh in the same manner as that of MO method and Choudhury and Nimbalkar (Geotech Geol Eng 24(5):1103-1113, 2006) study. To increase in ϕ, there is a reduction in static as well as seismic earth pressure. Also, by keeping constant ϕ value, as kh increases from 0 to 0.3, earth pressure increases; whereas as δ increases, active earth pressure decreases. The seismic active earth pressure coefficient (Kae) obtained from the present study is approximately same as that obtained by previous researchers. Though seismic earth

  5. Clear retainer

    Directory of Open Access Journals (Sweden)

    Priyakorn Chaimongkol

    2017-01-01

    Full Text Available A clear retainer is a removable retainer that is popular in the present day. Compared with conventional fixed and removable orthodontic retainers, it is a more esthetic, comfortable, and inexpensive appliance. Although several studies have been published about clear retainers, it could be difficult to interpret the results because of the variety of study designs, sample sizes, and research methods. This article is intended to compile the content from previous studies and discuss advantages, disadvantages, fabrication, insertion, and adjustment. Moreover, the effectiveness in maintaining dental position, occlusion, retention protocols, thickness, and survival rate of clear retainers is discussed.

  6. Failure evolution in granular material retained by rigid wall in active mode

    Science.gov (United States)

    Pietrzak, Magdalena; Leśniewska, Danuta

    2012-10-01

    This paper presents a detailed study of a selected small scale model test, performed on a sample of surrogate granular material, retained by a rigid wall (typical geotechnical problem of earth thrust on a retaining wall). The experimental data presented in this paper show that the deformation of granular sample behind retaining wall can undergo some cyclic changes. The nature of these cycles is not clear - it is probably related to some micromechanical features of granular materials, which are recently extensively studied in many research centers in the world. Employing very precise DIC (PIV) method can help to relate micro and macro-scale behavior of granular materials.

  7. Chlorogenic acid loaded chitosan nanoparticles with sustained release property, retained antioxidant activity and enhanced bioavailability

    Directory of Open Access Journals (Sweden)

    Ilaiyaraja Nallamuthu

    2015-06-01

    Full Text Available In this study, chlorogenic acid (CGA, a phenolic compound widely distributed in fruits and vegetables, was encapsulated into chitosan nanoparticles by ionic gelation method. The particles exhibited the size and zeta potential of 210 nm and 33 mV respectively. A regular, spherical shaped distribution of nanoparticles was observed through scanning electron microscopy (SEM and the success of entrapment was confirmed by FTIR analysis. The encapsulation efficiency of CGA was at about 59% with the loading efficiency of 5.2%. In vitro ABTS assay indicated that the radical scavenging activity of CAG was retained in the nanostructure and further, the release kinetics study revealed the burst release of 69% CGA from nanoparticles at the end of 100th hours. Pharmacokinetic analysis in rats showed a lower level of Cmax, longer Tmax, longer MRT, larger AUC0–t and AUC0–∞ for the CGA nanoparticles compared to free CGA. Collectively, these results suggest that the synthesised nanoparticle with sustained release property can therefore ease the fortification of food-matrices targeted for health benefits through effective delivery of CGA in body.

  8. Carbon-13 NMR study of switch variant anti-dansyl antibodies: Antigen binding and domain-domain interactions

    Energy Technology Data Exchange (ETDEWEB)

    Kato, Koichi; Matsunaga, Chigusa; Odaka, Asano; Yamato, Sumie; Takaha, Wakana; Shimada, Ichio; Arata, Yoji (Univ. of Tokyo (Japan))

    1991-07-02

    A {sup 13}C NMR study is reported of switch variant anti-dansyl antibodies, which possess the identical V{sub H}, V{sub L}, and C{sub L} domains in conjunction with highly homologous but not identical heavy-chain constant regions. Each of the antibodies has been selectively labeled with {sup 13}C at the carbonyl carbon of Trp, Tyr, His, or Cys residue by growing hybridoma cells in serum-free medium. Spectral assignments have been made by folowing the procedure described previously for the switch variant antibodies labeled with (1-{sup 13}C)Met. On the basis of the spectral data collected for the antibodies and their proteolytic fragments, the authors discuss how {sup 13}C NMR spectroscopy can be used for the structural analyses of antigen binding and also of domain-domain interactions in the antibody molecule.

  9. Carbon-13 NMR study of switch variant anti-dansyl antibodies: Antigen binding and domain-domain interactions

    International Nuclear Information System (INIS)

    Kato, Koichi; Matsunaga, Chigusa; Odaka, Asano; Yamato, Sumie; Takaha, Wakana; Shimada, Ichio; Arata, Yoji

    1991-01-01

    A 13 C NMR study is reported of switch variant anti-dansyl antibodies, which possess the identical V H , V L , and C L domains in conjunction with highly homologous but not identical heavy-chain constant regions. Each of the antibodies has been selectively labeled with 13 C at the carbonyl carbon of Trp, Tyr, His, or Cys residue by growing hybridoma cells in serum-free medium. Spectral assignments have been made by folowing the procedure described previously for the switch variant antibodies labeled with [1- 13 C]Met. On the basis of the spectral data collected for the antibodies and their proteolytic fragments, the authors discuss how 13 C NMR spectroscopy can be used for the structural analyses of antigen binding and also of domain-domain interactions in the antibody molecule

  10. A critical examination of the numerology of antigen-binding cells: evidence for multiple receptor specificities on single cells.

    Science.gov (United States)

    Miller, A

    1977-01-01

    The data available from other laboratories as well as our own on the frequency of cells recognizing major histocompatibility antigens or conventional protein and hapten antigens is critically evaluated. The frequency of specific binding for a large number of antigens is sufficiently high to support the idea that at least part of the antigen-binding cell population must have multiple specificities. Our results suggest that these multiple specific cells result from single cells synthesizing and displaying as many as 50-100 species of receptor, each at a frequency of 10(4) per cell. A model involving gene expansion of constant-region genes is suggested and some auxilliary evidence consistent with such C-gene expansion is presented.

  11. Transient Activation of Apomixis in Sexual Neotriploids May Retain Genomically Altered States and Enhance Polyploid Establishment

    Directory of Open Access Journals (Sweden)

    Diego Hojsgaard

    2018-02-01

    Full Text Available Polyploid genomes evolve and follow a series of dynamic transfigurations along with adaptation and speciation. The initial formation of a new polyploid individual within a diploid population usually involves a triploid bridge, a two-step mechanism of cell fusions between ubiquitous (reduced and rare (unreduced gametes. The primary fusion event creates an intermediate triploid individual with unbalanced genome sets, a situation of genomic-shock characterized by gene expression dysregulation, high dosage sensitivity, disturbed cell divisions, and physiological and reproductive attributes drastically altered. This near-sterile neotriploid must produce (even eupolyploids through secondary fusion events to restore genome steadiness, meiotic balance, and fertility required for the demographic establishment of a nascent lineage. Natural conditions locate several difficulties to polyploid establishment, including the production of highly unbalanced and rarely unreduced (euploid gametes, frequency-dependent disadvantages (minority cytotype exclusion, severe fitness loss, and ecological competition with diploid parents. Persistence and adaptation of neopolyploids depend upon genetic and phenotypic novelty coupled to joint selective forces that preserve shock-induced genomic changes (subgenome homeolog partitioning and drive meiotic (reproductive stabilization and ecological diversification. Thus, polyploid establishment through the triploid bridge is a feasible but not ubiquitous process that requires a number of low-probability events and singular circumstances. Yet, frequencies of polyploids suggest that polyploid establishment is a pervasive process. To explain this disparity, and supported in experimental evidence, I propose that situations like hybridization and ploidy-state transitions associated to genomic shock and substantial developmental alterations can transiently activate apomixis as a mechanism to halt genomic instability and cancel factors

  12. Effect of polyethylene glycol conjugation on conformational and colloidal stability of a monoclonal antibody antigen-binding fragment (Fab').

    Science.gov (United States)

    Roque, Cristopher; Sheung, Anthony; Rahman, Nausheen; Ausar, S Fernando

    2015-02-02

    We have investigated the effects of site specific "hinge" polyethylene glycol conjugation (PEGylation) on thermal, pH, and colloidal stability of a monoclonal antibody antigen-binding fragment (Fab') using a variety of biophysical techniques. The results obtained by circular dichroism (CD), ultraviolet (UV) absorbance, and fluorescence spectroscopy suggested that the physical stability of the Fab' is maximized at pH 6-7 with no apparent differences due to PEGylation. Temperature-induced aggregation experiments revealed that PEGylation was able to increase the transition temperature, as well as prevent the formation of visible and subvisible aggregates. Statistical comparison of the three-index empirical phase diagram (EPD) revealed significant differences in thermal and pH stability signatures between Fab' and PEG-Fab'. Upon mechanical stress, micro-flow imaging (MFI) and measurement of the optical density at 360 nm showed that the PEG-Fab' had significantly higher resistance to surface-induced aggregation compared to the Fab'. Analysis of the interaction parameter, kD, indicated repulsive intermolecular forces for PEG-Fab' and attractive forces for Fab'. In conclusion, PEGylation appears to protect Fab' against thermal and mechanical stress-induced aggregation, likely due to a steric hindrance mechanism.

  13. Active Thrust on an Inclined Retaining Wall with Inclined Cohesionless Backfill due to Surcharge Effect

    OpenAIRE

    Dewaikar, D. M.; Pandey, S. R.; Dixit, Jagabandhu

    2012-01-01

    A method based on the application of Kötter’s equation is proposed for the complete analysis of active thrust on an inclined wall with inclined cohesionless backfill under surcharge effect. Coulomb’s failure mechanism is considered in the analysis. The point of application of active thrust is determined from the condition of moment equilibrium. The coefficient of active pressure and the point of application of the active thrust are computed and presented in nondimensional form. One distinguis...

  14. Activity-Based Profiling of Retaining β-Glucosidases: A Comparative Study

    NARCIS (Netherlands)

    Witte, Martin D.; Walvoort, Marthe T. C.; Li, Kah-Yee; Kallemeijn, Wouter W.; Donker-Koopman, Wilma E.; Boot, Rolf G.; Aerts, Johannes M. F. G.; Codée, Jeroen D. C.; van der Marel, Gijsbert A.; Overkleeft, Herman S.

    2011-01-01

    Activity-based protein profiling (ABPP) is a versatile strategy to report on enzyme activity in vitro, in situ, and in vivo. The development and use of ABPP tools and techniques has met with considerable success in monitoring physiological processes involving esterases and proteases. Activity-based

  15. Activity-Based Profiling of Retaining beta-Glucosidases : A Comparative Study

    NARCIS (Netherlands)

    Witte, Martin D.; Walvoort, Marthe T. C.; Li, Kah-Yee; Kallemeijn, Wouter W.; Donker-Koopman, Wilma E.; Boot, Rolf G.; Aerts, Johannes M. F. G.; Codee, Jeroen D. C.; van der Marel, Gijsbert A.; Overkleeft, Herman S.

    2011-01-01

    Activity-based protein profiling (ABPP) is a versatile strategy to report on enzyme activity in vitro, in situ, and in vivo. The development and use of ABPP tools and techniques has met with considerable success in monitoring physiological processes involving esterases and proteases. Activity-based

  16. Activity-Based Profiling of Retaining β-Glucosidases : A Comparative Study

    NARCIS (Netherlands)

    Witte, Martin D.; Walvoort, Marthe T.C.; Li, Kah-Yee; Kallemeijn, Wouter W.; Donker-Koopman, Wilma E.; Boot, Rolf G.; Aerts, Johannes M.F.G.; Codée, Jeroen D.C.; Marel, Gijsbert A. van der; Overkleeft, Herman S.

    2011-01-01

    Activity-based protein profiling (ABPP) is a versatile strategy to report on enzyme activity in vitro, in situ, and in vivo. The development and use of ABPP tools and techniques has met with considerable success in monitoring physiological processes involving esterases and proteases. Activity-based

  17. Structurally simplified biphenyl combretastatin A4 derivatives retain in vitro anti-cancer activity dependent on mitotic arrest

    Science.gov (United States)

    Tarade, Daniel; Ma, Dennis; Pignanelli, Christopher; Mansour, Fadi; Simard, Daniel; van den Berg, Sean; Gauld, James; McNulty, James; Pandey, Siyaram

    2017-01-01

    The cis-stilbene, combretastatin A4 (CA4), is a potent microtubule targeting and vascular damaging agent. Despite promising results at the pre-clinical level and extensive clinical evaluation, CA4 has yet to be approved for therapeutic use. One impediment to the development of CA4 is an inherent conformational instability about the ethylene linker, which joins two aromatic rings. We have previously published preliminary data regarding structurally simplified biphenyl derivatives of CA4, lacking an ethylene linker, which retain anti-proliferative and pro-apoptotic activity, albeit at higher doses. Our current study provides a more comprehensive evaluation regarding the anti-proliferative and pro-apoptotic properties of biphenyl CA4 derivatives in both 2D and 3D cancerous and non-cancerous cell models. Computational analysis has revealed that cytotoxicity of CA4 and biphenyl analogues correlates with predicted tubulin affinity. Additional mechanistic evaluation of the biphenyl derivatives found that their anti-cancer activity is dependent on prolonged mitotic arrest, in a similar manner to CA4. Lastly, we have shown that cancer cells deficient in the extrinsic pathway of apoptosis experience delayed cell death following treatment with CA4 or analogues. Biphenyl derivatives of CA4 represent structurally simplified analogues of CA4, which retain a similar mechanism of action. The biphenyl analogues warrant in vivo examination to evaluate their potential as vascular damaging agents. PMID:28253265

  18. Structurally simplified biphenyl combretastatin A4 derivatives retain in vitro anti-cancer activity dependent on mitotic arrest.

    Directory of Open Access Journals (Sweden)

    Daniel Tarade

    Full Text Available The cis-stilbene, combretastatin A4 (CA4, is a potent microtubule targeting and vascular damaging agent. Despite promising results at the pre-clinical level and extensive clinical evaluation, CA4 has yet to be approved for therapeutic use. One impediment to the development of CA4 is an inherent conformational instability about the ethylene linker, which joins two aromatic rings. We have previously published preliminary data regarding structurally simplified biphenyl derivatives of CA4, lacking an ethylene linker, which retain anti-proliferative and pro-apoptotic activity, albeit at higher doses. Our current study provides a more comprehensive evaluation regarding the anti-proliferative and pro-apoptotic properties of biphenyl CA4 derivatives in both 2D and 3D cancerous and non-cancerous cell models. Computational analysis has revealed that cytotoxicity of CA4 and biphenyl analogues correlates with predicted tubulin affinity. Additional mechanistic evaluation of the biphenyl derivatives found that their anti-cancer activity is dependent on prolonged mitotic arrest, in a similar manner to CA4. Lastly, we have shown that cancer cells deficient in the extrinsic pathway of apoptosis experience delayed cell death following treatment with CA4 or analogues. Biphenyl derivatives of CA4 represent structurally simplified analogues of CA4, which retain a similar mechanism of action. The biphenyl analogues warrant in vivo examination to evaluate their potential as vascular damaging agents.

  19. PEGylation of α-momorcharin retained its anti-tumor activity with ...

    African Journals Online (AJOL)

    user

    the anti-tumor activity of α-MMC-PEG decreased by about 30% in vitro. This sensitivity increase of 50 ... experiments and were acclimatized in the animal room. They were housed on aspen ..... PEGylation, successful approach to drug delivery.

  20. Retaining in-gel zymographic activity of cysteine proteases via a cysteine-supplemented running buffer.

    Science.gov (United States)

    Vootukuri Reddy, Sreekanth; Philpott, Mike P; Trigiante, Giuseppe

    2016-10-01

    Zymography is a powerful technique to separate and identify different enzymatic activities on a standard acrylamide gel. For oxidation prone enzymes such as cysteine proteases however, the oxidizing species generated by electrolysis of the gel running buffer may result in partial or complete inactivation, thus compromising the final readout. This can be only partially remedied by subsequent treatment of the gel with reducing agents. We demonstrate the generation of reactive oxidizing species during electrophoresis and discovered that supplementation of the gel running buffer with a minimum of 5 mM cysteine prevents enzyme inactivation and allows retention of proteolytic activity as measured by zymography on model substrate N α-benzoyl-l-arginine p-nitroanilide, without at the same time altering the mobilities of the gel proteins. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Glycosylation site-targeted PEGylation of glucose oxidase retains native enzymatic activity.

    Science.gov (United States)

    Ritter, Dustin W; Roberts, Jason R; McShane, Michael J

    2013-04-10

    Targeted PEGylation of glucose oxidase at its glycosylation sites was investigated to determine the effect on enzymatic activity, as well as the bioconjugate's potential in an optical biosensing assay. Methoxy-poly(ethylene glycol)-hydrazide (4.5kDa) was covalently coupled to periodate-oxidized glycosylation sites of glucose oxidase from Aspergillus niger. The bioconjugate was characterized using gel electrophoresis, liquid chromatography, mass spectrometry, and dynamic light scattering. Gel electrophoresis data showed that the PEGylation protocol resulted in a drastic increase (ca. 100kDa) in the apparent molecular mass of the protein subunit, with complete conversion to the bioconjugate; liquid chromatography data corroborated this large increase in molecular size. Mass spectrometry data proved that the extent of PEGylation was six poly(ethylene glycol) chains per glucose oxidase dimer. Dynamic light scattering data indicated the absence of higher-order oligomers in the PEGylated GOx sample. To assess stability, enzymatic activity assays were performed in triplicate at multiple time points over the course of 29 days in the absence of glucose, as well as before and after exposure to 5% w/v glucose for 24h. At a confidence level of 95%, the bioconjugate's performance was statistically equivalent to native glucose oxidase in terms of activity retention over the 29 day time period, as well as following the 24h glucose exposure. Finally, the bioconjugate was entrapped within a poly(2-hydroxyethyl methacrylate) hydrogel containing an oxygen-sensitive phosphor, and the construct was shown to respond approximately linearly with a 220±73% signal change (n=4, 95% confidence interval) over the physiologically-relevant glucose range (i.e., 0-400mg/dL); to our knowledge, this represents the first demonstration of PEGylated glucose oxidase incorporated into an optical biosensing assay. Copyright © 2013 Elsevier Inc. All rights reserved.

  2. Using molecular principal axes for structural comparison: determining the tertiary changes of a FAB antibody domain induced by antigenic binding

    Directory of Open Access Journals (Sweden)

    Silverman B David

    2007-11-01

    Full Text Available Abstract Background Comparison of different protein x-ray structures has previously been made in a number of different ways; for example, by visual examination, by differences in the locations of secondary structures, by explicit superposition of structural elements, e.g. α-carbon atom locations, or by procedures that utilize a common symmetry element or geometrical feature of the structures to be compared. Results A new approach is applied to determine the structural changes that an antibody protein domain experiences upon its interaction with an antigenic target. These changes are determined with the use of two different, however comparable, sets of principal axes that are obtained by diagonalizing the second-order tensors that yield the moments-of-geometry as well as an ellipsoidal characterization of domain shape, prior to and after interaction. Determination of these sets of axes for structural comparison requires no internal symmetry features of the domains, depending solely upon their representation in three-dimensional space. This representation may involve atomic, Cα, or residue centroid coordinates. The present analysis utilizes residue centroids. When the structural changes are minimal, the principal axes of the domains, prior to and after interaction, are essentially comparable and consequently may be used for structural comparison. When the differences of the axes cannot be neglected, but are nevertheless slight, a smaller relatively invariant substructure of the domains may be utilized for comparison. The procedure yields two distance metrics for structural comparison. First, the displacements of the residue centroids due to antigenic binding, referenced to the ellipsoidal principal axes, are noted. Second, changes in the ellipsoidal distances with respect to the non-interacting structure provide a direct measure of the spatial displacements of the residue centroids, towards either the interior or exterior of the domain

  3. Retaining Oxidative Stability of Emulsified Foods by Novel Nonmigratory Polyphenol Coated Active Packaging.

    Science.gov (United States)

    Roman, Maxine J; Decker, Eric A; Goddard, Julie M

    2016-07-13

    Oxidation causes lipid rancidity, discoloration, and nutrient degradation that decrease shelf life of packaged foods. Synthetic additives are effective oxidation inhibitors, but are undesirable to consumers who prefer "clean" label products. The aim of this study was to improve oxidative stability of emulsified foods by a novel nonmigratory polyphenol coated active packaging. Polyphenol coatings were applied to chitosan functionalized polypropylene (PP) by laccase assisted polymerization of catechol and catechin. Polyphenol coated PP exhibited both metal chelating (39.3 ± 2.5 nmol Fe(3+) cm(-2), pH 4.0) and radical scavenging (up to 52.9 ± 1.8 nmol Trolox eq cm(-2)) capacity, resulting in dual antioxidant functionality to inhibit lipid oxidation and lycopene degradation in emulsions. Nonmigratory polyphenol coated PP inhibited ferric iron promoted degradation better than soluble chelators, potentially by partitioning iron from the emulsion droplet interface. This work demonstrates that polyphenol coatings can be designed for advanced material chemistry solutions in active food packaging.

  4. Crystal structure of the anti-(carcinoembryonic antigen) single-chain Fv antibody MFE-23 and a model for antigen binding based on intermolecular contacts.

    Science.gov (United States)

    Boehm, M K; Corper, A L; Wan, T; Sohi, M K; Sutton, B J; Thornton, J D; Keep, P A; Chester, K A; Begent, R H; Perkins, S J

    2000-03-01

    MFE-23 is the first single-chain Fv antibody molecule to be used in patients and is used to target colorectal cancer through its high affinity for carcinoembryonic antigen (CEA), a cell-surface member of the immunoglobulin superfamily. MFE-23 contains an N-terminal variable heavy-chain domain joined by a (Gly(4)Ser)(3) linker to a variable light-chain (V(L)) domain (kappa chain) with an 11-residue C-terminal Myc-tag. Its crystal structure was determined at 2.4 A resolution by molecular replacement with an R(cryst) of 19.0%. Five of the six antigen-binding loops, L1, L2, L3, H1 and H2, conformed to known canonical structures. The sixth loop, H3, displayed a unique structure, with a beta-hairpin loop and a bifurcated apex characterized by a buried Thr residue. In the crystal lattice, two MFE-23 molecules were associated back-to-back in a manner not seen before. The antigen-binding site displayed a large acidic region located mainly within the H2 loop and a large hydrophobic region within the H3 loop. Even though this structure is unliganded within the crystal, there is an unusually large region of contact between the H1, H2 and H3 loops and the beta-sheet of the V(L) domain of an adjacent molecule (strands DEBA) as a result of intermolecular packing. These interactions exhibited remarkably high surface and electrostatic complementarity. Of seven MFE-23 residues predicted to make contact with antigen, five participated in these lattice contacts, and this model for antigen binding is consistent with previously reported site-specific mutagenesis of MFE-23 and its effect on CEA binding.

  5. Ibuprofen arginate retains eNOS substrate activity and reverses endothelial dysfunction: implications for the COX-2/ADMA axis.

    Science.gov (United States)

    Kirkby, Nicholas S; Tesfai, Abel; Ahmetaj-Shala, Blerina; Gashaw, Hime H; Sampaio, Walkyria; Etelvino, Gisele; Leão, Nádia Miricéia; Santos, Robson A; Mitchell, Jane A

    2016-12-01

    Nonsteroidal antiinflammatory drugs, including ibuprofen, are among the most commonly used medications and produce their antiinflammatory effects by blocking cyclooxygenase (COX)-2. Their use is associated with increased risk of heart attacks caused by blocking COX-2 in the vasculature and/or kidney, with our recent work implicating the endogenous NOS inhibitor asymmetric dimethylarginine (ADMA), a cardiotoxic hormone whose effects can be prevented by l-arginine. The ibuprofen salt ibuprofen arginate (Spididol) was created to increase solubility but we suggest that it could also augment the NO pathway through codelivery of arginine. Here we investigated the idea that ibuprofen arginate can act to simultaneously inhibit COX-2 and preserve the NO pathway. Ibuprofen arginate functioned similarly to ibuprofen sodium for inhibition of mouse/human COX-2, but only ibuprofen arginate served as a substrate for NOS. Ibuprofen arginate but not ibuprofen sodium also reversed the inhibitory effects of ADMA and N G -nitro-l-arginine methyl ester on inducible NOS (macrophages) and endothelial NOS in vitro (aorta) and in vivo (blood pressure). These observations show that ibuprofen arginate provides, in one preparation, a COX-2 inhibitor and NOS substrate that could act to negate the harmful cardiovascular consequences mediated by blocking renal COX-2 and increased ADMA. While remarkably simple, our findings are potentially game-changing in the nonsteroidal antiinflammatory drug arena.-Kirkby, N. S., Tesfai, A., Ahmetaj-Shala, B., Gashaw, H. H., Sampaio, W., Etelvino, G., Leão, N. M., Santos, R. A., Mitchell, J. A. Ibuprofen arginate retains eNOS substrate activity and reverses endothelial dysfunction: implications for the COX-2/ADMA axis. © The Author(s).

  6. An approach to the unification of suppressor T cell circuits: a simplified assay for the induction of suppression by T cell-derived, antigen-binding molecules (T-ABM).

    Science.gov (United States)

    Chue, B; Ferguson, T A; Beaman, K D; Rosenman, S J; Cone, R E; Flood, P M; Green, D R

    1989-01-01

    A system is presented in which the in vitro response to sheep red blood cells (SRBC) can be regulated using antigenic determinants coupled to SRBC and T cell-derived antigen-binding molecules (T-ABM) directed against the coupled determinants. T suppressor-inducer factors (TsiF's) are composed of two molecules, one of which is a T-ABM and one which bears I-J determinants (I-J+ molecule). Using two purified T-ABM which have not previously been shown to have in vitro activity, we produced antigen-specific TsiF's which were capable of inducing the suppression of the anti-SRBC response. Suppression was found to require both the T-ABM and the I-J+ molecule, SRBC conjugated with the antigen for which the T-ABM was specific, and a population of Ly-2+ T cells in the culture. Two monoclonal TsiF (or TsF1) were demonstrated to induce suppression of the anti-SRBC response in this system, provided the relevant antigen was coupled to the SRBC in culture. The results are discussed in terms of the general functions of T-ABM in the immune system. This model will be useful in direct, experimental comparisons of the function of T-ABM and suppressor T cell factors under study in different systems and laboratories.

  7. E. coli-Derived L-Asparaginase Retains Enzymatic and Cytotoxic Activity In Vitro for Canine and Feline Lymphoma after Cold Storage

    Directory of Open Access Journals (Sweden)

    Jackie M. Wypij

    2013-01-01

    Full Text Available Background. L-asparaginase is effective in treating canine and feline lymphoma, however chemotherapy poses a significant financial cost to veterinary clients, limiting therapy for many pets. Single dose vials result in significant drug wastage, and drug shortages limit consistent availability for pets. Hypothesis. E. coli-derived asparaginase retains enzymatic and antineoplastic activity in canine and feline lymphoma cells after cold storage. Methods. E. coli-derived asparaginase was cold-stored: refrigeration (7–14 days and freezing (14 days–six months, one to three freeze/thaw cycles. Enzymatic activity of asparaginase was measured via a modified asparagine assay. Effects of cold-stored asparaginase on cell proliferation and cytotoxicity were measured in feline (MYA-1, F1B and canine (17–71, OSW lymphoma cells. Results. Cold-stored E. coli-derived asparaginase retains antineoplastic activity in all four cell lines tested. Cold-stored E. coli-derived L-asparaginase depletes asparagine and retains enzymatic activity. Duration of refrigeration, duration of freezing, and number of freeze-thaw cycles have minimal effect on asparaginase enzyme activity. Conclusions and Clinical Importance. This study establishes a scientific basis for long-term cold storage of reconstituted E. coli-derived asparaginase that may result in better utilization of limited drug resources and improve financial feasibility of E. coli-derived asparaginase as a therapeutic option for pets with lymphoma.

  8. The solvent at antigen-binding site regulated C3d-CR2 interactions through the C-terminal tail of C3d at different ion strengths: insights from molecular dynamics simulation.

    Science.gov (United States)

    Zhang, Yan; Guo, Jingjing; Li, Lanlan; Liu, Xuewei; Yao, Xiaojun; Liu, Huanxiang

    2016-10-01

    The interactions of complement receptor 2 (CR2) and the degradation fragment C3d of complement component C3 play important links between the innate and adaptive immune systems. Due to the importance of C3d-CR2 interaction in the design of vaccines and inhibitors, a number of studies have been performed to investigate C3d-CR2 interaction. Many studies have indicated C3d-CR2 interactions are ionic strength-dependent. To investigate the molecular mechanism of C3d-CR2 interaction and the origin of effects of ionic strength, molecular dynamics simulations for C3d-CR2 complex together with the energetic and structural analysis were performed. Our results revealed the increased interactions between charged protein and ions weaken C3d-CR2 association, as ionic strengths increase. Moreover, ion strengths have similar effects on antigen-binding site and CR2 binding site. Meanwhile, Ala17 and Gln20 will transform between the activated and non-activated states mediated by His133 and Glu135 at different ion strengths. Our results reveal the origins of the effects of ionic strengths on C3d-CR2 interactions are due to the changes of water, ion occupancies and distributions. This study uncovers the origin of the effect of ionic strength on C3d-CR2 interaction and deepens the understanding of the molecular mechanism of their interaction, which is valuable for the design of vaccines and small molecule inhibitors. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. Bat Caliciviruses and Human Noroviruses Are Antigenically Similar and Have Overlapping Histo-Blood Group Antigen Binding Profiles.

    Science.gov (United States)

    Kocher, Jacob F; Lindesmith, Lisa C; Debbink, Kari; Beall, Anne; Mallory, Michael L; Yount, Boyd L; Graham, Rachel L; Huynh, Jeremy; Gates, J Edward; Donaldson, Eric F; Baric, Ralph S

    2018-05-22

    Emerging zoonotic viral diseases remain a challenge to global public health. Recent surveillance studies have implicated bats as potential reservoirs for a number of viral pathogens, including coronaviruses and Ebola viruses. Caliciviridae represent a major viral family contributing to emerging diseases in both human and animal populations and have been recently identified in bats. In this study, we blended metagenomics, phylogenetics, homology modeling, and in vitro assays to characterize two novel bat calicivirus (BtCalV) capsid sequences, corresponding to strain BtCalV/A10/USA/2009, identified in Perimyotis subflavus near Little Orleans, MD, and bat norovirus. We observed that bat norovirus formed virus-like particles and had epitopes and receptor-binding patterns similar to those of human noroviruses. To determine whether these observations stretch across multiple bat caliciviruses, we characterized a novel bat calicivirus, BtCalV/A10/USA/2009. Phylogenetic analysis revealed that BtCalV/A10/USA/2009 likely represents a novel Caliciviridae genus and is most closely related to "recoviruses." Homology modeling revealed that the capsid sequences of BtCalV/A10/USA/2009 and bat norovirus resembled human norovirus capsid sequences and retained host ligand binding within the receptor-binding domains similar to that seen with human noroviruses. Both caliciviruses bound histo-blood group antigens in patterns that overlapped those seen with human and animal noroviruses. Taken together, our results indicate the potential for bat caliciviruses to bind histo-blood group antigens and overcome a significant barrier to cross-species transmission. Additionally, we have shown that bat norovirus maintains antigenic epitopes similar to those seen with human noroviruses, providing further evidence of evolutionary descent. Our results reiterate the importance of surveillance of wild-animal populations, especially of bats, for novel viral pathogens. IMPORTANCE Caliciviruses are

  10. Use of thermodynamic coupling between antibody-antigen binding and phospholipid acyl chain phase transition energetics to predict immunoliposome targeting affinity.

    Science.gov (United States)

    Klegerman, Melvin E; Zou, Yuejiao; Golunski, Eva; Peng, Tao; Huang, Shao-Ling; McPherson, David D

    2014-09-01

    Thermodynamic analysis of ligand-target binding has been a useful tool for dissecting the nature of the binding mechanism and, therefore, potentially can provide valuable information regarding the utility of targeted formulations. Based on a consistent coupling of antibody-antigen binding and gel-liquid crystal transition energetics observed for antibody-phosphatidylethanolamine (Ab-PE) conjugates, we hypothesized that the thermodynamic parameters and the affinity for antigen of the Ab-PE conjugates could be effectively predicted once the corresponding information for the unconjugated antibody is determined. This hypothesis has now been tested in nine different antibody-targeted echogenic liposome (ELIP) preparations, where antibody is conjugated to dipalmitoylphosphatidylethanolamine (DPPE) head groups through a thioether linkage. Predictions were satisfactory (affinity not significantly different from the population of values found) in five cases (55.6%), but the affinity of the unconjugated antibody was not significantly different from the population of values found in six cases (66.7%), indicating that the affinities of the conjugated antibody tended not to deviate appreciably from those of the free antibody. While knowledge of the affinities of free antibodies may be sufficient to judge their suitability as targeting agents, thermodynamic analysis may still provide valuable information regarding their usefulness for specific applications.

  11. Crystal structure of the antigen-binding fragment of a monoclonal antibody specific for the multidrug-resistance-linked ABC transporter human P-glycoprotein

    Energy Technology Data Exchange (ETDEWEB)

    Esser, Lothar; Shukla, Suneet; Zhou, Fei; Ambudkar, Suresh V.; Xia, Di

    2016-07-27

    P-glycoprotein (P-gp) is a polyspecific ATP-dependent transporter linked to multidrug resistance in cancers that plays important roles in the pharmacokinetics of a large number of drugs. The drug-resistance phenotype of P-gp can be modulated by the monoclonal antibody UIC2, which specifically recognizes human P-gp in a conformation-dependent manner. Here, the purification, sequence determination and high-resolution structure of the Fab fragment of UIC2 (UIC2/Fab) are reported. Purified UIC2/Fab binds human P-gp with a 1:1 stoichiometry. Crystals of UIC2/Fab are triclinic (space groupP1), with unit-cell parametersa= 40.67,b= 44.91,c= 58.09 Å, α = 97.62, β = 99.10, γ = 94.09°, and diffracted X-rays to 1.6 Å resolution. The structure was determined by molecular replacement and refined to 1.65 Å resolution. The asymmetric unit contains one molecule of UIC2/Fab, which exhibits a positively charged antigen-binding surface, suggesting that it might recognize an oppositely charged extracellular epitope of P-gp.

  12. Frequency of Helicobacter pylori blood-group antigen-binding adhesion 2 and sialic acid binding adhesion genes among dyspeptic patients in Tabriz, Iran

    Directory of Open Access Journals (Sweden)

    Leila Yousefi

    2015-06-01

    Full Text Available Introduction: The purpose of this research was to analyze blood-group antigen-binding adhesion (babA2 and sialic acid binding adhesion (sabA genotypes status in Helicobacter pylori (H. pylori isolates and their relationship with clinical outcomes. Methods: Gastric biopsy specimens were homogenized and placed in Brucella agar medium supplemented with 5% sheep blood and 3 antibiotics and were cultured at 37 °C under microaerophilic conditions and incubated for 4-7 days. H. pylori was identified by typical morphology, gram-staining and urease tests, and babA2 and sabA genes were detected by polymerase chain reaction (PCR. Results: From a total of 100 H. pylori isolates; babA2 and sabA genes were detected in 23.0 and 26.4%, respectively. There was a significant relationship between these genes and clinical outcomes (P < 0.050. Conclusion: We found that the babA2 status was not related to clinical outcomes in Tabriz, Iran. However, sabA was a promoting determinant for disease, and multivariate analysis disclosed sabA to be an independent marker of non-ulcer diseases in our subjects.

  13. Genotoxic effect and antigen binding characteristics of SLE auto-antibodies to peroxynitrite-modified human DNA.

    Science.gov (United States)

    Khan, Md Asad; Alam, Khursheed; Mehdi, Syed Hassan; Rizvi, M Moshahid A

    2017-12-01

    Systemic lupus erythematosus (SLE) is an inflammatory autoimmune disease characterized by auto-antibodies against native deoxyribonucleic acid after modification and is one of the reasons for the development of SLE. Here, we have evaluated the structural perturbations in human placental DNA by peroxynitrite using spectroscopy, thermal denaturation and high-performance liquid chromatography (HPLC). Peroxynitrite is a powerful potent bi-functional oxidative/nitrative agent that is produced both endogenously and exogenously. In experimental animals, the peroxynitrite-modified DNA was found to be highly immunogenic. The induced antibodies showed cross-reactions with different types of DNA and nitrogen bases that were modified with peroxynitrite by inhibition ELISA. The antibody activity was inhibited by approximately 89% with its immunogen as the inhibitor. The antigen-antibodies interaction between induced antibodies with peroxynitrite-modified DNA showed retarded mobility as compared to the native form. Furthermore, significantly increased binding was also observed in SLE autoantibodies with peroxynitrite-modified DNA than native form. Moreover, DNA isolated from lymphocyte of SLE patients revealed significant recognition of anti-peroxynitrite-modified DNA immunoglobulin G (IgG). Our data indicates that DNA modified with peroxynitrite presents unique antigenic determinants that may induce autoantibody response in SLE. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. Furin is a chemokine-modifying enzyme: in vitro and in vivo processing of CXCL10 generates a C-terminally truncated chemokine retaining full activity.

    Science.gov (United States)

    Hensbergen, Paul J; Verzijl, Dennis; Balog, Crina I A; Dijkman, Remco; van der Schors, Roel C; van der Raaij-Helmer, Elizabeth M H; van der Plas, Mariena J A; Leurs, Rob; Deelder, André M; Smit, Martine J; Tensen, Cornelis P

    2004-04-02

    Chemokines comprise a class of structurally related proteins that are involved in many aspects of leukocyte migration under basal and inflammatory conditions. In addition to the large number of genes, limited processing of these proteins by a variety of enzymes enhances the complexity of the total spectrum of chemokine variants. We have recently shown that the native chemokine CXCL10 is processed at the C terminus, thereby shedding the last four amino acids. The present study was performed to elucidate the mechanism in vivo and in vitro and to study the biological activity of this novel isoform of CXCL10. Using a combination of protein purification and mass spectrometric techniques, we show that the production of C-terminally truncated CXCL10 by primary keratinocytes is inhibited in vivo by a specific inhibitor of pro-protein convertases (e.g. furin) but not by inhibition of matrix metalloproteinases. Moreover, CXCL10 is processed by furin in vitro, which is abrogated by a mutation in the furin recognition site. Using GTPgammaS binding, Ca(2+) mobilization, and chemotaxis assays, we demonstrate that the C-terminally truncated CXCL10 variant is a potent ligand for CXCR3. Moreover, the inverse agonist activity on the virally encoded receptor ORF74 and the direct antibacterial activity of CXCL10 are fully retained. Hence, we have identified furin as a novel chemokine-modifying enzyme in vitro and most probably also in vivo, generating a C-terminally truncated CXCL10, which fully retains its (inverse) agonistic properties.

  15. The PD-1/PD-L1 complex resembles the antigen-binding Fv domains of antibodies and T cell receptors

    Energy Technology Data Exchange (ETDEWEB)

    Lin, David Yin-wei; Tanaka, Yoshimasa; Iwasaki, Masashi; Gittis, Apostolos G.; Su, Hua-Poo; Mikami, Bunzo; Okazaki, Taku; Honjo, Tasuku; Minato, Nagahiro; Garboczi, David N. (NIH); (Kyoto)

    2008-07-29

    Signaling through the programmed death 1 (PD-1) inhibitory receptor upon binding its ligand, PD-L1, suppresses immune responses against autoantigens and tumors and plays an important role in the maintenance of peripheral immune tolerance. Release from PD-1 inhibitory signaling revives 'exhausted' virus-specific T cells in chronic viral infections. Here we present the crystal structure of murine PD-1 in complex with human PD-L1. PD-1 and PD-L1 interact through the conserved front and side of their Ig variable (IgV) domains, as do the IgV domains of antibodies and T cell receptors. This places the loops at the ends of the IgV domains on the same side of the PD-1/PD-L1 complex, forming a surface that is similar to the antigen-binding surface of antibodies and T cell receptors. Mapping conserved residues allowed the identification of residues that are important in forming the PD-1/PD-L1 interface. Based on the structure, we show that some reported loss-of-binding mutations involve the PD-1/PD-L1 interaction but that others compromise protein folding. The PD-1/PD-L1 interaction described here may be blocked by antibodies or by designed small-molecule drugs to lower inhibitory signaling that results in a stronger immune response. The immune receptor-like loops offer a new surface for further study and potentially the design of molecules that would affect PD-1/PD-L1 complex formation and thereby modulate the immune response.

  16. Isolation of a Spodoptera exigua baculovirus recombinant with retained biological activity despite a 10.6 kb deletion

    NARCIS (Netherlands)

    Dai, X.; Hajos, J.P.; Joosten, N.N.; Oers, van M.M.; IJkel, W.F.J.; Zuidema, D.; Yi, P.

    2000-01-01

    When Spodoptera exigua multicapsid nucleopolyhedrovirus (SeMNPV) is grown in insect cell culture, defective viruses are generated. These viruses lack about 25 kbp of sequence information and are no longer infectious for insects. This makes the engineering of SeMNPV for improved insecticidal activity

  17. Recruiting and Retaining Cyberwarriors

    National Research Council Canada - National Science Library

    Westermeyer, Roger H

    2008-01-01

    .... Recruiting and retaining this highly skilled workforce is a significant challenge for the Air Force due to the high public and private sector demand for people with IT and related engineering skills...

  18. Reality of Retainers

    Science.gov (United States)

    ... the cafeteria take out his retainer before eating lunch. Carefully, he places it in a plastic container to make sure that it's safe while he eats. You can tell that this small plastic and metal mouthpiece is important to him. ...

  19. Earth retaining structures manual

    Science.gov (United States)

    2009-10-29

    The objectives of this policy are to obtain statewide uniformity, establish standard : procedures and delineate responsibility for the preparation and review of plans, : design and construction control of earth retaining structures. In addition, it i...

  20. Site-specific bioconjugation of a murine dihydrofolate reductase enzyme by copper(I-catalyzed azide-alkyne cycloaddition with retained activity.

    Directory of Open Access Journals (Sweden)

    Sung In Lim

    Full Text Available Cu(I-catalyzed azide-alkyne cycloaddition (CuAAC is an efficient reaction linking an azido and an alkynyl group in the presence of copper catalyst. Incorporation of a non-natural amino acid (NAA containing either an azido or an alkynyl group into a protein allows site-specific bioconjugation in mild conditions via CuAAC. Despite its great potential, bioconjugation of an enzyme has been hampered by several issues including low yield, poor solubility of a ligand, and protein structural/functional perturbation by CuAAC components. In the present study, we incorporated an alkyne-bearing NAA into an enzyme, murine dihydrofolate reductase (mDHFR, in high cell density cultivation of Escherichia coli, and performed CuAAC conjugation with fluorescent azide dyes to evaluate enzyme compatibility of various CuAAC conditions comprising combination of commercially available Cu(I-chelating ligands and reductants. The condensed culture improves the protein yield 19-fold based on the same amount of non-natural amino acid, and the enzyme incubation under the optimized reaction condition did not lead to any activity loss but allowed a fast and high-yield bioconjugation. Using the established conditions, a biotin-azide spacer was efficiently conjugated to mDHFR with retained activity leading to the site-specific immobilization of the biotin-conjugated mDHFR on a streptavidin-coated plate. These results demonstrate that the combination of reactive non-natural amino acid incorporation and the optimized CuAAC can be used to bioconjugate enzymes with retained enzymatic activity.

  1. Site-Specific Bioconjugation of an Organometallic Electron Mediator to an Enzyme with Retained Photocatalytic Cofactor Regenerating Capacity and Enzymatic Activity

    Directory of Open Access Journals (Sweden)

    Sung In Lim

    2015-04-01

    Full Text Available Photosynthesis consists of a series of reactions catalyzed by redox enzymes to synthesize carbohydrates using solar energy. In order to take the advantage of solar energy, many researchers have investigated artificial photosynthesis systems mimicking the natural photosynthetic enzymatic redox reactions. These redox reactions usually require cofactors, which due to their high cost become a key issue when constructing an artificial photosynthesis system. Combining a photosensitizer and an Rh-based electron mediator (RhM has been shown to photocatalytically regenerate cofactors. However, maintaining the high concentration of cofactors available for efficient enzymatic reactions requires a high concentration of the expensive RhM; making this process cost prohibitive. We hypothesized that conjugation of an electron mediator to a redox enzyme will reduce the amount of electron mediators necessary for efficient enzymatic reactions. This is due to photocatalytically regenerated NAD(PH being readily available to a redox enzyme, when the local NAD(PH concentration near the enzyme becomes higher. However, conventional random conjugation of RhM to a redox enzyme will likely lead to a substantial loss of cofactor regenerating capacity and enzymatic activity. In order to avoid this issue, we investigated whether bioconjugation of RhM to a permissive site of a redox enzyme retains cofactor regenerating capacity and enzymatic activity. As a model system, a RhM was conjugated to a redox enzyme, formate dehydrogenase obtained from Thiobacillus sp. KNK65MA (TsFDH. A RhM-containing azide group was site-specifically conjugated to p-azidophenylalanine introduced to a permissive site of TsFDH via a bioorthogonal strain-promoted azide-alkyne cycloaddition and an appropriate linker. The TsFDH-RhM conjugate exhibited retained cofactor regenerating capacity and enzymatic activity.

  2. Design Diagrams for the Analysis of Active Pressure on Retaining Walls with the Effect of Line Surcharge

    Directory of Open Access Journals (Sweden)

    Mojtaba Ahmadabadi

    2017-01-01

    Full Text Available In this study, a formulation has been proposed to calculate the pressure on wall and determine the angle of failure wedge based on limit equilibrium method. The mentioned formulation is capable of calculating active pressure coefficient, culmination of forces in failure surface, and pressure distribution on wall with the effect of line surcharge. In addition, based on the proposed method, a simple formula has been proposed to calculate the angle of failure wedge by the effect of surcharge. Moreover, the proposed approach has the advantage of taking into account the effect of surcharge on elastoplastic environment by considering the parameters of soil and determining the extent to which the surcharge is effective in pressure distribution on the wall. However, in most previous methods and specifications, resultant lateral pressure from surcharge in elastic environment had been considered. Finally, based on the obtained results, the design diagrams for different soils and different surcharges have been proposed. According to these diagrams, pressure on wall, pressure distribution on wall, and angle of failure wedge will easily be achieved. Also, a computer program has been written in MATLAB software environment. Using the results of these codes, the pressure on wall with the effect of surcharge, the angle of failure wedge, and pressure distribution on wall will be determined.

  3. Human neuroblastoma cells with acquired resistance to the p53 activator RITA retain functional p53 and sensitivity to other p53 activating agents.

    Science.gov (United States)

    Michaelis, M; Rothweiler, F; Agha, B; Barth, S; Voges, Y; Löschmann, N; von Deimling, A; Breitling, R; Doerr, H Wilhelm; Rödel, F; Speidel, D; Cinatl, J

    2012-04-05

    Adaptation of wild-type p53 expressing UKF-NB-3 cancer cells to the murine double minute 2 inhibitor nutlin-3 causes de novo p53 mutations at high frequency (13/20) and multi-drug resistance. Here, we show that the same cells respond very differently when adapted to RITA, a drug that, like nutlin-3, also disrupts the p53/Mdm2 interaction. All of the 11 UKF-NB-3 sub-lines adapted to RITA that we established retained functional wild-type p53 although RITA induced a substantial p53 response. Moreover, all RITA-adapted cell lines remained sensitive to nutlin-3, whereas only five out of 10 nutlin-3-adapted cell lines retained their sensitivity to RITA. In addition, repeated adaptation of the RITA-adapted sub-line UKF-NB-3(r)RITA(10 μM) to nutlin-3 resulted in p53 mutations. The RITA-adapted UKF-NB-3 sub-lines displayed no or less pronounced resistance to vincristine, cisplatin, and irradiation than nutlin-3-adapted UKF-NB-3 sub-lines. Furthermore, adaptation to RITA was associated with fewer changes at the expression level of antiapoptotic factors than observed with adaptation to nutlin-3. Transcriptomic analyses indicated the RITA-adapted sub-lines to be more similar at the gene expression level to the parental UKF-NB-3 cells than nutlin-3-adapted UKF-NB-3 sub-lines, which correlates with the observed chemotherapy and irradiation sensitivity phenotypes. In conclusion, RITA-adapted cells retain functional p53, remain sensitive to nutlin-3, and display a less pronounced resistance phenotype than nutlin-3-adapted cells.

  4. A retained menstrual cup.

    Science.gov (United States)

    Day, S

    2012-05-01

    A 20-year-old woman attended a genitourinary clinic with a retained vaginal Mooncup that she had inserted the night before. A Mooncup is one type of menstrual cup. On speculum examination the device was visualized high in the vagina and the cervix appeared firmly lodged within it. The physician experienced difficulty in retrieving the cup despite following product instructions. This case highlights a new adverse event with an increasingly used sanitation product. It is important that clinicians are familiar with the cup, its removal process and are able to counsel patients with retained devices on future correct placement.

  5. Retained surgical sponge

    International Nuclear Information System (INIS)

    Koyama, Masashi; Kurono, Kenji; Iida, Akihiko; Suzuki, Hirochika; Hara, Masaki; Mizutani, Hirokazu; Ohba, Satoru; Mizutani, Masaru; Nakajima, Yoichiro.

    1993-01-01

    The CT, US, and MRI findings of confirmed retained surgical sponges were reviewed. The CT examinations in eight lesions demonstrated round or oval masses with heterogeneous internal structures. The US examinations in 5 lesions demonstrated low echogenic masses with high echogenic internal structures, which suggested retained surgical sponges. MR imagings in three lesions showed slightly high intensity comparable to that of muscles on T1-weighted images and high signal intensity on T2-weighted images, suggesting fluid collections of high protein concentration. (author)

  6. Randomized study on the effect of single-implant versus two-implant retained overdentures on implant loss and muscle activity: a 12-month follow-up report.

    Science.gov (United States)

    Alqutaibi, A Y; Kaddah, A F; Farouk, M

    2017-06-01

    The objective was to evaluate and compare single- and two-implant retained overdentures for the rehabilitation of the edentulous mandible. Fifty-six edentulous subjects were eligible for inclusion. Using a random sampling system, a single implant or two implants were placed in the mandible. After 3 months, locator attachments were connected to the implants and the denture delivered with the retentive components incorporated in the denture base. Implant failure and muscle activity were evaluated at the 3-, 6-, and 12-month follow-up examinations. The study sample comprised 56 patients (32 male, 24 female), with a mean age of 58.2 years. A total of 84 implants were placed (28 in the single-implant group and 56 in the two-implant group). All patients completed the 12 months of follow-up. No significant differences were found between subjects in the two groups with respect to implant failure. With regard to improvements in muscle activity, the two-implant group showed statistically significant but perhaps not clinically important differences. Single-implant mandibular overdentures may be suggested as an alternative treatment modality for the rehabilitation of edentulous patients who cannot afford the cost of a two-implant overdenture. Copyright © 2017 International Association of Oral and Maxillofacial Surgeons. Published by Elsevier Ltd. All rights reserved.

  7. Control component retainer

    International Nuclear Information System (INIS)

    Walton, L.A.; King, R.A.

    1983-01-01

    An apparatus is described for retaining an undriven control component assembly disposed in a fuel assembly in a nuclear reactor of the type having a core grid plate. The first part of the mechanism involves a housing for the control component and the second part is a brace with a number of arms that reach under the grid plate. The brace and the housing are coupled together to firmly hold the control components in place even under strong flows of th coolant

  8. Phase I hydroxylated metabolites of the K2 synthetic cannabinoid JWH-018 retain in vitro and in vivo cannabinoid 1 receptor affinity and activity.

    Directory of Open Access Journals (Sweden)

    Lisa K Brents

    Full Text Available K2 products are synthetic cannabinoid-laced, marijuana-like drugs of abuse, use of which is often associated with clinical symptoms atypical of marijuana use, including hypertension, agitation, hallucinations, psychosis, seizures and panic attacks. JWH-018, a prevalent K2 synthetic cannabinoid, is structurally distinct from Δ(9-THC, the main psychoactive ingredient in marijuana. Since even subtle structural differences can lead to differential metabolism, formation of novel, biologically active metabolites may be responsible for the distinct effects associated with K2 use. The present study proposes that K2's high adverse effect occurrence is due, at least in part, to distinct JWH-018 metabolite activity at the cannabinoid 1 receptor (CB1R.JWH-018, five potential monohydroxylated metabolites (M1-M5, and one carboxy metabolite (M6 were examined in mouse brain homogenates containing CB1Rs, first for CB1R affinity using a competition binding assay employing the cannabinoid receptor radioligand [(3H]CP-55,940, and then for CB1R intrinsic efficacy using an [(35S]GTPγS binding assay. JWH-018 and M1-M5 bound CB1Rs with high affinity, exhibiting K(i values that were lower than or equivalent to Δ(9-THC. These molecules also stimulated G-proteins with equal or greater efficacy relative to Δ(9-THC, a CB1R partial agonist. Most importantly, JWH-018, M2, M3, and M5 produced full CB1R agonist levels of activation. CB1R-mediated activation was demonstrated by blockade with O-2050, a CB1R-selective neutral antagonist. Similar to Δ(9-THC, JWH-018 and M1 produced a marked depression of locomotor activity and core body temperature in mice that were both blocked by the CB1R-preferring antagonist/inverse agonist AM251.Unlike metabolites of most drugs, the studied JWH-018 monohydroxylated compounds, but not the carboxy metabolite, retain in vitro and in vivo activity at CB1Rs. These observations, combined with higher CB1R affinity and activity relative to Δ(9

  9. Adolescent girls' and parents' views on recruiting and retaining girls into an after-school dance intervention: implications for extra-curricular physical activity provision

    Directory of Open Access Journals (Sweden)

    Powell Jane

    2011-08-01

    Full Text Available Abstract Background Many adolescents are not sufficiently active and girls are less active than boys. Physical activity interventions delivered during curriculum time have reported weak effects. More sustained changes in physical activity may be obtained by facilitating participation in enjoyable activities. Dance is the favourite activity of UK girls but there is a shortage of dance provision. Dance sessions delivered after the school day could prove to be an effective means of engaging adolescent girls in physical activity. There is a lack of information about the factors that would affect girls' recruitment and retention in an after-school dance programme. Methods Focus groups were conducted with 65, Year 7 (11-12 year old girls from 4 secondary schools in Bristol. In-depth phone interviews were also conducted with 16 (4 per school of the girls' parents. Interviews and focus groups examined issues that would affect recruitment into the intervention, strategies that could be used to attract girls who have little or no previous experience in dance, any factors that would increase their interest in participating in an after-school dance programme and any factors that would affect retention in the programme. All interviews and focus groups were digitally recorded and thematically analysed. Results Girls reported that a taster session in which they had an opportunity to sample the intervention content and "word of mouth" campaigns by peers, who did not need to be their friends, would encourage them to participate in an after-school dance programme. Sessions that maximised enjoyment and facilitated socialisation opportunities would enhance retention. Parents reported that encouraging groups of friends to join the programme, and stressing the enjoyment of the session would increase participation. Conclusions Recruitment and retention campaigns that focus on enjoyment, socialisation, mastery, goal setting and relating to other girls may be effective

  10. T-antigen binding lectin with antibacterial activity from marine invertebrate, sea cucumber (Holothuria scabra): Possible involvement in differential recognition of bacteria

    Digital Repository Service at National Institute of Oceanography (India)

    Gowda, N.M.; Goswami, U.; Khan, M.I.

    report a study of a lectin (HSL) involved in immune response in the echinoderm, sea cucumber (Holothuria scabra). Correlative studies indicate that the expression of this defensive lectin is induced by bacterial challenge, wherein cell wall...

  11. Retained gas inventory comparison

    International Nuclear Information System (INIS)

    BARTON, W.B.

    1999-01-01

    Gas volume data derived from four different analytical methods were collected and analyzed for comparison to volumes originally used in the technical basis for the Basis for Interim Operations (BIO). The original volumes came from Hodgson (1996) listed in the reference section of this document. Hodgson (1996) screened all 177 single and double-shell tanks for the presence of trapped gas in waste via two analytical methods: Surface Level Rise (SLR), and Barometric Pressure Effect (BPE). More recent gas volume projections have been calculated using different analytical techniques along with updates to the parameters used as input to the SLR and BPE models. Gas volumes derived from new analytical instruments include those as measured by the Void Fraction Instrument (VFI) and Retained Gas Sampler (RGS). The results of this comparison demonstrate that the original retained gas volumes of Hodgson (1996) used as a technical basis in developing the BIO were conservative, and were conservative from a safety analysis standpoint. These results represent only comparisons to the original reported volumes using the limited set of newly acquired data that is available

  12. Retained Herrick Plug

    Directory of Open Access Journals (Sweden)

    Justin B. Hellman

    2018-05-01

    Full Text Available A 79-year-old female with a history of keratoconjunctivitis sicca presented with several years of epiphora of both eyes. Thirteen years earlier, intracanalicular Herrick lacrimal plugs (Lacrimedics, Eastsound, WA, USA had been placed in both eyes to treat her dry eye syndrome. After 13 years the patient felt the epiphora was intolerable and underwent endoscopic dacryocystorhinostomy (DCR of the left, then the right side. Intraoperatively, during the right endoscopic DCR, a Herrick lacrimal plug was found in the common canaliculus into the lacrimal sac. Postoperatively, the patient did well with improved epiphora. The Herrick plug is designed to be intracanalicular, and this case illustrates that the plug can migrate and be retained for many years. Collared punctal plugs have a lower risk of this type of complication.

  13. Use of JH4 joining segment gene by an anti-arsonate antibody that bears the major A-strain cross-reactive idiotype but displays diminished antigen binding.

    Science.gov (United States)

    Slaughter, C A; Jeske, D J; Kuziel, W A; Milner, E C; Capra, J D

    1984-06-01

    One of the antibody families utilized by the A/J mouse in its response to p-azophenylarsonate (Ars) is characterized by the expression of the major anti-arsonate cross-reactive idiotype (CRI) of the A strain. This family has been termed the Ars-A family. A hybridoma antibody (HP 101F11 ) obtained after immunization of an A/J mouse with Ars was identified initially as displaying the CRI, but was subsequently found to bind antigen at a level much lower than most members of the Ars-A family. The results of binding studies suggested that HP 101F11 possesses reduced avidity for antigen. When isolated light and heavy chains were allowed to recombine with the heavy and light chains of a strongly antigen-binding, strongly CRI-positive antibody of the Ars-A family (HP 93G7 ), the low level of antigen binding by HP 101F11 was found to be due to a structurally variant heavy chain. Whereas antibodies of the Ars-A family with normal avidity for antigen had been shown to use the JH2 joining segment gene, amino acid sequence analysis of HP 101F11 revealed that this antibody has a JH segment with a sequence identical to that encoded by a portion of a different JH gene, JH4 . The implication that 101F11 uses the JH4 gene instead of JH2 was supported by the observation that the productively rearranged gene is associated with an Eco R1 restriction fragment 0.95 Kb smaller than the corresponding fragments of Ars-A hybridomas with normal avidity for antigen. The size difference of 0.95 Kb corresponds exactly to the known distance between the JH2 and JH4 genes in BALB/c germline DNA. In addition to the structural differences immediately attributable to the use of JH4 , HP 101F11 has shown an amino acid interchange in the DH segment, and a single amino acid deletion at the DH-JH boundary. These results show that variation among members of the Ars-A family in the DH and/or JH segments provides alternative structural forms of Ars-A antibodies upon which selective processes can operate

  14. Bioaccumulation and elimination of 60 Co and 137 Cs by Anomalocardia brasiliana (Gmelin, 1791) (Mollusca bivalvia). Remobilization of 60 Co, retained in marine sediment by microbial activity

    International Nuclear Information System (INIS)

    Mayr, L.M.

    1984-05-01

    It was studied the capacity of a bi valve mollusc Anomalocardia brasiliana, which lives in the local bottom sediment, to remobilize 60 Co previously sorbed in the sediment. Laboratory experiments demonstrated that the transference of 60 Co from the sediment to the animal was insignificant (bioaccumulation factor (BF) of the order of 10 -3 ). At the same time, the capacity of microorganisms, present in the bottom sediment, to remobilize 60 Co was studied. The results showed that this via of transference was important, considering the much greater microorganism biomass in relation to the biomass of bentonic organisms, as a whole. For 137 Cs the determined BF from water to the animal was 2.2. and, as in the case of 60 Co, the soft tissues concentrated more 137 Cs than shell. Remaining viscera showed the highest BFs. In another series of experiments, the loss of 60 Co or 137 Cs, previously accumulated by A. brasiliana, was followed in aquaria with or without sediment and the respective biological half-lives were calculated. Soft tissues retained 60 Co longer (biological half-life = 117 days) than shells, whereas for 137 Cs the opposite was observed and shells showed a biological half life of 38.5 days. The low values of 60 Co and 137 Cs BF S do not allow to classify A. brasiliana as good biological indicator for pollution by there radionuclides. However since A brasiliana is consumed by the local population and is commercialized to other areas, it was recommended that its contamination by 60 Co or 137 Cs should be monitored. (author)

  15. High throughput testing of the SV40 Large T antigen binding to cellular p53 identifies putative drugs for the treatment of SV40-related cancers

    International Nuclear Information System (INIS)

    Carbone, Michele; Rudzinski, Jennifer; Bocchetta, Maurizio

    2003-01-01

    SV40 has been linked to some human malignancies, and the evidence that this virus plays a causative role in mesothelioma and brain tumors is mounting. The major SV40 oncoprotein is the Large tumor antigen (Tag). A key Tag transforming activity is connected to its capability to bind and inactivate cellular p53. In this study we developed an effective, high throughput, ELISA-based method to study Tag-p53 interaction in vitro. This assay allowed us to screen a chemical library and to identify a chemical inhibitor of the Tag binding to p53. We propose that our in vitro assay is a useful method to identify molecules that may be used as therapeutic agents for the treatment of SV40-related human cancers

  16. NERVA turbopump bearing retainer fabrication on nonmetallic retainer

    Science.gov (United States)

    Accinelli, J. B.

    1972-01-01

    The need for a low-wear, lightweight, high strength bearing retainer material with a radiation degradation threshold of 10 to the 9th power rads (C) prompted development of nonmetallic reinforced polymers of the following types: (1) polybenzimidazole, (2) polyimide, and (3) polyquinoxaline. Retainers were machined from tubular laminates (billets), including reinforcement by either glass or graphite fabric or filament. Fabrication of billets involves hot preimpregnation of the reinforcement fabric or filament with polymer followed by wrapping this prepreg over a heated mandrel to form a tube with the required thickness and length.

  17. The antigen-binding fragment of human gamma immunoglobulin prevents amyloid β-peptide folding into β-sheet to form oligomers

    Science.gov (United States)

    Valls-Comamala, Victòria; Guivernau, Biuse; Bonet, Jaume; Puig, Marta; Perálvarez-Marín, Alex; Palomer, Ernest; Fernàndez-Busquets, Xavier; Altafaj, Xavier; Tajes, Marta; Puig-Pijoan, Albert; Vicente, Rubén; Oliva, Baldomero; Muñoz, Francisco J.

    2017-01-01

    The amyloid beta-peptide (Aβ) plays a leading role in Alzheimer's disease (AD) physiopathology. Even though monomeric forms of Aβ are harmless to cells, Aβ can aggregate into β-sheet oligomers and fibrils, which are both neurotoxic. Therefore, one of the main therapeutic approaches to cure or delay AD onset and progression is targeting Aβ aggregation. In the present study, we show that a pool of human gamma immunoglobulins (IgG) protected cortical neurons from the challenge with Aβ oligomers, as assayed by MTT reduction, caspase-3 activation and cytoskeleton integrity. In addition, we report the inhibitory effect of IgG on Aβ aggregation, as shown by Thioflavin T assay, size exclusion chromatography and atomic force microscopy. Similar results were obtained with Palivizumab, a human anti-sincitial virus antibody. In order to dissect the important domains, we cleaved the pool of human IgG with papain to obtain Fab and Fc fragments. Using these cleaved fragments, we functionally identified Fab as the immunoglobulin fragment inhibiting Aβ aggregation, a result that was further confirmed by an in silico structural model. Interestingly, bioinformatic tools show a highly conserved structure able to bind amyloid in the Fab region. Overall, our data strongly support the inhibitory effect of human IgG on Aβ aggregation and its neuroprotective role. PMID:28467807

  18. 7 CFR 1767.25 - Retained earnings.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Retained earnings. 1767.25 Section 1767.25....25 Retained earnings. The retained earnings accounts identified in this section shall be used by all RUS borrowers. Retained Earnings 433-439 [Reserved] Retained Earnings 433-439 [Reserved] ...

  19. Activation-induced cytidine deaminase induces reproducible DNA breaks at many non-Ig Loci in activated B cells

    NARCIS (Netherlands)

    Staszewski, Ori; Baker, Richard E.; Ucher, Anna J.; Martier, Raygene; Stavnezer, Janet; Guikema, Jeroen E. J.

    2011-01-01

    After immunization or infection, activation-induced cytidine deaminase (AID) initiates diversification of immunoglobulin (Ig) genes in B cells, introducing mutations within the antigen-binding V regions (somatic hypermutation, SHM) and double-strand DNA breaks (DSBs) into switch (S) regions, leading

  20. HLA-DPβ1 Asp84-Lys69 antigen-binding signature predicts event-free survival in childhood B-cell precursor acute lymphoblastic leukaemia: results from the MRC UKALL XI childhood ALL trial.

    Science.gov (United States)

    Taylor, G M; Wade, R; Hussain, A; Thompson, P; Hann, I; Gibson, B; Eden, T; Richards, S

    2012-07-01

    We previously reported that children in the UKALL XI ALL trial with HLA-DP 1 and -DP 3 supertypes had significantly worse event-free survival (EFS) than children with other DP supertypes. As DP 1 and DP 3 share two of four key antigen-binding amino-acid polymorphisms (aspartic acid84-lysine69), we asked whether Asp84-Lys69 or Asp84 alone were independent prognostic indicators in childhood acute lymphoblastic leukemia (ALL). We analysed EFS in 798 UKALL XI patients, stratified by Asp84-Lys69 vs non-Asp84-Lys69, for a median follow-up of 12.5 years. Asp84-Lys69 was associated with a significantly worse EFS than non-Asp84-Lys69 (5-year EFS: Asp84-Lys69: 58.8% (95% CI (confidence of interval): 52.7-64.9%); non-Asp84-Lys69: 67.3% (63.4-71.2%); 2P=0.007). Post-relapse EFS was 10% less in Asp84-Lys69 than non-Asp84-Lys69 patients. EFS was significantly worse (P=0.03) and post-relapse EFS marginally worse (P=0.06) in patients with Asp84 compared with Gly84. These results suggest that Asp84-Lys69 predicted adverse EFS in the context of UKALL XI because of Asp84, and may have influenced post-relapse EFS. We speculate that this may be due to the recruitment of Asp84-Lys69-restricted regulatory T cells in the context of this regimen, leading to the re-emergence of residual disease. However, functional and molecular studies of the prognostic value of this and other HLA molecular signatures in other childhood ALL trials are needed.

  1. 47 CFR 32.4550 - Retained earnings.

    Science.gov (United States)

    2010-10-01

    ... FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.4550 Retained earnings. (a) This account shall include the undistributed balance of retained earnings derived from the...

  2. Rehabilitating drug-induced long-QT promoters: in-silico design of hERG-neutral cisapride analogues with retained pharmacological activity.

    Science.gov (United States)

    Durdagi, Serdar; Randall, Trevor; Duff, Henry J; Chamberlin, Adam; Noskov, Sergei Y

    2014-03-08

    The human ether-a-go-go related gene 1 (hERG1), which codes for a potassium ion channel, is a key element in the cardiac delayed rectified potassium current, IKr, and plays an important role in the normal repolarization of the heart's action potential. Many approved drugs have been withdrawn from the market due to their prolongation of the QT interval. Most of these drugs have high potencies for their principal targets and are often irreplaceable, thus "rehabilitation" studies for decreasing their high hERG1 blocking affinities, while keeping them active at the binding sites of their targets, have been proposed to enable these drugs to re-enter the market. In this proof-of-principle study, we focus on cisapride, a gastroprokinetic agent withdrawn from the market due to its high hERG1 blocking affinity. Here we tested an a priori strategy to predict a compound's cardiotoxicity using de novo drug design with molecular docking and Molecular Dynamics (MD) simulations to generate a strategy for the rehabilitation of cisapride. We focused on two key receptors, a target interaction with the (adenosine) receptor and an off-target interaction with hERG1 channels. An analysis of the fragment interactions of cisapride at human A2A adenosine receptors and hERG1 central cavities helped us to identify the key chemical groups responsible for the drug activity and hERG1 blockade. A set of cisapride derivatives with reduced cardiotoxicity was then proposed using an in-silico two-tier approach. This set was compared against a large dataset of commercially available cisapride analogs and derivatives. An interaction decomposition of cisapride and cisapride derivatives allowed for the identification of key active scaffolds and functional groups that may be responsible for the unwanted blockade of hERG1.

  3. Nano-formulation enhances insecticidal activity of natural pyrethrins against Aphis gossypii (Hemiptera: Aphididae) and retains their harmless effect to non-target predators.

    Science.gov (United States)

    Papanikolaou, Nikos E; Kalaitzaki, Argyro; Karamaouna, Filitsa; Michaelakis, Antonios; Papadimitriou, Vassiliki; Dourtoglou, Vassilis; Papachristos, Dimitrios P

    2018-04-01

    The insecticidal activity of a new nano-formulated natural pyrethrin was examined on the cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae), and the predators Coccinella septempunctata L. (Coleoptera: Coccinellidae) and Macrolophus pygmaeus Rambur (Hemiptera: Miridae), in respect with the nano-scale potential to create more effective and environmentally responsible pesticides. Pyrethrin was nano-formulated in two water-in-oil micro-emulsions based on safe biocompatible materials, i.e., lemon oil terpenes as dispersant, polysorbates as stabilizers, and mixtures of water with glycerol as the dispersed aqueous phase. Laboratory bioassays showed a superior insecticidal effect of the pyrethrin micro-emulsions compared to two commercial suspension concentrates of natural pyrethrins against the aphid. The nano-formulated pyrethrins were harmless, in terms of caused mortality and survival time, to L3 larvae and four-instar nymphs of the predators C. septempunctata and M. pygmaeus, respectively. We expect that these results can contribute to the application of nano-technology in optimization of pesticide formulation, with further opportunities in the development of effective plant protection products compatible with integrated pest management practices.

  4. Healthy human CSF promotes glial differentiation of hESC-derived neural cells while retaining spontaneous activity in existing neuronal networks

    Directory of Open Access Journals (Sweden)

    Heikki Kiiski

    2013-05-01

    The possibilities of human pluripotent stem cell-derived neural cells from the basic research tool to a treatment option in regenerative medicine have been well recognized. These cells also offer an interesting tool for in vitro models of neuronal networks to be used for drug screening and neurotoxicological studies and for patient/disease specific in vitro models. Here, as aiming to develop a reductionistic in vitro human neuronal network model, we tested whether human embryonic stem cell (hESC-derived neural cells could be cultured in human cerebrospinal fluid (CSF in order to better mimic the in vivo conditions. Our results showed that CSF altered the differentiation of hESC-derived neural cells towards glial cells at the expense of neuronal differentiation. The proliferation rate was reduced in CSF cultures. However, even though the use of CSF as the culture medium altered the glial vs. neuronal differentiation rate, the pre-existing spontaneous activity of the neuronal networks persisted throughout the study. These results suggest that it is possible to develop fully human cell and culture-based environments that can further be modified for various in vitro modeling purposes.

  5. Plasmid-cured Chlamydia caviae activates TLR2-dependent signaling and retains virulence in the guinea pig model of genital tract infection.

    Science.gov (United States)

    Frazer, Lauren C; Darville, Toni; Chandra-Kuntal, Kumar; Andrews, Charles W; Zurenski, Matthew; Mintus, Margaret; AbdelRahman, Yasser M; Belland, Robert J; Ingalls, Robin R; O'Connell, Catherine M

    2012-01-01

    Loss of the conserved "cryptic" plasmid from C. trachomatis and C. muridarum is pleiotropic, resulting in reduced innate inflammatory activation via TLR2, glycogen accumulation and infectivity. The more genetically distant C. caviae GPIC is a natural pathogen of guinea pigs and induces upper genital tract pathology when inoculated intravaginally, modeling human disease. To examine the contribution of pCpGP1 to C. caviae pathogenesis, a cured derivative of GPIC, strain CC13, was derived and evaluated in vitro and in vivo. Transcriptional profiling of CC13 revealed only partial conservation of previously identified plasmid-responsive chromosomal loci (PRCL) in C. caviae. However, 2-deoxyglucose (2DG) treatment of GPIC and CC13 resulted in reduced transcription of all identified PRCL, including glgA, indicating the presence of a plasmid-independent glucose response in this species. In contrast to plasmid-cured C. muridarum and C. trachomatis, plasmid-cured C. caviae strain CC13 signaled via TLR2 in vitro and elicited cytokine production in vivo similar to wild-type C. caviae. Furthermore, inflammatory pathology induced by infection of guinea pigs with CC13 was similar to that induced by GPIC, although we observed more rapid resolution of CC13 infection in estrogen-treated guinea pigs. These data indicate that either the plasmid is not involved in expression or regulation of virulence in C. caviae or that redundant effectors prevent these phenotypic changes from being observed in C. caviae plasmid-cured strains.

  6. Plasmid-cured Chlamydia caviae activates TLR2-dependent signaling and retains virulence in the guinea pig model of genital tract infection.

    Directory of Open Access Journals (Sweden)

    Lauren C Frazer

    Full Text Available Loss of the conserved "cryptic" plasmid from C. trachomatis and C. muridarum is pleiotropic, resulting in reduced innate inflammatory activation via TLR2, glycogen accumulation and infectivity. The more genetically distant C. caviae GPIC is a natural pathogen of guinea pigs and induces upper genital tract pathology when inoculated intravaginally, modeling human disease. To examine the contribution of pCpGP1 to C. caviae pathogenesis, a cured derivative of GPIC, strain CC13, was derived and evaluated in vitro and in vivo. Transcriptional profiling of CC13 revealed only partial conservation of previously identified plasmid-responsive chromosomal loci (PRCL in C. caviae. However, 2-deoxyglucose (2DG treatment of GPIC and CC13 resulted in reduced transcription of all identified PRCL, including glgA, indicating the presence of a plasmid-independent glucose response in this species. In contrast to plasmid-cured C. muridarum and C. trachomatis, plasmid-cured C. caviae strain CC13 signaled via TLR2 in vitro and elicited cytokine production in vivo similar to wild-type C. caviae. Furthermore, inflammatory pathology induced by infection of guinea pigs with CC13 was similar to that induced by GPIC, although we observed more rapid resolution of CC13 infection in estrogen-treated guinea pigs. These data indicate that either the plasmid is not involved in expression or regulation of virulence in C. caviae or that redundant effectors prevent these phenotypic changes from being observed in C. caviae plasmid-cured strains.

  7. Odynophagia following retained bee stinger

    Directory of Open Access Journals (Sweden)

    S Viswanathan

    2012-01-01

    Full Text Available Nearly half of Hymenoptera stings affect the head and neck region of victims, but reports on oropharyngeal bee stings are very few. We describe the case of a patient with odynophagia and suffocation in mass envenomation. He had a retained bee stinger whose removal was delayed for more than 24 hours following the sting, due to persisting angioedema. Odynophagia receded after removal of the stinger and treatment with paracetamol, steroids and metronidazole. The patient also developed rhabdomyolysis, renal failure and hepatitis that were treated with conservative therapy. Oropharyngeal stings can simulate symptoms of persisting angioedema in victims of mass envenomation.

  8. Dynamic active earth pressure on retaining structures

    Indian Academy of Sciences (India)

    This theory is based on a pseudo- static forced-based approach ... large enough to induce a limit or failure state in the soil, and hence full mobilization of earth pressure is ... The base of the soil layer is excited by a harmonic excitation to simu-.

  9. Recruiting and Retaining Army Nurses: An Annotated Bibliography

    OpenAIRE

    Roberts, Benjamin J.; Kocher, Kathryn M.

    1988-01-01

    This listing of annotated references includes studies dealing with the labor market behavior of registered nurses. References describing both the military and the civilian working environments for RNs are contained in the bibliography. Because the Army must recruit and retain nurses in the context of the national labor market for nurses, a broad perspective was maintained in selecting publication. Studies dealing with the factors influential in attracting and retaining Army Active Duty and Re...

  10. 9 CFR 441.10 - Retained water.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Retained water. 441.10 Section 441.10... STANDARDS: RAW PRODUCTS § 441.10 Retained water. (a) Raw livestock and poultry carcasses and parts will not be permitted to retain water resulting from post-evisceration processing unless the establishment...

  11. Characterization of a monoclonal antibody that specifically inhibits triosephosphate isomerase activity of Taenia solium.

    Science.gov (United States)

    Víctor, Sanabria-Ayala; Yolanda, Medina-Flores; Araceli, Zavala-Carballo; Lucía, Jiménez; Abraham, Landa

    2013-08-01

    In the present study, we obtained and characterized partially a monoclonal antibody (4H11D10B11 mAb) against triosephosphate isomerase from Taenia solium (TTPI). This antibody recognized the enzyme by both ELISA and western blot and was able to inhibit its enzymatic activity in 74%. Moreover, the antigen-binding fragments (Fabs), products of digestion of the monoclonal antibody with papain, retained almost the same inhibitory effect. We determined the binding site by ELISA; synthetic peptides containing sequences from different non-conserved regions of the TTPI were confronted to the 4H11D10B11 mAb. The epitope recognized by the monoclonal antibody was located on peptide TTPI-56 (ATPAQAQEVHKVVRDWIRKHVDAGIADKARI), and an analysis of mimotopes, obtained with the 4H11D10B11 mAb, suggests that the epitope spans the sequence WIRKHVDAGIAD, residues 193-204 of the enzyme. This epitope is located within helix 6, next to loop 6, an essential active loop during catalysis. The antibody did not recognize triosephosphate isomerase from man and pig, definitive and intermediary hosts of T. solium, respectively. Furthermore, it did not bind to the catalytic site, since kinetic analysis demonstrated that inhibition had a non-competitive profile. Copyright © 2013 Elsevier Inc. All rights reserved.

  12. The Analysis Stability of Anchor Retaining Wall

    International Nuclear Information System (INIS)

    Benamara, F. Z.; Belabed, L

    2011-01-01

    The construction of anchored retaining walls reach every day in the field of Civil Engineering especially in public works. Their dimensioning and stability are the axes of research for geotechnical. The rule is to reduce the active forces of the slide and increase the effective normal stress on the rupture surface. So that, we anchored tied-back (constituted by steel cables) in the stable ground located under the failure surface and we apply at the top a traction force. This effort can be distributed over the ground surface by means of small plates or massive reinforced concrete. The study of the stability of anchored retaining wall was also performed by using software GEO4. Many cases can be solved using analytical solutions available in the group GEO4 program, but for our standard model solution studied analytically proved unsatisfactory so we used a numerical analysis based on the method of finite element in this program. The results obtained by numerical study were interpreted to identify the precision numerical predictions. Moreover these methods were useful and economics in the realization of reinforced slopes by tied-buck. (author)

  13. Federal Aviation Administration retained savings program proposal

    International Nuclear Information System (INIS)

    Hostick, D.J.; Larson, L.L.; Hostick, C.J.

    1998-03-01

    Federal legislation allows federal agencies to retain up to 50% of the savings associated with implementing energy efficiency and water conservation measures and practices. Given budget pressures to reduce expenditures, the use of retained savings to fund additional projects represents a source of funds outside of the traditional budget cycle. The Southwest Region Federal Aviation Administration (FAA) has tasked Pacific Northwest National Laboratory (PNNL) to develop a model retained savings program for Southwest Region FAA use and as a prototype for consideration by the FAA. PNNL recommends the following steps be taken in developing a Southwest Region FAA retained savings program: Establish a retained savings mechanism. Determine the level at which the retained savings should be consolidated into a fund. The preliminary recommendation is to establish a revolving efficiency loan fund at the regional level. Such a mechanism allows some consolidation of savings to fund larger projects, while maintaining a sense of facility ownership in that the funds will remain within the region

  14. Abnormal Retained Earnings Around The World

    OpenAIRE

    Alves, Paulo; Silva, Paulo

    2017-01-01

    Using a firm-level survey database covering 50 countries we evaluate firms´ abnormal retained earnings. The results of our work indicate that firms located in emerging markets retain more earnings than firms from developed countries. On the other hand, firms located on common law based countries retain earnings above the expected and higher than firms placed on civil law based countries. A possible explanation, according to our results, can be seen in the economic growth that these countries ...

  15. Reoccurrence of retained placenta at vaginal delivery

    DEFF Research Database (Denmark)

    Nikolajsen, Sys; Løkkegaard, Ellen Christine Leth; Bergholt, Thomas

    2013-01-01

    To estimate the prevalence and validate the diagnosis of retained placenta in nulliparous women and the risk of reoccurrence at subsequent vaginal delivery.......To estimate the prevalence and validate the diagnosis of retained placenta in nulliparous women and the risk of reoccurrence at subsequent vaginal delivery....

  16. Unexpected complications of bonded mandibular lingual retainers.

    NARCIS (Netherlands)

    Katsaros, C.; Livas, C.; Renkema, A.M.

    2007-01-01

    INTRODUCTION: The flexible spiral wire (FSW) retainer is the most frequently used type of fixed retainer bonded on all 6 anterior teeth. Our aim in this article was to demonstrate unexpected posttreatment changes in the labiolingual position of the mandibular anterior teeth associated with the use

  17. 76 FR 69126 - Graduated Retained Interests

    Science.gov (United States)

    2011-11-08

    ... in trust or otherwise) includible in the grantor's gross estate if the grantor has retained the use..., or for a period that does not in fact end before the grantor's death. The final regulations will... trust corpus of a grantor retained annuity or unitrust trust (GRT) that is includible in the grantor's...

  18. The cyclops lesion after bicruciate-retaining total knee replacement

    Directory of Open Access Journals (Sweden)

    Mark A. Klaassen, MD, FACS

    2017-12-01

    Full Text Available The cyclops lesion is a localized anterior arthrofibrosis most commonly seen following anterior cruciate ligament reconstruction. The lesion forms at the anterior cruciate ligament insertion creating a painful extension block between femoral intercondylar notch and tibial plateau. We present 2 cases (3 knees in which cyclops lesions appeared atypically following bicruciate-retaining total knee replacement. Two lesions occurred in a single patient following bilateral knee replacement. One lesion occurred in an active sportswoman. All 3 resolved following arthroscopic debridement. We describe the presentation of this unusual complication and suggest keys to its diagnosis, treatment, and prevention. Keywords: Cyclops lesion, Bicruciate-retaining, Total knee arthroplasty, Extension deficit

  19. Redistribution of retained particles. Effect of hyperpnea

    International Nuclear Information System (INIS)

    Valberg, P.A.; Wolff, R.K.; Mauderly, J.L.

    1985-01-01

    The effect of postexposure hyperpnea on clearance of particles deposited in the lungs of adult male beagle dogs was examined. Sedated dogs inhaled an insoluble 67 Gg 2 O 3 (T 1/2 . 78 h) aerosol (0.12 micron AMD) for one half hour on three separate occasions. Following aerosol exposures 1 and 2, dogs were assigned to either an eupneic (EUP) or hyperpneic (HYP) group and clearance was followed noninvasively for 9 days by whole body counting and gamma camera analysis. After exposure 2, EUP and HYP assignments were interchanged so that each dog was studied under both conditions. Hyperpnea was induced by housing dogs in an atmosphere of 7% CO 2 in air, 6 h per day. Carbon dioxide inhalation increased VE a factor of 3.7 +/- 0.9 (SD). The authors found that pulmonary clearance was retarded by CO 2 -stimulated hyperpnea in 7 of 8 dogs. Following aerosol exposure 3, dogs were divided between EUP and HYP and subsequently were killed in pairs at 3 h, 1 day, 3 days, and 7 days. Distribution of activity in body organs was examined, and translocation to the hilar lymph nodes was followed. Both retention distribution and removal of activity by saline lavage were measured in postmortem lungs. The percentage of lavaged activity associated with pulmonary macrophages increased from 44% at 3 h after exposure to 91% at 4 and 7 days after exposure. Examination of dried lung slices by autoradiography showed clearance of particles from airways and formation of a more punctate distribution in the retained activity at increasing times after exposure. Distinctive differences between HYP and EUP dogs were not seen

  20. Postpartum MR diagnosis of retained placenta accreta

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Yumiko Oishi; Itai, Yuji [Department of Radiology, Institute of Clinical Medicine, University of Tsukuba, 1-1-1 Tennodai, 305-8575, Tsukuba, Ibaraki (Japan); Shigemitsu, Sadahiko [Department of Obstetrics and Gynecology, Ryugasaki Saiseikai General Hospital, Ryagasaki (Japan); Ichikawa, Yoshihito; Sohda, Satoshi; Yoshikawa, Hiroyuki [Department of Obstetrics and Gynecology, Institute of Clinical Medicine, University of Tsukuba, 1-1-1 Tennodai, 305-8575, Tsukuba, Ibaraki (Japan)

    2004-06-01

    Retained placenta accreta can cause catastrophic postpartum hemorrhage. This study aims to determine whether MR imaging can differentiate retained placenta accreta from postpartum hemorrhage caused by other conditions. Fourteen cases suspicious for retained placenta were examined with MR imaging. Signal intensity, the enhancing pattern of uterine contents, and flow voids within the myometrium were retrospectively studied. As hysterectomy was performed in only two cases, final diagnosis was based on clinical outcome and analysis of uterine contents. Final diagnoses were retained placenta accreta in seven cases, retained normally attached placenta in four, hematoma in two, and placental site trophoblastic tumor (PSTT) in one. All seven cases with placenta accreta had a very hyperintense area on T2-weighted images, showing transient early enhancement. None demonstrated delayed strong enhancement around the hyperintense area. In two cases with retained normally attached placenta and in both with hematomas, there were no hyperintense areas on T2-weighted images. Of these, only one showed transient early enhancement. Flow voids were observed in four cases with placenta accreta, one with normally attached placenta, and the case with PSTT. A markedly hyperintense area on T2-weighted images and transient early enhancement without delayed strong enhancement between the mass and the myometrium can indicate retained placenta accreta. (orig.)

  1. Postpartum MR diagnosis of retained placenta accreta

    International Nuclear Information System (INIS)

    Tanaka, Yumiko Oishi; Itai, Yuji; Shigemitsu, Sadahiko; Ichikawa, Yoshihito; Sohda, Satoshi; Yoshikawa, Hiroyuki

    2004-01-01

    Retained placenta accreta can cause catastrophic postpartum hemorrhage. This study aims to determine whether MR imaging can differentiate retained placenta accreta from postpartum hemorrhage caused by other conditions. Fourteen cases suspicious for retained placenta were examined with MR imaging. Signal intensity, the enhancing pattern of uterine contents, and flow voids within the myometrium were retrospectively studied. As hysterectomy was performed in only two cases, final diagnosis was based on clinical outcome and analysis of uterine contents. Final diagnoses were retained placenta accreta in seven cases, retained normally attached placenta in four, hematoma in two, and placental site trophoblastic tumor (PSTT) in one. All seven cases with placenta accreta had a very hyperintense area on T2-weighted images, showing transient early enhancement. None demonstrated delayed strong enhancement around the hyperintense area. In two cases with retained normally attached placenta and in both with hematomas, there were no hyperintense areas on T2-weighted images. Of these, only one showed transient early enhancement. Flow voids were observed in four cases with placenta accreta, one with normally attached placenta, and the case with PSTT. A markedly hyperintense area on T2-weighted images and transient early enhancement without delayed strong enhancement between the mass and the myometrium can indicate retained placenta accreta. (orig.)

  2. Floating retained root lesion mimicking apical periodontitis.

    Science.gov (United States)

    Chung, Ming-Pang; Chen, Chih-Ping; Shieh, Yi-Shing

    2009-10-01

    A case of a retained root tip simulating apical periodontitis on radiographic examination is described. The retained root tip, originating from the left lower first molar, floated under the left lower second premolar apical region mimicking apical periodontitis. It appeared as an ill-defined periapical radiolucency containing a smaller radiodense mass on radiograph. The differential diagnosis included focal sclerosing osteomyelitis (condensing osteitis) and ossifying fibroma. Upon exicisional biopsy, a retained root associated with granulation tissue was found. After 1-year follow-up, the patient was asymptomatic and the periradicular lesion was healing. Meanwhile, the associated tooth showed a normal response to stimulation testing.

  3. Method for reducing power consumption in a state retaining circuit, state reaining circuit and electronic device.

    NARCIS (Netherlands)

    2006-01-01

    A method for reducing the power consumption in a state retaining circuit during a standby mode is disclosed comprising, in an active state, providing a regular power supply (VDD) and a standby power supply (VDD STANDBY) to the state retaining circuit; for a transition from an active state to a

  4. Separation of foot-and-mouth disease virus leader protein activities; identification of mutants that retain efficient self-processing activity but poorly induce eIF4G cleavage.

    Science.gov (United States)

    Guan, Su Hua; Belsham, Graham J

    2017-04-01

    Foot-and-mouth disease virus is a picornavirus and its RNA genome encodes a large polyprotein. The N-terminal part of this polyprotein is the leader protein, a cysteine protease, termed Lpro. The virus causes the rapid inhibition of host cell cap-dependent protein synthesis within infected cells. This results from the Lpro-dependent cleavage of the cellular translation initiation factor eIF4G. Lpro also releases itself from the virus capsid precursor by cleaving the L/P1 junction. Using site-directed mutagenesis of the Lpro coding sequence, we have investigated the role of 51 separate amino acid residues in the functions of this protein. These selected residues either are highly conserved or are charged and exposed on the protein surface. Using transient expression assays, within BHK-21 cells, it was found that residues around the active site (W52, L53 and A149) of Lpro and others located elsewhere (K38, K39, R44, H138 and W159) are involved in the induction of eIF4G cleavage but not in the processing of the L/P1 junction. Modified viruses, encoding such amino acid substitutions within Lpro, can replicate in BHK-21 cells but did not grow well in primary bovine thyroid cells. This study characterizes mutant viruses that are deficient in blocking host cell responses to infection (e.g. interferon induction) and can assist in the rational design of antiviral agents targeting this process and in the production of attenuated viruses.

  5. Evaluation of Causes of Retaining Wall Failure

    Directory of Open Access Journals (Sweden)

    Mu'azu Mohammed ABDULLAHI

    2009-07-01

    Full Text Available Retaining structures are vital geotechnical structure, because the topography of the earth surface is a combination of plain, sloppy and undulating terrain. The retaining wall resists thrust of a bank of earth as well as providing soil stability of a change of ground elevation. Earth pressures on retaining wall are designed from theories of Soil Mechanics, but unfortunately the engineers using them do not always realize the significance of the assumption in their development. This is usually accompanied by with failure and partial failures because of designed based on rules and formulae that fit only limited conditions. In addition there are also problems of using bad backfill materials without taking precautionary measures against built–up of hydrostatic pressure by provision of drainage and also poor workmanship.

  6. Retained gas sampler interim safety assessment

    Energy Technology Data Exchange (ETDEWEB)

    Pasamehmetoglu, K.O.; Miller, W.O.; Unal, C.; Fujita, R.K.

    1995-01-13

    This safety assessment addresses the proposed action to install, operate, and remove a Retained Gas Sampler (RGS) in Tank 101-SY at Hanford. Purpose of the RGS is to help characterize the gas species retained in the tank waste; the information will be used to refine models that predict the gas-producing behavior of the waste tank. The RGS will take samples of the tank from top to bottom; these samples will be analyzed for gas constituents. The proposed action is required as part of an evaluation of mitigation concepts for eliminating episodic gas releases that result in high hydrogen concentrations in the tank dome space.

  7. Migration of innumerable chronically retained acupuncture needles

    Directory of Open Access Journals (Sweden)

    Frances Lazarow, MD

    2017-09-01

    Full Text Available We present a case of a 50-year-old female with a 2-day history of back and abdominal pain who was discovered to have innumerable chronically retained acupuncture needles, which had migrated throughout her abdomen and pelvis. Although many of these needles were in precarious positions, including the epidural space, renal parenchyma, small bowel, and vasculature, there was no evidence for acute injury. We also briefly discuss evidence for the magnetic resonance imaging compatibility of acupuncture needles. Although a rare complication, given the high frequency of acupuncture therapy in the United States, physicians must be aware of the potential for retained and migrated needles.

  8. Retained gas sampler interim safety assessment

    International Nuclear Information System (INIS)

    Pasamehmetoglu, K.O.; Miller, W.O.; Unal, C.; Fujita, R.K.

    1995-01-01

    This safety assessment addresses the proposed action to install, operate, and remove a Retained Gas Sampler (RGS) in Tank 101-SY at Hanford. Purpose of the RGS is to help characterize the gas species retained in the tank waste; the information will be used to refine models that predict the gas-producing behavior of the waste tank. The RGS will take samples of the tank from top to bottom; these samples will be analyzed for gas constituents. The proposed action is required as part of an evaluation of mitigation concepts for eliminating episodic gas releases that result in high hydrogen concentrations in the tank dome space

  9. Large Scale Testing of Drystone Retaining Structures

    OpenAIRE

    Mundell, Chris

    2009-01-01

    Drystone walls have been used extensively around the world as earth retaining structures wherever suitable stone is found. Commonly about 0.6m thick (irrespective of height), there are about 9000km of drystone retaining walls on the UK road network alone, mostly built in the 19th and early 20th centuries, with an estimated replacement value in excess of £1 billion[1]. Drystone wall design is traditionally empirical, based on local knowledge of what has worked in the past. Methods vary from re...

  10. Retained Gas Sampler Calibration and Simulant Tests

    Energy Technology Data Exchange (ETDEWEB)

    CRAWFORD, B.A.

    2000-01-05

    This test plan provides a method for calibration of the retained gas sampler (RGS) for ammonia gas analysis. Simulant solutions of ammonium hydroxide at known concentrations will be diluted with isotopically labeled 0.04 M ammonium hydroxide solution. Sea sand solids will also be mixed with ammonium hydroxide solution and diluent to determine the accuracy of the system for ammonia gas analysis.

  11. Placemaking: Attracting and Retaining Today's Students

    Science.gov (United States)

    Knight, Brent

    2016-01-01

    Research suggests that the appearance of a college campus--both inside and out--is a significant criterion in college selection. As community colleges are finding it increasingly important to attract and retain students, placemaking is becoming an effective and efficient platform to support recruitment and retention. Placemaking is imagining and…

  12. Health matters in hiring and retaining personnel

    NARCIS (Netherlands)

    Houtman, I.L.D.

    2014-01-01

    Health is the most important issue when an employer is deciding whether to hire a worker, according to a new study from the Netherlands. The research looked at the results of a ‘vignette’ study on employer preferences when hiring or retaining personnel. It also showed that when an employer is

  13. Retained Gas Sampler Calibration and Simulant Tests

    International Nuclear Information System (INIS)

    CRAWFORD, B.A.

    2000-01-01

    This test plan provides a method for calibration of the retained gas sampler (RGS) for ammonia gas analysis. Simulant solutions of ammonium hydroxide at known concentrations will be diluted with isotopically labeled 0.04 M ammonium hydroxide solution. Sea sand solids will also be mixed with ammonium hydroxide solution and diluent to determine the accuracy of the system for ammonia gas analysis

  14. [Conventional retaining of removable partial dentures

    NARCIS (Netherlands)

    Keltjens, H.M.A.M.; Witter, D.J.; Creugers, N.H.J.

    2009-01-01

    Mechanical and biological criteria have to be met in retaining the metal frame of a removable partial denture. Additionally, a removable partial denture is part of the occlusal interface by the clasps and the denture teeth. With respect to mechanical aspects, all rigid parts of the removable partial

  15. Illusory Speed is Retained in Memory during Invisible Motion

    Directory of Open Access Journals (Sweden)

    Luca Battaglini

    2013-05-01

    Full Text Available The brain can retain speed information in early visual short-term memory in an astonishingly precise manner. We investigated whether this (early visual memory system is active during the extrapolation of occluded motion and whether it reflects speed misperception due to contrast and size. Experiments 1A and 2A showed that reducing target contrast or increasing its size led to an illusory speed underestimation. Experiments 1B, 2B, and 3 showed that this illusory phenomenon is reflected in the memory of speed during occluded motion, independent of the range of visible speeds, of the length of the visible trajectory or the invisible trajectory, and of the type of task. These results suggest that illusory speed is retained in memory during invisible motion.

  16. Abdominal retained surgical sponges: CT appearance

    Energy Technology Data Exchange (ETDEWEB)

    Kalovidouris, A.; Kehagias, D.; Moulopoulos, L.; Gouliamos, A.; Pentea, S.; Vlahos, L. [Department of Radiology, University of Athens (Greece)

    1999-09-01

    Retention of surgical sponges is rare. They cause either an aseptic reaction without significant symptoms or an exudative reaction which results in early but nonspecific symptoms. Computed tomography is very useful for recognition of retained sponges. The appearance of retained sponges is widely variable. Air trapping into a surgical sponge results in the spongiform pattern which is characteristic but unfortunately uncommon. A low-density, high-density, or complex mass is found in the majority of cases, but these patterns are not specific. Sometimes, a thin high-density capsule may be seen. Rim or internal calcification is a rare finding. Finally, a radiopaque marker is not a reliable sign. Differentiation from abscess and hematoma is sometimes difficult. (orig.) With 11 figs., 12 refs.

  17. Abdominal retained surgical sponges: CT appearance

    International Nuclear Information System (INIS)

    Kalovidouris, A.; Kehagias, D.; Moulopoulos, L.; Gouliamos, A.; Pentea, S.; Vlahos, L.

    1999-01-01

    Retention of surgical sponges is rare. They cause either an aseptic reaction without significant symptoms or an exudative reaction which results in early but nonspecific symptoms. Computed tomography is very useful for recognition of retained sponges. The appearance of retained sponges is widely variable. Air trapping into a surgical sponge results in the spongiform pattern which is characteristic but unfortunately uncommon. A low-density, high-density, or complex mass is found in the majority of cases, but these patterns are not specific. Sometimes, a thin high-density capsule may be seen. Rim or internal calcification is a rare finding. Finally, a radiopaque marker is not a reliable sign. Differentiation from abscess and hematoma is sometimes difficult. (orig.)

  18. Tooth Retained Implant: No More an Oxymoron

    Directory of Open Access Journals (Sweden)

    Divya Bhat

    2011-03-01

    Full Text Available Introduction: Periodontally af-fected teeth are treated in one of the two ways. (1 Tooth retention after periodontal surgery, in which the degree of regeneration achieved is unpredictable. (2 Tooth extrac-tion and implant placement. Implants have an osseointegrated surface which does not provide adequate shock absorption. Regeneration can be achieved by resecting the crown of the affected tooth and submerging the root. This technique has not had a clinical application so far as the tooth becomes difficult to restore. Placing an implant within the root can make the retained root restorable. At the same time, as the implant is placed within the root surface it achieves a periodontal integration which dampens occlusal forces better than osseointegration. Therefore, such a “tooth retained implant” may serve as an additional treatment option with significant benefits over tooth retention and implant placement alone. The hypothesis: Implants placed within retained roots have shown cementum deposition and attachment of periodontal ligament fibers over their surface. This periodontal attachment may be able to dam-pen forces better than in an osseointegrated implant. Moreover, since an implant is being placed, the crown of the tooth can be resected and submerged. This prevents epithelial migration, allows for the periodontal ligament cells to populate the wound and favors regeneration.Evaluation of the hypothesis: The technique of placing implants within cavities prepared in the root and then submerging them are simple for any practitioner placing implants routinely.

  19. Kansal′s Retainer: A Removable, Tooth-Borne Orthodontic Retainer

    Directory of Open Access Journals (Sweden)

    Sudhanshu Kansal

    2013-01-01

    Full Text Available Adequate retention of a finished orthodontic patient can be the difference between a successful or an unsuccessful treatment. The acrylic portion of the conventional Hawley′s appliance causes a reduced compliance in many orthodontic patients. In an attempt to overcome the drawbacks of the previously used orthodontic retainers a tooth-borne orthodontic retainer was designed, also called the ′Kansal′s retainer′ (Patent pending.

  20. Retained Surgical Foreign Bodies after Surgery

    Directory of Open Access Journals (Sweden)

    Valon A. Zejnullahu

    2017-01-01

    Full Text Available The problem of retained surgical bodies (RSB after surgery is an issue for surgeons, hospitals and the entire medical team. They have potentially harmful consequences for the patient as they can be life threatening and usually, a further operation is necessary. The incidence of RSB is between 0.3 to 1.0 per 1,000 abdominal operations, and they occur due to a lack of organisation and communication between surgical staff during the process. Typically, the RSB are surgical sponges and instruments located in the abdomen, retroperitoneum and pelvis.

  1. Adding a purple corn extract in rats supplemented with chia oil decreases gene expression of SREBP-1c and retains Δ5 and Δ6 hepatic desaturase activity, unmodified the hepatic lipid profile.

    Science.gov (United States)

    Reyna Gallegos, Sixto; Torres Arrunátegui, Génesis; Valenzuela, Rodrigo; Rincón-Cervera, Miguel Ángel; Villanueva Espinoza, María Elena

    2018-05-01

    Flavonoids upregulate gene expression of PPAR-α and underregulate the gene expression of SREBP-1c, and their intake increases the plasmatic concentration of n-3 LC-PUFAs. However, the biological mechanisms underlying these effects have not been elucidated. In this work, the effect of oral supplementation of ALA from chia (Salvia hispanica L.) seed oil and anthocyanins from a purple corn extract (PCE) on gene expression of SREBP-1c, PPAR-α and Δ5 and Δ6 desaturases (Δ5D and Δ6D), the activity of these enzymes in the liver as well as the hepatic lipid profile were evaluated in thirty-six female Sprague Dawley rats whose diet was supplemented with olive oil (OL), chia oil (CH), olive oil and PCE (OL + PCE) or chia oil and PCE (CH + PCE). Gene expression of PPAR-α was significantly higher when supplemented with CH and CH + PCE, SREBP-1c gene expression was higher when supplemented with chia oil. CH supplementation enhanced Δ5D expression whereas no significant differences between treatments were observed concerning Δ6D gene expression. Activities of both desaturases were increased by including olive oil (OL + PCE and OL), and they were found to be higher in CH + PCE respect to CH for both enzymes. The ALA and n-3 LCPUFAs hepatic content was higher with CH, decreasing the levels of AA and n-6 LCPUFAs. It is concluded that the joint action of flavonoids such as anthocyanins and ALA show an anti-adipogenic effect. Desaturase activity was inhibited by ALA and kept by the anthocyanins from PCE, thus anthocyanins would exert a protective effect on the desaturase activity but they would not affect on its gene expression, however, high doses of ALA increased the production of its metabolites, masking the effect of PCE. Copyright © 2018 Elsevier Ltd. All rights reserved.

  2. Transabdominal Migration of Retained Surgical Sponge

    Directory of Open Access Journals (Sweden)

    Ali Guner

    2012-01-01

    Full Text Available Retained surgical sponge (RSS is a rare surgical complication. The RSSs are mostly located intra-abdominally but they can also be left in the thorax, spine, extremity, cranium, and breast. RSS is often difficult to diagnose because of the nonspecific clinical symptoms and radiologic findings. Clinically, RSS may present as an exudative reaction in the early postoperative period or may also cause an aseptic fibrous tissue response. A foreign body may remain asymptomatically silent for a long time, and it may later present with obstruction, fistulization, or mass formation. In this report, we present a case in which an RSS has migrated through the abdominal wall and caused an anterior abdominal wall abscess.

  3. Delayed inflammation associated with retained perfluorocarbon liquid

    Directory of Open Access Journals (Sweden)

    S Pradeep

    2011-01-01

    Full Text Available A 55-year-old woman, with history of cataract surgery 1 year back, presented with features of ocular inflammation for last 3 months. She had no history of any other intraocular surgery. On examination, anterior segment showed frothy material in the inferior angle with moderate anterior chamber reaction (cells+/flare+ and sulcus intraocular lens with large posterior capsule rent. Fundoscopy showed multiple, small to medium-sized transparent bubbles of perfluorocarbon liquid (PFCL with membranes in the vitreous cavity. Ultrasonography confirmed the presence of PFCL in the vitreous cavity. Pars plana vitrectomy with anterior chamber wash was done which led to good visual recovery. To conclude, retained PFCL can cause late onset fibrinous inflammation after a quiescent period but surgical intervention may lead to good visual outcome.

  4. Nuclear fuel element nut retainer cup

    International Nuclear Information System (INIS)

    Walton, L.A.

    1977-01-01

    A typical embodiment has an end fitting for a nuclear reactor fuel element that is joined to the control rod guide tubes by means of a nut plate assembly. The nut plate assembly has an array of nuts, each engaging the respective threaded end of the control rod guide tubes. The nuts, moreover, are retained on the plate during handling and before fuel element assembly by means of hollow cylindrical locking cups that are brazed to the plate and loosely circumscribe the individual enclosed nuts. After the nuts are threaded onto the respective guide tube ends, the locking cups are partially deformed to prevent one or more of the nuts from working loose during reactor operation. The locking cups also prevent loose or broken end fitting parts from becoming entrained in the reactor coolant

  5. 18 CFR 367.2160 - Account 216, Unappropriated retained earnings.

    Science.gov (United States)

    2010-04-01

    ..., Unappropriated retained earnings. 367.2160 Section 367.2160 Conservation of Power and Water Resources FEDERAL... retained earnings. This account must include the balances, either debit or credit, of unappropriated retained earnings arising from earnings of the service company. This account must not include any amounts...

  6. 17 CFR 256.215 - Appropriated retained earnings.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Appropriated retained earnings... UTILITY HOLDING COMPANY ACT OF 1935 Liabilities and Other Credit Accounts § 256.215 Appropriated retained earnings. This account shall include the amount of retained earnings which has been appropriated or set...

  7. 18 CFR 367.2150 - Account 215, Appropriated retained earnings.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Account 215, Appropriated retained earnings. 367.2150 Section 367.2150 Conservation of Power and Water Resources FEDERAL... retained earnings. This account must include the amount of retained earnings that has been appropriated or...

  8. Soil Retaining Structures : Development of models for structural analysis

    NARCIS (Netherlands)

    Bakker, K.J.

    2000-01-01

    The topic of this thesis is the development of models for the structural analysis of soil retaining structures. The soil retaining structures being looked at are; block revetments, flexible retaining walls and bored tunnels in soft soil. Within this context typical structural behavior of these

  9. 31 CFR 203.16 - Retainer and investor depositaries.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Retainer and investor depositaries... TREASURY TAX AND LOAN PROGRAM PATAX § 203.16 Retainer and investor depositaries. (a) Credit to TIP main account balance. On the business day that the TSC receives an AOC from a retainer or investor depositary...

  10. RETAINED STONE PIECE IN ANTERIOR CHAMBER

    Directory of Open Access Journals (Sweden)

    ZvornicaninJasmin, Nadarevic-VodencarevicAmra

    2015-04-01

    Full Text Available ABSTRACT We read with interest the article by Surekha et al. regarding the retained stone piece in anterior chamber. Similar to the results of previous studies, the authors found that delayed intraocular foreign body (IOFB management can result in good visual outcome without an apparent increased risk of endophthalmitis or other deleterious side effects. However, the authors failed to explain the exact reason for the diminution of vision in patients left eye. It is unclear what the uncorrected visual acuity was and what kind of correction was used, more precisely type and amount of cylinder, given the presence of the corneal opacity. Since the size of the IOFB is approximately 4x4x1mm, significant irido-corneal angle changes resulting in intraocular pressure raise and optic nerve head damage can be expected. Traumatic glaucoma following open globe injury can occur in 2.7 to 19% of cases, with several risk factors associated with glaucoma development (advanced age, poor visual acuity at presentation,perforating rather than penetrating ocular injury,lens injury, presence of vitreous hemorrhage and presence of an IOFB. Earlier reportsof latetraumaticoptic neuropathy onset, even after several years, indicate that this possibility cannot be completely ruled out too. Therefore, repeated intraocular pressure measurements, gonioscopy, pupillary reaction assessment, together with through posterior segment examination including visual field and optical coherence tomography examinations can be useful in determining the possible optic nerve damage as one of the possible reasons for visual acuity reduction. The authors did not suggest any operative treatment at this time. However, it should bear in mind that the inert anterior chamber IOFB could be a risk factor for non-infectious endophthalmitis development even after many years. Also, long term retained anterior chamber foreign body leads to permanent endothelial cell loss and can even result in a corneal

  11. 24 CFR 1000.36 - How long must a recipient retain records regarding exceptions made to the conflict of interest...

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false How long must a recipient retain records regarding exceptions made to the conflict of interest provisions? 1000.36 Section 1000.36 Housing... AMERICAN HOUSING ACTIVITIES General § 1000.36 How long must a recipient retain records regarding exceptions...

  12. Periodontal implication of bonded and removable retainers: A comparative study

    Directory of Open Access Journals (Sweden)

    Sonali Mondal

    2017-09-01

    Full Text Available The purpose of this study is to compare the periodontal health of the lower anterior teeth retained with the use of removable and fixed retainers. Fifty four cases receiving comprehensive orthodontic treatment in between 10 to 30 years were randomly selected and divided into 2 groups of 27 each. One group was given removable retainers and other was given fixed retainers. The periodontal status of the patients was accessed with bleeding on probing index, Plaque index and Calculus index. The mean plaque index in case of removable retainers at 1st, 3rd and 6th month were 0.5, 1.0 and 1.7 where as in case of fixed retainers that were 1.8, 3.0 and 4.5. The mean dental calculus index in case of removable retainers at 1st, 3rd and 6th month were 0.0, 0.1 and 0.1 where as in case of fixed retainers that were 0.1, 0.9 and 1.8. In conclusion, removable retainers are superior in oral hygiene maintenance, yet the use of fixed retainers cannot be denied.

  13. Attracting and retaining doctors in rural Nepal.

    Science.gov (United States)

    Shankar, P R

    2010-01-01

    In Nepal, a number of private sector medical schools have opened recently; although sufficient numbers of doctors are graduating there continues to be a doctor shortage in rural areas. This article analysed the rural doctor shortage in Nepal and reviewed the international literature for strategies that may be suitable for use in Nepal. Original research articles, reviews, magazine articles and project reports dealing with Nepal and other developing countries during the period 1995 to 2010 were sourced via Google, Google Scholar and Pubmed. Full text access was obtained via WHO's HINARI database. The health workforce in Nepal is unevenly distributed resulting in doctor shortages in rural areas. The recent introduction of mandatory rural service for scholarship students was aimed to reduce the loss of medical graduates to developed nations. High tuition fees in private medical schools and low Government wages prevent recent graduates from taking up rural positions, and those who do face many challenges. Potential corrective strategies include community-based medical education, selecting rural-background medical students, and providing a partial or complete tuition fee waiver for medical students who commit to rural service. Traditional healers and paramedical staff can also be trained for and authorized to provide rural health care. A range of strategies developed elsewhere could be used in Nepal, especially community-oriented medical education that involves rural doctors in training medical students. The reimbursement of tuition fees, assistance with relocation, and provision of opportunities for academic and professional advancement for rural doctors should also be considered. Government investment in improving working conditions in rural Nepal would assist rural communities to attract and retain doctors.

  14. DNase 1 Retains Endodeoxyribonuclease Activity Following Gold Nanocluster Synthesis

    Science.gov (United States)

    2014-07-04

    mM) was added to 2 mL of protein solution under vigorous stirring at 37 °C (Table 1). After 5 min, 200 μL of NaOH (1 M) was added to raise the pH to...12 for the 1, 5, and 10 mM HAuCl4 samples whereas 400 μL of NaOH (1M) was required to obtain a pH of 12 for the 20 mM HAuCl4 sample due to the... magnesium sulfate pH 5.0), containing 2 μg of dsDNA. The reaction was incubated at room temperature for 20 min followed by the addition of 2 units of

  15. Reliability-based design of a retaining wall

    OpenAIRE

    Kim, John Sang

    1995-01-01

    A retaining wall is subject to various limit states such as sliding, overturning and bearing capacity, and it can fail by anyone of them. Since a great deal of uncertainty is involved in the analysis of the limit states~ the use of detenninistic conventional safety factors may produce a misleading result. The main objective of this study is to develop a procedure for the optimum design of a retaining wall by using the reliability theory. Typical gravity retaining walls with fou...

  16. Effectiveness of Horizontal Rebar on Concrete Block Retaining Wall Strength

    OpenAIRE

    Krishpersad Manohar; Rikhi Ramkissoon

    2016-01-01

    The effectiveness of including a horizontal rebar compared to only a vertical rebar in concrete filled core interlocking concrete block retaining wall sections was investigated with respect to the horizontal retaining force. Experimental results for three specimens of interlocking blocks with vertical rebar and concrete filled cores showed an average horizontal retaining force of 24546 N ± 5.7% at an average wall deflection of 13.3 mm. Experimental results for three wall specimens of interloc...

  17. Doxorubicin-anti-carcinoembryonic antigen immunoconjugate activity in vitro.

    Science.gov (United States)

    Richardson, V J; Ford, C H; Tsaltas, G; Gallant, M E

    1989-04-01

    An in vitro model consisting of a series of 11 human cancer cell lines with varying density of expression of membrane carcinoembryonic antigen (CEA) has been used to evaluate conjugates of doxorubicin (Adriamycin) covalently linked by a carbodiimide method to goat polyclonal antibodies and mouse monoclonal antibodies to CEA. Conjugates were produced which retained both antigen binding and drug cytotoxicity. IC50 values were determined for free drug, free drug mixed with unconjugated antibodies and for the immunoconjugates. Cell lines that were very sensitive to free drug (IC50 less than 100 ng/ml) were also found to be highly sensitive to conjugated drug and similarly cell lines resistant to drug (IC50 greater than 1,000 ng/ml) were also resistant to conjugated drug. Although there was no correlation between CEA expression and conjugates efficacy, competitive inhibition studies using autologous antibody to block conjugate binding to cells indicated immunoconjugates specificity for the CEA target.

  18. 17 CFR 256.216 - Unappropriated retained earnings.

    Science.gov (United States)

    2010-04-01

    ... retained earnings. This account shall include the balance, either debit or credit, arising from earnings... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Unappropriated retained earnings. 256.216 Section 256.216 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  19. Economic and reproductive consequences of retained placenta in dairy cattle.

    NARCIS (Netherlands)

    Joosten, I.; Stelwagen, J.; Dijkhuizen, A.A.

    1988-01-01

    The financial losses due to retained placenta in Dutch dairy cattle were estimated by using two different methods of calculation. A data-set containing the birth records of 160,188 Meuse-Rhine-Yssel cows provided data on the reproductive performance of cows with and without retained placenta. The

  20. The challenge of retaining customers acquired with free trials

    NARCIS (Netherlands)

    Datta, H.; Foubert, B.; van Heerde, H.J.

    Many service firms acquire customers by offering free-trial promotions. A crucial challenge is to retain customers acquired with these free trials. To address this challenge, firms need to understand how free-trial customers differ from regular customers in terms of their decision making to retain

  1. The use of implants as retainers for removable partial dentures.

    Science.gov (United States)

    Zinner, Ira D; Markovits, Stanley; Jansen, Curtis E; Reid, Patrick E; Shapiro, Herbert J

    2010-01-01

    There has been little presented in the literature regarding the use of implant bodies as retainers for removable partial dentures. However, these fixtures can be a useful asset for restorative dentists, as they can be used when there is insufficient bone for a fixed prosthesis or as retainers for a provisional appliance until additional dental treatment is possible.

  2. 12 CFR 1805.504 - Retained earnings.

    Science.gov (United States)

    2010-01-01

    ... applicable Notice of Funds Availability; (C) The Applicant's Comprehensive Business Plan shall discuss its strategy for achieving the increases described in (c)(1)(iii)(A) of this section and the activities associated therewith; (D) The level from which the achievement of said increases will be measured will be as...

  3. [Effect of cigarette smoking on coexistence of cadmium and zinc in retained wisdom teeth].

    Science.gov (United States)

    Malara, Piotr; Kwapuliński, Jerzy; Drugacz, Jan; Malara, Beata

    2005-01-01

    The change in coexistence pattern of elements (antagonism-synergism) in conditions of excessive level of toxic element is observed in many biological samples. The aim of this study was to establish the cadmium and zinc content in hard tissues of retained wisdom teeth of smokers and non-smokers and to find out if active exposure to cigarette smoke has an influence on coexistence of both metals in these tissues. Material consisted of 127 retained wisdom teeth (65 from smokers and 62 from non-smokers). Cadmium and zinc contents were determined by means of atomic absorption spectrometry. We found out that retained wisdom tooth from smokers exhibited higher cadmium and zinc contents compared to non-smokers' teeth. Moreover, coexistence pattern of cadmium and zinc in teeth depends on exposure to heavy metals and exhibits strong synergism in smokers.

  4. An unrecognized foreign body retained in the calcaneus

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ro Woon; Choi, Soo Jung; Hwang, Jae Kwang; Ahn, Jae Hong; Kang, Chae Hoon; Shin, Dong Rock [Gangneung Asan Hospital, College of Medicine, University of Ulsan, Gangneung (Korea, Republic of)

    2017-06-15

    We describe a case of an unrecognized foreign body retained in the calcaneus. The patient denied any history of trauma. The skin overlying the calcaneus was intact with no local signs of inflammation. The retained foreign body was not observed on the radiograph of the calcaneus. Magnetic Resonance Imaging showed a tubular low signal intensity lesion in the calcaneal body, surrounded by strongly enhanced soft tissue and bone marrow edema caused by a foreign body reaction. A foreign body retained in the calcaneus was suspected on the basis of these findings. Surgical exploration and curettage was performed, and a rod shaped wooden fragment was found.

  5. SPP retains interest in geothermal project

    International Nuclear Information System (INIS)

    Anon

    2007-01-01

    Slovensky plynarensky priemysel (SPP) officially indicated that it intended to drop its project of using geothermal energy in the Kosicka kotlina. This spring it published an advert that it was looking for a company that wished to acquire a majority stake in the company, Geoterm Kosice. The company was established to commercially develop this geothermal source. But it seems SPP does not want to drop the project completely. It has kept some important cards, such as control over the land where the boreholes are located Any company that wants to use geothermal energy needs a ruling issued by the Ministry of Environment defining the exploration area. Geothermal sources were found in the villages of Durkov, Svinica, Bidovce and Olsovany. Not so long ago the area was assigned to Geoterm but from May 9 the area can be explored by Slovgeoterm. Both companies have the same majority shareholder - SPP. It controls 96% of Geoterm shares and 50% of Slovgeoterm. So far it has only officially announced its intention to sell the Geoterm shares. But as far as the use of the geothermal resource is concerned since May Slovgeoterm has played a key role.The company focuses on the utilization of geothermal energy. In addition to the project in the Kosice region, it has also participated in a project to heat more than a thousand flats using geothermal water in Galanta and a project to heat greenhouses in Podhajske. There are also other geothermal projects running in Presov and Michalovce. Icelandic company, Enex, with the same specialisation controls 28% of the company and a further 20% is owned by the investment group, NEFCO based in Helsinki. Two percent of the company is owned by its general director and the general proxy of Geoterm, Otto Halas. And so without the agreement of this company no-one can start any activities related to the utilization of geothermal energy. (authors)

  6. Assessment of Soil Arching Factor for Retaining Wall Pile Foundations

    Science.gov (United States)

    2017-03-31

    Despite the prevalence of the soldier piles retaining wall systems as temporary and even permanent shoring systems along state highways, relatively little is known on the effect of the foreslope bench width and the slope inclination on the arching ca...

  7. Percutaneous Retrieval of a Retained Jackson-Pratt Drain Fragment

    International Nuclear Information System (INIS)

    Namyslowski, Jan; Halin, Neil J.; Greenfield, Alan J.

    1996-01-01

    A retained intraabdominal Jackson-Pratt drain fragment was percutaneously retrieved using an inflated angioplasty balloon that had been maneuvered inside of the drain lumen over a hydrophilic-coated steerable guidewire

  8. Myomectomy for Retained Placenta Due to Incarcerated Fibroid Mass

    African Journals Online (AJOL)

    and life threatening complication. We present a patient who had mid-trimester miscarriage, complicated by retained ... the couple gave consent for the termination of the pregnancy. .... In conclusion, it is pertinent to note that uterine fibroid in.

  9. Gossypiboma – the retained surgical swab: An enduring clinical ...

    African Journals Online (AJOL)

    Retained abdominal swabs remain a difficult problem. This review ... and continues to date, despite advances .... difficult problem to eradicate even though .... to complete multiple emergency surgeries with no rest is great, ... The position.

  10. Probabilistic safety analysis of earth retaining structures during earthquakes

    Science.gov (United States)

    Grivas, D. A.; Souflis, C.

    1982-07-01

    A procedure is presented for determining the probability of failure of Earth retaining structures under static or seismic conditions. Four possible modes of failure (overturning, base sliding, bearing capacity, and overall sliding) are examined and their combined effect is evaluated with the aid of combinatorial analysis. The probability of failure is shown to be a more adequate measure of safety than the customary factor of safety. As Earth retaining structures may fail in four distinct modes, a system analysis can provide a single estimate for the possibility of failure. A Bayesian formulation of the safety retaining walls is found to provide an improved measure for the predicted probability of failure under seismic loading. The presented Bayesian analysis can account for the damage incurred to a retaining wall during an earthquake to provide an improved estimate for its probability of failure during future seismic events.

  11. Retained Foreign Bodies: A Serious Threat in the Indian Operation ...

    African Journals Online (AJOL)

    hanumantp

    report cases of RFBs. Keywords: Medical negligence, Radiography, Retained foreign bodies. Review Article ... different technology used to reduce medical errors was included in this review. ..... body mimicking a spinal mass. Eur Spine J 2006 ...

  12. Retaining professional nurses in South Africa: Nurse managers ...

    African Journals Online (AJOL)

    Retaining professional nurses in South Africa: Nurse managers' perspectives. ... This implies that creating a favourable environment in the workplace situation ... Unsafe working environments and a lack of resources threaten the safety and ...

  13. Knowledge and attitude of dentists toward implant retained ...

    African Journals Online (AJOL)

    2014-09-13

    Sep 13, 2014 ... and 80% of GDP used SRR in <50% and <25% of their implant practice respectively. ..... micro‑gap formation resulting in plaque accumulation and .... opening in screw‑or cement‑retained implant fixed partial denture designs.

  14. Implant retention systems for implant-retained overdentures.

    Science.gov (United States)

    Laverty, D P; Green, D; Marrison, D; Addy, L; Thomas, M B M

    2017-03-10

    Implant retained overdentures are being increasingly utilised in both general and specialist practice to rehabilitate patients with missing teeth, particularly those that are edentate. This article aims to inform the reader of a variety of retention systems that are available to retain an implant overdenture and to understand how these systems work, their advantages and disadvantages and to outline some of the clinical and treatment planning considerations involved in selecting the most appropriate retention system for patients.

  15. ORGANIZING, TRAINING, AND RETAINING INTELLIGENCE PROFESSIONALS FOR CYBER OPERATIONS

    Science.gov (United States)

    2016-02-13

    in Education,” Preventing School Failure 57(3), (2013): 162-170. Wall , Andru, “Demystifying the Title 10-Title 50 Debate,” Harvard Law School...AIR WAR COLLEGE AIR UNIVERSITY ORGANIZING, TRAINING, AND RETAINING INTELLIGENCE PROFESSIONALS FOR CYBER OPERATIONS by Melissa A...to adequately organize, train and retain cyber expertise. This is especially true within Air Force intelligence, a critical component of the

  16. Attachment retained overdentures: a report on their maintenance requirements.

    Science.gov (United States)

    Shaw, M J

    1984-07-01

    Twenty-three patients who received attachment retained overdentures between 1964 and 1977 are reviewed. One third of the patients examined had carious abutment teeth, oral hygiene was poor, and periodontal disease prevalent. Overdentures opposed by natural teeth required more extensive prosthetic maintenance than overdentures opposed by a conventional complete denture. Three quarters of the teeth retaining the prostheses were functioning adequately after a mean period of 7 years.

  17. Total rewards that retain: A study of demographic preferences

    OpenAIRE

    Monica Pregnolato; Mark H.R. Bussin; Anton F. Schlechter

    2017-01-01

    Orientation: Changing workplace demographics and a dearth of employees with scarce skills have forced employers to better understand the various factors that retain talented employees. Research purpose: In this empirical study, the reward preferences and ideal combination of total reward elements (based on an estimation of their relative importance) that retain employees from various demographic groups, including employees of different race, gender and age groups, were investigated. M...

  18. Analysis of Different Positions of Fiber-Reinforced Composite Retainers versus Multistrand Wire Retainers Using the Finite Element Method

    Directory of Open Access Journals (Sweden)

    Arezoo Jahanbin

    2014-01-01

    Full Text Available Background. The aim of this study was to evaluate root displacement of the lower incisors fixed with FRC in different positions versus FSW retainers using the finite element method. Materials and Methods. 3D finite element models were designed for a mandibular anterior segment: Model 1: flexible spiral wire bonded to the lingual teeth surfaces, Model 2: FRC bonded to the upper third of lingual teeth surfaces, and Model 3: FRC bonded to the middle third. FE analysis was performed for three models and then tooth displacements were evaluated. Results. In contrast to lateral incisors and canines, the FSW retainer caused the central teeth to move more than the teeth bonded with FRC in both loadings. Comparison between Models 2 and 3 (in vertical loading showed that FRC retainers that bonded at the upper third of lingual teeth surfaces made central and canine teeth move less than FRC retainers bonded at the middle third; however, for lateral teeth it was the opposite. Conclusion. FRC retainers bonded at the upper third of lingual teeth surfaces make central and canine teeth move less than FRC retainers bonded at the middle third in vertical loading; however, for lateral teeth it was the opposite.

  19. Peripartal leukogram in cows with and without retained placenta

    Directory of Open Access Journals (Sweden)

    Lužajić Tijana

    2014-01-01

    Full Text Available The aim of this study was to investigate whether prepartal leukogram in cows with retained placenta could indicate the presence of subclinical systemic inflammatory response before the onset of disease. After calving, sixteen highly pregnant Holstein cows, aged 3 to 9 years, without clinical signs of the disease prior to calving were divided into two groups: the first group (n=9 were animals without retained placenta, or any visible inflammation after birth; the second group (n=7 were cows with retained placenta. Blood was sampled three times before parturition, at intervals of one week, and once 24 hours after birth. The number of total leukocytes, segmented and non segmented neutrophilic granulocytes (NG, lymphocytes and monocytes were determined by standard laboratory techniques. The results have shown that in the group of cows with retained placenta the number of mature neutrophils was slightly elevated in the third, second and last week before calving, and equal number of non segmented neutrophils in regard to the group with no retention. The results have also shown that, in both groups of cows, 24 hours after calving, the number of total leukocytes and the number of segmented neutrophils decreased, but the number of the non segmented neutrophils increased. Based on this, we can conclude that cows with retained placenta had no systemic inflammatory response during three weeks prepartal period, but 24 hours after calving, systemic inflammatory response was documented in all the cows. Moreover, the intensity of inflammatory response in cows with retained placenta was not more pronounced in comparison to cows without retained placenta. [Projekat Ministarstva nauke Republike Srbije, br. 175061

  20. Seismic analysis for translational failure of landfills with retaining walls.

    Science.gov (United States)

    Feng, Shi-Jin; Gao, Li-Ya

    2010-11-01

    In the seismic impact zone, seismic force can be a major triggering mechanism for translational failures of landfills. The scope of this paper is to develop a three-part wedge method for seismic analysis of translational failures of landfills with retaining walls. The approximate solution of the factor of safety can be calculated. Unlike previous conventional limit equilibrium methods, the new method is capable of revealing the effects of both the solid waste shear strength and the retaining wall on the translational failures of landfills during earthquake. Parameter studies of the developed method show that the factor of safety decreases with the increase of the seismic coefficient, while it increases quickly with the increase of the minimum friction angle beneath waste mass for various horizontal seismic coefficients. Increasing the minimum friction angle beneath the waste mass appears to be more effective than any other parameters for increasing the factor of safety under the considered condition. Thus, selecting liner materials with higher friction angle will considerably reduce the potential for translational failures of landfills during earthquake. The factor of safety gradually increases with the increase of the height of retaining wall for various horizontal seismic coefficients. A higher retaining wall is beneficial to the seismic stability of the landfill. Simply ignoring the retaining wall will lead to serious underestimation of the factor of safety. Besides, the approximate solution of the yield acceleration coefficient of the landfill is also presented based on the calculated method. Copyright © 2010 Elsevier Ltd. All rights reserved.

  1. Design principles for engaging and retaining virtual citizen scientists.

    Science.gov (United States)

    Wald, Dara M; Longo, Justin; Dobell, A R

    2016-06-01

    Citizen science initiatives encourage volunteer participants to collect and interpret data and contribute to formal scientific projects. The growth of virtual citizen science (VCS), facilitated through websites and mobile applications since the mid-2000s, has been driven by a combination of software innovations and mobile technologies, growing scientific data flows without commensurate increases in resources to handle them, and the desire of internet-connected participants to contribute to collective outputs. However, the increasing availability of internet-based activities requires individual VCS projects to compete for the attention of volunteers and promote their long-term retention. We examined program and platform design principles that might allow VCS initiatives to compete more effectively for volunteers, increase productivity of project participants, and retain contributors over time. We surveyed key personnel engaged in managing a sample of VCS projects to identify the principles and practices they pursued for these purposes and led a team in a heuristic evaluation of volunteer engagement, website or application usability, and participant retention. We received 40 completed survey responses (33% response rate) and completed a heuristic evaluation of 20 VCS program sites. The majority of the VCS programs focused on scientific outcomes, whereas the educational and social benefits of program participation, variables that are consistently ranked as important for volunteer engagement and retention, were incidental. Evaluators indicated usability, across most of the VCS program sites, was higher and less variable than the ratings for participant engagement and retention. In the context of growing competition for the attention of internet volunteers, increased attention to the motivations of virtual citizen scientists may help VCS programs sustain the necessary engagement and retention of their volunteers. © 2016 Society for Conservation Biology.

  2. Ammonia concentration modeling based on retained gas sampler data

    International Nuclear Information System (INIS)

    Terrones, G.; Palmer, B.J.; Cuta, J.M.

    1997-09-01

    The vertical ammonia concentration distributions determined by the retained gas sampler (RGS) apparatus were modeled for double-shell tanks (DSTs) AW-101, AN-103, AN-104, and AN-105 and single-shell tanks (SSTs) A-101, S-106, and U-103. One the vertical transport of ammonia in the tanks were used for the modeling. Transport in the non-convective settled solids and floating solids layers is assumed to occur primarily via some type of diffusion process, while transport in the convective liquid layers is incorporated into the model via mass transfer coefficients based on empirical correlations. Mass transfer between the top of the waste and the tank headspace and the effects of ventilation of the headspace are also included in the models. The resulting models contain a large number of parameters, but many of them can be determined from known properties of the waste configuration or can be estimated within reasonable bounds from data on the waste samples themselves. The models are used to extract effective diffusion coefficients for transport in the nonconvective layers based on the measured values of ammonia from the RGS apparatus. The modeling indicates that the higher concentrations of ammonia seen in bubbles trapped inside the waste relative to the ammonia concentrations in the tank headspace can be explained by a combination of slow transport of ammonia via diffusion in the nonconvective layers and ventilation of the tank headspace by either passive or active means. Slow transport by diffusion causes a higher concentration of ammonia to build up deep within the waste until the concentration gradients between the interior and top of the waste are sufficient to allow ammonia to escape at the same rate at which it is being generated in the waste

  3. The stability of gabion walls for earth retaining structures

    Directory of Open Access Journals (Sweden)

    Mahyuddin Ramli

    2013-12-01

    Full Text Available The stability of earth retaining structures in flood prone areas has become a serious problem in many countries. The two most basic causes of failure arising from flooding are scouring and erosion of the foundation of the superstructure. Hence, a number of structures like bridges employ scour-arresting devices, e.g., gabions to acting on the piers and abutments during flooding. Research was therefore undertaken to improve gabion resistance against lateral movement by means of an interlocking configuration instead of the conventional stack-and-pair system. This involved simulating lateral thrusts against two dimensionally identical retaining wall systems configured according to the rectangular and hexagonal gabion type. The evolution of deformation observed suggested that the interlocking design exhibits better structural integrity than the conventional box gabion-based wall in resisting lateral movement and therefore warrants consideration for use as an appropriate scour-arresting device for earth retaining structures.

  4. Lead poisoning from retained bullets: pathogenesis, diagnosis, and management

    International Nuclear Information System (INIS)

    Linden, M.A.; Manton, W.I.; Stewart, R.M.; Thal, E.R.; Feit, H.

    1982-01-01

    Lead intoxication (plumbism) from retained bullets has rarely been reported but may be fatal if unrecognized. Bullets lodged within joint spaces or pseudocysts are more likely to develop this complication, although patients with retained missiles in other locations may also be at risk. Subtle findings such as the occurrence of unexplained anemia, abdominal colic, nephropathy, or neurologic deterioration in patients with retained missiles may suggest consideration of plumbism. An intercurrent metabolic stress such as infection, endocrinopathy, or alcoholism may be a precipitating factor. Among the various diagnostic studies available, mass spectrometric stable isotope dilution analysis may be the most reliable. It is important to employ chelation therapy prior to any operative intervention. This will reduce the mobilization of lead from bone during or following the surgical procedure

  5. Dust retaining properties of leaves of some tree species

    Energy Technology Data Exchange (ETDEWEB)

    Gusev, M I

    1960-05-01

    A study was made in Tashkent, Russia of the dust-retaining power of leaves of several tree species. Investigations were made in a park where these tree species were growing in close proximity, exposed to the effects of dust from the main city street and from the highway passing through the park. Observations on the dust-retaining power of leaves were made mostly during the summer and fall months. The dust-retaining power of leaves of different tree species varied with the dust concentration in the air. In the summer and fall when rains are scarce a steady accumulation of dust was observed on the surface of the leaves. 1 table.

  6. A Two-Pronged Approach to Retaining Millennial Nurses.

    Science.gov (United States)

    Koppel, Jenna; Deline, Marisa; Virkstis, Katherine

    2017-12-01

    Despite increased staff engagement and improved new hire on-boarding, organizations struggle to retain millennial nurses. One dominant trait is shared by organizations that have successfully reduced turnover for this group: investment in select strategies that cement loyalty to the organization. In this article, the authors describe 2 strategies for retaining early-tenure millennial nurses. In the 1st article of this series, the authors described why nursing leaders must supplement their organization's current investments in engagement with strategies targeted at millennials in their 1st 3 years. This 2nd part of the series will outline these strategies.

  7. Retained sensitivity to cytotoxic pyrimidine nucleoside analogs in thymidine kinase 2 deficient human fibroblasts

    OpenAIRE

    Bjerke, Mia; Solaroli, Nicola; Lesko, Nicole; Balzarini, Jan; Johansson, Magnus; Karlsson, Anna

    2010-01-01

    Thymidine kinase 2 (TK2) is a mitochondrial deoxyribonucleoside kinase that phosphorylates several nucleoside analogs used in anti-viral and anti-cancer therapy. A fibroblast cell line with decreased TK2 activity was investigated in order to obtain insights in the effects of TK2 deficiency on nucleotide metabolism. The role of TK2 for the sensitivity against cytotoxic nucleoside analogs was also investigated. The TK2 deficient cells retained their sensitivity against all pyrimidine nucleoside...

  8. Management of retained encrusted urethral catheter with extracorporeal shockwave lithotripsy

    Directory of Open Access Journals (Sweden)

    Sameh Anwar Kunzman

    2002-01-01

    Full Text Available We report a case of non-deflating heavily encrusted Foley catheter successfully removed by extracorporeal shockwave lithotripsy (ESWL. To our knowledge this is the first case of using ESWL to remove encrusted foley catheter retained in the bladder.

  9. A Market-Driven Approach to Retaining Talent.

    Science.gov (United States)

    Cappelli, Peter

    2000-01-01

    Employee retention must be rethought in a free-agent market. Compensation can shape who leaves and stays. Job design and customization can tailor jobs to employee needs. Encouraging social ties among colleagues and selecting appealing locations for workplaces are other ways to retain talented workers. (SK)

  10. Good Laboratory Practice. Part 2. Recording and Retaining Raw Data

    Science.gov (United States)

    Wedlich, Richard C.; Libera, Agata E.; Pires, Amanda; Tellarini, Cassandra

    2013-01-01

    A clear understanding of how "raw data" is defined, recorded, and retained in the laboratory record is essential to the chemist employed in the laboratory compliant with the Good Laboratory Practices regulations. This article is intended to provide an understanding by drawing upon examples taken from the modern pharmaceutical analysis…

  11. 40 CFR 98.227 - Records that must be retained.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Records that must be retained. 98.227 Section 98.227 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... significant changes to process. (b) Documentation of how process knowledge was used to estimate abatement...

  12. 40 CFR 98.57 - Records that must be retained.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Records that must be retained. 98.57 Section 98.57 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS...) Documentation of how process knowledge was used to estimate abatement technology destruction efficiency. (f...

  13. INTRODUCTION The incidence of retained placenta varies greatly ...

    African Journals Online (AJOL)

    balance between the post-partum haemorrhage risk of leaving the placenta in ... Conclusion: Retained placenta still remains a potentially life threatening condition in ... obstetric services by high skilled health care providers in ensuring a properly conducted .... of the preterm placenta may require more uterine work and time ...

  14. A survey of failed post-retained restorations

    DEFF Research Database (Denmark)

    Peutzfeldt, A; Sahafi, A; Asmussen, E

    2008-01-01

    Survival of endodontically treated, post-restored teeth depends on a multitude of factors, all of which are practically impossible to include in a randomized, controlled clinical study. The purpose of this survey was to characterize and analyze reported failures of post-retained restorations...

  15. Retained portion of latex glove during femoral nailing. Case report.

    Science.gov (United States)

    Sadat-Ali, M; Marwah, S; al-Habdan, I

    1996-11-01

    A case of retained glove during Kuntscher intramedullary nailing is described. An abscess around the glove could have lead to osteomyelitis. One need to be cautious feeling the top end of the nail while femoral nailing to avoid such a complication.

  16. 15 CFR 762.2 - Records to be retained.

    Science.gov (United States)

    2010-01-01

    ..., Statement by Ultimate Consignee and Purchaser; (17) § 748.13, Delivery Verification (DV); (18) § 748.2(c... to be retained; (38) § 764.2, Violations; (39) § 764.5, Voluntary self-disclosure; and (40) § 766.10...

  17. 13 CFR 120.1707 - Seller's retained Loan Interest.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Seller's retained Loan Interest. 120.1707 Section 120.1707 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1707 Seller...

  18. Vesicovaginal fistula, bladder calculus, retained foreign body or all ...

    African Journals Online (AJOL)

    L. Paik

    Vesicovaginal fistula, bladder calculus, retained foreign body or all of the above? The unusual presentation of a female with total urinary incontinence. L. Paika, S. Smitb,∗. , H. van Heerdenb, K. du Toitb,. A. van der Merweb, C. Heynsb a Department of Urology, Michigan State University College of Osteopathic Medicine, ...

  19. Management of Retained Genital Piercings: A Case Report and Review

    Directory of Open Access Journals (Sweden)

    Laura J. Moulton

    2017-01-01

    Full Text Available The prevalence of genital piercing among women is increasing. As the popularity increases, the number of complications from infection, injury, and retained jewelry is likely to rise. Techniques to remove embedded jewelry are not well described in the literature. The purpose of this report was to describe a case of a patient with a retained clitoral glans piercing, discuss a simple technique for outpatient removal, and review current evidence regarding associated risks of clitoral piercings. A 24-year-old female presented to the emergency department with an embedded clitoral glans piercing. Local anesthetic was injected into the periclitoral skin and a small superficial vertical incision was made to remove the ball of the retained barbell safely. In conclusion, among patients with retained genital piercing, outpatient removal of embedded jewelry is feasible. While the practice of female genital piercing is not regulated, piercing of the glans of the clitoris is associated with increased injury to the nerves and blood supply of the clitoris structures leading to future fibrosis and diminished function compared to piercing of the clitoral hood.

  20. Management of Retained Genital Piercings: A Case Report and Review.

    Science.gov (United States)

    Moulton, Laura J; Jernigan, Amelia M

    2017-01-01

    The prevalence of genital piercing among women is increasing. As the popularity increases, the number of complications from infection, injury, and retained jewelry is likely to rise. Techniques to remove embedded jewelry are not well described in the literature. The purpose of this report was to describe a case of a patient with a retained clitoral glans piercing, discuss a simple technique for outpatient removal, and review current evidence regarding associated risks of clitoral piercings. A 24-year-old female presented to the emergency department with an embedded clitoral glans piercing. Local anesthetic was injected into the periclitoral skin and a small superficial vertical incision was made to remove the ball of the retained barbell safely. In conclusion, among patients with retained genital piercing, outpatient removal of embedded jewelry is feasible. While the practice of female genital piercing is not regulated, piercing of the glans of the clitoris is associated with increased injury to the nerves and blood supply of the clitoris structures leading to future fibrosis and diminished function compared to piercing of the clitoral hood.

  1. Diffraction study of the retained austenite content in TRIP steels

    Energy Technology Data Exchange (ETDEWEB)

    Gnaeupel-Herold, T., E-mail: tg-h@nist.gov [NIST Center for Neuron Research, 100 Bureau Dr., Gaithersburg MD 20899-6102 (United States); University of Maryland, Department of Material Science and Engineering., College Park MD 20742-2142 (United States); Creuziger, A., E-mail: adam.creuziger@nist.gov [NIST Metallurgy Division, 100 Bureau Dr., Gaithersburg MD 20899-8553 (United States); Kent State University, Kent, OH 44242 (United States)

    2011-04-25

    Research highlights: {yields} Novel orientation averaging scheme for retained austenite content measurement. {yields} assumption of random grain orientation generally not justified. {yields} Averaging scheme allows to disregard texture. {yields} unlike Rietveld method, averaging method does not orientation density function. {yields} Two independent (hkl) are necessary for retained austenite content. - Abstract: The results of a study of using neutron diffraction for determining the retained austenite content of TRIP steels are presented. The study covers a wide area of materials, deformation modes (uniaxial, biaxial and plane strain), strains, and the retained austenite content as a result of these variables. It was determined using basic principles of statistics that a minimum of two reflections (hkl) for each phase is necessary to calculate a phase mass fraction and the associated standard deviation. Texture from processing the steel is the largest source of uncertainty. Through the method of complete orientation averaging described in this paper, the texture effect and with it the standard deviation of the austenite mass fraction can be substantially reduced, regardless of the type or severity of the texture.

  2. Retained Foreign Bodies: A Serious Threat in the Indian Operation ...

    African Journals Online (AJOL)

    Proper communication among the personnel participating in surgery aimed at preventing this medical negligence would help in mitigating such errors. Finally, the surgeon should not only follow the standard recommended procedure, but also report cases of RFBs. Keywords: Medical negligence, Radiography, Retained ...

  3. Summary report on the design of the retained gas sampler system (retained gas sampler, extruder and extractor)

    International Nuclear Information System (INIS)

    Wootan, D.W.; Bolden, R.C.; Bridges, A.E.; Cannon, N.S.; Chastain, S.A.; Hey, B.E.; Knight, R.C.; Linschooten, C.G.; Pitner, A.L.; Webb, B.J.

    1994-01-01

    This document summarizes work performs in Fiscal Year 1994 to develop the three main components of Retained Gas Sampler System (RGSS). These primary components are the Retained Gas Sampler (RGS), the Retained Gas Extruder (RGE), and the Retained Gas Extractor (RGEx). The RGS is based on the Westinghouse Hanford Company (WHC) Universal Sampler design, and includes modifications to reduce gas leakage. The primary data priorities for the RGSS are to measure the void fraction and the flammable gas concentration in the waste sample. Significant progress has been made in developing the RGSS. The RGSS is being developed by WHC to extract a representative waste sample from a Flammable Gas Watch List Tanks and to measure both the amount and composition of free and open-quotes boundclose quotes gases. Sudden releases of flammable gas mixtures are a safety concern for normal waste storage operations and eventual waste retrieval. Flow visualization testing was used to identify important fluid dynamic issues related to the sampling process. The primary data priorities for the RGSS are to measure the void fraction and the flammable gas concentration in the waste sample. The safety analysis for the RGSS is being performed by Los Alamos National Laboratory and is more than sixty percent (60%) complete

  4. Complete endoscopic management of a retained bullet in the bladder.

    Science.gov (United States)

    Friedman, Ariella A; Trinh, Quoc-Dien; Kaul, Sanjeev; Bhandari, Akshay

    2013-01-01

    A 25-year-old male gunshot victim presented at our institution with gross hematuria following Foley catheter insertion. Computed tomography and cystogram did not show a bladder perforation, but were notable for a left ischial fracture and the presence of a bullet within the bladder. After failed attempts at retrieving the bullet with a resectoscope and loop, as well as a cystoscope and stone crusher, a 26 French nephroscope was inserted transurethrally, and the bullet was successfully engaged and removed using a Perc NCircle (Cook Medical, Bloomington, IN) grasper. The extra-peritoneal injury was managed conservatively with catheter drainage. To our knowledge, this represents the first case of successful transurethral management of a retained intravesical bullet. Such an approach may benefit patients with retained intravesical bullets or other challenging intravesical foreign bodies and may be helpful in select circumstances to spare patients from more extensive surgeries.

  5. CT and sonographic diagnosis of retained surgical sponge

    International Nuclear Information System (INIS)

    Matsumoto, Syunro; Aikawa, Hisayuki; Miyake, Hidetoshi; Mori, Hiromu; Maeda, Tohru; Nishimura, Hiro; Monzen, Yoshio; Ashizawa, Akira; Isomoto, Ichiro.

    1990-01-01

    Seven cases of pathologically proven retained surgical sponge were reviewed and classified into four types, depending on CT and US findings. CT showed a mass with tiny gas bubbles, and sonogram showed an echogenic area with strong posterior shadow (Type I). CT showed an irregular high density mass with no gas bubble, and sonogram showed an echogenic area with strong posterior shadow (Type II). CT showed a low density mass with irregular internal high density areas, and somogram showed a cystic mass with zigzag internal components (Type III). CT showed an eliptic high density mass with low density area internally. Judging from the experiment and operative findings, these patterns were decided by the number and status of the gauze, volume of the exudate and hematoma, and status of the granulation. The author concludes that these characteristic CT and US findings, together with a history of surgery, permit the correct diagnosis of retained surgical sponge. (author)

  6. Functional design criteria for the retained gas sampler system

    International Nuclear Information System (INIS)

    Wootan, D.W.

    1995-01-01

    A Retained Gas Sampler System (RGSS) is being developed to capture and analyze waste samples from Hanford Flammable Gas Watch List Tanks to determine both the quantity and composition of gases retained in the waste. The RGSS consists of three main components: the Sampler, Extractor, and Extruder. This report describes the functional criteria for the design of the RGSS components. The RGSS Sampler is based on the WHC Universal Sampler design with modifications to eliminate gas leakage. The primary function of the Sampler is to capture a representative waste sample from a tank and transport the sample with minimal loss of gas content from the tank to the laboratory. The function of the Extruder is to transfer the waste sample from the Sampler to the Extractor. The function of the Extractor is to separate the gases from the liquids and solids, measure the relative volume of gas to determine the void fraction, and remove and analyze the gas constituents

  7. Early Decomposition of Retained Heavy Silicone Oil Droplets

    Directory of Open Access Journals (Sweden)

    Touka Banaee

    2012-01-01

    Full Text Available Purpose: To report a case of early decomposition of retained heavy silicone oil droplets. Case Report: The single highly myopic eye of a 16-year-old boy with history of scleral buckling and buckle revision developed redetachment due to inferior retinal dialysis. The patient underwent pars plana vitrectomy and injection of heavy silicone oil. Early emulsification of the silicone oil was observed following surgery, which was removed 4 weeks later in another operation. Retained heavy silicone droplets lost their heavier- than-water specific gravity within 2 months together with extensive iris depigmentation, and release of pigment granules into the anterior chamber and vitreous cavity. Conclusion: This case report demonstrates that heavy silicone oil droplets can undergo in vivo chemical decomposition with possible toxic effects on ocular tissues.

  8. A study of the carbon distribution in retained austenite

    International Nuclear Information System (INIS)

    Scott, C.P.; Drillet, J.

    2007-01-01

    Cold-rolled and annealed transformation-induced plasticity (TRIP) steels were overaged to modify the carbon concentrations (C γ ) in retained austenite. Experimental C γ values were directly obtained by electron energy loss spectroscopy and compared with data derived from X-ray diffraction measurements of the austenite lattice parameter (a γ ). In this way, we evaluated the different expressions available in the literature relating C γ to a γ

  9. The cyclops lesion after bicruciate-retaining total knee replacement

    OpenAIRE

    Klaassen, Mark A.; Aikins, Jerry L.

    2017-01-01

    The cyclops lesion is a localized anterior arthrofibrosis most commonly seen following anterior cruciate ligament reconstruction. The lesion forms at the anterior cruciate ligament insertion creating a painful extension block between femoral intercondylar notch and tibial plateau. We present 2 cases (3 knees) in which cyclops lesions appeared atypically following bicruciate-retaining total knee replacement. Two lesions occurred in a single patient following bilateral knee replacement. One les...

  10. Macroeconomic effects of zero corporate income tax on retained earnings

    OpenAIRE

    Jaan Masso; Jaanika Meriküll

    2011-01-01

    International tax competition had led to a lowering of corporate tax rates worldwide. Estonia was the first country to reduce the tax rate on retained earnings to zero, while distributed profits remained taxed at the pre-reform level. This paper seeks to analyse the effects of this unique tax reform implemented in year 2000. We apply a neoclassical exogenous growth general equilibrium model with an extension for endogenous corporate finance. Our findings indicate that the reform had a strong ...

  11. Removal of Retained Lead Shot Through Laparoscopic Appendectomy

    Science.gov (United States)

    Lloyd, D. M.

    2003-01-01

    We describe a patient presenting with lead shot in his appendix. A plain radiograph of his lumbar spine was performed for back pain, and an incidental finding of lead shot retained within the appendix was seen. Lead shot in the appendix is associated with appendicitis, and 2 cases have been reported of lead intoxication. We suggest that an elective laparoscopic appendectomy should be offered to patients as a possible management option. PMID:12856854

  12. Intravitreal Phacoemulsification Using Torsional Handpiece for Retained Lens Fragments

    OpenAIRE

    Kumar, Vinod; Takkar, Brijesh

    2016-01-01

    Purpose: To evaluate the results of intravitreal phacoemulsification with torsional hand piece in eyes with posteriorly dislocated lens fragments. Methods: In this prospective, interventional case series, 15 eyes with retained lens fragments following phacoemulsification were included. All patients underwent standard three-port pars plana vitrectomy and intravitreal phacoemulsification using sleeveless, torsional hand piece (OZiL™, Alcon's Infiniti Vision System). Patients were followed up...

  13. The stability of gabion walls for earth retaining structures

    OpenAIRE

    Mahyuddin Ramli; T.J.r. Karasu; Eethar Thanon Dawood

    2013-01-01

    The stability of earth retaining structures in flood prone areas has become a serious problem in many countries. The two most basic causes of failure arising from flooding are scouring and erosion of the foundation of the superstructure. Hence, a number of structures like bridges employ scour-arresting devices, e.g., gabions to acting on the piers and abutments during flooding. Research was therefore undertaken to improve gabion resistance against lateral movement by means of an interlocking ...

  14. Implant-Retained Auricular Prosthesis: A Case Report

    OpenAIRE

    Ozturk, A. Nilgun; Usumez, Aslihan; Tosun, Zekeriya

    2010-01-01

    Extraoral implant retained prosthesis have been proven to be a predictable treatment option for maxillofacial rehabilitation. This case report describes the clinical and laboratory procedures for fabricating an auricular prosthesis. In this case report, an auricular prosthesis was fabricated for a patient who lost the left and right external ear in an electrical burn. Extraoral implants and bar-and-clip retention for the proper connection of the auricular prosthesis to implant were used. This...

  15. An integrated framework for transmission cost allocation retaining efficiency concepts

    Energy Technology Data Exchange (ETDEWEB)

    Lima, J.W. Marangon [Escola Federal de Engenharia de Itajuba, MG (Brazil); Gorenstin, B G; Vieira Filho, X [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil); Chipp, H J; Alvarenga Filho, S [ELETROBRAS, Rio de Janeiro, RJ (Brazil); Hirota, M [Companhia Energetica de Sao Paulo (CESP), SP (Brazil); Pereira, M V.F. [Power System Research, Inc., Rio de Janeiro, RJ (Brazil)

    1994-12-31

    This paper describes a methodology for allocating transmission costs among utilities and wheeling agents. The proposed approach is based on the extension of marginal cost theory to take into account discrete component sizes and economy of scale, while retaining desirable economic properties such as revenue reconciliation and incentives for all participants to remain in the pool. The methodology is illustrated in case studies with the Brazilian system. (author) 21 refs., 1 fig., 3 tabs.

  16. Comparison of Stability of the Results of Orthodontic Treatment and Gingival Health between Hawley and Vacuum-formed Retainers.

    Science.gov (United States)

    Moslemzadeh, Seyed H; Sohrabi, Aydin; Rafighi, Ali; Farshidnia, Somaieh

    2018-04-01

    Aim: Retention is one of the stages of orthodontic treatment, which is an attempt to retain teeth in their corrected positions after active treatment with the use of fixed orthodontic appliances. The aim of the present study was to compare the stability of the results of orthodontic treatment and the gingival health between Hawley retainer (HR) and vacuum-formed retainer (VFR) with two different thicknesses. Materials and methods: In this randomized clinical trial, 66 patients undergoing comprehensive orthodontic treatment in a private office were evaluated after completion of treatment. The subjects were randomly assigned to three groups. At the end of orthodontic treatment, the subjects in all the groups received a fixed bonded retainer in the mandible; in the maxilla, group I received an HR, group II received a VFR with a thickness of 1.5 mm, and group III received a VFR with a thickness of 1 mm. The American Board of Orthodontics objective grading system (ABO-OGS) index was used at the end of treatment (before the delivery of the retainers) and 6 months after the use of retainers to evaluate the stability of the results of orthodontic treatment. Gingival index (GI) was used at the two above-mentioned intervals to evaluate gingival health. The ABO-OGS measurements were carried out on dental casts by a clinician who was blinded to the types of retainers the patients wore. Data were analyzed with Statistical Package for the Social Sciences (SPSS) version 20, using proper statistical analyses. Results: Six months after the delivery of retainers, ABO-OGS and GI scores with the 1.5 mm VFR were higher than those in the two other groups, with no significant differences between the three groups. There were no significant differences between the ABO-OGS scores before the delivery of retainers and 6 months after the use of retainers in any of the study groups. In the HR and 1.5 mm VFR groups, there were significant differences in GI scores between the period before the

  17. Retainment of r-process material in dwarf galaxies

    Science.gov (United States)

    Beniamini, Paz; Dvorkin, Irina; Silk, Joe

    2018-04-01

    The synthesis of r-process elements is known to involve extremely energetic explosions. At the same time, recent observations find significant r-process enrichment even in extremely small ultra-faint dwarf (UFD) galaxies. This raises the question of retainment of those elements within their hosts. We estimate the retainment fraction and find that it is large ˜0.9, unless the r-process event is very energetic (≳ 1052erg) and / or the host has lost a large fraction of its gas prior to the event. We estimate the r-process mass per event and rate as implied by abundances in UFDs, taking into account imperfect retainment and different models of UFD evolution. The results are consistent with previous estimates (Beniamini et al. 2016b) and with the constraints from the recently detected macronova accompanying a neutron star merger (GW170817). We also estimate the distribution of abundances predicted by these models. We find that ˜0.07 of UFDs should have r-process enrichment. The results are consistent with both the mean values and the fluctuations of [Eu/Fe] in galactic metal poor stars, supporting the possibility that UFDs are the main 'building blocks' of the galactic halo population.

  18. animal trial on imaging appearances of abdominally retained gauze

    International Nuclear Information System (INIS)

    Wang Longxia; An Ningyu; Yin Hui; Wang Xiangdong; Li Jia; Bai Ying

    2000-01-01

    Objective: To evaluate the imaging appearances of abdominally retained crumpled gauze with US, CT and MRI and the changes with time. Methods: Eight rabbits were operated and crumpled gauze was put into in their abdominal cavity. US , plain and enhanced CT and MRI scan were performed on the day of operation, and 1 to 7 weeks after operation. The imaging appearances were compared with operation findings. Pathologic examination was done simultaneously. Results: Abdominally retained crumpled gauze was instantly adhesive with omentum and neighboring intestines tightly. Fibro-connective tissue membrane was produced at the adhesion site gradually, spreading out to enclose the crumpled gauze. The enclosure was finished completely in 3 to 4 weeks. Thickened membrane also invaded into the spaces within the gauze. The crumpled gauze was eventually infected. These changes could be revealed on US, CT or MRI scans. The US appearance exhibited a hyper echoic arc zone with broad clean acoustic shadow behind. It appeared as a soft tissue mass to CT and MRI scans. In early stage CT scan could easily show the gas within the crumpled gauze. CT and MRI enhanced scans showed only the enhanced membrane and no enhancement of the crumpled gauze. Conclusion: US, CT and MRI have quite characteristic appearances of the abdominally retained crumpled gauze, especially when combined imaging techniques were employed, which can lead to a correct diagnosis together with a history of operation

  19. 18 CFR 367.4360 - Account 436, Appropriations of retained earnings.

    Science.gov (United States)

    2010-04-01

    ..., Appropriations of retained earnings. 367.4360 Section 367.4360 Conservation of Power and Water Resources FEDERAL... NATURAL GAS ACT Retained Earnings Accounts § 367.4360 Account 436, Appropriations of retained earnings. This account must include appropriations of retained earnings as follows: (a) Appropriations required...

  20. The effect of retained intramedullary nails on tibial bone mineral density.

    Science.gov (United States)

    Allen, J C; Lindsey, R W; Hipp, J A; Gugala, Z; Rianon, N; LeBlanc, A

    2008-07-01

    Intramedullary nailing has become a standard treatment for adult tibial shaft fractures. Retained intramedullary nails have been associated with stress shielding, although their long-term effect on decreasing tibial bone mineral density is currently unclear. The purpose of this study was to determine if retained tibial intramedullary nails decrease tibial mineral density in patients with successfully treated fractures. Patients treated with statically locked intramedullary nails for isolated, unilateral tibia shaft fractures were studied. Inclusion required that fracture had healed radiographically and that the patient returned to the pre-injury activity level. Data on patient demographic, fracture type, surgical technique, implant, and post-operative functional status were tabulated. Dual energy X-ray absorptiometry was used to measure bone mineral density in selected regions of the affected tibia and the contralateral intact tibia. Image reconstruction software was employed to ensure symmetry of the studied regions. Twenty patients (mean age 43; range 22-77 years) were studied at a mean of 29 months (range 5-60 months) following intramedullary nailing. There was statistically significant reduction of mean bone mineral density in tibiae with retained intramedullary nails (1.02 g/cm(2) versus 1.06 g/cm(2); P=0.04). A significantly greater decrease in bone mineral density was detected in the reamed versus non-reamed tibiae (-7% versus +6%, respectively; P<0.05). The present study demonstrates a small, but statistically significant overall bone mineral density decrease in healed tibiae with retained nails. Intramedullary reaming appears to be a factor potentiating the reduction of tibia bone mineral density in long-term nail retention.

  1. [Retaining and transformation of incoming soil N from highland to adjacent terrestrial water body in riparian buffer zone].

    Science.gov (United States)

    Wang, Qing-cheng; Yu, Hong-li; Yao, Qin; Han, Zhuang-xing; Qiao, Shu-liang

    2007-11-01

    Highland soil nitrogen can enter adjacent water body via erosion and leaching, being one of the important pollutants in terrestrial water bodies. Riparian buffer zone is a transitional zone between highland and its adjacent water body, and a healthy riparian buffer zone can retain and transform the incoming soil N through physical, biological, and biochemical processes. In this paper, the major pathways through which soil nitrogen enters terrestrial water body and the mechanisms the nitrogen was retained and transformed in riparian buffer zone were introduced systematically, and the factors governing the nitrogen retaining and transformation were analyzed from the aspects of hydrological processes, soil characters, vegetation features, and human activities. The problems existing in riparian buffer zone study were discussed, and some suggestions for the further study in China were presented.

  2. Crystallography of lath martensite and stabilization of retained austenite

    Energy Technology Data Exchange (ETDEWEB)

    Sarikaya. M.

    1982-10-01

    TEM was used to study the morphology and crystallography of lath martensite in low and medium carbon steels in the as-quenched and 200/sup 0/C tempered conditions. The steels have microduplex structures of dislocated lath martensite and continuous thin films of retained austenite at the lath interfaces. Stacks of laths form the packets which are derived from different (111) variants of the same austenite grain. The residual parent austenite enables microdiffraction experiments with small electron beam spot sizes for the orientation relationships (OR) between austenite and martensite. All three most commonly observed ORs, namely Kurdjumov-Sachs, Nishiyama-Wassermann, and Greninger-Troiano, operate within the same sample.

  3. Crystallography of lath martensite and stabilization of retained austenite

    International Nuclear Information System (INIS)

    Sarikaya, M.

    1982-10-01

    TEM was used to study the morphology and crystallography of lath martensite in low and medium carbon steels in the as-quenched and 200 0 C tempered conditions. The steels have microduplex structures of dislocated lath martensite and continuous thin films of retained austenite at the lath interfaces. Stacks of laths form the packets which are derived from different [111] variants of the same austenite grain. The residual parent austenite enables microdiffraction experiments with small electron beam spot sizes for the orientation relationships (OR) between austenite and martensite. All three most commonly observed ORs, namely Kurdjumov-Sachs, Nishiyama-Wassermann, and Greninger-Troiano, operate within the same sample

  4. Spherical powder for retaining thermosetting acrylic resin veneers.

    Science.gov (United States)

    Tanaka, T; Atsuta, M; Uchiyama, Y; Nakabayashi, N; Masuhara, E

    1978-03-01

    1. Nine different sizes of spherical powder were prepared, and their effectiveness as retentive devices was evaluated against those available commercially. 2. Smaller-diameter spherical powder (No. 5) gave the best results of all retaining devices tested. 3. The physical properties of the resins play an important role in the retentive strength with No. 5 retention beads. The retentive strength was reduced when brittle resin was used. 4. The retentive strength of the resin veneer was greatly affected by the angle of stress at the incisal resin. The retentive strength increased as the angle between the longitudinal axis of the specimen and the direction of stress decreased.

  5. Total rewards that retain: A study of demographic preferences

    Directory of Open Access Journals (Sweden)

    Monica Pregnolato

    2017-01-01

    Full Text Available Orientation: Changing workplace demographics and a dearth of employees with scarce skills have forced employers to better understand the various factors that retain talented employees. Research purpose: In this empirical study, the reward preferences and ideal combination of total reward elements (based on an estimation of their relative importance that retain employees from various demographic groups, including employees of different race, gender and age groups, were investigated. Motivation for study: Organisations are competing for talented employees and to benefit from the value these individuals add, it is required of them to stay at the respective businesses. Previous studies have indicated that employees who are offered a reward package that is aligned to their personal preferences are prone to stay longer at the organisation and to be more engaged at work. However, new and novel ways need to be found to identify the reward preferences of employees. Research design, approach and method: A quantitative approach and descriptive research design was employed to estimate the individual reward preferences and identify an ideal mix of total reward elements that retain different cohorts of employees. Three questionnaires were distributed, including a Remuneration Managers Questionnaire (n = 7, a Remuneration Preference Questionnaire (n = 368 and a Choice-based Conjoint Task Questionnaire (n = 368. The latter two questionnaires were distributed as an online questionnaire to South African businesses and consisted of eight choice-based conjoint tasks, as well as a field survey. Main findings: The results of the choice-based conjoint analysis revealed that all respondents considered financial rewards (Benefits, Performance and Recognition, Remuneration, Career, in that order as relatively speaking, the most important components in their total rewards package that would lead to their retention. For most demographic groups, the remaining three places

  6. Retained sensitivity to cytotoxic pyrimidine nucleoside analogs in thymidine kinase 2 deficient human fibroblasts.

    Science.gov (United States)

    Bjerke, Mia; Solaroli, Nicola; Lesko, Nicole; Balzarini, Jan; Johansson, Magnus; Karlsson, Anna

    2010-01-01

    Thymidine kinase 2 (TK2) is a mitochondrial deoxyribonucleoside kinase that phosphorylates several nucleoside analogs used in anti-viral and anti-cancer therapy. A fibroblast cell line with decreased TK2 activity was investigated in order to obtain insights in the effects of TK2 deficiency on nucleotide metabolism. The role of TK2 for the sensitivity against cytotoxic nucleoside analogs was also investigated. The TK2 deficient cells retained their sensitivity against all pyrimidine nucleoside analogs tested. This study suggests that nucleoside analog phosphorylation mediated by TK2 may be less important, compared to other deoxyribonucleoside kinases, for the cytotoxic effects of these compounds.

  7. The paper of the forests like retainers of carbon, an experience in the south of Mexico

    International Nuclear Information System (INIS)

    De Jong, Ben H; Soto Pinto, Lorena; Montoya Gomez, Guillermo; Nelson, Kristen; Taylor John; Tipper, Richard

    1999-01-01

    The forests play an important paper in the global cycle of the carbon. At the moment, the deforestation is responsible for approximately 1.8GtC (gigatons of carbon), 20% of the global annual emissions of carbonic gas caused by the human activity. However, it is calculated that the reforestation could retain from 50 to 150 GtC along next 50 years. Concepts related with the retention of carbon are discussed. The necessity is commented of carrying out the regulation of an international market in retention of carbon with the purpose of being able to maintain acceptable norms in the reforestation projects that are executed under this program

  8. An appraisal of retained placentae in ibadan: a five year review.

    Science.gov (United States)

    Obajimi, G O; Roberts, A O; Aimakhu, C O; Bello, F A; Olayemi, O

    2009-06-01

    To determine the frequency of retained placenta at the University College Hospital Ibadan (UCH). and to describe the socio-demographic characteristics of the patients and examine the risk factors predisposing to retained placenta. This is a descriptive study covering a period of 5 years from January 1(st) 2002 to December 31(st) 2006. During the study period, 4980 deliveries took place at the University College Hospital, Ibadan and 106 cases of retained placenta were managed making the incidence 2.13 per cent of all births. During the five year period, there were 106 patients with retained placenta; of these, 90 (84.9%) case notes were available for analysis. The mean age was 29.37 ± 4.99 years. First and second Para accounted for 52 per cent of the patients. Majority of the patient were unbooked for antenatal care in UCH with booked patients accounting for 27.8 per cent of the cases. The mean gestational age at delivery was 34.29 ± 6.02. Three patients presented to the hospital in shock of which 2 died on account of severe haemorrhagic shock. Fifty-eight patients (64.8%) presented with anaemia (packed cell volume less than 30 per cent) and 35 patients (38.8%) had blood transfusion ranging between 1-4 pints. 1 patient required hysterectomy on account of morbidly adherent placenta. Eleven patients (12.2%) had placenta retention in the past, 28 patients (31%) had a previous dilatation and curettage, 14 patients (15.5%) had previous caesarean sections and 47 patients (41.3%) had no known predisposing factors. Retained placenta still remains a potentially life threatening condition in the tropics due to the associated haemorrhage, and other complications related to its removal. The incidence and severity may be decreased by health education, women empowerment and the provision of facilities for essential obstetric services by high skilled health care providers in ensuring a properly conducted delivery with active management of the third stage of labour.

  9. Retained austenite thermal stability in a nanostructured bainitic steel

    International Nuclear Information System (INIS)

    Avishan, Behzad; Garcia-Mateo, Carlos; Yazdani, Sasan; Caballero, Francisca G.

    2013-01-01

    The unique microstructure of nanostructured bainite consists of very slender bainitic ferrite plates and high carbon retained austenite films. As a consequence, the reported properties are opening a wide range of different commercial uses. However, bainitic transformation follows the T 0 criteria, i.e. the incomplete reaction phenomena, which means that the microstructure is not thermodynamically stable because the bainitic transformation stops well before austenite reaches an equilibrium carbon level. This article aims to study the different microstructural changes taking place when nanostructured bainite is destabilized by austempering for times well in excess of that strictly necessary to end the transformation. Results indicate that while bainitic ferrite seems unaware of the extended heat treatment, retained austenite exhibits a more receptive behavior to it. - Highlights: • Nanostructured bainitic steel is not thermodynamically stable. • Extensive austempering in these microstructures has not been reported before. • Precipitation of cementite particles is unavoidable at longer austempering times. • TEM, FEG-SEM and XRD analysis were used for microstructural characterization

  10. Retained austenite thermal stability in a nanostructured bainitic steel

    Energy Technology Data Exchange (ETDEWEB)

    Avishan, Behzad, E-mail: b_avishan@sut.ac.ir [Faculty of Materials Engineering, Sahand University of Technology, Tabriz (Iran, Islamic Republic of); Garcia-Mateo, Carlos, E-mail: cgm@cenim.csic.es [Department of Physical Metallurgy, National Centre for Metallurgical Research (CENIM-CSIC), MATERALIA Research Group, Avda. Gregorio del Amo, 8, 28040, Madrid (Spain); Yazdani, Sasan, E-mail: yazdani@sut.ac.ir [Faculty of Materials Engineering, Sahand University of Technology, Tabriz (Iran, Islamic Republic of); Caballero, Francisca G., E-mail: fgc@cenim.csic.es [Department of Physical Metallurgy, National Centre for Metallurgical Research (CENIM-CSIC), MATERALIA Research Group, Avda. Gregorio del Amo, 8, 28040, Madrid (Spain)

    2013-07-15

    The unique microstructure of nanostructured bainite consists of very slender bainitic ferrite plates and high carbon retained austenite films. As a consequence, the reported properties are opening a wide range of different commercial uses. However, bainitic transformation follows the T{sub 0} criteria, i.e. the incomplete reaction phenomena, which means that the microstructure is not thermodynamically stable because the bainitic transformation stops well before austenite reaches an equilibrium carbon level. This article aims to study the different microstructural changes taking place when nanostructured bainite is destabilized by austempering for times well in excess of that strictly necessary to end the transformation. Results indicate that while bainitic ferrite seems unaware of the extended heat treatment, retained austenite exhibits a more receptive behavior to it. - Highlights: • Nanostructured bainitic steel is not thermodynamically stable. • Extensive austempering in these microstructures has not been reported before. • Precipitation of cementite particles is unavoidable at longer austempering times. • TEM, FEG-SEM and XRD analysis were used for microstructural characterization.

  11. A new skeletal retention system for retaining anterior open bites

    Directory of Open Access Journals (Sweden)

    Bodore Albaker

    2013-01-01

    Full Text Available Objectives: Relapse of anterior open bite after treatment poses a challenge to orthodontists and warrants finding new methods. We aimed to compare the effect of a skeletal retention (SR system to the conventional retention (CR commonly used. Materials and Methods: Twenty patients participated in this study. SR group ten patients (five females and five males with mean age of 16.2 years, CR group ten patients (five females and five males with mean age of 17.1 years in pretreatment stage. The SR system is comprised of four self-drilling miniscrews and vacuum retainers with interarch elastics where the CR group is comprised of removable or fixed retainers. Pretreatment (T1, posttreatment (T2, and 1-year follow up (T3 lateral cephalograms were taken and analyzed to compare the stability of both retention modalities. Results: The overbite in the CR group showed more relapse in the form of significant reduction when compared to the SR group (P < 0.001. The overbite was reduced only by 0.1 mm (±0.3 in the SR group compared to 1.4 mm (±0.9 in the CR group. In the CR group, the upper incisors and first molar showed a more significant relapse compared to the SR group (P < 0.05. Conclusion: Skeletal retention using miniscrews and vertical elastic is an effective method for retention of anterior open bite cases.

  12. Arctic water tracks retain phosphorus and transport ammonium

    Science.gov (United States)

    Harms, T.; Cook, C. L.; Wlostowski, A. N.; Godsey, S.; Gooseff, M. N.

    2017-12-01

    Hydrologic flowpaths propagate biogeochemical signals among adjacent ecosystems, but reactions may attenuate signals by retaining, removing, or transforming dissolved and suspended materials. The theory of nutrient spiraling describes these simultaneous reaction and transport processes, but its application has been limited to stream channels. We applied nutrient spiraling theory to water tracks, zero-order channels draining Arctic hillslopes that contain perennially saturated soils and flow at the surface either perennially or in response to precipitation. In the Arctic, experimental warming results in increased availability of nitrogen, the limiting nutrient for hillslope vegetation at the study site, which may be delivered to aquatic ecosystems by water tracks. Increased intensity of rain events, deeper snowpack, earlier snowmelt, and increasing thaw depth resulting from climate change might support increased transport of nutrients, but the reactive capacity of hillslope flowpaths, including sorption and uptake by plants and microbes, could counter transport to regulate solute flux. Characteristics of flowpaths might influence the opportunity for reaction, where slower flowpaths increase the contact time between solutes and soils or roots. We measured nitrogen and phosphorus uptake and transient storage of water tracks through the growing season and found that water tracks retain inorganic phosphorus, but transport ammonium. Nutrient uptake was unrelated to transient storage, suggesting high capacity for nutrient retention by shallow organic soils and vegetation. These observations indicate that increased availability of ammonium, the biogeochemical signal of warming tundra, is propagated by hillslope flowpaths, whereas water tracks attenuate delivery of phosphorus to aquatic ecosystems, where its availability typically limits production.

  13. Salary is not enough to attract and retain the best

    Directory of Open Access Journals (Sweden)

    Rosa María Fuchs Ángeles

    2015-09-01

    Full Text Available Organizations face the challenge of attracting and retaining talented staff. In some instances, a reference to the existence of a war for talent is made. It is that way that the retention of workers has stopped being managed, exclusively, with the offer of good salaries. This paper explores, in a first instance, the theoretical framework that describes the principal tools of talent retention that companies develop, and that are considered as part of the total remuneration that workers receive: economic compensations, recognition, career plans and staff development, feedback, personal and professional life balance, social network and team making, proper relationship with superiors and organizational climate life. Later, the results that were obtained from interviews with ten of the best companies to work for in Peru, according to the Great Place to Work Institute ranking in 2007, on retaining talent tools that they implement are shown. Finally, conclusions on the case studies are presented.

  14. MULTIPLE RETAINED TEETH IN MANDIBLE: A Case Report

    Directory of Open Access Journals (Sweden)

    Cvetan Cvetanov

    2010-07-01

    Full Text Available Purpose: The aim of this science report is to show a rare case of multiple impacted teeth at adult patient and our propose clinical approach.Materials and methods: The clinical case is showed from adult man /64-year old/ with multiple impacted teeth (6 impacted teeth in the anterior place on the mandible were not suggestive of any syndrome or metabolic disorder. The extraction of the impacted teeth was made on two stage with piezosurgery unit under local anaesthesia. For prevention of postsurgical complications, as a swelling and prevention of postsurgical resorbtion were used coneshapes from pressure xeno colagen. To base on clinical and radiological examination we will discuss the differential diagnosis and we will offer a clinical approach about decided the case.Result and Conclusion: The incidence of multiple retained teeth by literature research range from 10.9% to 40.4%, most frequently is the retention of the third molars. In the literature most rarely have clinical reports about multiple retained teeth which differ from third molars at adult patients. The rare clinical case we showed is very demonstrative and the medicative approach which we used gave excellent result.

  15. USING BRANDING TO ATTRACT, RECRUIT, AND RETAIN TALENTED STAFF

    Directory of Open Access Journals (Sweden)

    Nicoleta Valentina FLOREA

    2011-01-01

    Full Text Available In this environment in continuous changing it is hard for organizations toattract and maintain the best candidates. The organizations use manymethods to recruit and hire, but now it is time to use the organization’s brandto attract talents the organization would like. This article will define theemployer brand as the organization’s image, as an exceptional place to workin the minds of the current employees as well as potential candidates, clients,customers, and stakeholders. The case study is made in six largeorganizations from Dambovita County, Romania, and describes how to usethe organization’s brand to attract, retain, and engage the people it needs. Imade a survey and the data collected I putted them in a model of analyzeand can be applied to any organization which wants to find out if it is usingcorrectly its strong powers to attract and retain the best candidates. Theemployer brand is the value proposition that organization conveys itsemployees and the external labor market. Great organizations create such astrong brand that it draws the talent to them rather than having to spendsignificant time and money on selling the organization to the talent market.Many benefits in the recruiting world are provided by a strong employmentbrand.

  16. Acquisition and Retaining Granular Samples via a Rotating Coring Bit

    Science.gov (United States)

    Bar-Cohen, Yoseph; Badescu, Mircea; Sherrit, Stewart

    2013-01-01

    This device takes advantage of the centrifugal forces that are generated when a coring bit is rotated, and a granular sample is entered into the bit while it is spinning, making it adhere to the internal wall of the bit, where it compacts itself into the wall of the bit. The bit can be specially designed to increase the effectiveness of regolith capturing while turning and penetrating the subsurface. The bit teeth can be oriented such that they direct the regolith toward the bit axis during the rotation of the bit. The bit can be designed with an internal flute that directs the regolith upward inside the bit. The use of both the teeth and flute can be implemented in the same bit. The bit can also be designed with an internal spiral into which the various particles wedge. In another implementation, the bit can be designed to collect regolith primarily from a specific depth. For that implementation, the bit can be designed such that when turning one way, the teeth guide the regolith outward of the bit and when turning in the opposite direction, the teeth will guide the regolith inward into the bit internal section. This mechanism can be implemented with or without an internal flute. The device is based on the use of a spinning coring bit (hollow interior) as a means of retaining granular sample, and the acquisition is done by inserting the bit into the subsurface of a regolith, soil, or powder. To demonstrate the concept, a commercial drill and a coring bit were used. The bit was turned and inserted into the soil that was contained in a bucket. While spinning the bit (at speeds of 600 to 700 RPM), the drill was lifted and the soil was retained inside the bit. To prove this point, the drill was turned horizontally, and the acquired soil was still inside the bit. The basic theory behind the process of retaining unconsolidated mass that can be acquired by the centrifugal forces of the bit is determined by noting that in order to stay inside the interior of the bit, the

  17. Treatment of retained placenta with misoprostol: a randomised controlled trial in a low-resource setting (Tanzania

    Directory of Open Access Journals (Sweden)

    Fauteck Heiner

    2009-10-01

    Full Text Available Abstract Background Retained placenta is one of the common causes of maternal mortality in developing countries where access to appropriate obstetrical care is limited. Current treatment of retained placenta is manual removal of the placenta under anaesthesia, which can only take place in larger health care facilities. Medical treatment of retained placenta with prostaglandins E1 (misoprostol could be cost-effective and easy-to-use and could be a life-saving option in many low-resource settings. The aim of this study is to assess the efficacy and safety of sublingually administered misoprostol in women with retained placenta in a low resource setting. Methods Design: Multicentered randomised, double-blind, placebo-controlled trial, to be conducted in 5 hospitals in Tanzania, Africa. Inclusion criteria: Women with retained placenta, at a gestational age of 28 weeks or more and blood loss less than 750 ml, 30 minutes after delivery of the newborn despite active management of third stage of labour. Trial Entry & Randomisation & Study Medication: After obtaining informed consent, eligible women will be allocated randomly to the treatment groups using numbered envelopes that will be randomized in variable blocks containing identical capsules with either 800 microgram of misoprostol or placebo. The drugs will be given sublingually. The women, maternal care providers and researchers will be blinded to treatment allocation. Sample Size: 117 women, to show a 40% reduction in manual removals of the placenta (p = 0.05, 80% power. The randomization will be misoprostol: placebo = 2:1 Primary Study Outcome: Expulsion of the placenta without manual removal. Secondary outcome is the number of blood transfusions. Discussion This is a protocol for a randomized trial in a low resource setting to assess if medical treatment of women with retained placenta with misoprostol reduces the incidence of manual removal of the placenta. Clinical Trial Registration Current

  18. Ignalina RBMK-1500 building capability in retaining radioactive releases

    International Nuclear Information System (INIS)

    Nilsson, Lars; Johansson, K.

    1993-01-01

    The Ignalina reactor building structures are capable of retaining substantial fractions of radioactive emissions from the fuel core, in those accident sequences where pressurization failure of structures can be averted by pressure relief arrangements. In stage 1 of the IBBA project it was demonstrated that enhanced retention of radioactive fission products within the plant can be achieved if natural convection is facilitated in the upper building compartments. In this report of stage 2 is discussed for which accident sequences the introduction of natural convection in combination with the existing forced convection ventilation and the accident localization system can improve the total safety of Ignalina 1-2. The purpose of this stage is to provide a basis for further review and more detailed studies of the natural convection concept, its benefits and disadvantages, and of the feasability to introduce the concept in existing plants

  19. Teeth in the Line of Fracture: To Retain or Remove?

    Science.gov (United States)

    Samson, Jimson; John, Reena; Jayakumar, Shalini

    2010-01-01

    The purpose of this study was to analyze mandibular fracture site, relationship of the fracture line to the periodontium, vitality of teeth, displacement of the fracture segments and their implications, and determine whether to retain or remove the teeth in the fracture line. Fifty patients with 62 fractures were involved in this study. An electric pulp tester was used to measure the pulpal response. The degree of fracture displacement and the relationship of the fracture line to the periodontium were evaluated using panoramic radiographs. Fractures of the parasymphysis region constituted a majority of 60.87% in the gross displacement category. Four of 50 patients showed no response presurgically and minimal response postoperatively on pulp vitality testing. Patients with teeth in the fracture line showing no response on pulp vitality testing should be advised extraction to avoid further complications. PMID:22132255

  20. Apparatus and Process for Controlled Nanomanufacturing Using Catalyst Retaining Structures

    Science.gov (United States)

    Nguyen, Cattien (Inventor)

    2013-01-01

    An apparatus and method for the controlled fabrication of nanostructures using catalyst retaining structures is disclosed. The apparatus includes one or more modified force microscopes having a nanotube attached to the tip portion of the microscopes. An electric current is passed from the nanotube to a catalyst layer of a substrate, thereby causing a localized chemical reaction to occur in a resist layer adjacent the catalyst layer. The region of the resist layer where the chemical reaction occurred is etched, thereby exposing a catalyst particle or particles in the catalyst layer surrounded by a wall of unetched resist material. Subsequent chemical vapor deposition causes growth of a nanostructure to occur upward through the wall of unetched resist material having controlled characteristics of height and diameter and, for parallel systems, number density.

  1. Intravitreal Phacoemulsification Using Torsional Handpiece for Retained Lens Fragments.

    Science.gov (United States)

    Kumar, Vinod; Takkar, Brijesh

    2016-01-01

    To evaluate the results of intravitreal phacoemulsification with torsional hand piece in eyes with posteriorly dislocated lens fragments. In this prospective, interventional case series, 15 eyes with retained lens fragments following phacoemulsification were included. All patients underwent standard three-port pars plana vitrectomy and intravitreal phacoemulsification using sleeveless, torsional hand piece (OZiL™, Alcon's Infiniti Vision System). Patients were followed up for a minimum of six months to evaluate the visual outcomes and complications. The preoperative best-corrected visual acuity (BCVA) ranged from light perception to 0.3. No complications such as thermal burns of the scleral wound, retinal damage due to flying lens fragments, or difficult lens aspiration occurred during intravitreal phacoemulsification. Mean post-operative BCVA at the final follow-up was 0.5. Two eyes developed cystoid macular edema, which was managed medically. No retinal detachment was noted. Intravitreal phacoemulsification using torsional hand piece is a safe and effective alternative to conventional longitudinal phacofragmentation.

  2. Retainment of the antimicrobial agent triclosan in a septic tank.

    Science.gov (United States)

    Kirjanova, Ala; Rimeika, Mindaugas; Vollertsen, Jes; Nielsen, Asbjørn Haaning

    2014-01-01

    Laboratory experiments were conducted to investigate the fate of the antimicrobial agent triclosan (TCS) in a conventional septic tank. The main mechanism of TCS removal from wastewater was identified to be rapid TCS sorption to suspended particles followed by settling of these particles to the bottom of the septic tank. Sorption to particles was completed within minutes while the settling took several days. Therefore, in a septic tank the removal of TCS from wastewater is mainly determined by the removal of suspended particles by sedimentation. Over 5 days of hydraulic residence time the initial dissolved TCS concentration of 100 μg L(-1) was reduced by 87 ± 8%. During the first 24 hours, 66-86% of all removed TCS was retained, whereas during the remainder of the experiment a slight but steady decrease in TCS concentration was observed. This was most likely caused by TCS diffusion and its subsequent sorption onto the septic sludge.

  3. Analysis of the Retained Gas Sample (RGS) Extruder Assembly

    International Nuclear Information System (INIS)

    Coverdell, B.L.

    1995-09-01

    In order for the Retained Gas Sample (RGS) Extruder Assembly to be safely used it was determined by the cognizant engineer that analysis was necessary. The use of the finite-element analysis (FEA) progarm COSMOS/M version 1.71 permitted a quick, easy, and detailed stress analysis of the RGS Extruder Assembly. The FEA model is a three dimensional model using the SHELL4T element type. From the results of the FEA, the cognizant engineer determined that the RGS extruder would be rated at 10,000 lbf and load tested to 12,000 lbf. The respective input and output files for the model are EXTR02.GFM and EXTR02.OUT and can be found on the attached tape

  4. The aging nursing workforce: How to retain experienced nurses.

    Science.gov (United States)

    Cohen, Jeremye D

    2006-01-01

    In the face of an anticipated nursing shortage, healthcare organizations must evaluate their culture, operations, and compensation system to ensure that these elements align with organizational efforts to retain nurses who are approaching retirement age. Management should focus on enhancing elements of job satisfaction and job embeddedness that will motivate nurses to remain both in the workforce and with their employer. Although much of this responsibility falls on the nurse manager, nurse managers are often not provided the necessary support by top management and are neither recognized nor held accountable for nurse turnover. Other retention initiatives can include altering working conditions to reduce both physical and mental stress and addressing issues of employee health and safety. As for compensation, organizations may be well-served by offering senior nursing staff flexible working hours, salary structures that reward experience, and benefit programs that hold value for an aging workforce.

  5. Language comprehenders retain implied shape and orientation of objects.

    Science.gov (United States)

    Pecher, Diane; van Dantzig, Saskia; Zwaan, Rolf A; Zeelenberg, René

    2009-06-01

    According to theories of embodied cognition, language comprehenders simulate sensorimotor experiences to represent the meaning of what they read. Previous studies have shown that picture recognition is better if the object in the picture matches the orientation or shape implied by a preceding sentence. In order to test whether strategic imagery may explain previous findings, language comprehenders first read a list of sentences in which objects were mentioned. Only once the complete list had been read was recognition memory tested with pictures. Recognition performance was better if the orientation or shape of the object matched that implied by the sentence, both immediately after reading the complete list of sentences and after a 45-min delay. These results suggest that previously found match effects were not due to strategic imagery and show that details of sensorimotor simulations are retained over longer periods.

  6. Recruiting and retaining low-income Latinos in psychotherapy research.

    Science.gov (United States)

    Miranda, J; Azocar, F; Organista, K C; Muñoz, R F; Lieberman, A

    1996-10-01

    This article offers suggestions for recruiting and retaining low-income Latinos in treatment studies. Because Latinos underuse traditional mental health services, places such as medical centers or churches with large Latino constituents are suggested as useful alternative sources. To keep Latinos in research protocols, providing culturally sensitive treatments are necessary. Culturally sensitive treatments should incorporate families as part of recruitment efforts, particularly older men in the family. In addition, showing respect is an important aspect of traditional Latino culture that includes using formal titles and taking time to listen carefully. Finally, traditional Latinos tend to like interactions with others that are more warm and personal than is generally part of a research atmosphere.

  7. Tightening techniques for the retaining screws of universal abutment

    Directory of Open Access Journals (Sweden)

    Alexandre Wittcinski REGALIN

    Full Text Available Abstract Purpose This study evaluated the torque maintenance of universal abutment retaining screws using different tightening techniques, and coated or uncoated screws. Material and method The screws were tightened to implants as following: Control – 32 Ncm torque; H20 – holding 32 Ncm torque for 20 s; R – 32 Ncm torque, repeated after 10 min (retorque; and H20+R – combining the two tightening techniques. Titanium and coated screws were also evaluated. Result Statistical analysis showed higher maintained torque for titanium screws (p<0.001. The H20+R technique showed the highest maintained torque (p=0.003, but the H20 technique’s maintained torque was similar. Conclusion Titanium screws associating the two tightening techniques can improve maintained torque.

  8. Recruiting and retaining high-quality teachers in rural areas.

    Science.gov (United States)

    Monk, David H

    2007-01-01

    In examining recruitment and retention of teachers in rural areas, David Monk begins by noting the numerous possible characteristics of rural communities--small size, sparse settlement, distance from population concentrations, and an economic reliance on agricultural industries that are increasingly using seasonal and immigrant workers to minimize labor costs. Many, though not all, rural areas, he says, are seriously impoverished. Classes in rural schools are relatively small, and teachers tend to report satisfaction with their work environments and relatively few problems with discipline. But teacher turnover is often high, and hiring can be difficult. Monk observes that rural schools have a below-average share of highly trained teachers. Compensation in rural schools tends to be low, perhaps because of a lower fiscal capacity in rural areas, thus complicating efforts to attract and retain teachers. Several student characteristics, including relatively large shares of students with special needs and with limited English skills and lower shares of students attending college, can also make it difficult to recruit and retain high-quality teachers. Other challenges include meeting the needs of highly mobile children of low-income migrant farm workers. With respect to public policy, Monk asserts a need to focus on a subcategory of what might be called hard-to-staff rural schools rather than to develop a blanket set of policies for all rural schools. In particular, he recommends a focus on such indicators as low teacher qualifications, teaching in fields far removed from the area of training, difficulty in hiring, high turnover, a lack of diversity among teachers in the school, and the presence of migrant farm workers' children. Successful efforts to stimulate economic growth in these areas would be highly beneficial. He also calls attention to the potential for modern telecommunication and computing technologies to offset some of the drawbacks associated with teaching

  9. Reliability Coupled Sensitivity Based Design Approach for Gravity Retaining Walls

    Science.gov (United States)

    Guha Ray, A.; Baidya, D. K.

    2012-09-01

    Sensitivity analysis involving different random variables and different potential failure modes of a gravity retaining wall focuses on the fact that high sensitivity of a particular variable on a particular mode of failure does not necessarily imply a remarkable contribution to the overall failure probability. The present paper aims at identifying a probabilistic risk factor ( R f ) for each random variable based on the combined effects of failure probability ( P f ) of each mode of failure of a gravity retaining wall and sensitivity of each of the random variables on these failure modes. P f is calculated by Monte Carlo simulation and sensitivity analysis of each random variable is carried out by F-test analysis. The structure, redesigned by modifying the original random variables with the risk factors, is safe against all the variations of random variables. It is observed that R f for friction angle of backfill soil ( φ 1 ) increases and cohesion of foundation soil ( c 2 ) decreases with an increase of variation of φ 1 , while R f for unit weights ( γ 1 and γ 2 ) for both soil and friction angle of foundation soil ( φ 2 ) remains almost constant for variation of soil properties. The results compared well with some of the existing deterministic and probabilistic methods and found to be cost-effective. It is seen that if variation of φ 1 remains within 5 %, significant reduction in cross-sectional area can be achieved. But if the variation is more than 7-8 %, the structure needs to be modified. Finally design guidelines for different wall dimensions, based on the present approach, are proposed.

  10. Complete overdentures retained by mini implants: A systematic review.

    Science.gov (United States)

    Lemos, Cleidiel Aparecido Araujo; Verri, Fellippo Ramos; Batista, Victor Eduardo de Souza; Júnior, Joel Ferreira Santiago; Mello, Caroline Cantieri; Pellizzer, Eduardo Piza

    2017-02-01

    The purpose of this systematic review was to evaluate the use of mini implants to retain complete overdentures in terms of survival rates of mini implants, marginal bone loss, satisfaction, and quality of life. This report followed the PRISMA Statement and PICO question. This review has been registered at PROSPERO under the number CRD42016036141. Two independent reviewers performed a comprehensive search of studies published until September 2016 and listed in the PubMed/MEDLINE, Embase, and The Cochrane Library databases. The focused question was: is the use of mini implants feasible for prosthodontic rehabilitation with complete overdentures? The 24 studies selected for review evaluated 1273 patients whose mean age was 65.93 years; these patients had received 2494 mini implants and 386 standard implants for retaining overdenture prosthesis. The mean follow-up time was 2.48 years (range: 1-7 years). There was a higher survival rate of mini implants (92.32%). More frequent failures for maxillary (31.71%) compared with mandibular arches (4.89%). The majority of studies revealed marginal bone loss values similar to those of standard implants (overdenture prosthesis is considered an alternative treatment when standard treatment is not possible, since it presents high survival rates, acceptable marginal bone loss, and improvements in variables related to satisfaction and quality of life. Based on the results of this study, the use of a minimum 4 and 6 mini implants can be considered a satisfactory treatment option for rehabilitation of the mandibular and maxillary arches respectively with a complete overdenture. Copyright © 2016. Published by Elsevier Ltd.

  11. Long-term effectiveness of canine-to-canine bonded flexible spiral wire lingual retainers

    NARCIS (Netherlands)

    Renkema, Anne-Marie; Renkema, Alianne; Bronkhorst, Ewald; Katsaros, Christos

    Introduction: The flexible spiral wire (FSW) canine-to-canine lingual retainer bonded to all 6 anterior teeth is a frequently used type of mandibular fixed retainer. This study aimed to assess the long-term effectiveness of FSW canine-to-canine lingual retainers in maintaining the alignment of the

  12. Long-term effectiveness of canine-to-canine bonded flexible spiral wire lingual retainers

    NARCIS (Netherlands)

    Renkema, A.M.; Bronkhorst, E.M.; Katsaros, C.

    2011-01-01

    INTRODUCTION: The flexible spiral wire (FSW) canine-to-canine lingual retainer bonded to all 6 anterior teeth is a frequently used type of mandibular fixed retainer. This study aimed to assess the long-term effectiveness of FSW canine-to-canine lingual retainers in maintaining the alignment of the

  13. 18 CFR 367.4390 - Account 439, Adjustments to retained earnings.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Account 439, Adjustments to retained earnings. 367.4390 Section 367.4390 Conservation of Power and Water Resources FEDERAL... NATURAL GAS ACT Retained Earnings Accounts § 367.4390 Account 439, Adjustments to retained earnings. (a...

  14. 21 CFR 882.4800 - Self-retaining retractor for neurosurgery.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Self-retaining retractor for neurosurgery. 882...-retaining retractor for neurosurgery. (a) Identification. A self-retaining retractor for neurosurgery is a self-locking device used to hold the edges of a wound open during neurosurgery. (b) Classification...

  15. [Knowledge retain of BLS and BLS-D theoretical contents in a long-term follow-up].

    Science.gov (United States)

    Paolini, Enrico; Conti, Elettra; Guerra, Federico; Capucci, Alessandro

    2018-03-01

    Despite the many recent improvements in basic life support (BLS) and the widespread training to a great number of lay rescuers, out-of-hospital cardiac arrest (OHCA) is still a major cause of death. Nowadays, BLS teaching protocols ask for many concepts to be learned and specific algorithms to be applied, without any available data on how much all these inputs are retained by the students. The present survey aims to evaluate how BLS is really retained by those rescuers (laypersons and nurses) who do not often put it into practice. The first survey was targeted at laypersons who are responsible for security in their work environment. The second survey was targeted at nurses operating in low-intensity wards or out-of-hospital clinics. Both surveys were anonymous and asked specific questions aimed at evaluating how BLS/BLS-D (BLS and defibrillation) information was retained on an average of 3 years after training completion. Lay rescuers showed difficulties in recognizing specific signs of OHCA, were unsure on when to call the emergency medical service and retained few and sometime erroneous information on the correct BLS sequence to perform. The nurses operating in low-intensity settings performed better in terms of OHCA recognition and advanced medical assistance activation, while how to set and operate an automatic external defibrillation was seldom clear. BLS information is usually not retained after a 3-year follow-up by people who are not involved in OHCA management as part of their everyday job. It should be useful to lower the number of concepts taught in current BLS courses in order to focus on the most significant aspects of it, such as prompt emergency medical system activation and early defibrillation.

  16. Forms of newly retained phosphorus in mineral soils

    Directory of Open Access Journals (Sweden)

    Armi Kaila

    1964-01-01

    Full Text Available The distribution of soluble phosphate in various fractions of soil phosphorus was studied by treating 1 g-samples of 180 mineral soils with 50 ml of a KH2PO4- solution containing P 5 mg/l for 24 hours, and carrying out the fractionation by the method of CHANG and JACKSON after the solution was removed and the moist samples had stood for 3 days at room temperature. The amount of retained phosphorus in the different fractions was computed by taking the difference between the treated and check samples. In the 70 samples of clay soils, the mean proportion of the retained phosphorus was 57 per cent of the 250 mg/kg applied, in the 62 samples of the sand and fine sand soils the corresponding part was 45 per cent, and in the 48 samples of loam and silt soils it was 44 per cent. The higher retention in the clay soils was mainly due to a higher retention in the alkali-soluble fraction. The net increase in the fluoride-soluble forms was of the same order in these three soil groups. On the average, more than 95 per cent of the sorbed phosphorus was found in the fluoride-soluble and alkali-soluble fractions. In one third of the samples a low net increase in the acid soluble fraction was detected, but this may be partly due to changes in the solubility of the native phosphorus in the treated samples. Owing to the fairly large variation, the tendency to somewhat higher mean values for the sorption in the subsoils compared with those of the topsoils was not statistically significant. The ratio between the sorbed amounts of fluoride-soluble and alkali soluble forms was higher in the sand and fine sand soils than in the clay soils. Only in 15 samples, most of them Litorina-soils, the net increase in the alkali-soluble forms was higher than in the fluoride-soluble fraction. Probably, because an equilibrium in the phosphorus conditions was not yet reached at the end of the treatment, the attempt failed to find any clear connection between the distribution of the

  17. Bioaccumulation and elimination of {sup 60} Co and {sup 137} Cs by Anomalocardia brasiliana (Gmelin, 1791) (Mollusca bivalvia). Remobilization of {sup 60} Co, retained in marine sediment by microbial activity; Bioacumulacao e eliminacao de {sup 60}Co e {sup 137}Cs por anomalocardia brasiliana (Gmelin, 1791) (Mollusca bivalvia). Remobilizacao de {sup 60}Co retido em sedimento marinho por atividade microbiana

    Energy Technology Data Exchange (ETDEWEB)

    Mayr, L M

    1984-05-01

    It was studied the capacity of a bi valve mollusc Anomalocardia brasiliana, which lives in the local bottom sediment, to remobilize {sup 60} Co previously sorbed in the sediment. Laboratory experiments demonstrated that the transference of {sup 60} Co from the sediment to the animal was insignificant (bioaccumulation factor (BF) of the order of 10{sup -3}). At the same time, the capacity of microorganisms, present in the bottom sediment, to remobilize {sup 60} Co was studied. The results showed that this via of transference was important, considering the much greater microorganism biomass in relation to the biomass of bentonic organisms, as a whole. For {sup 137} Cs the determined BF from water to the animal was 2.2. and, as in the case of {sup 60} Co, the soft tissues concentrated more {sup 137} Cs than shell. Remaining viscera showed the highest BFs. In another series of experiments, the loss of {sup 60} Co or {sup 137} Cs, previously accumulated by A. brasiliana, was followed in aquaria with or without sediment and the respective biological half-lives were calculated. Soft tissues retained {sup 60} Co longer (biological half-life = 117 days) than shells, whereas for {sup 137} Cs the opposite was observed and shells showed a biological half life of 38.5 days. The low values of {sup 60} Co and {sup 137} Cs BF{sub S} do not allow to classify A. brasiliana as good biological indicator for pollution by there radionuclides. However since A brasiliana is consumed by the local population and is commercialized to other areas, it was recommended that its contamination by {sup 60} Co or {sup 137} Cs should be monitored. (author).

  18. Ion beam analysis of hydrogen retained in carbon nanotubes and carbon films

    International Nuclear Information System (INIS)

    McDaniel, F.D.; Holland, O.W.; Naab, F.U.; Mitchell, L.J.; Dhoubhadel, M.; Duggan, J.L.

    2006-01-01

    Carbon nanotubes (CNTs) are studied as a possible hydrogen storage medium for future energy needs. Typically, hydrogen is stored in the CNTs by exposure of the material to a high-pressure H 2 atmosphere at different temperatures. The maximum hydrogen concentrations stored following this method and measured using ion beam analysis do not exceed 1 wt.%. Introduction of defects by ion irradiation (i.e. implantation) prior to high-pressure H 2 treatment, offers an alternative method to activate H adsorption and enhance the chemisorption of hydrogen. This is a preliminary work where hydrogen was introduced into single-wall nanotubes and carbon films by low-energy (13.6 keV) hydrogen ion implantation. Elastic recoil detection was used to measure the quantity and depth distribution of hydrogen retained in the carbonaceous materials. Results show that there are substantial differences in the measured profiles between the CNT samples and the vitreous carbon. On another hand, only ∼43% of the implanted hydrogen in the CNTs is retained in the region where it should be located according to the SRIM simulations for a solid carbon sample

  19. Effect of plastic soil on a retaining wall subjected to surcharge loading

    Directory of Open Access Journals (Sweden)

    Al-Juari Khawla

    2016-01-01

    Full Text Available The seasonal variation and climatic changes play a significant role that affects the stresses exerted on a retaining wall, and the state of stresses in the soil mass behind the wall especially for highly expansive soil. These stresses resulted in the wall moving either away or towards the soil. In this study, a laboratory physical model of the retaining wall formed of a box having (950×900×600 mm dimensions with one side representing the wall being developed. After the soil being laid out in the box in specified layers, specified conditions of saturation and normal stresses were applied. The wall is allowed to move horizontally in several distances (0.1, 0.2, 0.3, 0.6, 0.8, 1.0 , 2.0, 3.0 and 4.0 mm, and the stresses being measured, then the vertical loading was released. The main measured variables during the tests are; the active and passive earth pressures, vertical movement of the soil, total suction and time. Results showed that the lateral earth pressure along the depth of the wall largely decreased when wall moved away from the soil. Total suction was slightly affected during wall’s movement. At unloading stage, the lateral earth pressure decreased at the upper half of wall height, but increased at the other wall part. Total suction was increased at all depths during this stage.

  20. Six-year clinical outcome of single implant-retained mandibular overdentures--a pilot study.

    Science.gov (United States)

    Passia, Nicole; Wolfart, Stefan; Kern, Matthias

    2015-10-01

    The aim of this prospective pilot study was to evaluate the prosthodontic maintenance as well as the implant outcome of single implant-retained mandibular overdentures over an observation period of 6 years. Eleven edentulous patients received one single implant in the midline of the mandible. Denture bases were temporarily relined and 2 months later provided with a ball attachment for implant retention. Implant related parameters and prosthodontic maintenance interventions were assessed 4 weeks after implant loading and then once a year. Over a mean observation period of 75.9 months, no implant was lost. The most frequent prosthetic maintenance intervention was activation of the matrix due to loss of retention, followed by exchange of the female part. Eight denture bases had to be repaired after a fracture in the midline area. Within the limitations of this preliminary clinical study, the concept of a single midline implant to retain a mandibular complete denture was a successful treatment option for elderly edentulous patients. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  1. Tumor-Initiating Label-Retaining Cancer Cells in Human Gastrointestinal Cancers Undergo Asymmetric Cell Division

    Science.gov (United States)

    Xin, Hong-Wu; Hari, Danielle M.; Mullinax, John E.; Ambe, Chenwi M.; Koizumi, Tomotake; Ray, Satyajit; Anderson, Andrew J.; Wiegand, Gordon W.; Garfield, Susan H.; Thorgeirsson, Snorri S.; Avital, Itzhak

    2012-01-01

    Label-retaining cells (LRCs) have been proposed to represent adult tissue stem cells. LRCs are hypothesized to result from either slow cycling or asymmetric cell division (ACD). However, the stem cell nature and whether LRC undergo ACD remain controversial. Here, we demonstrate label-retaining cancer cells (LRCCs) in several gastrointestinal (GI) cancers including fresh surgical specimens. Using a novel method for isolation of live LRCC, we demonstrate that a subpopulation of LRCC is actively dividing and exhibits stem cells and pluripotency gene expression profiles. Using real-time confocal microscopic cinematography, we show live LRCC undergoing asymmetric nonrandom chromosomal cosegregation LRC division. Importantly, LRCCs have greater tumor-initiating capacity than non-LRCCs. Based on our data and that cancers develop in tissues that harbor normal-LRC, we propose that LRCC might represent a novel population of GI stem-like cancer cells. LRCC may provide novel mechanistic insights into the biology of cancer and regenerative medicine and present novel targets for cancer treatment. PMID:22331764

  2. Do we really understand how to retain nurses?

    Science.gov (United States)

    O'Brien-Pallas, Linda; Duffield, Christine; Hayes, Laureen

    2006-05-01

    To compare views of nurse executives with those of nurses who have left the profession on the importance of retention strategies. Although much has been written about nursing turnover, there continues to be dissonance among decision makers as to why nurses leave the profession and what the most crucial issues are for retention. Factor analysis was undertaken to compare responses of nurse executives with those of nurses employed outside of nursing. Contract requirements represented the greatest discrepancy, 1.07, followed by legal and employer issues, 1.02; worklife/homelife balance, 0.91; external values and beliefs about nursing, 0.75; and professional practice, 0.29. A disparity exists between perceptions of nurse executives and those of nurses who have left the profession as to which issues are most critical in retention. We suggest that nurse executives ensure sufficient organizational support for nursing unit managers who are more likely to understand methods of retaining nurses at the clinical interface.

  3. Leading a multigenerational workforce: strategies for attracting and retaining millennials.

    Science.gov (United States)

    Cahill, Terrence F; Sedrak, Mona

    2012-01-01

    Over the past several years, leaders in healthcare have noticed an increase in generational tension among employees, most often focused on the attitudes and behaviors of the arriving millennials (generation Y). While these employee relations issues were a nuisance, they rarely rose to the level of a priority demanding leadership intervention. Some leaders, in fact, hoped that the issues would resolve themselves as these young employees settled in and learned that they had to demonstrate new behaviors to be successful in the workplace. Most organizations adopted this wait-and-see attitude. Not so today. As the boomer generation has begun its exodus from the workplace, organizations are increasingly looking at the millennials as not a problem but a solution to the workplace manpower transition that is under way. Our problem is that we don't yet know how best to lead such a diverse, multigenerational workforce. This article examines the generational topic and provides advice concerning a variety of changes that leaders may implement to advance their organization's ability to attract and to retain the millennials.

  4. Automated identification of retained surgical items in radiological images

    Science.gov (United States)

    Agam, Gady; Gan, Lin; Moric, Mario; Gluncic, Vicko

    2015-03-01

    Retained surgical items (RSIs) in patients is a major operating room (OR) patient safety concern. An RSI is any surgical tool, sponge, needle or other item inadvertently left in a patients body during the course of surgery. If left undetected, RSIs may lead to serious negative health consequences such as sepsis, internal bleeding, and even death. To help physicians efficiently and effectively detect RSIs, we are developing computer-aided detection (CADe) software for X-ray (XR) image analysis, utilizing large amounts of currently available image data to produce a clinically effective RSI detection system. Physician analysis of XRs for the purpose of RSI detection is a relatively lengthy process that may take up to 45 minutes to complete. It is also error prone due to the relatively low acuity of the human eye for RSIs in XR images. The system we are developing is based on computer vision and machine learning algorithms. We address the problem of low incidence by proposing synthesis algorithms. The CADe software we are developing may be integrated into a picture archiving and communication system (PACS), be implemented as a stand-alone software application, or be integrated into portable XR machine software through application programming interfaces. Preliminary experimental results on actual XR images demonstrate the effectiveness of the proposed approach.

  5. Intravitreal Phacoemulsification Using Torsional Handpiece for Retained Lens Fragments

    Science.gov (United States)

    Kumar, Vinod; Takkar, Brijesh

    2016-01-01

    Purpose: To evaluate the results of intravitreal phacoemulsification with torsional hand piece in eyes with posteriorly dislocated lens fragments. Methods: In this prospective, interventional case series, 15 eyes with retained lens fragments following phacoemulsification were included. All patients underwent standard three-port pars plana vitrectomy and intravitreal phacoemulsification using sleeveless, torsional hand piece (OZiL™, Alcon's Infiniti Vision System). Patients were followed up for a minimum of six months to evaluate the visual outcomes and complications. Results: The preoperative best-corrected visual acuity (BCVA) ranged from light perception to 0.3. No complications such as thermal burns of the scleral wound, retinal damage due to flying lens fragments, or difficult lens aspiration occurred during intravitreal phacoemulsification. Mean post-operative BCVA at the final follow-up was 0.5. Two eyes developed cystoid macular edema, which was managed medically. No retinal detachment was noted. Conclusion: Intravitreal phacoemulsification using torsional hand piece is a safe and effective alternative to conventional longitudinal phacofragmentation. PMID:27621783

  6. Grass Plants Bind, Retain, Uptake, and Transport Infectious Prions

    Directory of Open Access Journals (Sweden)

    Sandra Pritzkow

    2015-05-01

    Full Text Available Prions are the protein-based infectious agents responsible for prion diseases. Environmental prion contamination has been implicated in disease transmission. Here, we analyzed the binding and retention of infectious prion protein (PrPSc to plants. Small quantities of PrPSc contained in diluted brain homogenate or in excretory materials (urine and feces can bind to wheat grass roots and leaves. Wild-type hamsters were efficiently infected by ingestion of prion-contaminated plants. The prion-plant interaction occurs with prions from diverse origins, including chronic wasting disease. Furthermore, leaves contaminated by spraying with a prion-containing preparation retained PrPSc for several weeks in the living plant. Finally, plants can uptake prions from contaminated soil and transport them to aerial parts of the plant (stem and leaves. These findings demonstrate that plants can efficiently bind infectious prions and act as carriers of infectivity, suggesting a possible role of environmental prion contamination in the horizontal transmission of the disease.

  7. Seniors in Society. Strategies to Retain Individual Autonomy

    Directory of Open Access Journals (Sweden)

    2004-05-01

    Full Text Available The research project on "Seniors in Society. Strategies to Retain Individual Autonomy" (2002 - 2004 is supported by the Grant Agency of the Czech Republic. It's importance is empha-sized by the relevance of social and economic aspects of demographic ageing of the popula-tion and that of fundamental changes associated with the transformation of Czech society. The objectives of the research are (1 to find out seniors' material and social resources sup-porting their relative autonomy in everyday life, (2 to record their personal expectations from state, community, or formal and informal support and aid institutions, respectively, and (3 to uncover their engagement in social interaction and individual experiencing of the integration into social groups. The data acquired become the base for (4 identifying the typologies corre-sponding to the levels of seniors' social integration (i.e. groups of relatives, friends, neighbours, special-interest and professional groups. By applying qualitative methods, we explore (5 strategies of everyday life and coping with life cycle events and crisis within par-ticular types. Special attention is paid to the family background of the seniors, including rela-tives in the vertical line. Specifically, we focus on (6 conditions under which family is capa-ble and willing to help or actually is helping it's oldest members, as well as on their interpre-tation within (7 identified types of the relatives supportive systems.

  8. Research and Development on Coatings for Retaining Fission Product Iodine

    Energy Technology Data Exchange (ETDEWEB)

    Genco, J. M.; Berry, D. A.; Rosenberg, H. S.; Cremeans, G. E.; Morrison, D. L. [Battelle Memorial Institute, Columbus Laboratories, Columbus, OH (United States)

    1968-12-15

    It is well known that elemental iodine has the propensity for forming charge-transfer complexes with amines. These complexes are stable at ambient temperatures and retain much of this stability at elevated temperatures. Amines also react with methyl iodide and hydrogen iodide to form the quaternary ammonium salts and amine salts, respectively. These chemical properties of amines provide the basis for the development of retentive coatings for fission product iodine. Various amine-containing polymers were studied in steam-air environments at elevated temperatures using dilute quantities of tagged iodine. Both non-condensing and condensing steam conditions were investigated. Several of the polymers showed sorption rates and capacities that would be adequate for the chemical removal of accident-released fission-product iodine and were several times more effective than commercial protective coatings currently being used. The removal capabilities for amine polymers also could be enhanced by impregnating the reactant on a matrix material such as asbestos mat, presumably because the impregnation technique leads to enhanced surface area and porosity. The two most promising coating systems found were 1:10-phenanthroline impregnated upon asbestos and a three component composite film of the co-polymer of Genamid 2000 and Epon 828 as a reactive binder with 1,10-phenanthroline as a reactive filler. The use of a reactive coating as a passive safety system should reduce appreciably the airborne iodine half-life and the hazards associated with iodine release during a nuclear reactor accident. (author)

  9. Grass plants bind, retain, uptake, and transport infectious prions.

    Science.gov (United States)

    Pritzkow, Sandra; Morales, Rodrigo; Moda, Fabio; Khan, Uffaf; Telling, Glenn C; Hoover, Edward; Soto, Claudio

    2015-05-26

    Prions are the protein-based infectious agents responsible for prion diseases. Environmental prion contamination has been implicated in disease transmission. Here, we analyzed the binding and retention of infectious prion protein (PrP(Sc)) to plants. Small quantities of PrP(Sc) contained in diluted brain homogenate or in excretory materials (urine and feces) can bind to wheat grass roots and leaves. Wild-type hamsters were efficiently infected by ingestion of prion-contaminated plants. The prion-plant interaction occurs with prions from diverse origins, including chronic wasting disease. Furthermore, leaves contaminated by spraying with a prion-containing preparation retained PrP(Sc) for several weeks in the living plant. Finally, plants can uptake prions from contaminated soil and transport them to aerial parts of the plant (stem and leaves). These findings demonstrate that plants can efficiently bind infectious prions and act as carriers of infectivity, suggesting a possible role of environmental prion contamination in the horizontal transmission of the disease. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  10. Strain characteristics of Marburg double crown-retained implant overdentures compared with bar and ball-retained implant overdentures, with and without a rigid major connector.

    Science.gov (United States)

    Kazokoğlu, F Şehnaz; Akaltan, Funda

    2014-12-01

    It is hard to identify the most favorable retainer type and the denture design when considering strain levels around implants and in edentulous ridges for implant overdentures (IOVD). The purpose of this study was to evaluate the strain transmitted to the implants and edentulous ridges by Marburg double crown (MDC)-retained IOVD as opposed to bar and ball-retained IOVD and the efficiency of a rigid major connector in the maxilla. An in vitro maxillary model was prepared with 4 implants, with strain gauges placed distally to each implant and also in the anterior and posterior edentulous ridges. Five overdentures were fabricated for each MDC and each ball and bar attachment retainers. Vertical loads of 280 N were applied bilaterally on the first molar region. Then the palatal bars of each IOVD were disconnected, and loading procedures were repeated for the prostheses. No significant difference was observed among the MDC and the bar and ball-retained IOVD, with and without a rigid bar according to the data taken from both the implants and edentulous ridges. However, when the strain values attained from each strain gauge separately were considered, a slight difference was observed around the implants of ball-retained overdentures and in the edentulous ridges of MDC-retained overdentures. Within the limitations of this in vitro study, MDC-retained maxillary overdentures with 4 parallel and symmetrically placed implants can be used safely without a rigid major connector as with bar and ball-retained IOVD with regard to the strains generated in the edentulous ridge and around implants. Copyright © 2014 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.

  11. Evaluation of stress patterns produced by implant-retained overdentures and implant-retained fixed partial denture.

    Science.gov (United States)

    Mazaro, José Vitor Quinelli; Filho, Humberto Gennari; Vedovatto, Eduardo; Pellizzer, Eduardo Piza; Rezende, Maria Cristina Rosifini Alves; Zavanelli, Adriana Cristina

    2011-11-01

    The purposes of this study were to photoelastically measure the biomechanical behavior of 4 implants retaining different cantilevered bar mandibular overdenture designs and to compare a fixed partial denture (FPD). A photoelastic model of a human edentulous mandible was fabricated, which contained 4 screw-type implants (3.75 × 10 mm) embedded in the parasymphyseal area. An FPD and 3 overdenture designs with the following attachments were evaluated: 3 plastic Hader clips, 1 Hader clip with 2 posterior resilient cap attachments, and 3 ball/O-ring attachments. Vertical occlusal forces of 100 N were applied between the central incisor and unilaterally to the right and left second premolars and second molars. Stresses that developed in the supporting structure were monitored photoelastically and recorded photographically. The results showed that the anterior loading, the overdenture with 3 plastic Hader clips, displayed the largest stress concentration at the medium implant. With premolar loading, the FPD and overdenture with 3 plastic Hader clips displayed the highest stresses to the ipsilateral terminal implant. With molar loading, the overdenture with 3 ball/O-ring attachments displayed the most uniform stress distribution in the posterior edentulous ridge, with less overloading in the terminal implant. It was concluded that vertical forces applied to the bar-clip overdenture and FPD created immediate stress patterns of greater magnitude and concentration on the ipsilateral implants, whereas the ball/O-ring attachments transferred minimal stress to the implants. The increased cantilever in the FPD caused the highest stresses to the terminal implant.

  12. The role of organizational culture in retaining nursing workforce.

    Science.gov (United States)

    Banaszak-Holl, Jane; Castle, Nicholas G; Lin, Michael K; Shrivastwa, Nijika; Spreitzer, Gretchen

    2015-06-01

    We examined how organizational culture in nursing homes affects staff turnover, because culture is a first step to creating satisfactory work environments. Nursing home administrators were asked in 2009 to report on facility culture and staff turnover. We received responses from 419 of 1,056 administrators contacted. Respondents reported the strength of cultural values using scales from a Competing Values Framework and percent of staff leaving annually for Registered Nurse (RN), Licensed Practice Nurse (LPN), and nursing aide (NA) staff. We estimated negative binomial models predicting turnover.  Turnover rates are lower than found in past but remain significantly higher among NAs than among RNs or LPNs. Facilities with stronger market values had increased turnover among RNs and LPNs, and among NAs when turnover was adjusted for facilities with few staff. Facilities emphasizing hierarchical internal processes had lower RN turnover. Group and developmental values focusing on staff and innovation only lowered LPN turnover. Finally, effects on NA turnover become insignificant when turnover was adjusted if voluntary turnover was reported. Organizational culture had differential effects on the turnover of RN, LPN, and NA staff that should be addressed in developing culture-change strategies. More flexible organizational culture values were important for LPN staff only, whereas unexpectedly, greater emphasis on rigid internal rules helped facilities retain RNs. Facilities with a stronger focus on customer needs had higher turnover among all staff. © The Author 2013. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  13. Organizational configuration of hospitals succeeding in attracting and retaining nurses.

    Science.gov (United States)

    Stordeur, Sabine; D'Hoore, William

    2007-01-01

    This paper contrasts structural and managerial characteristics of low- and high-turnover hospitals, and describes the organizational configuration of attractive hospitals. In countries facing nurse shortages and turnover, some hospitals succeed in recruiting and retaining nurses. In Magnet Hospitals, managerial practices and environmental characteristics increase nurses' job satisfaction and their commitment to the organization, which in turn decreases nurse turnover. Such an approach suggests that organizations are best understood as clusters of interconnected structures and practices, i.e. organizational configurations rather than entities whose components can be understood in isolation. From a sample of 12 hospitals whose nurse turnover was studied for 1 year, structural and organizational features of hospitals in the first and fourth quartiles, i.e. attractive (turnover 11.8%) were contrasted. A questionnaire, including perceptions of health-related factors, job demands, stressors, work schedules, organizational climate, and work adjustments antecedent to turnover, was received from 401 nurses working in attractive hospitals (response rate = 53.8%) and 774 nurses in conventional hospitals (response rate = 54.5%). Structural characteristics did not differentiate attractive and conventional hospitals, but employee perceptions towards the organization differed strikingly. Differences were observed for risk exposure, emotional demands, role ambiguity and conflicts, work-family conflicts, effort-reward imbalance and the meaning of work, all in favour of attractive hospitals (P satisfaction with working time, handover shifts and schedules were also better in attractive hospitals (P Job satisfaction and commitment were higher in attractive hospitals, whereas burnout and intention to leave were lower (P retention. Nurses face difficulties in their work situations, but some hospitals are perceived as healthy organizations. The concept of attractive institutions could

  14. Attracting and retaining GPs: a stakeholder survey of priorities.

    Science.gov (United States)

    Lorant, Vincent; Geerts, Charlotte; Duchesnes, Christiane; Goedhuys, Jo; Ryssaert, Lynn; Remmen, Roy; D'hoore, William

    2011-07-01

    Despite being a key player in the healthcare system, training and practising general practice has become less attractive in many countries and is in need of reform. To identify political priorities for improving GPs' attraction to the profession and their retention within it. Stakeholder face-to-face survey in Belgium, 2008. A total of 102 key stakeholders were recruited from policymakers, professional groups, academia, GP leaders, and the media. All interviewees were asked to score 23 policies on four criteria: effectiveness in attracting and retaining GPs, cost to society, acceptance by other health professionals, and accessibility of care. An overall performance score was computed (from -3 to +3) for each type of policy - training, financing, work-life balance, practice organisation, and governance - and for innovative versus conservative policies. Practice organisation policies and training policies received the highest scores (mean score ≥ 1.11). Financing policies, governance, and work-life balance policies scored poorly (mean score ≤ 0.65) because they had negative effects, particularly in relation to cost, acceptance, and accessibility of care. Stakeholders were keen on moving GPs towards team work, improving their role as care coordinator, and helping them to offload administrative tasks (score ≥ 1.4). They also favoured moves to increase the early and integrated exposure of all medical students to general practice. Overall, conservative policies were better scored than innovative ones (beta = -0.16, 95% confidence interval = -0.28 to -0.03). The reforming of general practice is made difficult by the small-step approach, as well as the importance of decision criteria related to cost, acceptance, and access.

  15. DETERMINANTS OF RETAINED EARNINGS IN PROFITABLE STEEL COMPANIES IN INDIA: A STUDY OF STEEL SECTOR

    OpenAIRE

    Dr. Sohaib Masood

    2018-01-01

    In this paper an attempt has been made to identify the important determinants of retained earnings in profitable steel companies in steel sector of India and which have impact on the retention of earnings of steel companies under study. Multiple linear regression is used to identify the determinants of retained earnings for a period of sixteen years. Also the importance of retained earnings as a source of finance for steel sector companies is also studied in the paper.

  16. Model Tests on the Retaining Walls Constructed from Geobags Filled with Construction Waste

    OpenAIRE

    Wen, Hua; Wu, Jiu-jiang; Zou, Jiao-li; Luo, Xin; Zhang, Min; Gu, Chengzhuang

    2016-01-01

    Geobag retaining wall using construction waste is a new flexible supporting structure, and the usage of construction waste to fill geobags can facilitate the construction recycling. In this paper, model tests were performed on geobag retaining wall using construction waste. The investigation was concentrated on the slope top settlement, the distribution characteristics of the earth pressures on retaining walls and horizontal wall displacements, and slope failure modes. The results indicated t...

  17. Effect of Abutment Modification and Cement Type on Retention of Cement-Retained Implant Supported Crowns

    OpenAIRE

    Farzin, Mitra; Torabi, Kianoosh; Ahangari, Ahmad Hasan; Derafshi, Reza

    2014-01-01

    Objective: Provisional cements are commonly used to facilitate retrievability of cement-retained fixed implant restorations; but compromised abutment preparation may affect the retention of implant-retained crowns.The purpose of this study was to investigate the effect of abutment design and type of luting agent on the retentive strength of cement-retained implant restorations. Materials and Method: Two prefabricated abutments were attached to their corresponding analogs and embedded in an ac...

  18. Seismic performance of geosynthetic-soil retaining wall structures

    Science.gov (United States)

    Zarnani, Saman

    Vertical inclusions of expanded polystyrene (EPS) placed behind rigid retaining walls were investigated as geofoam seismic buffers to reduce earthquake-induced loads. A numerical model was developed using the program FLAC and the model validated against 1-g shaking table test results of EPS geofoam seismic buffer models. Two constitutive models for the component materials were examined: elastic-perfectly plastic with Mohr-Coulomb (M-C) failure criterion and non-linear hysteresis damping model with equivalent linear method (ELM) approach. It was judged that the M-C model was sufficiently accurate for practical purposes. The mechanical property of interest to attenuate dynamic loads using a seismic buffer was the buffer stiffness defined as K = E/t (E = buffer elastic modulus, t = buffer thickness). For the range of parameters investigated in this study, K ≤50 MN/m3 was observed to be the practical range for the optimal design of these systems. Parametric numerical analyses were performed to generate design charts that can be used for the preliminary design of these systems. A new high capacity shaking table facility was constructed at RMC that can be used to study the seismic performance of earth structures. Reduced-scale models of geosynthetic reinforced soil (GRS) walls were built on this shaking table and then subjected to simulated earthquake loading conditions. In some shaking table tests, combined use of EPS geofoam and horizontal geosynthetic reinforcement layers was investigated. Numerical models were developed using program FLAC together with ELM and M-C constitutive models. Physical and numerical results were compared against predicted values using analysis methods found in the journal literature and in current North American design guidelines. The comparison shows that current Mononobe-Okabe (M-O) based analysis methods could not consistently satisfactorily predict measured reinforcement connection load distributions at all elevations under both static

  19. Atmospheric Pressure Effect of Retained Gas in High Level Waste

    International Nuclear Information System (INIS)

    Weber, A.H.

    1999-01-01

    Isolated high level waste tanks in H-Area have unexplained changes in waste-level which have been attributed to environmental effects including pressure, temperature, and relative humidity. Previous studies at SRS have considered waste-level changes from causes not including the presence of gas in the salt cake. This study was undertaken to determine the effect of atmospheric pressure on gas in the salt cake and resultant changes in the supernate level of Tank 41H, and to model that effect if possible. A simple theory has been developed to account for changes in the supernate level in a high level waste tank containing damp salt cake as the response of trapped gases to changes in the ambient pressure. The gas is modeled as an ideal gas retained as bubbles within the interstitial spaces in the salt cake and distributed uniformly throughout the tank. The model does not account for consistent long term increases or decreases in the tank level. Any such trend in the tank level is attributed to changes in the liquid content in the tank (from condensation, evaporation, etc.) and is removed from the data prior to the void estimation. Short term fluctuations in the tank level are explained as the response of the entrained gas volume to changes in the ambient pressure. The model uses the response of the tank level to pressure changes to estimate an average void fraction for the time period of interest. This estimate of the void is then used to predict the expected level response. The theory was applied to three separate time periods of the level data for tank 41H as follows: (1) May 3, 1993 through August 3, 1993, (2) January 23, 1994 through April 21, 1994, and (3) June 4, 1994 through August 24, 1994. A strong correlation was found between fluctuations in the tank level and variations in the ambient pressure. This correlation is a clear marker of the presence of entrained gases in the tank. From model calculations, an average void fraction of 11 percent was estimated to

  20. Two-year survival analysis of twisted wire fixed retainer versus spiral wire and fiber-reinforced composite retainers: a preliminary explorative single-blind randomized clinical trial.

    Science.gov (United States)

    Sobouti, Farhad; Rakhshan, Vahid; Saravi, Mahdi Gholamrezaei; Zamanian, Ali; Shariati, Mahsa

    2016-03-01

    Traditional retainers (both metal and fiber-reinforced composite [FRC]) have limitations, and a retainer made from more flexible ligature wires might be advantageous. We aimed to compare an experimental design with two traditional retainers. In this prospective preliminary clinical trial, 150 post-treatment patients were enrolled and randomly divided into three groups of 50 patients each to receive mandibular canine-to-canine retainers made of FRC, flexible spiral wire (FSW), and twisted wire (TW). The patients were monitored monthly. The time at which the first signs of breakage/debonding were detected was recorded. The success rates of the retainers were compared using chi-squared, Kaplan-Meier, and Cox proportional-hazard regression analyses (α = 0.05). In total, 42 patients in the FRC group, 41 in the FSW group, and 45 in the TW group completed the study. The 2-year failure rates were 35.7% in the FRC group, 26.8% in the FSW group, and 17.8% in the TW group. These rates differed insignificantly (chi-squared p = 0.167). According to the Kaplan-Meier analysis, failure occurred at 19.95 months in the FRC group, 21.37 months in the FSW group, and 22.36 months in the TW group. The differences between the survival rates in the three groups were not significant (Cox regression p = 0.146). Although the failure rate of the experimental retainer was two times lower than that of the FRC retainer, the difference was not statistically significant. The experimental TW retainer was successful, and larger studies are warranted to verify these results.

  1. Academic retainer medicine: an innovative business model for cross-subsidizing primary care.

    Science.gov (United States)

    Lucier, David J; Frisch, Nicholas B; Cohen, Brian J; Wagner, Michael; Salem, Deeb; Fairchild, David G

    2010-06-01

    Retainer-medicine primary care practices, commonly referred to as "luxury" or "concierge" practices, provide enhanced services to patients beyond those available in traditional practices for a yearly retainer fee. Adoption of retainer practices has been largely absent in academic health centers (AHCs). Reasons for this trend stem primarily from ethical concerns, such as the potential for patient abandonment when physicians downsize from larger, traditional practices to smaller, retainer-medicine practices.In 2004, the Department of Medicine at Tufts Medical Center developed an academic retainer-medicine primary care practice within the Division of General Medicine that not only generates financial support for the division but also incorporates a clinical and business model that is aligned with the mission and ethics of an academic institution.In contrast to private retainer-medicine practices, this unique business model addresses several of the ethical issues associated with traditional retainer practices-it does not restrict net access to care and it neutralizes concerns about patient abandonment. Addressing the growing primary care shortage, the model also presents the opportunity for a retainer practice to cross-subsidize the expansion of general medicine in an academic medical setting. The authors elucidate the benefits, as well as the inherent challenges, of embedding an academic retainer-medicine practice within an AHC.

  2. Supra-aural gossypiboma: case report of a retained textile surgical sponge in an unusual location.

    Science.gov (United States)

    Chawla, N; Gupta, N; Dhawan, N

    2016-11-01

    Gossypiboma or retained surgical sponge is an infrequently encountered surgical complication, more so in the head and neck region. A literature search did not reveal a previously reported case of retained or concealed surgical sponge after microscopic ear surgery. We present a unique and previously unreported case of a 25-year-old male who presented with a cystic swelling in the right supra-aural region 5 months post-modified radical mastoidectomy of the right ear. Surgical excision of the swelling revealed a retained surgical sponge. We emphasise the importance of counting surgical sponges after every surgical step to minimise the incidence of such retained surgical items.

  3. Building and Retaining Human Capital Through the Assignment Process

    National Research Council Canada - National Science Library

    Bruce, Prince

    2002-01-01

    ...). The active involvement of the HR department in partnership with the hiring unit in the decision process contributed to achieving broader organizational and individual focused criteria and other indices of decision effectiveness.

  4. Computer aided detection of surgical retained foreign object for prevention

    International Nuclear Information System (INIS)

    Hadjiiski, Lubomir; Marentis, Theodore C.; Rondon, Lucas; Chan, Heang-Ping; Chaudhury, Amrita R.; Chronis, Nikolaos

    2015-01-01

    Purpose: Surgical retained foreign objects (RFOs) have significant morbidity and mortality. They are associated with approximately $1.5 × 10 9 annually in preventable medical costs. The detection accuracy of radiographs for RFOs is a mediocre 59%. The authors address the RFO problem with two complementary technologies: a three-dimensional (3D) gossypiboma micro tag, the μTag that improves the visibility of RFOs on radiographs, and a computer aided detection (CAD) system that detects the μTag. It is desirable for the CAD system to operate in a high specificity mode in the operating room (OR) and function as a first reader for the surgeon. This allows for fast point of care results and seamless workflow integration. The CAD system can also operate in a high sensitivity mode as a second reader for the radiologist to ensure the highest possible detection accuracy. Methods: The 3D geometry of the μTag produces a similar two dimensional (2D) depiction on radiographs regardless of its orientation in the human body and ensures accurate detection by a radiologist and the CAD. The authors created a data set of 1800 cadaver images with the 3D μTag and other common man-made surgical objects positioned randomly. A total of 1061 cadaver images contained a single μTag and the remaining 739 were without μTag. A radiologist marked the location of the μTag using an in-house developed graphical user interface. The data set was partitioned into three independent subsets: a training set, a validation set, and a test set, consisting of 540, 560, and 700 images, respectively. A CAD system with modules that included preprocessing μTag enhancement, labeling, segmentation, feature analysis, classification, and detection was developed. The CAD system was developed using the training and the validation sets. Results: On the training set, the CAD achieved 81.5% sensitivity with 0.014 false positives (FPs) per image in a high specificity mode for the surgeons in the OR and 96

  5. Development of a Framework for Attracting and Retaining Women in Construction Practice

    Directory of Open Access Journals (Sweden)

    K.J. Adogbo

    2015-01-01

    Full Text Available Previous research has indicated that women are significantly under-represented in the Nigerian construction industry and that female undergraduates face barriers that deter them from engaging in construction practice. This research examined the barriers faced by female undergraduates in the construction disciplines at Nigerian Universities. The research adopted the use of a questionnaire and semi-structured interviews. A total of 360 questionnaires were distributed, and 259 (71.94% were returned and used in the analysis. The semi-structured interviews were conducted with 50 female students and 16 women across the professions of Architecture, Building, Civil Engineering and Quantity Surveying. The results revealed that the undergraduates perceived the construction practice to be synonymous with site activities and that family responsibility posed the greatest barrier to their participation. The strategies identified by the women in practice included active participation in the activity of professional bodies and seeking a mentor. It was concluded that female graduates can be attracted to the industry, but efforts need to be put in place to successfully implement the strategies identified by the professional women. A framework that addresses gender issues in attracting and retaining graduates in the construction practice was developed to help women plan their career in the industry.

  6. Antigen-binding properties of monoclonal antibodies reactive with EBNA1 and use in immunoaffinity chromatography.

    Directory of Open Access Journals (Sweden)

    Sarah J Duellman

    Full Text Available Epstein-Barr virus (EBV nuclear antigen 1 (EBNA1 was overexpressed and purified from Escherichia coli. Mouse monoclonal antibodies (mAbs were prepared that react with EBNA1. Eleven high affinity mAbs were recovered. Nine mAbs are isotype IgG (all subisotype IgG(1 and two mAbs are isotype IgM. All mAbs react strongly with EBNA1 in an ELISA assay while only one mAb (designated 1EB6 fails to react in a Western blot assay. The epitopes for these mAbs were mapped to seven different regions, providing good coverage of the entire EBNA1 protein. The mAbs had differing affinity for an EBNA1/DNA complex with four mAbs able to supershift the complex completely. All mAbs can immunoprecipitate EBNA1 from E. coli overexpressing EBNA1. A modified ELISA assay, termed ELISA-elution assay, was used to screen for mAbs that release EBNA1 in the presence of a low molecular weight polyhydroxylated compound (polyol and a nonchaotropic salt. MAbs with this property, termed polyol-responsive (PR-mAbs, allow gentle elution of labile proteins and protein complexes. Four mAbs are polyol-responsive with two showing usefulness in gentle immunoaffinity chromatography. Purification with these PR-mAbs may be useful in purifying EBNA1 complexes and elucidating EBNA1-associated proteins. This panel of anti-EBNA1 mAbs will advance the study of EBV by providing new tools to detect and purify EBNA1.

  7. Concanavalin A immobilized magnetic poly(glycidyl methacrylate) beads for prostate specific antigen binding.

    Science.gov (United States)

    Idil, Neslihan; Perçin, Işık; Karakoç, Veyis; Yavuz, Handan; Aksöz, Nilüfer; Denizli, Adil

    2015-10-01

    The aim of this study was to prepare Concanavalin A (Con A) immobilized magnetic poly(glycidyl methacrylate) (mPGMA) beads for prostate specific antigen (PSA) binding and to study binding capacities of the beads using lectin-glycoprotein interactions. Firstly, iron oxide nanoparticles were synthesized by co-precipitation method and then, beads were synthesized by dispersion polymerization in the presence of iron oxide nanoparticles. Con A molecules were both covalently immobilized onto the beads directly and through the spacer arm (1,6-diaminohexane-HDMA). The total PSA and free PSA binding onto the mPGMA-HDMA-Con A beads were higher than that of the mPGMA-Con A beads. Maximum PSA binding capacity was observed as 91.2 ng/g. Approximately 45% of the bound PSA was eluted by using 0.1 M mannose as elution agent. The mPGMA-HDMA-Con A beads could be reused without a remarkable decrease in the binding capacities after 5 binding-desorption cycles. Serum fractions were analyzed using SDS-PAGE. The mPGMA-HDMA-Con A beads could be useful for the detection of PSA and suggested as a model system for other glycoprotein biomarkers. Copyright © 2015 Elsevier B.V. All rights reserved.

  8. Characterisation of peptide microarrays for studying antibody-antigen binding using surface plasmon resonance imagery.

    Directory of Open Access Journals (Sweden)

    Claude Nogues

    Full Text Available BACKGROUND: Non-specific binding to biosensor surfaces is a major obstacle to quantitative analysis of selective retention of analytes at immobilized target molecules. Although a range of chemical antifouling monolayers has been developed to address this problem, many macromolecular interactions still remain refractory to analysis due to the prevalent high degree of non-specific binding. We describe how we use the dynamic process of the formation of self assembling monolayers and optimise physical and chemical properties thus reducing considerably non-specific binding and allowing analysis of specific binding of analytes to immobilized target molecules. METHODOLOGY/PRINCIPAL FINDINGS: We illustrate this approach by the production of specific protein arrays for the analysis of interactions between the 65kDa isoform of human glutamate decarboxylase (GAD65 and a human monoclonal antibody. Our data illustrate that we have effectively eliminated non-specific interactions with the surface containing the immobilised GAD65 molecules. The findings have several implications. First, this approach obviates the dubious process of background subtraction and gives access to more accurate kinetic and equilibrium values that are no longer contaminated by multiphase non-specific binding. Second, an enhanced signal to noise ratio increases not only the sensitivity but also confidence in the use of SPR to generate kinetic constants that may then be inserted into van't Hoff type analyses to provide comparative DeltaG, DeltaS and DeltaH values, making this an efficient, rapid and competitive alternative to ITC measurements used in drug and macromolecular-interaction mechanistic studies. Third, the accuracy of the measurements allows the application of more intricate interaction models than simple Langmuir monophasic binding. CONCLUSIONS: The detection and measurement of antibody binding by the type 1 diabetes autoantigen GAD65 represents an example of an antibody-antigen interaction where good structural, mechanistic and immunological data are available. Using SPRi we were able to characterise the kinetics of the interaction in greater detail than ELISA/RIA methods. Furthermore, our data indicate that SPRi is well suited to a multiplexed immunoassay using GAD65 proteins, and may be applicable to other biomarkers.

  9. Determination of High-affinity Antibody-antigen Binding Kinetics Using Four Biosensor Platforms.

    Science.gov (United States)

    Yang, Danlin; Singh, Ajit; Wu, Helen; Kroe-Barrett, Rachel

    2017-04-17

    Label-free optical biosensors are powerful tools in drug discovery for the characterization of biomolecular interactions. In this study, we describe the use of four routinely used biosensor platforms in our laboratory to evaluate the binding affinity and kinetics of ten high-affinity monoclonal antibodies (mAbs) against human proprotein convertase subtilisin kexin type 9 (PCSK9). While both Biacore T100 and ProteOn XPR36 are derived from the well-established Surface Plasmon Resonance (SPR) technology, the former has four flow cells connected by serial flow configuration, whereas the latter presents 36 reaction spots in parallel through an improvised 6 x 6 crisscross microfluidic channel configuration. The IBIS MX96 also operates based on the SPR sensor technology, with an additional imaging feature that provides detection in spatial orientation. This detection technique coupled with the Continuous Flow Microspotter (CFM) expands the throughput significantly by enabling multiplex array printing and detection of 96 reaction sports simultaneously. In contrast, the Octet RED384 is based on the BioLayer Interferometry (BLI) optical principle, with fiber-optic probes acting as the biosensor to detect interference pattern changes upon binding interactions at the tip surface. Unlike the SPR-based platforms, the BLI system does not rely on continuous flow fluidics; instead, the sensor tips collect readings while they are immersed in analyte solutions of a 384-well microplate during orbital agitation. Each of these biosensor platforms has its own advantages and disadvantages. To provide a direct comparison of these instruments' ability to provide quality kinetic data, the described protocols illustrate experiments that use the same assay format and the same high-quality reagents to characterize antibody-antigen kinetics that fit the simple 1:1 molecular interaction model.

  10. 5 CFR 536.307 - Treatment of a retained rate as basic pay for other purposes.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Treatment of a retained rate as basic pay... CIVIL SERVICE REGULATIONS GRADE AND PAY RETENTION Pay Retention § 536.307 Treatment of a retained rate... for accumulated and annual leave under 5 CFR part 550, subpart L; (8) General Schedule pay...

  11. Reproductive performance of Friesian mares after retained placenta and manual removal of the placenta

    NARCIS (Netherlands)

    Sevinga, M; Hesselink, JW; Barkema, H.W.

    2002-01-01

    Because the incidence of retained placenta in Friesian mares is estimated to be high, and no reports have been published on the reproductive performance of Friesian mares after retained placenta, we studied postpartum reproductive performance in Friesian brood mares with (n = 54) and without (n =

  12. 75 FR 11207 - Policy Statement on Obtaining and Retaining Beneficial Ownership Information for Anti-Money...

    Science.gov (United States)

    2010-03-10

    ... Retaining Beneficial Ownership Information for Anti-Money Laundering Purposes AGENCY: Securities and...-money laundering purposes. DATES: Effective Date: March 5, 2010. FOR FURTHER INFORMATION CONTACT... retaining beneficial ownership information for anti-money laundering purposes. This guidance is being issued...

  13. 12 CFR 714.6 - Are you required to retain salvage powers over the leased property?

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Are you required to retain salvage powers over the leased property? 714.6 Section 714.6 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING CREDIT UNIONS LEASING § 714.6 Are you required to retain salvage powers over the leased...

  14. Model Tests on the Retaining Walls Constructed from Geobags Filled with Construction Waste

    Directory of Open Access Journals (Sweden)

    Hua Wen

    2016-01-01

    Full Text Available Geobag retaining wall using construction waste is a new flexible supporting structure, and the usage of construction waste to fill geobags can facilitate the construction recycling. In this paper, model tests were performed on geobag retaining wall using construction waste. The investigation was concentrated on the slope top settlement, the distribution characteristics of the earth pressures on retaining walls and horizontal wall displacements, and slope failure modes. The results indicated that the ultimate loads that the slope tops with retaining walls could bear were 87.5%~125% higher than that of the slope top without retaining walls. The ultimate loading of strengthened slopes with different slope ratios from 1 : 0.75 to 1 : 0.25 could be reduced by 11.8% to 29.4%. The horizontal displacements of the retaining walls constructed from geobags were distributed in a drum shape, with the greatest horizontal displacements occurring about 1/3~1/2 of the wall height away from the bottom of the wall. As the slope ratio increased, the failure of the slope soil supported by geobag retaining wall using construction waste changed from sliding to sliding-toppling (dominated by sliding and then to toppling-sliding (dominated by toppling. The range of 1/3~1/2 of wall height is the weak part of the retaining walls, which should be strengthened with certain measures during the process of design and construction.

  15. An appraisal of retained placentae in Ibadan: a five year review ...

    African Journals Online (AJOL)

    During the study period, 4980 deliveries took place at the University College Hospital, Ibadan and 106 cases of retained placenta were managed making the incidence 2.13 per cent of all births. Results: During the five year period, there were 106 patients with retained placenta; of these, 90 (84.9%) case notes were ...

  16. 41 CFR 102-42.25 - Who retains custody of gifts and decorations pending disposal?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who retains custody of gifts and decorations pending disposal? 102-42.25 Section 102-42.25 Public Contracts and Property..., Handling and Disposition § 102-42.25 Who retains custody of gifts and decorations pending disposal? (a) The...

  17. Telescopic retainers: an old or new solution? A second chance to have normal dental function.

    Science.gov (United States)

    Breitman, Joseph B; Nakamura, Scott; Freedman, Arnold L; Yalisove, Irving L

    2012-01-01

    This article is an overview of the biomechanics and advantages of telescopic retainers. Telescopic retainers offer more possibilities than any other treatment modality available in modern dentistry. Telescopic implant fixtures make the already versatile technique even more flexible. Telescopes should not be forgotten as a treatment modality, but should be embraced as a great option. © 2011 by the American College of Prosthodontists.

  18. Maxillary overdentures retained by splinted and unsplinted implants : A retrospective study

    NARCIS (Netherlands)

    Narhi, TO; Hevinga, M; Voorsmit, RACA; Kalk, W

    2001-01-01

    The purpose of this retrospective study was to evaluate the clinical performance of and patients' satisfaction with maxillary overdentures retained by splinted and unsplinted implants. Patients who had been treated with maxillary implant-retained overdentures because of functional problems with

  19. 17 CFR 300.304 - Retained rights of brokers or dealers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Retained rights of brokers or... Completion of Open Contractual Commitments § 300.304 Retained rights of brokers or dealers. (a) Nothing stated in these rules shall be construed to prejudice the right of a broker or dealer to any claim...

  20. Fracture resistance of direct inlay-retained adhesive bridges : Effect of pontic material and occlusal morphology

    NARCIS (Netherlands)

    Breuklander, Marijn; Salihoglu-Yener, Esra; Ozcan, Mutlu

    This study evaluated the effect of a) pontic materials and b) occlusal morphologies on the fracture resistance of fiber-reinforced composite (FRC) inlay-retained fixed dental prostheses (FDP). Inlay-retained FRC FPDs (N=45, n=9) were constructed using a) resin composite (deep anatomy), b) natural

  1. Patient preference and satisfaction with implant-supported mandibular overdentures retained with ball or locator attachments: a crossover clinical trial.

    Science.gov (United States)

    Krennmair, Gerald; Seemann, Rudolf; Fazekas, Andres; Ewers, Rolf; Piehslinger, Eva

    2012-01-01

    To determine patient satisfaction and preference for implant-supported mandibular overdentures (IOD) retained with ball or Locator attachments. In addition, peri-implant conditions and prosthodontic maintenance efforts for the final attachments were evaluated after 1 year of function. In this crossover clinical trial, 20 edentulous patients were recruited to receive two mandibular implants in the canine region and were provided with implant-retained mandibular overdentures and new complete maxillary dentures. Implant-retained mandibular overdentures were stabilized with either ball attachments or Locator attachments, in random order. After 3 months of function, the attachments in the existing denture were changed. Questionnaires on satisfaction/complaints with the prostheses were administered at baseline (with the old dentures) and after 3 months of function with each attachment, thus providing for an intraindividual comparison. The decision for the final attachment chosen was based on the patient's preference. For the definitive attachment, peri-implant conditions (peri-implant marginal bone resorption, pocket depth, and Plaque Index, Gingival Index, and Bleeding Index) as well as prosthodontic maintenance efforts and satisfaction score were evaluated after an insertion period of 1 year. Nineteen (95%) patients completed the study (1 dropout). Patient satisfaction improved significantly (P<.05) from baseline (old dentures) to the new prostheses retained with each of the two attachment types for all domains of satisfaction. However, there were no differences between ball or Locator attachment for any items of satisfaction evaluated and neither attachment had a significant patient preference. No differences for peri-implant parameters or for patient satisfaction were noted between the definitive attachments (ball, n=10; Locator, n=9) after 1 year. Although the overall incidence rate of prosthodontic maintenance did not significantly differ between both retention

  2. Indirect vs direct bonding of mandibular fixed retainers in orthodontic patients: Comparison of retainer failures and posttreatment stability. A 2-year follow-up of a single-center randomized controlled trial.

    Science.gov (United States)

    Egli, Fabienne; Bovali, Efstathia; Kiliaridis, Stavros; Cornelis, Marie A

    2017-01-01

    The objectives of this 2-arm parallel trial were to compare the numbers of failures of mandibular fixed retainers bonded with indirect and direct methods and to investigate the posttreatment changes 2 years after placement. Sixty-four consecutive patients from the postgraduate orthodontic clinic of the University of Geneva in Switzerland were randomly allocated to either an indirect or a traditional direct bonding procedure of a mandibular fixed retainer at the end of their orthodontic treatment (T0). Eligibility criteria were the presence of the 4 mandibular incisors and the 2 mandibular canines, and no active caries, restorations, fractures, or periodontal disease of these teeth. The patients were randomized in blocks of 4 (using an online randomization service) with allocation concealment secured by contacting the sequence generator for assignment. The patients were recalled 12 months and 24 months (T3) after retainer bonding. The main outcome was any first-time failure of retainers (ie, at least 1 composite pad debonded or fractured); unexpected posttreatment changes of the mandibular incisors and canines were a secondary outcome. Impressions and lateral cephalograms were taken at T0 and T3: changes in mandibular intercanine and interpremolar distances and mandibular incisor inclination were assessed. Blinding was applicable for outcome assessment only. The chi-square test and Cox regression were used to compare the survival rates of the retainers bonded with direct and indirect methods. Paired t tests were used to assess differences in intercanine and interpremolar distances and mandibular incisor inclination at T0 and T3. Significance was set at P direct bonding group (log-rank test, P = 0.64). The hazard ratio was 1.26 (95% confidence interval, 0.56-2.81; P = 0.58). Bond failures occurred mainly during the first year. There were no clinically significant changes in mandibular intercanine distance, interpremolar distance, and incisor inclination

  3. Accelerated aging effects on surface hardness and roughness of lingual retainer adhesives.

    Science.gov (United States)

    Ramoglu, Sabri Ilhan; Usumez, Serdar; Buyukyilmaz, Tamer

    2008-01-01

    To test the null hypothesis that accelerated aging has no effect on the surface microhardness and roughness of two light-cured lingual retainer adhesives. Ten samples of light-cured materials, Transbond Lingual Retainer (3M Unitek) and Light Cure Retainer (Reliance) were cured with a halogen light for 40 seconds. Vickers hardness and surface roughness were measured before and after accelerated aging of 300 hours in a weathering tester. Differences between mean values were analyzed for statistical significance using a t-test. The level of statistical significance was set at P statistically significant (P statistically significant (P .05). Accelerated aging significantly increased the surface microhardness of both light-cured retainer adhesives tested. It also significantly increased the surface roughness of the Transbond Lingual Retainer.

  4. Persistence and vulnerability: retaining biodiversity in the landscape ...

    Indian Academy of Sciences (India)

    Unknown

    An objective of biodiversity conservation activities is to minimize the exposure of biodiversity features to threatening processes and to ensure, as far as possible, that biodiversity persists in the landscape. We discuss how issues of vulnerability and persistence can and should be addressed at all stages of the conservation.

  5. Odontoblast-Like Cells Differentiated from Dental Pulp Stem Cells Retain Their Phenotype after Subcultivation

    Directory of Open Access Journals (Sweden)

    Paula A. Baldión

    2018-01-01

    Full Text Available Odontoblasts, the main cell type in teeth pulp tissue, are not cultivable and they are responsible for the first line of response after dental restauration. Studies on dental materials cytotoxicity and odontoblast cells physiology require large quantity of homogenous cells retaining most of the phenotype characteristics. Odontoblast-like cells (OLC were differentiated from human dental pulp stem cells using differentiation medium (containing TGF-β1, and OLC expanded after trypsinization (EXP-21 were evaluated and compared. Despite a slower cell growth curve, EXP-21 cells express similarly the odontoblast markers dentinal sialophosphoprotein and dentin matrix protein-1 concomitantly with RUNX2 transcripts and low alkaline phosphatase activity as expected. Both OLC and EXP-21 cells showed similar mineral deposition activity evidenced by alizarin red and von Kossa staining. These results pointed out minor changes in phenotype of subcultured EXP-21 regarding the primarily differentiated OLC, making the subcultivation of these cells a useful strategy to obtain odontoblasts for biocompatibility or cell physiology studies in dentistry.

  6. Attracting and Retaining Talent in the Global Nuclear Industry

    International Nuclear Information System (INIS)

    Thomas, C.

    2014-01-01

    Recruiting 'non-nuclear' candidates: → Analysis of supply and demand; → Identify differentiators (longevity of project, interesting nature of work etc); → Online and offline recruitment (local and international) managed by recruiters; → Efficient and timely interview process; → Time and cost advantages through volume. Recruiting 'nuclear experts': → Detailed job descriptions written by nuclear experts; → People with strong nuclear knowledge involved throughout recruitment process (internal and external) - 'Excellence attracts exellence'; → 'Best Athlete' recruitment approach - passive and active candidates; → International search; → Higher investment in each case

  7. A new effect of retained austenite on ductility enhancement in high strength bainitic steel

    Energy Technology Data Exchange (ETDEWEB)

    Wang Ying; Zhang Ke; Guo Zhenghong; Chen Nailu [School of Materials Science and Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Rong Yonghua, E-mail: yhrong@sjtu.edu.cn [School of Materials Science and Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China)

    2012-08-30

    Highlights: Black-Right-Pointing-Pointer A new DARA effect in the bainitic steel is proposed. Black-Right-Pointing-Pointer The conditions of DARA effect are proposed. Black-Right-Pointing-Pointer The mechanism of retained austenite on ductility enhancement is clarified. - Abstract: A designed high strength bainitic steel with considerable amount of retained austenite is presented in order to study the effect of retained austenite on the ductility enhancement in bainitic steels. Transformation induced plasticity (TRIP) effect is verified by both X-ray diffraction (XRD) measurement of retained austenite fraction in various deformation stages and transmission electron microscopy observation of the deformed twin-type martensite. Results from XRD line profile analysis reveal that the average dislocation density in bainite during the deformation is lower than that before deformation, and such a phenomenon can be explained by a new effect, dislocations absorption by retained austenite (DARA) effect, based on our previous investigation of martensitic steels. DARA effect availably enhances the compatibility of deformation ability of bainite with retained austenite. In view of microstructure similarity of bainitic steels with martensitic steels, the conditions of DARA effect are proposed. The effects of retained austenite on the ductility enhancement in bainitic steels are clarified.

  8. Incidence and outcome of retained Port-A-Cath fragments during removal.

    Science.gov (United States)

    Aworanti, Olugbenga Michael; Linnane, Niall; Tareen, Farhan; Mortell, Alan

    2017-07-01

    Port-A-Cath devices are frequently used for long-term venous access. We postulate that long-term use predisposes them to getting stuck and retained in a central vein at the time of removal. We aim to report the incidence and outcome of this complication. Between January 2006 and July 2016, a retrospective review of all Port-A-Cath removals that were performed at our centre was conducted. At the time of removal, catheters that could not be removed from the vein were considered retained. During the study period, 107 children had 174 episodes of silicone Sitimplant (Vygon, Ecouen, France) Port-A-Cath insertions. These children required 135 removal episodes and there were 3 (2.2%) instances whereby the catheter fragment was retained. These episodes of retained catheters only occurred in children with factor VIII deficiency (4.1% incidence in this cohort). For each episode of catheter insertion and removal, the catheters had been left in situ for a mean duration of 43 months in children with factor deficiency and no retained fragments, and the mean duration was 91 months in children with factor deficiency and retained catheter fragments (p = 0.0011). Port-A-Caths that are retained after attempted removal is a complication encountered predominantly in catheters that have been in use for a prolonged duration. Furthermore, factor replacement therapy in haemophiliacs may be a risk factor for this complication.

  9. Effects of Geofoam Panels on Static Behavior of Cantilever Retaining Wall

    Directory of Open Access Journals (Sweden)

    Navid Hasanpouri Notash

    2018-01-01

    Full Text Available Geofoam is one of the geosynthetic products that can be used in geotechnical applications. According to researches, expanded polystyrene (EPS geofoam placed directly against a rigid retaining wall has been proposed as a strategy to reduce static loads on the wall. This study employed a finite difference analysis using a 2-D FLAC computer program by considering yielding and nonyielding states for retaining walls to explore the effectiveness of geofoam panels in improving the static performance of cantilever retaining walls. Retaining walls at heights of 3, 6, and 9 meters and geofoam panels with densities of 15, 20, and 25 (kg/m3 at three relative thicknesses of t/H = 0.05, 0.2, and 0.4 were modelled in this numerical study. In addition, the performance of the double EPS buffer system, which involves two vertical geofoam panels, in retaining walls’ stability with four panel spacing (50, 100, 150, and 200 cm was also evaluated in this research. The results showed that use of EPS15 with density equal to 15 (kg/m3 which has the lowest density among other geofoam panels has a significant role in reduction of lateral stresses, although the performance of geofoam in nonyielding retaining walls is better than yielding retaining walls.

  10. Factors influencing success of cement versus screw-retained implant restorations: a clinical review

    Directory of Open Access Journals (Sweden)

    Ahmad Manawar

    2012-10-01

    Full Text Available Aim: As more and more dental practitioners are focusing on implant-supported fixed restorations, some clinicians favor the use of cement retained restorations while others consider screw retained prosthesis to be the best choice. Discussion: In screw-retained restorations, the fastening screw provides a solid joint between the restoration and the implant abutment, while in cement-retained prostheses the restorative screw is eliminated to enhance esthetics, occlusal stability, and passive fit of the restorations. The factors that influence the type of fixation of the prostheses to the implants like passivity of the framework, ease of fabrication, occlusion, esthetics, accessibility, retention and retrievability are discussed in this article with scientific studies demonstrating superior outcomes of one technique over another. Screwretained implant restorations have an advantage of predictable retention, retrievability and lack of potentially retained subgingival cement. However, a few disadvantages exist such as precise placement of the implant for optimal and esthetic location of the screw access hole and obtaining passive fit. On the other hand, cement retained restorations eliminate unesthetic screw access holes, have passive fit of castings, reduced complexity of clinical and lab procedures, enhanced esthetics, reduced cost factors and non disrupted morphology of the occlusal table. Conclusion: This article compares the advantages, potential disadvantages and limitations of screw and cement retained restorations and their specific implications in the most common clinical situation.

  11. [The impact of personality traits on adolescents' adaptation and compliance to clear retainers].

    Science.gov (United States)

    Xu, Fan; Tang, Guo-Hua

    2017-02-01

    The aim of this study was to evaluate the adolescents' adaptation and compliance to clear retainers, and to investigate their associations with personality traits. Fifty adolescents at the end of fixed orthodontic treatment were consecutively recruited. After debonding the fixed orthodontic appliances, clear retainers were used. Participants were asked to fill questionnaires 2 months after wearing the clear retainers. A questionnaire was designed to evaluate their adaptation and compliance for clear retianers. Eysenck personality questionnaire was used to assess the personality traits. Spearman rank correlation was used to analyze the associations between personality traits with the adaptation and compliance to clear retainers using SAS8.0 software package. Forty-two of 50 adolescents accomplished the questionnaires. 76% felt no mucous irritation, 95% felt no influence on socializing. However, 75% showed oral constraint, 71% felt impaired speech. Moreover, 40% adolescents wore the retainers less than 18 hours per day. 31% patients had their aligner lost. 83% patients did not brush their teeth after each meal. Neuroticism was positively associated with the effect of impaired chewing (r=0.32). Psychoticism was positively associated with the oral constraint (r=0.31) and facial muscular soreness (r=0.35), but negatively associated with the influence on emotion (r=-0.34). Extraversion was positively associated with the retainers' damage (r=0.31). Adolescents showed good adaptation for clear retainers, but unsatisfactory compliance. There are associations between adolescents' adaptation and compliance for clear retainers and personality traits. These results suggest that clinicians should pay more attention to the compliance of adolescents when using clear retainer. Personality traits could be a useful prediction to assess the compliance for clear aligners.

  12. Prediction of retained residual stresses in laboratory fracture mechanics specimens extracted from welded components

    International Nuclear Information System (INIS)

    Hurlston, R.G.; Sherry, A.H.; James, P.; Sharples, J.K.

    2015-01-01

    The measurement of weld material fracture toughness properties is important for the structural integrity assessment of engineering components. However, welds can contain high levels of residual stress and these can be retained in fracture mechanics specimens, particularly when machined from non-stress relieved welds. Retained residual stresses can make the measurement of valid fracture toughness properties difficult. This paper describes the results of analytical work undertaken to investigate factors that can influence the magnitude and distribution of residual stresses retained in fracture mechanics specimen blanks extracted from as-welded ferritic and austenitic stainless steel plates. The results indicate that significant levels of residual stress can be retained in specimen blanks prior to notching, and that the magnitude and distribution of stress is dependent upon material properties, specimen geometry and size, and extraction location through the thickness of the weld. Finite element modelling is shown to provide a useful approach for estimating the level and distributions of retained residual stresses. A new stress partitioning approach has been developed to estimate retained stress levels and results compare favourably with FE analysis and available experimental data. The approach can help guide the selection of specimen geometry and machining strategies to minimise the level of residual stresses retained in fracture mechanics specimen blanks extracted from non stress-relieved welds and thus improve the measurement of weld fracture toughness properties. - Highlights: • A simplified method for generating realistic weld residual stresses has been developed. • It has been shown that significant levels of residual stress can be retained within laboratory fracture mechanics specimens. • The level and distribution is dependant upon material, specimen type, specimen size and extraction location. • A method has been developed to allow estimates of the

  13. Doctoral Programs Need Changes to Attract and Retain Underrepresented Groups

    Science.gov (United States)

    Bernard, R. E.; Mayfield, K. K.

    2017-12-01

    Geoscience is currently recognized as the least diverse of all STEM fields. While attention typically focuses on K-12 and undergraduate populations, the extreme lack of diversity among graduate students, and doctoral students in particular, should be examined and addressed. In 2016, members of underrepresented minority (URM) groups made up only 6% of those graduating with geoscience PhDs. In all STEM fields, only 48% of Hispanic/Latino and 38% of Black/African American doctoral studies had earned doctorates within 7 years, with 36% of members of these groups leaving the program entirely. Recent studies suggest that these high attrition rates can be attributed, in part, to a mismatch between motivations of URM members and PhD-granting institutions while students are pursuing scientific education and careers. Traditional STEM doctoral programs do not offer, facilitate, or incentivize substantial opportunities to integrate social justice issues, community involvement, and altruism—factors which have been found to be of more importance to these populations than to male members of well-represented groups. URM members are also less likely to be interested in purely academic research careers, so doctoral programs may be failing to attract (and failing to prepare) diverse populations by not offering experiences beyond typical research and TA duties. In this presentation, trends in motivation and persistence among URM students in STEM will be discussed, in addition to highlighting education and outreach activities that can be successfully incorporated for a more fulfilling, balanced, attractive, and preparatory education experience. Specific activities undertaken and recommended by the presenter in her PhD experience include the following: a federal research internship, a state government policy internship, a formal partnership with a local K-12 teacher though a former NSF GK-12 program, a two-week education workshop aboard a scientific research drillship, and attending a

  14. Effects of the type and rigidity of the retainer and the number of abutting teeth on stress distribution of telescopic-retained removable partial dentures

    Directory of Open Access Journals (Sweden)

    Volkan Sahin

    2012-03-01

    Conclusion: RPDs with an ARTR and both retainer types with a rigid design produced more strain distal to the abutting teeth. Using more than two abutting teeth did not improve the strain patterns of the tested RPDs. More strain was produced on the posterior edentulous ridges.

  15. Job sculpting: the art of retaining your best people.

    Science.gov (United States)

    Butler, T; Waldroop, J

    1999-01-01

    Hiring good people is tough, but keeping them can be even tougher. The professionals streaming out of today's MBA programs are so well educated and achievement oriented that they could do well in virtually any job. But will they stay? According to noted career experts Timothy Butler and James Waldroop, only if their jobs fit their deeply embedded life interests--that is, their long-held, emotionally driven passions. Butler and Waldroop identify the eight different life interests of people drawn to business careers and introduce the concept of job sculpting, the art of matching people to jobs that resonate with the activities that make them truly happy. Managers don't need special training to job sculpt, but they do need to listen more carefully when employees describe what they like and dislike about their jobs. Once managers and employees have discussed deeply embedded life interests--ideally, during employee performance reviews--they can work together to customize future work assignments. In some cases, that may mean simply adding another assignment to existing responsibilities. In other cases, it may require moving that employee to a new position altogether. Skills can be stretched in many directions, but if they are not going in the right direction--one that is congruent with deeply embedded life interests--employees are at risk of becoming dissatisfied and uncommitted. And in an economy where a company's most important asset is the knowledge, energy, and loyalty of its people, that's a large risk to take.

  16. Method of Retention Control for Compromised Periodontal Bone Support Abutment of Conical Crown Retained Denture

    Directory of Open Access Journals (Sweden)

    Chau-Hsiang Wang

    2010-08-01

    Full Text Available Conical crown-retained dentures (CCRD show a higher survival rate and greater patient satisfaction than transitional removable partial dentures during long-term follow-up. However, unsustainable denture retention force on supporting abutments after initial delivery and loss retention are frequently seen in long-term follow-up of clinical cases. The main causes are insufficient information concerning denture retention designs and the retention-tolerance of the supporting abutments. Monitoring by dental technicians of the quality of dental prostheses is critical. This case report describes an optimal method for CCRD construction that determines and distributes an optimal denture retention force on the supporting abutments to allow the patient to easily remove the denture while ensuring that the CCRD remains in place during physiologic activities. Oral rehabilitation with CCRD should consider the condition of the abutment periodontal support, the interarch occlusal relationship, supplemental fatigue of the terminal abutment, and patient's estimated bite force. The effects of friction on the abutment's inner crown were based on an optimal a angle. The dental laboratory used these measurements to fabricate a CCRD using a Koni-Meter to adjust the retention of the inner crown. This method protects the abutments and reduces the wear between the inner and outer crowns. The CCRD achieved good esthetic results and physiologic functions. Periodic long-term follow-up of the patient and CCRD after initial placement is recommended.

  17. A Socio-Technical Exploration for Reducing & Mitigating the Risk of Retained Foreign Objects

    Science.gov (United States)

    Corrigan, Siobhán; Kay, Alison; O’Byrne, Katie; Slattery, Dubhfeasa; Sheehan, Sharon; McDonald, Nick; Smyth, David; Mealy, Ken; Cromie, Sam

    2018-01-01

    A Retained Foreign Object (RFO) is a fairly infrequent but serious adverse event. An accurate rate of RFOs is difficult to establish due to underreporting but it has been estimated that incidences range between 1/1000 and 1/19,000 procedures. The cost of a RFO incident may be substantial and three-fold: (i) the cost to the patient of physical and/or psychological harm; (ii) the reputational cost to an institution and/or healthcare provider; and (iii) the financial cost to the taxpayer in the event of a legal claim. This Health Research Board-funded project aims to analyse and understand the problem of RFOs in surgical and maternity settings in Ireland and develop hospital-specific foreign object management processes and implementation roadmaps. This project will deploy an integrated evidence-based assessment methodology for social-technical modelling (Supply, Context, Organising, Process & Effects/ SCOPE Analysis Cube) and bow tie methodologies that focuses on managing the risks in effectively implementing and sustaining change. It comprises a multi-phase research approach that involves active and ongoing collaboration with clinical and other healthcare staff through each phase of the research. The specific objective of this paper is to present the methodological approach and outline the potential to produce generalisable results which could be applied to other health-related issues. PMID:29642646

  18. Multinucleated Giant Cancer Cells Produced in Response to Ionizing Radiation Retain Viability and Replicate Their Genome

    Directory of Open Access Journals (Sweden)

    Razmik Mirzayans

    2017-02-01

    Full Text Available Loss of wild-type p53 function is widely accepted to be permissive for the development of multinucleated giant cells. However, whether therapy-induced multinucleation is associated with cancer cell death or survival remains controversial. Herein, we demonstrate that exposure of p53-deficient or p21WAF1 (p21-deficient solid tumor-derived cell lines to ionizing radiation (between 2 and 8 Gy results in the development of multinucleated giant cells that remain adherent to the culture dish for long times post-irradiation. Somewhat surprisingly, single-cell observations revealed that virtually all multinucleated giant cells that remain adherent for the duration of the experiments (up to three weeks post-irradiation retain viability and metabolize 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyl-tetrazolium bromide (MTT, and the majority (>60% exhibit DNA synthesis. We further report that treatment of multinucleated giant cells with pharmacological activators of apoptosis (e.g., sodium salicylate triggers their demise. Our observations reinforce the notion that radiation-induced multinucleation may reflect a survival mechanism for p53/p21-deficient cancer cells. With respect to evaluating radiosensitivity, our observations underscore the importance of single-cell experimental approaches (e.g., single-cell MTT as the creation of viable multinucleated giant cells complicates the interpretation of the experimental data obtained by commonly-used multi-well plate colorimetric assays.

  19. VHL type 2B mutations retain VBC complex form and function.

    Directory of Open Access Journals (Sweden)

    Kathryn E Hacker

    Full Text Available von Hippel-Lindau disease is characterized by a spectrum of hypervascular tumors, including renal cell carcinoma, hemangioblastoma, and pheochromocytoma, which occur with VHL genotype-specific differences in penetrance. VHL loss causes a failure to regulate the hypoxia inducible factors (HIF-1alpha and HIF-2alpha, resulting in accumulation of both factors to high levels. Although HIF dysregulation is critical to VHL disease-associated renal tumorigenesis, increasing evidence points toward gradations of HIF dysregulation contributing to the degree of predisposition to renal cell carcinoma and other manifestations of the disease.This investigation examined the ability of disease-specific VHL missense mutations to support the assembly of the VBC complex and to promote the ubiquitylation of HIF. Our interaction analysis supported previous observations that VHL Type 2B mutations disrupt the interaction between pVHL and Elongin C but maintain partial regulation of HIF. We additionally demonstrated that Type 2B mutant pVHL forms a remnant VBC complex containing the active members ROC1 and Cullin-2 which retains the ability to ubiquitylate HIF-1alpha.Our results suggest that subtypes of VHL mutations support an intermediate level of HIF regulation via a remnant VBC complex. These findings provide a mechanism for the graded HIF dysregulation and genetic predisposition for cancer development in VHL disease.

  20. Retained Myogenic Potency of Human Satellite Cells from Torn Rotator Cuff Muscles Despite Fatty Infiltration.

    Science.gov (United States)

    Koide, Masashi; Hagiwara, Yoshihiro; Tsuchiya, Masahiro; Kanzaki, Makoto; Hatakeyama, Hiroyasu; Tanaka, Yukinori; Minowa, Takashi; Takemura, Taro; Ando, Akira; Sekiguchi, Takuya; Yabe, Yutaka; Itoi, Eiji

    2018-01-01

    Rotator cuff tears (RCTs) are a common shoulder problem in the elderly that can lead to both muscle atrophy and fatty infiltration due to less physical load. Satellite cells, quiescent cells under the basal lamina of skeletal muscle fibers, play a major role in muscle regeneration. However, the myogenic potency of human satellite cells in muscles with fatty infiltration is unclear due to the difficulty in isolating from small samples, and the mechanism of the progression of fatty infiltration has not been elucidated. The purpose of this study was to analyze the population of myogenic and adipogenic cells in disused supraspinatus (SSP) and intact subscapularis (SSC) muscles of the RCTs from the same patients using fluorescence-activated cell sorting. The microstructure of the muscle with fatty infiltration was observed as a whole mount condition under multi-photon microscopy. Myogenic differentiation potential and gene expression were evaluated in satellite cells. The results showed that the SSP muscle with greater fatty infiltration surrounded by collagen fibers compared with the SSC muscle under multi-photon microscopy. A positive correlation was observed between the ratio of muscle volume to fat volume and the ratio of myogenic precursor to adipogenic precursor. Although no difference was observed in the myogenic potential between the two groups in cell culture, satellite cells in the disused SSP muscle showed higher intrinsic myogenic gene expression than those in the intact SSC muscle. Our results indicate that satellite cells from the disused SSP retain sufficient potential of muscle growth despite the fatty infiltration.

  1. A Socio-Technical Exploration for Reducing & Mitigating the Risk of Retained Foreign Objects

    Directory of Open Access Journals (Sweden)

    Siobhán Corrigan

    2018-04-01

    Full Text Available A Retained Foreign Object (RFO is a fairly infrequent but serious adverse event. An accurate rate of RFOs is difficult to establish due to underreporting but it has been estimated that incidences range between 1/1000 and 1/19,000 procedures. The cost of a RFO incident may be substantial and three-fold: (i the cost to the patient of physical and/or psychological harm; (ii the reputational cost to an institution and/or healthcare provider; and (iii the financial cost to the taxpayer in the event of a legal claim. This Health Research Board-funded project aims to analyse and understand the problem of RFOs in surgical and maternity settings in Ireland and develop hospital-specific foreign object management processes and implementation roadmaps. This project will deploy an integrated evidence-based assessment methodology for social-technical modelling (Supply, Context, Organising, Process & Effects/ SCOPE Analysis Cube and bow tie methodologies that focuses on managing the risks in effectively implementing and sustaining change. It comprises a multi-phase research approach that involves active and ongoing collaboration with clinical and other healthcare staff through each phase of the research. The specific objective of this paper is to present the methodological approach and outline the potential to produce generalisable results which could be applied to other health-related issues.

  2. Managers’ Beliefs about Measures to Retain Senior Workforce

    Directory of Open Access Journals (Sweden)

    Reidar J. Mykletun

    2012-08-01

    Full Text Available This paper aims to describe and explain the beliefs of public sector managers regarding measures to promote active ageing within organizations and how these beliefs can relate to their own attitudes, age, gender, organizational roles, and structures. Data were collected by mailed questionnaires from 672 managers on operative and administrative levels in the Norwegian municipal and health sectors. It was found that managers believe in the usefulness of at least seven different measures, identified by factor analyses. Sum scores were calculated from the factors, and five of them showed sufficient reliability. Ranked according to their mean values, the factor-based sum scores were 1 reducing working hours, increasing the number of holidays, and offering flexible part-time schedules without a reduction in wages; 2 reducing workload and demands; 3 increasing wages, pensions, and bonuses; 4 increasing esteem, learning, and job enrichment for the senior workers; and 5 repositioning the workers to other, less demanding parts of the organization. In multiple regression analyses, these sum scores were found to be influenced mainly by the managers’ individual attributes, like age, gender, own retirement plans, beliefs, and attitudes. Organizational and structural factors seemed less important. The findings are discussed within three schools of thought: the ‘Human Relations Model,’ the ‘Market Model,’ and the ‘Age Management Model.’ A fourth ‘school,’ the ‘Laissez-faire Model,’ is indicated by the 26% of managers who claimed no responsibility for the age management issues.

  3. Design basis and requirements for 241-SY Modular Exhauster concrete pad and retaining wall

    International Nuclear Information System (INIS)

    Kriskovich, J.R.

    1994-01-01

    The purpose of this document is to serve as the design and functional requirements for a concrete pad for the new 241-SY Modular Exhauster and for a retaining wall to be built near the new ventilation systems

  4. A new approach to incisor retention--the lingual spur retainer.

    LENUS (Irish Health Repository)

    McNamara, T G

    1996-08-01

    Late lower incisor crowding and incisor rotations remain a problem in orthodontics. We describe a new fixed retainer which is simple to use, allows physiological tooth movement, but prevents rotational and labio-lingual relapse.

  5. Rotational Response of Toe-Restrained Retaining Walls to Earthquake Ground Motions

    National Research Council Canada - National Science Library

    Ebeling, Robert M; White, Barry C

    2006-01-01

    .... The PC software CorpsWallRotate (sometimes referred to as CWRotate) was developed to perform an analysis of permanent wall rotation for each proposed retaining wall section to a user-specified earthquake acceleration time-history...

  6. Masticatory performance and chewing experience with implant-retained mandibular overdentures

    NARCIS (Netherlands)

    Geertman, ME; Slagter, AP; van't Hof, MA; van Waas, MAJ; Kalk, W

    The relationship between masticatory performance and chewing experience has not yet been explored for patients with implant-retained overdentures. Although many relationships have been found between parameters of objective and subjective oral function, the structure of these relationships remain

  7. What is required to retain registered nurses in the public health ...

    African Journals Online (AJOL)

    What is required to retain registered nurses in the public health sector in Malawi? ... public sector in search for better remuneration in the private sector including ... The results indicate that poor salaries, heavy workloads, lack of promotional ...

  8. Effective post-construction best management practices (BMPs) to infiltrate and retain stormwater runoff.

    Science.gov (United States)

    2017-06-01

    Performance analyses of newly constructed linear BMPs in retaining stormwater run-off from 1 in. precipitation in : post-construction highway applications and urban areas were conducted using numerical simulations and field : observation. A series of...

  9. Reliability Analysis of Retaining Walls Subjected to Blast Loading by Finite Element Approach

    Science.gov (United States)

    GuhaRay, Anasua; Mondal, Stuti; Mohiuddin, Hisham Hasan

    2018-02-01

    Conventional design methods adopt factor of safety as per practice and experience, which are deterministic in nature. The limit state method, though not completely deterministic, does not take into account effect of design parameters, which are inherently variable such as cohesion, angle of internal friction, etc. for soil. Reliability analysis provides a measure to consider these variations into analysis and hence results in a more realistic design. Several studies have been carried out on reliability of reinforced concrete walls and masonry walls under explosions. Also, reliability analysis of retaining structures against various kinds of failure has been done. However, very few research works are available on reliability analysis of retaining walls subjected to blast loading. Thus, the present paper considers the effect of variation of geotechnical parameters when a retaining wall is subjected to blast loading. However, it is found that the variation of geotechnical random variables does not have a significant effect on the stability of retaining walls subjected to blast loading.

  10. Implementation of a protocol to reduce occurrence of retained sponges after vaginal delivery.

    Science.gov (United States)

    Lutgendorf, Monica A; Schindler, Lynnett L; Hill, James B; Magann, Everett F; O'Boyle, John D

    2011-06-01

    Retained sponges (gossypiboma) following vaginal delivery are an uncommon occurrence. Although significant morbidity from such an event is unlikely, there are many reported adverse effects, including symptoms of malodorous discharge, loss of confidence in providers and the medical system, and legal claims. To report a protocol intended to reduce the occurrence of retained sponges following vaginal delivery. After identification of limitations with existing delivery room protocols, we developed a sponge count protocol to reduce occurrence of retained vaginal sponges. We report our experience at Naval Medical Center Portsmouth, a large tertiary care military treatment facility with our efforts to implement a sponge count protocol to reduce retained sponges following vaginal delivery. With appropriate pre-implementation training, protocols which incorporate post-delivery vaginal sweep and sponge counts are well accepted by the health care team and can be incorporated into the delivery room routine.

  11. Torque resistance of different stainless steel wires commonly used for fixed retainers in orthodontics

    DEFF Research Database (Denmark)

    Arnold, Dario; Dalstra, Michel; Verna, Carlalberta

    2016-01-01

    Objective: Movements of teeth splinted by fixed retention wires after orthodontic treatment have been observed. The aetiological factors for these movements are unknown. The aim of this in vitro study was to compare the resistance to torque of different stainless steel wires commonly used for fixed...... retainers in orthodontics. Materials and Methods: Torquing moments acting on a retainer wire were measured in a mechanical force testing system by applying buccal crown torque to an upper lateral incisor in both a 3-teeth and in a 2-teeth setup. Seven stainless steel wires with different shape, type (plain...... or a braided 0.016 × 0.022-inch stainless steel wire. A tooth attached by a retainer wire to only one neighbouring tooth is less resistant to torque than a tooth connected to two neighbouring teeth. Annealing a retainer wire with a flame reduces the stiffness of the wire markedly and can lead to a non...

  12. The effects of retained austenite on dry sliding wear behavior of carburized steels

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyung-Jun [Research Inst. of Industrial Science and Technology, Steel Products Dept., Pohang (Korea, Republic of); Kweon, Young-Gak [Research Inst. of Industrial Science and Technology, Steel Products Dept., Pohang (Korea, Republic of)

    1996-04-01

    Ring-on-square tests on two kinds of low-alloy carburized steel which were AISI 8620 and 4140 were carried out to study the dry sliding wear behavior. The influence of different retained austenite level of 6% to 40% was evaluated while trying to eliminate other factors. Test results show that the effects of grain size and carburized steel species are negligible in dry sliding wear behavior. While the influence of retained austenite is negligible at 20 kg load condition, wear resistance is decreased at 40 kg load condition as the retained austenite level is increased from 6% to 30%. However, wear resistance is again increased above about 30% of retained austenite level at 40 kg load condition. (orig.)

  13. New developments in ultrasonic inspection of retaining rings on generators in operation

    International Nuclear Information System (INIS)

    Koch-Mathian, A.

    1990-01-01

    The ultrasonic inspection of retaining rings of operating generators has been operational since 1986. The aim of this presentation is to outline the experience acquired on many retaining rings on different types of generators. In-situ inspections have made it possible to detect more exactly the different shape echoes for the various elements located beneath the retaining ring such as rotor teeth, damping and epoxy insulation. Various methods of identifying these parts are currently being developed. Investigation on corroded retaining rings has made it possible to demonstrate the close correlation between the transverse beam detection and the presence of actual cracks identified by micrograph. The specific facies of these cracks precludes the use of classic dimensioning techniques, but a method based on longitudinal wave detection has already given encouraging results

  14. Development of an earth pressure model for design of earth retaining structures in piedmont soil.

    Science.gov (United States)

    2008-10-01

    Anecdotal evidence suggests that earth pressure in Piedmont residual soils is typically over estimated. Such estimates of earth pressure impact the design of earth retaining structures used on highway projects. Thus, the development of an appropriate...

  15. General requirements for pressure-retaining systems and components in CANDU nuclear power plants

    International Nuclear Information System (INIS)

    1991-11-01

    This standard specifies the general requirements for the design, fabrication and installation of pressure-retaining systems, components, and their supports in CANDU nuclear power plants. (16 figs., 2 tabs., 25 refs.)

  16. Singularities of marketing activities of small businesses: attracting and retaining customers

    Directory of Open Access Journals (Sweden)

    Roshchak Dmitrii Aleksandrovich

    2013-04-01

    Full Text Available The article deals with the use of internet marketing in general, and tools such as blogging, in particular with a view to establishing a system of customer relationship management: recruitment and retention. The article describes the most effective techniques to enhance the customer base. Common errors and the use of this tool by other companies of small and medium businesses are specified. Particular attention is paid to low-budget methods of "guerrilla" techniques by which these companies can achieve their goals and build an effective marketing strategy.

  17. Green Synthesized Silver Nanoparticles Exhibit Reduced Toxicity to Mammalian Cells and Retain Antimicrobial Activity

    Science.gov (United States)

    The interest in silver nanoparticles (AgNPs) and silver nanomaterial stems from their antimicrobial properties. AgNPs are being added to clothing, paint, refrigerators, washing machines and a variety of other commercially available items. Recent in vitro and in vivo studies, howe...

  18. Novel short chain chloroquine analogues retain activity against chloroquine resistant K1 Plasmodium falciparum.

    Science.gov (United States)

    Stocks, Paul A; Raynes, Kaylene J; Bray, Patrick G; Park, B Kevin; O'Neill, Paul M; Ward, Stephen A

    2002-11-07

    A series of short chain chloroquine (CQ) derivatives have been synthesized in one step from readily available starting materials. The diethylamine function of CQ is replaced by shorter alkylamine groups (4-9) containing secondary or tertiary terminal nitrogens. Some of these derivatives are significantly more potent than CQ against a CQ resistant strain of Plasmodium falciparum in vitro. We conclude that the ability to accumulate at higher concentrations within the food vacuole of the parasite is an important parameter that dictates their potency against CQ sensitive and the chloroquine resistant K1 P. falciparum.

  19. Veterans Health Administration: Actions Needed to Better Recruit and Retain Clinical and Administrative Staff

    Science.gov (United States)

    2017-03-22

    This Study VHA’s ability to attract, hire, and retain top talent is critical to its mission to provide quality and timely care for our nation’s...States’ military operations in Afghanistan and Iraq and the growing needs of an aging veteran population. Attracting, hiring, and retaining top talent ...police, and housekeepers.7 These employees are covered by three types of personnel systems:8 • Title 5 of the U.S. Code (Title 5): The majority of

  20. Experimental assessment of dry stone retaining wall stability on a rigid foundation

    OpenAIRE

    Villemus , B.; Morel , J.C.; Boutin , C.

    2007-01-01

    International audience; Dry stone masonry retaining walls are present in the majority of mountainous areas all around the world, but the technique is marginal today in developed countries. The emergence of the concept of sustainable development calls for renewed use of this technique, both for the repair of existing retaining walls and the building of new ones. The objective of this research was to seek the knowledge necessary to ensure the stability of these structures, using experimental in...

  1. Effects of Geofoam Panels on Static Behavior of Cantilever Retaining Wall

    OpenAIRE

    Navid Hasanpouri Notash; Rouzbeh Dabiri

    2018-01-01

    Geofoam is one of the geosynthetic products that can be used in geotechnical applications. According to researches, expanded polystyrene (EPS) geofoam placed directly against a rigid retaining wall has been proposed as a strategy to reduce static loads on the wall. This study employed a finite difference analysis using a 2-D FLAC computer program by considering yielding and nonyielding states for retaining walls to explore the effectiveness of geofoam panels in improving the static performanc...

  2. Magnet retained cheek plumper in complete denture esthetics: a case report.

    Directory of Open Access Journals (Sweden)

    Suryakant Chhagan Deogade

    2014-02-01

    Full Text Available This clinical report describes a technique to improve support for sunken cheeks using magnet retained detachable acrylic cheek plumpers. The new generation of magnets with improved technology provides sufficient denture retention for clinical application. However, further follow-up may be necessary to ascertain the long-term usefulness of the magnet-retained prosthesis, because of corrosion and further loss of magnetism.

  3. Macroscopic and histological characteristics of retained placenta: A prospectively collected case-control study.

    Science.gov (United States)

    Endler, Margit; Saltvedt, Sissel; Papadogiannakis, Nikos

    2016-05-01

    Retained placenta is a potentially fatal obstetric disorder due to postpartum hemorrhage, its pathophysiology is however unknown. We aimed to assess if retained placenta was associated with increased macroscopic and histological signs of placental maternal underperfusion, a pattern otherwise seen in preeclampsia and other disorders of defective placentation. This was a case-control study of retained (n = 49) and non-retained (n = 47) placentas, collected from full-term singleton and otherwise healthy pregnancies, carried out at a tertiary level obstetric department. Macroscopic and histological analysis was performed. Signs of maternal placental underperfusion and signs of placental inflammation, fetal vascular thrombo-occlusive disease and increased placental attachment were recorded in a primary and secondary analysis respectively. Variables were compared groupwise using unconditional logistic regression or comparison of median or mean values. Compared to non-retained placentas retained placentas had a significantly smaller surface area (p = 0.05), were more oblong in shape (OR 5.24 95% CI:1.34-20.21) and showed overall more signs of maternal underperfusion (OR 2.52 95% CI: 1.07-5.87). There was no significant difference in signs of placental inflammation, fetal vascular thrombo-occlusive disease or placenta accreta but basal plate myometrial fibers were more common among retained placentas. In regard to shape, surface area and histological signs of maternal placental underperfusion, retained placentas showed a histological pattern similar to that seen in preeclamptic placentas. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. A rare case report of hysterotomy for retained placenta accreta in bicornuate uterus

    OpenAIRE

    Reena Sharma; Amit Gupta; Usha K. Chaudhary; Ajay Sharma; Arvind Kumar

    2015-01-01

    Retained placenta is a common third stage complication. Placenta accreta is due to abnormal invasive placental implantation. Many cases of Post-partum haemorrhage (PPH) are caused by placenta accreta and may lead to peripartum hysterectomy. We here report a case of placenta accreta in a patient following two failed attempts of manual removal of retained placenta followed by conservative management with methotrexate in stable patient. Both attempts were unsuccessful and led to septicaemia, req...

  5. The effects of fixed and removable orthodontic retainers: a systematic review

    Directory of Open Access Journals (Sweden)

    Dalya Al-Moghrabi

    2016-07-01

    Full Text Available Abstract Objective In the view of the widespread acceptance of indefinite retention, it is important to determine the effects of fixed and removable orthodontic retainers on periodontal health, survival and failure rates of retainers, cost-effectiveness, and impact of orthodontic retainers on patient-reported outcomes. Methods A comprehensive literature search was undertaken based on a defined electronic and gray literature search strategy (PROSPERO: CRD42015029169. The following databases were searched (up to October 2015; MEDLINE via OVID, PubMed, the Cochrane Central Register of Controlled Trials, LILACS, BBO, ClinicalTrials.gov, the National Research Register, and ProQuest Dissertation and Thesis database. Randomized and non-randomized controlled clinical trials, prospective cohort studies, and case series (minimum sample size of 20 with minimum follow-up periods of 6 months reporting periodontal health, survival and failure rates of retainers, cost-effectiveness, and impact of orthodontic retainers on patient-reported outcomes were identified. The Cochrane Collaboration’s Risk of Bias tool and Newcastle-Ottawa Scale were used to assess the quality of included trials. Results Twenty-four studies were identified, 18 randomized controlled trials and 6 prospective cohort studies. Of these, only 16 were deemed to be of high quality. Meta-analysis was unfeasible due to considerable clinical heterogeneity and variations in outcome measures. The mean failure risk for mandibular stainless steel fixed retainers bonded from canine to canine was 0.29 (95 % confidence interval [CI] 0.26, 0.33 and for those bonded to canines only was 0.25 (95 % CI: 0.16, 0.33. A meta-regression suggested that failure of fixed stainless steel mandibular retainers was not directly related to the period elapsed since placement (P = 0.938. Conclusion Further well-designed prospective studies are needed to elucidate the benefits and potential harms associated with

  6. Basic fracture toughness requirements for ferritic materials of nuclear class pressure retaining equipment in NPP

    International Nuclear Information System (INIS)

    Ning Dong; Yao Weida

    2005-01-01

    In this paper, theory basis on cold brittleness and anti-brittle fracture design of ferritic materials are introduced summarily and fracture toughness requirements for ferritic materials in ASME code for nuclear safety class pressure retaining equipment in NPP are summarized and evaluated. The results show that notch impact toughness requirements for materials relate to nuclear safety class of materials so as to ensure that brittle fracture of retaining pressure boundary in NPP can not occur. (authors)

  7. The stability of retained austenite at different locations during straining of I&Q&P steel

    Energy Technology Data Exchange (ETDEWEB)

    Song, Chenghao [School of Materials Science and Engineering, University of Science & Technology Beijing, 30 Xueyuan Road, Haidian District, Beijing 100083 (China); Yu, Hao, E-mail: yuhao@ustb.edu.cn [School of Materials Science and Engineering, University of Science & Technology Beijing, 30 Xueyuan Road, Haidian District, Beijing 100083 (China); Li, Lili; Zhou, Tao; Lu, Jun [School of Materials Science and Engineering, University of Science & Technology Beijing, 30 Xueyuan Road, Haidian District, Beijing 100083 (China); Liu, Xihui [Qingzhou Construction Quality and Safety Supervision Station, Shandong 262500 (China)

    2016-07-18

    This paper presents a detailed investigation of the transformation behavior of retained austenite at different locations of intercritical heating, quenching and partitioning (I&Q&P) steel. The consumption of retained austenite at different strains is investigated by X-ray diffraction (XRD). Results indicate that retained austenite can transform into martensite progressively during the whole deformation process, which is in favor of a good combination of strength and ductility, contributing to a high product of strength and elongation (PSE) of 31.9 GPa%. The transformation characteristics of retained austenite at different locations after different strains are characterized by electron back scattered diffraction (EBSD) and transmission electron microscopy (TEM). Results show that the transformation preferentially occurs in the retained austenite at ferrite grain boundaries, subsequently the one within ferrite grains (at 10% strain) and eventually the one between martensite laths (at 15% strain). In FCC phase, the average local misorientations are 0.547° and 0.674° at 5% and 10% strain, respectively; however, the values are not more than 0.7° at 15% and 20% strain due to the TRIP effect. For the retained austenite within ferrite grains, the interior part preferentially transforms into twin martensite, while the interface still remains due to alloying elements segregation.

  8. Bonded versus vacuum-formed retainers: a randomized controlled trial. Part 1: stability, retainer survival, and patient satisfaction outcomes after 12 months.

    Science.gov (United States)

    Forde, Katherine; Storey, Madeleine; Littlewood, Simon J; Scott, Paul; Luther, Friedy; Kang, Jing

    2017-10-20

    There is a shortage of evidence on the best type of retainer. Evaluate upper and lower bonded retainers (BRs) versus upper and lower vacuum-formed retainers (VFRs) over 12 months, in terms of stability, retainer survival, and patient satisfaction. Two-arm parallel group multi-centre randomized controlled clinical trial. Sixty consecutive patients completing fixed appliance therapy and requiring retainers were recruited from 3 hospital departments. They were randomly allocated to either upper and lower labial segment BRs (n = 30) or upper and lower full-arch VFRs (n = 30). Primary outcome was stability. Secondary outcomes were retainer survival and patient satisfaction. A random sequence of treatment allocation was computer-generated and implemented by sealing in sequentially numbered opaque sealed envelopes independently prepared in advance. Patients, operators and outcome could not be blinded due to the nature of the intervention. Thirty patients received BRs (median [Mdn] age 16 years, inter-quartile range [IQR] = 2) and 30 received VFRs (Mdn age 17 years, IQR = 4). Baseline characteristics were similar between groups. At 12 months, there were no statistically significant inter-group differences in post-treatment change of maxillary labial segment alignment (BR = 1.1 mm, IQR = 1.56, VFR = 0.76 mm, IQR = 1.55, P = 0.61); however, there was greater post-treatment change in the mandibular VFR group (BR = 0.77 mm, IQR = 1.46, VFR = 1.69mm, IQR = 2.00, P = 0.008). The difference in maxillary retainer survival rates were statistically non-significant, P = 0.34 (BR = 63.6%, 239.3 days, 95% confidence interval [CI] = 191.1-287.5, VFR = 73.3%, 311.1 days, 95% CI = 278.3-344.29). The mandibular BR had a lower survival rate (P = 0.01) at 12 months (BR = 50%, 239.3 days 95% CI = 191.1-287.5, VFR = 80%, 324.9 days 95% CI = 295.4-354.4). More subjects with VFRs reported discomfort (P = 0.002) and speech difficulties (P = 0.004) but found them easier to clean than those with

  9. Chloroplast digestion and the development of functional kleptoplasty in juvenile Elysia timida (Risso, 1818 as compared to short-term and non-chloroplast-retaining sacoglossan slugs.

    Directory of Open Access Journals (Sweden)

    Elise Marie Jerschabek Laetz

    Full Text Available Sacoglossan sea slugs are the only metazoans known to perform functional kleptoplasty, the sequestration and retention of functional chloroplasts within their digestive gland cells. Remarkably, a few species with this ability can survive starvation periods of 3-12 months likely due to their stolen chloroplasts. There are no reports of kleptoplast transfer from mother slug to either eggs or juveniles, demonstrating that each animal must independently acquire its kleptoplasts and develop the ability to maintain them within its digestive gland. We present here an investigation into the development of functional kleptoplasty in a long-term kleptoplast retaining species, Elysia timida. Laboratory-reared juvenile slugs of different post-metamorphic ages were placed in starvation and compared to 5 known short-term retaining slug species and 5 non-retaining slug species. The subsequent results indicate that functional kleptoplasty is not performed by E. timida until after 15 days post-metamorphosis and that by 25 days, these animals outlive many of the short-term retention species. Digestive activity was also monitored using lysosomal abundance as an indicator, revealing different patterns in starving juveniles versus adults. Starved juveniles were reintroduced to food to determine any differences in digestive activity when starvation ends, resulting in an increase in the number of kleptoplasts, but no overall change in lysosomal activity. By revealing some of the changes that occur during early development in these animals, which begin as non-kleptoplast-retaining and grow into long-term retaining slugs, this investigation provides a basis for future inquiries into the origin and development of this remarkable ability.

  10. The short- and long-term fates of memory items retained outside the focus of attention.

    Science.gov (United States)

    LaRocque, Joshua J; Eichenbaum, Adam S; Starrett, Michael J; Rose, Nathan S; Emrich, Stephen M; Postle, Bradley R

    2015-04-01

    When a test of working memory (WM) requires the retention of multiple items, a subset of them can be prioritized. Recent studies have shown that, although prioritized (i.e., attended) items are associated with active neural representations, unprioritized (i.e., unattended) memory items can be retained in WM despite the absence of such active representations, and with no decrement in their recognition if they are cued later in the trial. These findings raise two intriguing questions about the nature of the short-term retention of information outside the focus of attention. First, when the focus of attention shifts from items in WM, is there a loss of fidelity for those unattended memory items? Second, could the retention of unattended memory items be accomplished by long-term memory mechanisms? We addressed the first question by comparing the precision of recall of attended versus unattended memory items, and found a significant decrease in precision for unattended memory items, reflecting a degradation in the quality of those representations. We addressed the second question by asking subjects to perform a WM task, followed by a surprise memory test for the items that they had seen in the WM task. Long-term memory for unattended memory items from the WM task was not better than memory for items that had remained selected by the focus of attention in the WM task. These results show that unattended WM representations are degraded in quality and are not preferentially represented in long-term memory, as compared to attended memory items.

  11. 24 CFR 585.406 - Faith-based activities.

    Science.gov (United States)

    2010-04-01

    ... religious organization retains its authority over its internal governance, and it may retain religious terms... that it does not use direct Youthbuild Program funds to support any inherently religious activities...

  12. Retained placenta in Friesian mares : reproductive performance after foal heat breeding versus breeding in a subsequent heat

    NARCIS (Netherlands)

    Sevinga, M; Hesselink, JW; Barkema, H.W.

    2001-01-01

    Postpartum reproductive performance was studied in 54 Friesian brood mares with and 50 without retained placenta. Retained placenta was defined as failure to expel all fetal membranes within 3 hours after the delivery of the foal. The group of mares with retained placenta was subdivided into mares

  13. Fracture strength and bending of all-ceramic and fiber-reinforced composites in inlay-retained fixed partial dentures

    Directory of Open Access Journals (Sweden)

    Serkan Saridag

    2012-06-01

    Conclusions: Zirconia-based ceramic inlay-retained fixed partial dentures demonstrated the highest fracture strength. The fiber-reinforced composite inlay-retained fixed partial dentures demonstrated higher bending values than did the all-ceramic inlay-retained fixed partial dentures.

  14. Fractures Due to Gunshot Wounds: Do Retained Bullet Fragments Affect Union?

    Science.gov (United States)

    Riehl, John T; Connolly, Keith; Haidukewych, George; Koval, Ken

    2015-01-01

    Many types of projectiles, including modern hollow point bullets, fragment into smaller pieces upon impact, particularly when striking bone. This study was performed to examine the effect on time to union with retained bullet material near a fracture site in cases of gunshot injury. All gunshot injuries operatively treated with internal fixation at a Level 1 Trauma Center between March 2008 and August 2011 were retrospectively reviewed. Retained bullet load near the fracture site was calculated based on percentage of material retained compared to the cortical diameter of the involved bone. Analyses were performed to assess the effect of the lead-cortical ratio and amount of comminution on time to fracture union. Thirty-two patients (34 fractures) met the inclusion criteria, with an equal number of comminuted (17) and non-comminuted fractures (17). Seventeen of 34 fractures (50%) united within 4 months, 16/34 (47%) developed a delayed union, and 1/34 (3%) developed a nonunion requiring revision surgery. Sixteen of 17 fractures (94%) that united by 4 months had a cumulative amount of bullet fragmentation retained near the fracture site of less than 20% of the cortical diameter. Nine out of 10 fractures (90%) with retained fragments near the fracture site was equal to or exceeding 20% of the cortical diameter had delayed or nonunion. Fracture comminution had no effect on time to union. The quantity of retained bullet material near the fracture site was more predictive of the rate of fracture union than was comminution. Fractures with bullet fragmentation equal to or exceeding 20% of the cortical width demonstrated a significantly higher rate of delayed union/nonunion compared to those fractures with less retained bullet material, which may indicate a local cytotoxic effect from lead on bone healing. These findings may influence decisions on timing of secondary surgeries. Level III.

  15. Torque resistance of different stainless steel wires commonly used for fixed retainers in orthodontics.

    Science.gov (United States)

    Arnold, Dario T; Dalstra, Michel; Verna, Carlalberta

    2016-06-01

    Movements of teeth splinted by fixed retention wires after orthodontic treatment have been observed. The aetiological factors for these movements are unknown. The aim of this in vitro study was to compare the resistance to torque of different stainless steel wires commonly used for fixed retainers in orthodontics. Torquing moments acting on a retainer wire were measured in a mechanical force testing system by applying buccal crown torque to an upper lateral incisor in both a 3-teeth and in a 2-teeth setup. Seven stainless steel wires with different shape, type (plain, braided, coaxial, or chain) and dimensions were selected for this study. For a torquing angle of 16.2° in the 3-teeth setup torsion moments can vary between 390 cNmm and 3299 cNmm depending on the retainer wire. For the 2-teeth setup the torsion moments are much smaller. Exposure to the flame of a butane-gas torch for 10 seconds to anneal the wire reduces the stiffness of the retainer wire. Clinicians must select wires for fixed retainers very carefully since the difference in resistance to torque is large. A high level of torque control can be achieved with a plain 0.016 × 0.016-inch or a braided 0.016 × 0.022-inch stainless steel wire. A tooth attached by a retainer wire to only one neighbouring tooth is less resistant to torque than a tooth connected to two neighbouring teeth. Annealing a retainer wire with a flame reduces the stiffness of the wire markedly and can lead to a non-uniform and non-reproducible effect.

  16. [Capacity of extensive green roof to retain rainwater runoff in hot and humid region.

    Science.gov (United States)

    Liu, Ming Xin; Dai, Se Ping; Zhou, Tian Yang; Ruan, Lin; Zhang, Qiao Song

    2017-02-01

    The water logging has become the environmental problem of major cities with the sharp increase of impermeable urban pavement as the contributing cause. Abroad, the green roof has been widely used as a practical measure to intercept rainwater, yet the capacity of green roof to retain rainwater varies with climate conditions. As the hot and humid climate zone features high temperature, humidity and precipitation, it is meaningful to study the capacity of green roof to retain rainwater under such climatic condition. In this research, 3 plat forms were set up in Guangzhou in rainy and hot summer to test the capability of simple green roof to retain rainwater runoff, and the efficiency of green roof to retain rainwater under local climate conditions was worked out based on the meteorological observation and data measurement during the 13-month test period. The results showed that the simple green roof with a substrate thickness of 30, 50 and 70 mm could retain 27.2%, 30.9% and 32.1% of precipitation and reduce the average peak value by 18.9%, 26.2% and 27.7%, respectively. Given an urban built-up area of 1035.01 km 2 in Guangzhou and a roof area percentage of approximately 37.3% and assuming the green roofs with 30 mm-thick substrate were applied within the area, the light, medium and heavy rain could be delayed at 72.8%, 22.6% and 17.4%, respectively. Accordingly, the rainwater retained could reach up to 14317×10 4 m 3 . It suggested the great potential of the simple green roof in retaining rainwater. The research could serve as reference for the hot and humid climate zone to alleviate water logging and visualize sponge city construction.

  17. Development of ultrasonic inspection technique for crack detection in retaining rings

    International Nuclear Information System (INIS)

    Brook, M.V.

    1990-01-01

    The majority of retaining rings which are currently in service, are composed of a material which is susceptible to stress corrosion when exposed to moisture. Due to the inherent stress levels in the shrunk-on areas, they are particularly susceptible to stress corrosion attack. Therefore, retaining rings require non-destructive examination to avert catastrophic failure. Guidelines for retaining ring inspection issued by EPRI recommend ultrasonic manual and automated methods of inspection for rings in place. Application of the conventional manual method, using S-waves is difficult, and yields unreliable results. Due to the unreliability factor, utilities have been forced to depend upon surface examination methods, such as visual and penetrant techniques. In most instances, a surface exam will necessitate the costly and potentially damaging removal of the rings from the rotor to provide full access to areas of interest. Due to the various complexities of conventional ultrasonic retaining ring inspections, it is essential that the front end ultrasonics (i.e., transducers and techniques) be optimized to produce the best possible examination. For this reason, AMDATA has developed custom transducers and techniques to enhance automated detection capability of flaws in the various suspect areas of retaining rings. When the optimized techniques are applied to generate the best possible raw data, the Intraspect /98 trademark is then used to reliably apply technique, acquire the data and perform post processing evaluations. One of the most promising ultrasonic techniques for retaining ring inspection is creeping waves. This paper investigates the use of creeping waves for retaining ring inspection

  18. Retained Austenite in SAE 52100 Steel Post Magnetic Processing and Heat Treatment

    Energy Technology Data Exchange (ETDEWEB)

    Pappas, Nathaniel R [ORNL; Watkins, Thomas R [ORNL; Cavin, Odis Burl [ORNL; Jaramillo, Roger A [ORNL; Ludtka, Gerard Michael [ORNL

    2007-01-01

    Steel is an iron-carbon alloy that contains up to 2% carbon by weight. Understanding which phases of iron and carbon form as a function of temperature and percent carbon is important in order to process/manufacture steel with desired properties. Austenite is the face center cubic (fcc) phase of iron that exists between 912 and 1394 C. When hot steel is rapidly quenched in a medium (typically oil or water), austenite transforms into martensite. The goal of the study is to determine the effect of applying a magnetic field on the amount of retained austenite present at room temperature after quenching. Samples of SAE 52100 steel were heat treated then subjected to a magnetic field of varying strength and time, while samples of SAE 1045 steel were heat treated then subjected to a magnetic field of varying strength for a fixed time while being tempered. X-ray diffraction was used to collect quantitative data corresponding to the amount of each phase present post processing. The percentage of retained austenite was then calculated using the American Society of Testing and Materials standard for determining the amount of retained austenite for randomly oriented samples and was plotted as a function of magnetic field intensity, magnetic field apply time, and magnetic field wait time after quenching to determine what relationships exist with the amount of retained austenite present. In the SAE 52100 steel samples, stronger field strengths resulted in lower percentages of retained austenite for fixed apply times. The results were inconclusive when applying a fixed magnetic field strength for varying amounts of time. When applying a magnetic field after waiting a specific amount of time after quenching, the analyses indicate that shorter wait times result in less retained austenite. The SAE 1045 results were inconclusive. The samples showed no retained austenite regardless of magnetic field strength, indicating that tempering removed the retained austenite. It is apparent

  19. The role of psychological ownership in retaining talent: A systematic literature review

    Directory of Open Access Journals (Sweden)

    Chantal Olckers

    2012-02-01

    Full Text Available Orientation: Managing psychological ownership can have positive attitudinal and behavioural effects, promote organisational effectiveness and support talent retention.Research purpose: This paper seeks to explore and describe psychological ownership, distinguish it from other work-related attitudes and clarify the role that psychological ownership can play in retaining talent.Motivation for the study: Previous studies of human resource practices and organisational characteristics that affect organisational commitment and the retention of talent have reported that absent variables could be responsible for varied results. Psychological ownership could be one of them.Research design, approach and method: Based on a systematic review of the literature published over the last 20 years, the authors synthesised various research perspectives into a framework of psychological ownership and its links to retaining talent.Main findings: The authors found that psychological ownership was a comprehensive multidimensional construct. It is distinct from other work-related attitudes and seems capable of enabling organisations to retain the talents of skilled employees.Practical/managerial implications: Organisations can benefit from psychological ownership because it leads employees to feel responsible towards targets (like organisations and to show stewardship. It can help organisations to retain talent and influence the intentions of skilled employees to remain with their organisations.Contribution/value-add: Psychological ownership, as an integrated multidimensional construct, has expanded the existing theory about the organisational commitment and work-related attitudes that organisations need to retain talent in the 21st century.

  20. Postoperative Radiculopathy Caused by a Retained Fractured Pedicle Cannulation Probe and Its Mechanism of Extraction.

    Science.gov (United States)

    Yuk, Frank; Steinberger, Jeremy; Skovrlj, Branko; Mascitelli, Justin; Cho, Samuel K; Caridi, John M

    2017-11-01

    Spine surgery relies heavily on technology and surgical instrumentation. Improperly used instrumentation can be detrimental to the patient. Despite multiple checkpoints to ensure that foreign bodies are not retained in surgery, numerous case reports have described retained foreign bodies; however, none of these cases involve retained instrumentation after open spine surgery. Of the retained objects, 4 were sponges and one was a Jamshidi needle fragment. Although smaller objects are more commonly the culprits, surgical instruments can break off, remain stuck, and cause clinical sequelae. This case presents a retained fractured pedicle finder as the cause of right L5 radiculopathy. To our knowledge, this report is the first to describe an instrumentation-associated postoperative radiculopathy. Because of the strength with which the object was impacted, its extraction proved difficult. The technique of removal using a mallet and osteotome in 4 directions to loosen its hold in the vertebral body. Attempts and eventual successful removal are described. Copyright © 2017 Elsevier Inc. All rights reserved.

  1. CT findings of foreign body reaction to retained endoloop ligature plastic tube mimicking acute appendicitis: A case report

    Energy Technology Data Exchange (ETDEWEB)

    Ahn, Jae Hong; Kang, Chae Hoon; Choi, Soo Jung; Park, Man Soo; Jung, Seung Mun; Ryu, Dae Shick; Shin, Dong Rock [Dept. of Radiology, GangNeung Asan Hospital, University of Ulsan College of Medicine, Gangneung (Korea, Republic of)

    2016-07-15

    Many hospitals experience one or more retained surgical instrument events with risk of patient morbidity and medicolegal problems. Identification of retained surgical instrument is important. The radiologists should be familiar with imaging finding of retained surgical instrument. In a 62-year-old female with a retained plastic tube, localized peritoneal infiltration around air-containing tubular structure mimicked acute appendicitis on abdomen computed tomography (CT), one year after laparoscopic cholecystectomy. We reported CT findings of foreign body reaction related to retained Endoloop ligature plastic tube mimicking acute appendicitis.

  2. CT Findings of Foreign Body Reaction to a Retained Endoloop Ligature Plastic Tube Mimicking Acute Appendicitis: A Case Report

    Energy Technology Data Exchange (ETDEWEB)

    Ahn, Jae Hong; Kang, Chae Hoon; Choi, Soo-Jung; Park, Man Soo; Jung, Seung Mun; Ryu, Dae Shick; Shin, Dong Rock [Department of Radiology, Asan Foundation, GangNeung Asan Hospital, University of Ulsan College of Medicine, Gangneung 25440 (Korea, Republic of)

    2016-11-01

    Many hospitals experience one or more retained surgical instrument events with risk of patient morbidity and medicolegal problems. Identification of retained surgical instrument is important. The radiologists should be familiar with imaging finding of retained surgical instrument. In a 62-year-old female with a retained plastic tube, localized peritoneal infiltration around air-containing tubular structure mimicked acute appendicitis on abdomen computed tomography (CT), one year after laparoscopic cholecystectomy. We reported CT findings of foreign body reaction related to retained Endoloop ligature plastic tube mimicking acute appendicitis.

  3. CT findings of foreign body reaction to retained endoloop ligature plastic tube mimicking acute appendicitis: A case report

    International Nuclear Information System (INIS)

    Ahn, Jae Hong; Kang, Chae Hoon; Choi, Soo Jung; Park, Man Soo; Jung, Seung Mun; Ryu, Dae Shick; Shin, Dong Rock

    2016-01-01

    Many hospitals experience one or more retained surgical instrument events with risk of patient morbidity and medicolegal problems. Identification of retained surgical instrument is important. The radiologists should be familiar with imaging finding of retained surgical instrument. In a 62-year-old female with a retained plastic tube, localized peritoneal infiltration around air-containing tubular structure mimicked acute appendicitis on abdomen computed tomography (CT), one year after laparoscopic cholecystectomy. We reported CT findings of foreign body reaction related to retained Endoloop ligature plastic tube mimicking acute appendicitis

  4. Becoming partners, retaining autonomy: ethical considerations on the development of precision medicine.

    Science.gov (United States)

    Blasimme, Alessandro; Vayena, Effy

    2016-11-04

    Precision medicine promises to develop diagnoses and treatments that take individual variability into account. According to most specialists, turning this promise into reality will require adapting the established framework of clinical research ethics, and paying more attention to participants' attitudes towards sharing genotypic, phenotypic, lifestyle data and health records, and ultimately to their desire to be engaged as active partners in medical research.Notions such as participation, engagement and partnership have been introduced in bioethics debates concerning genetics and large-scale biobanking to broaden the focus of discussion beyond individual choice and individuals' moral interests. The uptake of those concepts in precision medicine is to be welcomed. However, as data and medical information from research participants in precision medicine cohorts will be collected on an individual basis, translating a participatory approach in this emerging area may prove cumbersome. Therefore, drawing on Joseph Raz's perfectionism, we propose a principle of respect for autonomous agents that, we reckon, can address many of the concerns driving recent scholarship on partnership and public participation, while avoiding some of the limitations these concept have in the context of precision medicine. Our approach offers a normative clarification to how becoming partners in precision is compatible with retaining autonomy.Realigning the value of autonomy with ideals of direct engagement, we show, can provide adequate normative orientation to precision medicine; it can do justice to the idea of moral pluralism by stressing the value of moral self-determination: and, finally, it can reconcile the notion of autonomy with other more communitarian values such as participation and solidarity.

  5. Rehabilitation of maxillary arch with attachment-retained mesh-reinforced single complete denture

    Science.gov (United States)

    Vamsi Krishna, C H; Rao, A Kaleshwar; Sekhar, N Chandra; Shastry, Y Mahadev

    2014-01-01

    Fabrication of conventional complete dentures was one of the most commonly advised treatment options to mange edentulous patients since many years. One of the commonly encountered challenging tasks in prosthodontics is a clinical situation in which patients have maxillary completely edentulous arches opposing mandibular natural dentition. This situation can be effectively managed by retaining some of the natural teeth as overdenture abutments. Tooth supported overdenture retained by attachments will improve retention, support and stability, and reduces rate of ridge resorption along with psychological benefits to the patients by providing tactile sensation. The present case report describes management of patients with edentulous maxillary arch opposing natural mandibular dentition-rehabilitated attachment-retained mesh-reinforced overdenture. PMID:24574522

  6. Chronic Actinomyces Infection Caused by Retained Cervical Cerclage: A Case Report.

    Science.gov (United States)

    Lyttle, Brianna; Johnson, Julia V

    2016-01-01

    Historically, Actinomyces infection has been associated primarily with the intrauterine device. Recently, case reports associating Actinomyces with other implants have been described, including nonwoven polypropylene mesh used for urethral slings and Mersilene cerclage placements. However, there are no reported cases of chronic Actinomyces infections associated with retained Mersilene cerclage. A 51-year-old woman, gravida 3, para 3, presented with a 10-year history of vaginal discharge and Actinomyces identified on endometrial biopsy. After failing medical treatment and undergoing a hysterectomy, the patient was found to have a retained Mersilene cerclage. This is the first case to report persistent Actinomyces infection with a retained Mersilene cerclage. No current recommendations exist for assessing full removal of cerclage. Clinicians should have a high suspicion of Actinomyces infection in a patient who presents with persistent vaginal discharge and history of cerclage placement.

  7. Rehabilitation of maxillary arch with attachment-retained mesh-reinforced single complete denture.

    Science.gov (United States)

    Vamsi Krishna, C H; Rao, A Kaleshwar; Sekhar, N Chandra; Shastry, Y Mahadev

    2014-02-26

    Fabrication of conventional complete dentures was one of the most commonly advised treatment options to mange edentulous patients since many years. One of the commonly encountered challenging tasks in prosthodontics is a clinical situation in which patients have maxillary completely edentulous arches opposing mandibular natural dentition. This situation can be effectively managed by retaining some of the natural teeth as overdenture abutments. Tooth supported overdenture retained by attachments will improve retention, support and stability, and reduces rate of ridge resorption along with psychological benefits to the patients by providing tactile sensation. The present case report describes management of patients with edentulous maxillary arch opposing natural mandibular dentition-rehabilitated attachment-retained mesh-reinforced overdenture.

  8. An orthodontic device for retaining implanted radioactive sources during brachytherapy for cancer of the oral cavity

    International Nuclear Information System (INIS)

    Masuko, Noriko; Katsura, Kouji; Sugita, Tadashi; Sakai, Kunio; Sato, Katsurou; Kawana, Masahiro; Nonomura, Naobumi

    2000-01-01

    An orthodontic retainer was devised to keeping implanted radioactive sources in position and improve the quality of life during brachytherapy for cancer of the oral cavity. The retainer was used in 3 patients with oral cancer, one with cancer of the hard palate, one with cancer of the soft palate, and one with cancer of the floor of mouth, during brachytherapy using 198 Au grains and 137 Cs needles. These patients could speak freely. One with cancer of the hard palate could drink water and ingest semi-liquid food during treatment instead of nasal tube feeding. The plaster dental model obtained while making the retainer proved to be useful for training radiation oncologists. (author)

  9. Assessing the MR compatibility of dental retainer wires at 7 Tesla.

    Science.gov (United States)

    Wezel, Joep; Kooij, Bert Jan; Webb, Andrew G

    2014-10-01

    To determine the MR compatibility of common dental retainer wires at 7 Tesla in terms of potential RF heating and magnetic susceptibility effects. Electromagnetic simulations and experimental results were compared for dental retainer wires placed in tissue-mimicking phantoms. Simulations were then performed for a human model with wire in place. Finally, image quality was assessed for different scanning protocols and wires. Simulations and experimental data in phantoms agreed well, with the length of the wire correlating to maximum heating in phantoms being approximately 47 mm. Even in this case, no substantial heating occurs when scanning within the specific absorption rate (SAR) guidelines for the head. Image distortions from the most ferromagnetic dental wire were not significant for any brain region. Dental retainer wires appear to be MR compatible at 7 Tesla. Copyright © 2013 Wiley Periodicals, Inc.

  10. An experimental study on oil supply in a space bearing with an oil-impregnated retainer

    Science.gov (United States)

    Liu, Jianhai; Fan, Youwen; Wen, Shizhu

    1993-06-01

    Parched elastohydrodynamic lubrication (EHL) film thickness in a space ball bearing is measured by electrical capacitance and resistance, and parched transients of oil film and lubricant breakdown are observed. With different oil-impregnated polymer retainers, which are employed as oil supply resources, parched degradation is restricted to some degree, even lubricant breakdown disappears and a steady state of the oil film is produced. A long-term space bail bearing demands both the lowest driving torque and a steady state oil film, which depends on a strictly controlled oil supply from oil-impregnated retainers. The results of this experimental research describe the effects of oil supply by amounts of oil in retainers on parched EHL.

  11. Rigidly framed earth retaining structures thermal soil structure interaction of buildings supporting unbalanced lateral earth pressures

    CERN Document Server

    Aboumoussa, Walid

    2014-01-01

    Structures placed on hillsides often present a number of challenges and a limited number of economical choices for site design. An option sometimes employed is to use the building frame as a retaining element, comprising a Rigidly Framed Earth Retaining Structure (RFERS). The relationship between temperature and earth pressure acting on RFERS, is explored in this monograph through a 4.5 year monitoring program of a heavily instrumented in service structure. The data indicated that the coefficient of earth pressure behind the monitored RFERS had a strong linear correlation with temperature. The study also revealed that thermal cycles, rather than lateral earth pressure, were the cause of failure in many structural elements. The book demonstrates that depending on the relative stiffness of the retained soil mass and that of the structural frame, the developed lateral earth pressure, during thermal expansion, can reach magnitudes several times larger than those determined using classical earth pressure theories....

  12. Systemic Presentation of Retained Foreign Body in the Peritoneal Cavity (Gossypiboma

    Directory of Open Access Journals (Sweden)

    S Mehrabi

    2010-04-01

    Full Text Available Introduction & Objective: One of the infrequent complications of surgical operations is retained foreign body in body cavities which lead to morbidity and mortality for patients and also medico-legal problems for surgeons. Gossypiboma is an uncommon surgical complication, which is defined as a mass or cystic lesion due to retained surgical sponge in the abdominal cavity. Retained foreign body causes abscess, fistula, mass, obstruction after surgical operations and is diagnosed by x ray evaluation. In all patients, it is presented with pain, palpable mass. The infected post operation retained foreign bodies should be considered in differential diagnosis. In this study, we reported a patient with systemic presentation of retained two foreign bodies (surgical sponge in abdominal cavity. Case: The patient is a 32 years old female, which after cesarean section in 2008 developed abdominal pain, anorexia, and weight loss. The patient was referred to a specialist, and para-clinical checkup was done on her. In sonography and CT-scan, two cystic lesions with calcified wall were reported in the left and right sides of the abdomen. Then, the patient was referred to a surgeon with the diagnosis of hydatid cyst. During operation, cystic lesion with adhesion to viscera in the right side of the abdomen and a mass lesion in the descending colon in the left side were seen.The pathology report showed a surgical sponge in the right cystic lesion and surgical towel in the descending colon. Conclusion: Retained foreign bodies should be considered in differential diagnosis of any post operative patients who are presented with pain, infection, or palpable mass.

  13. Effect of small addition of Cr on stability of retained austenite in high carbon steel

    Energy Technology Data Exchange (ETDEWEB)

    Hossain, Rumana; Pahlevani, Farshid, E-mail: f.pahlevani@unsw.edu.au; Sahajwalla, Veena

    2017-03-15

    High carbon steels with dual phase structures of martensite and austenite have considerable potential for industrial application in high abrasion environments due to their hardness, strength and relatively low cost. To design cost effective high carbon steels with superior properties, it is crucial to identify the effect of Chromium (Cr) on the stability of retained austenite (RA) and to fully understand its effect on solid-state phase transition. This study addresses this important knowledge gap. Using standard compression tests on bulk material, quantitative X-ray diffraction analysis, nano-indentation on individual austenitic grains, transmission electron microscopy and electron backscatter diffraction–based orientation microscopy techniques, the authors investigated the effect of Cr on the microstructure, transformation behaviour and mechanical stability of retained austenite in high carbon steel, with varying Cr contents. The results revealed that increasing the Cr %, altered the morphology of the RA and increased its stability, consequently, increasing the critical pressure for martensitic transformation. This study has critically addressed the elastoplastic behaviour of retained austenite – and provides a deep understanding of the effect of small additions of Cr on the metastable austenite of high carbon steel from the macro- to nano-level. Consequently, it paves the way for new applications for high carbon low alloy steels. - Highlights: • Effect of small addition of Cr on metastable austenite of high carbon steel from the macro- to nano-level • A multi-scale study of elastoplastic behaviour of retained austenite in high carbon steel • The mechanical stability of retained austenite during plastic deformation increased with increasing Cr content • Effect of grain boundary misorientation angle on hardness of individual retained austenite grains in high carbon steel.

  14. Is magnetic resonance imaging safe for patients with retained metal fragments from combat and terrorist attacks?

    International Nuclear Information System (INIS)

    Eshed, Iris; Kushnir, Tamar; Shabshin, Noga; Konen, Eli

    2010-01-01

    Background: Increasing numbers of military confrontations and terrorist attacks have led to increasing reports of retained metal fragments among patients referred for magnetic resonance imaging (MRI). The potential hazard of retained metal fragments for patients undergoing MRI has been studied among patients with retained metal fragments from domestic violence but not from combat and terrorist attacks. Purpose: To retrospectively evaluate the safety of MRI in patients with subcutaneous warfare-metal fragments. Material and Methods: 10,322 consecutive metal screening forms of patients scheduled for 1.5 Tesla (T) MR examination were retrospectively reviewed. All patients reported to have retained metal fragments were contacted by telephone and asked to describe the event in which they were exposed to the fragments and for any adverse sequelae or sensations during and after MRI. Their radiographs were evaluated for the number and size of the fragments. The data were analyzed for correlations between these factors. Results: Seven of the 24 patients who reported retained metal fragments were excluded, since there was no validating evidence of their presence. Fragments in the remaining 17 patients (18 MRI examinations) were inflicted by military or terrorist attacks that occurred 2-39 years prior to the MRI. The fragment size ranged between 1 and 10 mm. One patient reported a superficial migration of a 10-mm fragment after MRI. No other adverse reactions were reported. Conclusion: Conducting 1.5T MRI examinations is safe in patients with retained metal fragments from combat and terrorist attacks not in the vicinity of vital organs. However, caution is advised.

  15. Is magnetic resonance imaging safe for patients with retained metal fragments from combat and terrorist attacks?

    Energy Technology Data Exchange (ETDEWEB)

    Eshed, Iris; Kushnir, Tamar; Shabshin, Noga; Konen, Eli (Dept. of Diagnostic Imaging, Sheba Medical center, Tel Hashomer, Sackler School of Medicine, Tel Aviv Univ., Tel Aviv (Israel)), e-mail: iris.eshed@sheba.health.gov.il

    2010-03-15

    Background: Increasing numbers of military confrontations and terrorist attacks have led to increasing reports of retained metal fragments among patients referred for magnetic resonance imaging (MRI). The potential hazard of retained metal fragments for patients undergoing MRI has been studied among patients with retained metal fragments from domestic violence but not from combat and terrorist attacks. Purpose: To retrospectively evaluate the safety of MRI in patients with subcutaneous warfare-metal fragments. Material and Methods: 10,322 consecutive metal screening forms of patients scheduled for 1.5 Tesla (T) MR examination were retrospectively reviewed. All patients reported to have retained metal fragments were contacted by telephone and asked to describe the event in which they were exposed to the fragments and for any adverse sequelae or sensations during and after MRI. Their radiographs were evaluated for the number and size of the fragments. The data were analyzed for correlations between these factors. Results: Seven of the 24 patients who reported retained metal fragments were excluded, since there was no validating evidence of their presence. Fragments in the remaining 17 patients (18 MRI examinations) were inflicted by military or terrorist attacks that occurred 2-39 years prior to the MRI. The fragment size ranged between 1 and 10 mm. One patient reported a superficial migration of a 10-mm fragment after MRI. No other adverse reactions were reported. Conclusion: Conducting 1.5T MRI examinations is safe in patients with retained metal fragments from combat and terrorist attacks not in the vicinity of vital organs. However, caution is advised.

  16. Kinked and retained nasogastric tube in polytrauma patient; a case report

    Directory of Open Access Journals (Sweden)

    Kumar Ashok

    2017-06-01

    Full Text Available Enteral feeding is an important and preferred technique of feeding in head injury patient to provide nutrition. As inadequate nutrition causes decrease in physical ability, neurological impairment and takes a long time for improvement or delayed deterioratation. With our best knowledge kinked and retained nasogastric tube in stomach is a very rare complication of feeding in head injuries patients. Predisposing factors that can cause kinking is excess tube length, tube in situ for long time and small bore tube. We are reporting one such case of kinked and retained nasogastric tube in the stomach of a polytrauma patient which was retrieved by upper GI endoscope.

  17. Kinetics modeling of delta-ferrite formation and retainment during casting of supermartensitic stainless steel

    DEFF Research Database (Denmark)

    Nießen, Frank; Tiedje, Niels Skat; Hald, John

    2017-01-01

    The kinetics model for multi-component diffusion DICTRA was applied to analyze the formation and retainment of δ-ferrite during solidification and cooling of GX4-CrNiMo-16-5-1 cast supermartensitic stainless steel. The obtained results were compared with results from the Schaeffler diagram......, equilibrium calculations and the Scheil model in Thermo-Calc, and validated by using microscopy and energy dispersive X-ray spectroscopy for chemical analysis on a cast ingot. The kinetics model showed that micro-segregation from solidification homogenizes within 2–3 s (70 °C) of cooling, and that retained δ...

  18. A technique for the management of screw access opening in cement-retained implant restorations

    Directory of Open Access Journals (Sweden)

    Hamid Kermanshah

    2014-01-01

    Full Text Available Introduction: Abutment screw loosening has been considered as a common complication of implant-supported dental prostheses. This problem is more important in cement-retained implant restorations due to their invisible position of the screw access opening. Case Report: This report describes a modified retrievability method for cement-retained implant restorations in the event of abutment screw loosening. The screw access opening was marked with ceramic stain and its porcelain surface was treated using hydrofluoric acid (HF, silane, and adhesive to bond to composite resin. Discussion: The present modified technique facilitates screw access opening and improves the bond between the porcelain and composite resin.

  19. Evolution of the Stability Work from Classic Retaining Walls to Mechanically Stabilized Earth Walls

    Directory of Open Access Journals (Sweden)

    Anghel Stanciu

    2008-01-01

    Full Text Available For the consolidation of soil mass and the construction of the stability works for roads infrastructure it was studied the evolution of these kinds of works from classical retaining walls - common concrete retaining walls, to the utilization in our days of the modern and competitive methods - mechanically stabilized earth walls. Like type of execution the variety of the reinforced soil is given by the utilization of different types of reinforcing inclusions (steel strips, geosynthetics, geogrids or facing (precast concrete panels, dry cast modular blocks, metal sheets and plates, gabions, and wrapped sheets of geosynthetics.

  20. Textiloma, migration of retained long gauze from abdominal cavity to intestine

    Directory of Open Access Journals (Sweden)

    Hojjat Molaei Govarjin

    2010-01-01

    Full Text Available Retaining of long gauzes and surgical sponges in the abdomen is one of the most frequent medical errors usually manifests as abscess or abdomino- cutaneus fistulas and with no definite symptoms during lifetime. Here, we introduce a 35 year old woman with an intestino-cutaneal fistula caused by retained long gauze in the abdomen entered the terminal ileum,9 months after cesarean section. This is called “Textiloma”. There is no report of textiloma in Iran and there are only a few cases in the world.

  1. Survival of bonded lingual retainers with chemical or photo polymerization over a 2-year period: a single-center, randomized controlled clinical trial.

    Science.gov (United States)

    Pandis, Nikolaos; Fleming, Padhraig S; Kloukos, Dimitrios; Polychronopoulou, Argy; Katsaros, Christos; Eliades, Theodore

    2013-08-01

    The objective of this trial was to compare the survival rates of mandibular lingual retainers bonded with either chemically cured or light-cured adhesive after orthodontic treatment. Patients having undergone orthodontic treatment at a private orthodontic office were randomly allocated to fixed retainers placed with chemically cured composite or light-cured composite. Eligibility criteria included no active caries, restorations, or fractures on the mandibular anterior teeth, and adequate oral hygiene. The main outcome was any type of first-time lingual retainer breakage; pattern of failure (adapted adhesive remnant index scores) was a secondary outcome. Randomization was accomplished with random permuted blocks of 20 patients with allocation concealed in sequentially numbered, opaque, sealed envelopes. Blinding was applicable for outcome assessment only. Patients were reviewed at 1, 3, and 6 months and then every 6 months after placement of the retainer until completion of the study. Data were analyzed using survival analysis including Cox regression; sensitivity analysis was carried out after data imputation for subjects lost to follow-up. Two hundred twenty patients (median age, 16 years; interquartile range, 2; range, 12-47 years) were randomized in a 1:1 ratio to either chemical or light curing. Baseline characteristics were similar between groups, the median follow-up period was 2.19 years (range, 0.003-3.64 years), and 16 patients were lost to follow-up. At a minimum follow-up of 2 years, 47 of 110 (42.7%) and 55 of 110 (50.0%) retainers had some type of failure with chemically cured and light-cured adhesive, respectively (log-rank test, P = 0.35). Data were analyzed on an intention-to-treat basis, and the hazard ratio (HR) was 1.15 (95% confidence interval [CI], 0.88-1.70; P = 0.47). There was weak evidence that age is a significant predictor for lingual retainer failures (HR, 0.96; 95% CI, 0.93-1.00; P = 0.08). Adhesive remnant index scoring was

  2. Metabolic and mineral conditions of retained placenta in highly productive dairy cows: pathogenesis, diagnostics and prevention – a review

    Directory of Open Access Journals (Sweden)

    Ryszard Mordak

    2017-01-01

    Full Text Available The time around calving in highly productive dairy cows is a critical period in terms of their metabolism, which is connected with high demands of the foetus as well as with the onset of lactation. Retained placenta in cows may have multifactorial aetiology, but in herds which are free from infectious diseases, the most important reasons are; periparturient metabolic changes and disturbances to the internal balance and stress. During the periparturient period, the most important factor causing immune suppression and hypotony of uterus in cows is metabolic stress due to hormonal and nutritional factors, including metabolic fluctuations, negative energy balance, as well as shortage of proteins, minerals, vitamins and antioxidants. This metabolic stress as a result of an imbalance in the internal metabolic homeostasis activates the hypothalamic-pituitary-adrenocortical axis (HPA and increases serum corticosterid (cortisol concentration, especially on the day of calving. Cortisol is a powerful immune suppressive factor that causes depression of leukocyte proliferation and their functions. The periparturient metabolic stress may also stimulate the production of catecholamines, especially adrenalin. Elevated levels of adrenalin activate adrenoreceptors of the myometrium, which in turn cause hypotony or atony of the uterus at calving in cows. Elevated levels of cortisol and adrenalin may significantly inhibit the rejection and expulsion of foetal membranes in cows, resulting in an increased incidence of their retention. These important mechanisms for placental retention in highly productive dairy cows often have primary nutritional metabolic aetiology, but they also occur during secondary metabolic disturbances and metabolic stress during calving. This metabolic and immunological aetiology and pathogenesis of retained placenta usually occur in highly productive periparturient cows on dairy farms in the absence of bovine infectious diseases, which can

  3. Effects of Hardness on Pintle Rod Performance in the Universal and Retained Gas Samplers

    International Nuclear Information System (INIS)

    BOGER, R.M.

    1999-01-01

    Interaction between hardness of the pintle rods and the retainer rings used in the core samplers is investigated. It is found that ordinary Rockwell C measurements are not sufficient and superficial hardness instruments are recommended to verify hardness since in-production hardness of pintle rods is found to vary widely and probably leads to some premature release of pistons in samplers

  4. 75 FR 32857 - Academic Competitiveness Grant (ACG) and National Science and Mathematics Access To Retain Talent...

    Science.gov (United States)

    2010-06-10

    ... and Mathematics Access To Retain Talent Grant (National Smart Grant) Programs CFR Correction In Title 34 of the Code of Federal Regulations, Part 400 to End, revised as of July 1, 2009, on page 978, in...; 8:45 am] BILLING CODE 1505-01-D ...

  5. Implant retained auricular prosthesis with a modified hader bar: a case report.

    Science.gov (United States)

    Lovely, M; Dathan, Pradeep C; Gopal, Dinesh; George, Biji Thomas; Chandrasekharan Nair, K

    2014-06-01

    Auricular prostheses for defects of external ear are retained either by mechanical means or implants. All implant retained prostheses are retained by various means such as bar and clip, magnetic attachments or a combination of bar, clip and magnets. The commonest problem encountered with the bar and clip system is loosening of the clip after 3-4 months. When magnets are used as retaining component they tend to corrode over a period of time. So various alternative retention methods which possess good retentive qualities, ease of reparability and patient friendly were tried. In the present case a newly modified Hader bar design which can act as an additional retentive feature apart from the clip is employed to increase retention. The major advantages in the modified Hader bar system were that only two implants were employed, the additional loops in the Hader bar prevented micro movements and the retentive acrylic locks were easy to repair if broken. The modified Hader bar has anti-rotational slots which prevents the sliding or rotation of the prosthesis which gave new confidence to the patient who was otherwise worried of inadvertent displacement of the ear prosthesis while playing.

  6. Changes in the edentulous maxilla in persons wearing implant-retained mandibular overdentures

    NARCIS (Netherlands)

    Narhi, TO; Geertman, ME; Hevinga, M; Abdo, H; Kalk, W

    Statement of problem. It has been suggested that risk for severe resorption in the anterior maxilla is increased in persons wearing mandibular implant-retained overdentures. However, little information is available about the changes in the edentulous maxilla after mandibular implant treatment.

  7. The S.M.A.R.T. Strategy to Recruiting and Retaining High School Coaches

    Science.gov (United States)

    Lubisco, Robyn; Birren, Genevieve F. E.

    2017-01-01

    This article discusses the S.M.A.R.T. strategy for recruiting and retaining quality high school coaches. S.M.A.R.T. stands for Scouting, Mentoring and Coaching, Appreciation, Rating, and Time. Scouting addresses how one goes about locating and hiring quality coaches. Mentoring and Coaching addresses how to develop the coach within the specific…

  8. MTBE BIODEGRADATION IN A GRAVITY FLOW, HIGH-BIOMASS RETAINING BIOREACTOR

    Science.gov (United States)

    The aerobic biodegradation of methyl tert-butyl ether (MtBE), a widely used fuel oxygenate, was investigated using a pilot-scale biomass-retaining bioreactor called a Biomass Concentrator Reactor (BCR). The reactor was operated for a year at a flow rate of 2500 L/d on Ci...

  9. Biomechanical analysis of posterior cruciate ligament retaining high-flexion total knee arthroplasty

    NARCIS (Netherlands)

    Zelle, J.; van der Zanden, A.C.; De Waal Malefijt, M.; Verdonschot, Nicolaas Jacobus Joseph

    2009-01-01

    Background High-flexion knee replacements have been developed to accommodate a large range of flexion (>120°) after total knee arthroplasty. Both posterior cruciate ligament retaining and sacrificing high-flexion knee designs have been marketed. The main objective of this study was to evaluate the

  10. Local benefits of retaining natural vegetation for soil retention and hydrological services

    CSIR Research Space (South Africa)

    O'Farrell, PJ

    2009-08-01

    Full Text Available for their conservation on private land. This study explored the benefits of retaining renosterveld fragments at the farm-scale based on the hydrological and soil retention services they provide. Rainfall simulations were carried out at paired sites of renosterveld...

  11. Reflections on Recruiting, Supporting, Retaining, Graduating, and Obtaining Employment for Doctoral Students from Diverse Backgrounds

    Science.gov (United States)

    Dieker, Lisa; Wienke, Wilfred; Straub, Carrie; Finnegan, Lisa

    2014-01-01

    In this article, the authors provide a summary of the current techniques being used to recruit, retain, and support a diverse range of scholars, including students with disabilities, in a doctoral program. The manuscript provides a summary of the current need for leadership personnel who are scholars with knowledge in special education, general…

  12. 49 CFR 40.99 - How long does the laboratory retain specimens after testing?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false How long does the laboratory retain specimens after testing? 40.99 Section 40.99 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Drug Testing Laboratories § 40.99 How...

  13. Finite element analysis to compare complete denture and implant-retained overdentures with different attachment systems.

    Science.gov (United States)

    Barão, Valentim Adelino Ricardo; Assunção, Wirley Gonçalves; Tabata, Lucas Fernando; Delben, Juliana Aparecida; Gomes, Erica Alves; de Sousa, Edson Antonio Capello; Rocha, Eduardo Passos

    2009-07-01

    This finite element analysis compared stress distribution on complete dentures and implant-retained overdentures with different attachment systems. Four models of edentulous mandible were constructed: group A (control), complete denture; group B, overdenture retained by 2 splinted implants with bar-clip system; group C, overdenture retained by 2 unsplinted implants with o'ring system; and group D, overdenture retained by 2 splinted implants with bar-clip and 2 distally placed o'ring system. Evaluation was performed on Ansys software, with 100-N vertical load applied on central incisive teeth. The lowest maximum general stress value (in megapascal) was observed in group A (64.305) followed by groups C (119.006), D (258.650), and B (349.873). The same trend occurred in supporting tissues with the highest stress value for cortical bone. Unsplinted implants associated with the o'ring attachment system showed the lowest maximum stress values among all overdenture groups. Furthermore, o'ring system also improved stress distribution when associated with bar-clip system.

  14. Survival of flexible, braided, bonded stainless steel lingual retainers : a historic cohort study

    NARCIS (Netherlands)

    Foek, D. J. Lie Sam; Ozcan, M.; Verkerke, G. J.; Sandham, John; Dijkstra, P. U.

    The objectives of this study were to retrospectively evaluate the clinical survival rate of flexible, braided, rectangular bonded stainless steel lingual retainers, and to investigate the influence of gender, age of the patient, and operator experience on survival after orthodontic treatment at the

  15. Retaining of botanical diversity of steppe ecosystems at the Semipalatinsk test site area

    International Nuclear Information System (INIS)

    Sultanova, B.M.

    2005-01-01

    The nuclear tests conducted on the STS area have an effect on steppe biome. Regime of military secrecy allowed retaining extensive diversity of steppe vegetation at the area of the former Semipalatinsk test site, although the vegetation was liquidated in the most part of Kazakhstan. Unique biologic diversity of the steppe vegetation requires status of particularly secured vegetation of the STS area. (author)

  16. Why Some Hope Scholarship Recipients Retain the Scholarship and Others Lose It

    Science.gov (United States)

    Trant, Eleanore C.; Crabtree, Katelyn E.; Ciancio, Dennis J.; Hart, Leslie A.; Watson, Tiffany B.; Williams, Robert L.

    2015-01-01

    The study we report here examined parental, pre-course, and in-course predictors of students' probability of retaining (n = 136) or losing the HOPE scholarship (n = 41). The study was conducted in a multi-section, entry-level course (n = 203) for the Teacher-Education Program at a large state university in the southeastern U.S. Logistic regression…

  17. Recruiting & Retaining Women: A Self-Assessment Guide for Law Enforcement.

    Science.gov (United States)

    Harrington, Penny E.

    This document presents information, guidelines, and resource materials to help law enforcement administrators address issues related to recruiting and retaining women in law enforcement. Its 14 chapters contain the following sections: statement of the problem; legal issues; possible solutions, model policies, and practices; expert assistance,…

  18. On the role of interlath retained austenite in the deformation of lath martensite

    International Nuclear Information System (INIS)

    Maresca, F; Kouznetsova, V G; Geers, M G D

    2014-01-01

    Literature presents extensive experimental evidence of large deformation and ductile fracture behaviour of lath martensite in martensitic and multi-phase high strength steels under quasi-static, uniaxial loading conditions. The physical origin of this apparent ductile behaviour of martensite is not clear, since martensite generally provides a high material strength. The presence of thin films of interlath retained austenite may trigger the observed apparent martensite ductility. The present contribution investigates the role played by interlath retained austenite on the mechanics of lath martensite by means of crystal plasticity simulations. It is shown that independently from the interlath retained austenite volume fraction and the exact lath morphology, localized shearing along the lath habit plane occurs as long as there are enough carriers for plasticity. The austenite film acts like a ‘greasy’ plane on which the stiffer laths can slide. The shearing mechanism is not a mere consequence of the lower flow stress in the austenitic phase, but it is largely due to the orientation relationship between the retained austenite face centred cubic lattice and the body centred cubic lath crystals. (paper)

  19. 77 FR 56798 - Fisheries of the Exclusive Economic Zone Off Alaska; Revise Maximum Retained Amounts for...

    Science.gov (United States)

    2012-09-14

    ... arrowtooth flounder fishery from zero to 20 percent for deep-water flatfish, rex sole, flathead sole, shallow... catching and processing fish at sea during an open Pacific cod directed fishery would convert the processed... with finding, processing, and retaining the species closed to directed fishing. Prior to 1994, a vessel...

  20. Peer Contexts: Do Old for Grade and Retained Peers Influence Student Behavior in Middle School?

    Science.gov (United States)

    Muschkin, Clara G.; Glennie, Elizabeth; Beck, Audrey N.

    2014-01-01

    Background: Many school systems have ended social promotion by implementing accountability systems where students who fail academic assessments are retained in grade. Additionally, some parents have delayed their children's entry into school, believing that older students have an advantage. While research has examined outcomes for students who…

  1. Clinics in diagnostic imaging (133). Retained placenta from an intra-abdominal pregnancy.

    Science.gov (United States)

    Win, T; Tang, P H; Lim, T Y

    2011-01-01

    A 29-year-old Indonesian woman presented with abdominal pain seven months after an intra-abdominal pregnancy. Ultrasonography revealed a cystic mass in the pelvis and magnetic resonance imaging showed an umbilical stump within it, indicating a retained placenta. This was removed surgically, and on histology, an infarcted placenta was confirmed.

  2. Retaining At-Risk Students: The Role of Career and Vocational Education. Information Series No. 335.

    Science.gov (United States)

    Tindall, Lloyd W.

    This paper reviews the literature related to the role of career and vocational education in retaining at-risk secondary youth and motivating them to return to secondary or postsecondary school. Selected literature from nonvocational but related areas of service is reviewed to provide the reader with an overview of the scope of the problem and the…

  3. Strategies to Recruit and Retain Students in Physical Science and Mathematics on a Diverse College Campus

    Science.gov (United States)

    Chang, Jen-Mei; Kwon, Chuhee; Stevens, Lora; Buonora, Paul

    2016-01-01

    This article presents implementation details and findings of a National Science Foundation Scholarship in Science, Technology, Engineering, and Mathematics Program (S-STEM) consisting of many high-impact practices to recruit and retain students in the physical sciences and mathematics programs, particularly first-generation and underrepresented…

  4. 9 CFR 355.23 - Tagging products “U.S. retained.”

    Science.gov (United States)

    2010-01-01

    ... INSPECTION AND CERTIFICATION CERTIFIED PRODUCTS FOR DOGS, CATS, AND OTHER CARNIVORA; INSPECTION... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Tagging products âU.S. retained.â 355.23 Section 355.23 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF...

  5. Optimum Design of Gravity Retaining Walls Using Charged System Search Algorithm

    Directory of Open Access Journals (Sweden)

    S. Talatahari

    2012-01-01

    Full Text Available This study focuses on the optimum design retaining walls, as one of the familiar types of the retaining walls which may be constructed of stone masonry, unreinforced concrete, or reinforced concrete. The material cost is one of the major factors in the construction of gravity retaining walls therefore, minimizing the weight or volume of these systems can reduce the cost. To obtain an optimal seismic design of such structures, this paper proposes a method based on a novel meta-heuristic algorithm. The algorithm is inspired by the Coulomb's and Gauss’s laws of electrostatics in physics, and it is called charged system search (CSS. In order to evaluate the efficiency of this algorithm, an example is utilized. Comparing the results of the retaining wall designs obtained by the other methods illustrates a good performance of the CSS. In this paper, we used the Mononobe-Okabe method which is one of the pseudostatic approaches to determine the dynamic earth pressure.

  6. 13 CFR 120.1706 - Pool Originator's retained interest in Pool.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Pool Originator's retained interest in Pool. 120.1706 Section 120.1706 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan...

  7. Recruiting and Retaining an Ethnically Diverse Sample of Older Adults in a Longitudinal Intervention Study

    Science.gov (United States)

    Austin-Wells, Vonnette; McDougall, Graham J.; Becker, Heather

    2006-01-01

    This paper describes strategies developed to recruit and retain an ethnically diverse sample in a longitudinal intervention of 246 participants in the SeniorWISE study. The ethnic and socioeconomic differences of these participants necessitated the use of different methods of effectively communicating with this population. Recruitment benefited…

  8. 17 CFR 229.1009 - (Item 1009) Persons/assets, retained, employed, compensated or used.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1009) Persons/assets, retained, employed, compensated or used. 229.1009 Section 229.1009 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING FORMS UNDER SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF 1934 AND ENERGY...

  9. In vivo biofilm formation on stainless steel bonded retainers during different oral health-care regimens

    NARCIS (Netherlands)

    Jongsma, Marije A.; van der Mei, Henny C.; Atema-Smit, Jelly; Busscher, Henk I.; Ren, Yijin

    2015-01-01

    Retention wires permanently bonded to the anterior teeth are used after orthodontic treatment to prevent the teeth from relapsing to pre-treatment positions. A disadvantage of bonded retainers is biofilm accumulation on the wires, which produces a higher incidence of gingival recession, increased

  10. Adhesive Properties of Bonded Orthodontic Retainers to Enamel : Stainless Steel Wire vs Fiber-reinforced Composites

    NARCIS (Netherlands)

    Foek, Dave Lie Sam; Krebs, Eliza; Sandham, John; Ozcan, Mutlu

    2009-01-01

    Purpose: The objectives of this study were to compare the bond strength of a stainless steel orthodontic wire vs various fiber-reinforced composites (FRC) used as orthodontic retainers on enamel, analyze the failure types after debonding, and investigate the influence of different application

  11. Recruiting and Retaining Learners in Workplace Literacy Programs in New Zealand

    Science.gov (United States)

    Benseman, John

    2013-01-01

    Successful workplace literacy and numeracy programs are dependent on effective strategies to recruit and then retain course participants. This article reports on the recruitment strategies used in a large workplace literacy and numeracy project involving 535 workers in 18 courses. It provides an analysis of the strategies used, their rates of…

  12. A Success Story: Recruiting & Retaining Underrepresented Minority Doctoral Students in Biomedical Engineering

    Science.gov (United States)

    Reichert, William M.

    2006-01-01

    There are various ways to succeed in recruiting and retaining underrepresented minority (URM) doctoral students; but key to them all is the creation of real student-faculty relationships, which demonstrate by example that diversity and excellence can and should coexist. This cannot be delegated or done indirectly, and no amount of outreach, campus…

  13. Quantitative analysis of retained austenite in laser melted martensitic stainless steel

    CSIR Research Space (South Africa)

    Seleka, T

    2007-11-01

    Full Text Available of this study was to determine if X-ray diffraction (XRD) was sufficient for quantifying the volume percentage of retained austenite. After a preliminary qualitative analysis, a Rietveld full pattern refinement program was used to quantify the volume percentage...

  14. MDCT in the diagnosis of small-bowel obstruction by a retained ...

    African Journals Online (AJOL)

    assessment of complications such as abscess formation, fistula. MDCT in the diagnosis of small-bowel obstruction by a retained surgical swab. M. Bindapersad, M.B. Ch.B., F.C.Rad. (Diag.) N. Govender, M.B. Ch.B. Department of Radiology, Chris Hani Baragwanath Hospital and Faculty of Health Sciences, University of the ...

  15. Localization of nuclear retained mRNAs in Saccharomyces cerevisiae

    DEFF Research Database (Denmark)

    Thomsen, Rune; Libri, Domenico; Boulay, Jocelyne

    2003-01-01

    site of transcription, and known S. cerevisiae nuclear structures such as the nucleolus and the nucleolar body. Our results show that retained SSA4 RNA localizes to an area in close proximity to the SSA4 locus. On deletion of Rrp6p and release from the genomic locus, heat shock mRNAs produced...

  16. Retained Products of Conception: An Atypical Presentation Diagnosed Immediately with Bedside Emergency Ultrasound

    Directory of Open Access Journals (Sweden)

    Kristin Adkins

    2016-01-01

    Full Text Available Background. Retained products of conception is an important diagnosis to consider in patients presenting with postpartum complaints. Bedside ultrasound is a rapid, accurate, noninvasive modality to evaluate these patients. Objective. To report an atypical case of retained products of conception diagnosed with bedside ultrasound in the emergency department. Case Report. A 27-year-old female who was 1-month postpartum presented with vaginal bleeding, pelvic pain, and no fever. At the time of initial H&P, bedside ultrasound revealed echogenic material within the endometrial cavity with blood flow seen by color Doppler consistent with retained products of conception. The bedside ultrasound rapidly narrowed the differential and allowed a definitive diagnosis immediately. Ob/Gyn was consulted and dilation and curettage was performed in the operating room. Conclusions. Retained products of conception is an important diagnosis for the emergency physician to consider in at-risk patients. The sonographic findings are easily obtained and interpreted by emergency physicians. Earlier diagnosis of this disease process should lead to more focused patient evaluations and management.

  17. Design and development of a magnetic device for mesenchymal stem cell retaining in deep targets

    Science.gov (United States)

    Banis, G. C.

    2017-12-01

    This paper focuses on the retaining of mesenchymal stem cells in blood flow conditions using the appropriate magnetic field. Mesenchymal stem cells can be tagged with magnetic nanoparticles and thus, they can be manipulated from distance, through the application of an external magnetic field. In this paper the case of kidney as target of the therapy is being studied.

  18. Control of pH of retained water in the coastal waste disposal site

    Directory of Open Access Journals (Sweden)

    Hem Ramrav

    2018-01-01

    Full Text Available After landfilling of wastes is completed, the stabilization of landfilled ground requires much time and cost. Therefore, this study aimed to control the pH of retained water in the coastal waste disposal sites during landfilling process, by conducting field surveys and laboratory experiments. In field surveys, we investigated the changes of retained water quality such as pH, salinity, and dissolved oxygen. The results show the pH of retained water has risen to about 10 when the volume of landfilled wastes reached about 25% of landfill capacity. In lowing the pH, we considered a low-cost method by pumping seawater from the adjacent sea into the landfill. The mechanism in this method is that, H+ dissociated from HCO3- in the fresh seawater react with OH- eluted from wastes would result in pH decrease. The laboratory experiments were conducted to verify the effect on pH change by adding fresh seawater to alkalized seawater. As a result, the effect of injecting fresh seawater into alkalized seawater with pH higher than 9 was confirmed. Therefore, this treatment method is suggested to enable the disposal sites to be used promptly after landfilling is completed, by adding fresh seawater to purify the retained water and waste at low cost during landfilling process.

  19. Masticatory efficiency and oral health-related quality of life with implant-retained mandibular overdentures

    Science.gov (United States)

    Sun, Xu; Zhai, Jun-Jiang; Liao, Jian; Teng, Min-Hua; Tian, Ai; Liang, Xing

    2014-01-01

    Objectives: To evaluate masticatory efficiency (ME) and oral health-related quality of life (OHRQoL) in patients rehabilitated with implant-retained mandibular overdentures. Methods: In this randomized controlled clinical trial, 50 edentulous patients visiting the Implant Center and Department of Prosthodontics, West China College of Stomatology, Sichuan University, Chengdu, China between June 2010 and June 2012 were selected and received 2 implant-retained mandibular overdenture treatments. All patients were rehabilitated with maxillary complete dentures. The ME and OHRQoL were determined both one month before the mandibular complete denture was anchored to the osseointegrated implants, and 6 months after anchoring. Paired t-tests were used to compare means of ME, and oral health impact profile-49 (OHIP-49) domains scores between pre- and post-implant. Linear regression models were utilized to seek correlations between ME and OHIP domains scores. Results: The ME increased from pre- to post-implant retained mandibular overdentures significantly (p<0.001). The total OHIP score and 4 subscales scores were changed significantly from pre- to post-implant; namely, functional limitation, psychological discomfort, physical disability, and physical pain. The total OHIP score, functional limitation, physical disability, and physical pain subscale scores were related to ME. Conclusion: Implant-retained mandibular over dentures can significantly improve patients’ ME and OHRQoL. The improvement in OHRQoL is mainly because of the improved ME. An improved chewing experience, and pain relief also contributes to improvement of OHRQoL. PMID:25316463

  20. Swallowing thresholds of mandibular implant-retained overdentures with variable portion sizes

    NARCIS (Netherlands)

    Fontijn-Tekamp, F.A.; Slagter, A.P.; Van der Bilt, A.; Van't Hof, M.A.; Kalk, W.; Jansen, J.A.

    2004-01-01

    We analysed the effect of three portion sizes Optocal Plus (small, medium and large) on swallowing thresholds in subjects with either conventional complete dentures or mandibular implant-retained overdentures (transmandibular and permucosal cylindric implants). Tests were carried out in 52 women and

  1. K-12 Education Nonprofit Employees' Perceptions of Strategies for Recruiting and Retaining Employees

    Science.gov (United States)

    Byrne, Tara Marie

    2013-01-01

    This qualitative study explored the key reasons individuals who work in K-12 education nonprofit organizations enter the field of K-12 nonprofit education and their motivations for doing so. The purpose of this study was to find new strategies for recruiting and retaining K-12 education nonprofit employees by examining the obstacles that exist to…

  2. An application of ultrasonic inspection system (INER-SCAN) inspecting generator retaining rings

    International Nuclear Information System (INIS)

    Chen, L.C.; Hwang, S.C.

    1994-01-01

    The performances of the automatic ultrasonic inspecting and imaging system (INER-SCAN) developed by the NDT laboratory of the Institute of Nuclear Energy Research have been enhanced and much more improved to commercial level. With appropriate rearrangements of software libraries, it is used to inspect generator retaining rings which are critical structural rotor components that support the end-turn regions of the rotor wingings against centrifugal forces. The use of the INER-SCAN provides distinct advantages over other systems in terms of the reliability of inspection and the flexibility of system performance modifications. The INER-SCAN system assists users to select and modify ultrasonic parameters under computer-aided environment. In addition, the INER-SCAN system contains the necessary software functions to image the ultrasonic data (A-SCAN, B-SCAN, B'-SCAN, C-SCAN). The use of the imaging system makes it quite easy to evaluate various test parameters and their effects on the discrimination between geometric and IGSCC reflectors. Through experimental test, it is recognized that the system has powerful detectable capability which can find 0.2mm-depth slight scratch on the inner surface of retaining rings. This system can also be used on different generator retaining rings (different in terms of hidden design features) without the need for access to the dimension of retaining ring

  3. 31 CFR 103.33 - Records to be made and retained by financial institutions.

    Science.gov (United States)

    2010-07-01

    ... financial institutions. 103.33 Section 103.33 Money and Finance: Treasury Regulations Relating to Money and... Maintained § 103.33 Records to be made and retained by financial institutions. Each financial institution... each advice, request, or instruction given to another financial institution or other person located...

  4. Instrumental and sensory quantification of oral coatings retained after swallowing semi-solid foods

    NARCIS (Netherlands)

    Prinz, J.F.; Huntjens, L.; Wijk, de R.A.

    2006-01-01

    After a mouthful of food has been swallowed, some food material is always retained in the mouth. With semi-solid foods this is in the form of a coating that adheres to the oral mucosa. The amount and location of this material may play an important role in food sensations. In this study two

  5. Math and Science Teachers: Recruiting and Retaining California's Workforce. Policy Brief

    Science.gov (United States)

    EdSource, 2008

    2008-01-01

    Middle and high school math and science teachers provide the foundation for education in the growing science, technology, engineering, and mathematics fields. They are crucial to California's efforts to remain competitive in a global economy. This policy brief looks at the shortage and challenges involved in recruiting and retaining fully prepared…

  6. Retained placenta of dairy cows associated with managemental factors in Rajshahi, Bangladesh

    Directory of Open Access Journals (Sweden)

    K. M. Mozaffor Hossain

    2013-08-01

    Full Text Available Aim: The incidence of retained placenta of dairy cows in relation to individual animal level and farm management factors such as farm type, farm size, housing system, floor type, feed quality, time of parturition, farming experience of farmer and delivery pattern of cows was determined. Materials and Methods: A total 1205 parturated dairy cows conducted in nine upazilas and four Metro Thana of Rajshahi district during July 2010 to June 2011for attainment of the result. Individual animal and farm management factors associated with retained placenta were recorded in a structured questionnaire through face-to-face farmer's interview and reviewing farm records. The raw data were compiled and statistical SPSS program to analyze to obtained result. Results: The overall incidence of retained placenta was 13.4%. The incidence was significantly higher in Local × Sahiwal genotype (4.6% and late delivery (longer gestation period (80% than their counter groups (p<0.05. The large farm (6.0% had higher incidence and had no significant effect than medium and individual household. Similarly animals housed in Tin shed building with poor ventilation facilities (6.6%, animal housed in unscientific concrete floor (6.8%, animals mostly grassed along with small amount of straw supplied (5.4% and a farmer had less than one year farming experience (5.3% had not significant statistically show higher incidence of retained placenta. Conclusion: The local genotype; mini farm; supplied better feed quality; vast farming experience of farmer and normal delivery with eutocia had less chance of retained placenta of dairy cows. [Vet World 2013; 6(4.000: 180-184

  7. An Innovative Approach for Gob-Side Entry Retaining in Thick Coal Seam Longwall Mining

    Directory of Open Access Journals (Sweden)

    Manchao He

    2017-11-01

    Full Text Available Gob-side entry retaining (GER is a popular non-pillar mining technique regarding how to reserve a gateroad for the use of next panel mining. When used in thick coal seams, the conventional entry retaining method requires a huge amount of filling materials and may cause entry (gateroad accidents. Thus, an innovative non-pillar longwall mining approach is introduced. First, structural and mechanical models were built to explore the mechanism of the new approach. The modeling results indicate that effective bulking of the gob roof and reasonable support of the entry roof were key governing factors in improving entry stabilities and reducing roof deformations. Accordingly, a directional roof fracturing technique was proposed to contribute to gob roof caving, and a constant resistance and large deformation anchor (CRLDA cable was used to stabilize the entry roof. Subsequently, the evolutionary laws of the roof structure and stresses were explored using numerical simulation. It was found that the structure of the surrounding rocks around the retained entry changed significantly after roof fracturing. The stress-bearing center was transferred to the gob area, and the entry roof was in a low stress environment after adopting the approach. Finally, the approach was tested on a thick coal seam longwall mining panel. Field monitoring indicates that the retained entry was in a stable state and the index of the retained entry met the requirement of the next mining panel. This work provides an effective and economical approach to non-pillar longwall mining in thick coal seams.

  8. Comparison of Wear Resistance of Hawley and Vacuum Formed Retainers: An in-vitro Study.

    Science.gov (United States)

    V, Moshkelgosha; M, Shomali; M, Momeni

    2016-06-01

    As a physical property, wear resistance of the materials used in the fabrication of orthodontic retainers play a significant role in the stability and long term use of the appliances. To evaluate the wear resistance of two commonly used materials for orthodontic retainers: Acropars OP, i.e. a polymethyl methacrylate based material, and 3A-GS060, i.e. a polyethylene based material. For each material, 30 orthodontic retainers were made according to the manufacturers' instructions and a 30×30×2 mm block was cut out from the mid- palatal area of each retainer. Each specimen underwent 1000 cycles of wear stimulation in a pin on disc machine. The depth of wear of each specimen was measured using a Nano Wizard II atomic force microscope in 3 random points of each specimen's wear trough. The average of these three measurements was calculated and considered as mean value wear depth of each specimen (µm). The mean wear depth was 6.10µm and 2.15µm for 3A-GS060 and Acropars OP groups respectively. Independent t-test showed a significant difference between the two groups ( p < 0.001). The results show Polymethyl methacrylate base (Acropars) is more wear resistance than the polyethylene based material (3A-GS060). As the higher wear resistance of the fabrication material can improve the retainers' survival time and its cost-effectiveness, VFRs should be avoided in situations that the appliance needs high wear resistance such as bite blocks opposing occlusal forces.

  9. One-Piece Implant-Retained Mandibular Overdentures By Pre-Fabricated Titanium Telescopic Attachments and Frictional Varnish: A Two-Year Prospective Study.

    Science.gov (United States)

    Nik, Shahram Namjoy; Nejatian, Touraj

    2016-12-01

    Clinical efficiency of one-piece screw-type implants with telescopic were attachments evaluated in this study. Twenty-four patients received a mandibular implant-supported overdenture and maxillary complete denture. Ninety-six one-piece implants were inserted in the inter-foraminal area. Implants were immediately loaded with an implant-retained overdenture and telescopic attachments which had frictional retention elements. There was 0.25±0.24 mm, 0.32±0.25 mm, 0.43±0.30 mm, 0.61±0.30 mm and of bone resorption after 3, 6, 12 and 24 months, respectively. The need to activate the frictional retention was the most common complication. Treatment outcomes for prefabricated telescopic retained overdentures on one-piece implants are similar to that obtained in cases of delayed loading. Copyright© 2016 Dennis Barber Ltd.

  10. Evaluation of the Mechanical Behavior of a Retaining Wall Structure on a Weathered Soil through Probabilistic Methods

    OpenAIRE

    P. V. S. Mascarenhas; B. C. P. Albuquerque; D. J. F. Campos; L. L. Almeida; V. R. Domingues; L. C. S. M. Ozelim

    2017-01-01

    Retaining slope structures are increasingly considered in geotechnical engineering projects due to extensive urban cities growth. These kinds of engineering constructions may present instabilities over the time and may require reinforcement or even rebuilding of the structure. In this context, statistical analysis is an important tool for decision making regarding retaining structures. This study approaches the failure probability of the construction of a retaining wall over the debris of an ...

  11. Large deformation and post-failure simulations of segmental retaining walls using mesh-free method (SPH)

    OpenAIRE

    Bui, H. H.; Kodikara, J. A.; Pathegama, R.; Bouazza, A.; Haque, A.

    2015-01-01

    Numerical methods are extremely useful in gaining insights into the behaviour of reinforced soil retaining walls. However, traditional numerical approaches such as limit equilibrium or finite element methods are unable to simulate large deformation and post-failure behaviour of soils and retaining wall blocks in the reinforced soil retaining walls system. To overcome this limitation, a novel numerical approach is developed aiming to predict accurately the large deformation and post-failure be...

  12. Seismic pressure effect on retaining walls; Presiones generadas por sismo en muros de retencion

    Energy Technology Data Exchange (ETDEWEB)

    Bonola, Isaac; Aviles, Javier [Instituto Mexicano de Tecnologia del Agua, Jiutepec, Morelos (Mexico)

    2006-04-15

    Retaining walls are auxiliary works used in different hydraulic structures. In seismically active areas, the dynamic pressures generated by the backfill must be appropriately evaluated at the design stage. Currently, a number of methods for estimating the seismic response of this type of works are available; however, most of them are simplified and not all the parameters involved have been examined. In this paper, a hybrid boundary and finite element method is presented for gravity walls in which the backfill can be represented by a horizontally layered medium. The effect of lateral extension of the backfill can be included in the model by introducing a vertical boundary coupling the movement of the backfill with that of the surrounding soil. The wave propagation analysis in the layered medium is carried out for both horizontal and vertical harmonic excitation; the latter excitation may cause important responses under certain situations. To illustrate the applicability of the proposed method, results for two numerical examples are presented: one for dry backfill and other for saturated backfill, considering in both cases the variations of dynamic properties of the soil with the depth. [Spanish] Los muros de retencion son estructuras auxiliares utilizadas en distintas obras hidraulicas. En zonas sismicas, las presiones dinamicas generadas por el relleno deben evaluarse adecuadamente en la etapa de diseno. Actualmente existen numerosos metodos para estimar la respuesta sismica de este tipo de estructuras; sin embargo, la mayoria de ellos son simplificados y no todos los parametros involucrados han sido examinados. En este trabajo se presenta un metodo hibrido de frontera y elemento finito para muros de gravedad en el que el relleno puede representarse por un medio estratificado horizontalmente. En el modelo puede incluirse el efecto de la extension lateral del relleno, introduciendo una frontera vertical que acopla el movimiento del relleno con el del suelo

  13. Hupresin Retains Binding Capacity for Butyrylcholinesterase and Acetylcholinesterase after Sanitation with Sodium Hydroxide

    Directory of Open Access Journals (Sweden)

    Seda Onder

    2017-10-01

    Full Text Available Hupresin is a new affinity resin that binds butyrylcholinesterase (BChE in human plasma and acetylcholinesterase (AChE solubilized from red blood cells (RBC. Hupresin is available from the CHEMFORASE company. BChE in human plasma binds to Hupresin and is released with 0.1 M trimethylammonium bromide (TMA with full activity and 10–15% purity. BChE immunopurified from plasma by binding to immobilized monoclonal beads has fewer contaminating proteins than the one-step Hupresin-purified BChE. However, when affinity chromatography on Hupresin follows ion exchange chromatography at pH 4.5, BChE is 99% pure. The membrane bound AChE, solubilized from human RBC with 0.6% Triton X-100, binds to Hupresin and remains bound during washing with sodium chloride. Human AChE is not released in significant quantities with non-denaturing solvents, but is recovered in 1% trifluoroacetic acid. The denatured, partially purified AChE is useful for detecting exposure to nerve agents by mass spectrometry. Our goal was to determine whether Hupresin retains binding capacity for BChE and AChE after Hupresin is washed with 0.1 M NaOH. A 2 mL column of Hupresin equilibrated in 20 mM TrisCl pH 7.5 was used in seven consecutive trials to measure binding and recovery of BChE from 100 mL human plasma. Between each trial the Hupresin was washed with 10 column volumes of 0.1 M sodium hydroxide. A similar trial was conducted with red blood cell AChE in 0.6% Triton X-100. It was found that the binding capacity for BChE and AChE was unaffected by washing Hupresin with 0.1 M sodium hydroxide. Hupresin could be washed with sodium hydroxide at least seven times without losing binding capacity.

  14. Failure Rates of Orthodontic Fixed Lingual Retainers bonded with Two Flowable Light-cured Adhesives: A Comparative Prospective Clinical Trial.

    Science.gov (United States)

    Talic, Nabeel F

    2016-08-01

    This comparative prospective randomized clinical trial examined the in vivo failure rates of fixed mandibular and maxillary lingual retainers bonded with two light-cured flowable composites over 6 months. Consecutive patients were divided into two groups on a 1:1 basis. Two hundred fixed lingual retainers were included, and their failures were followed for 6 months. One group (n = 50) received retainers bonded with a nano-hybrid composite based on nano-optimized technology (Tetric-N-Flow, Ivoclar Vivadent). Another group (n = 50) received retainers bonded with a low viscosity (LV) composite (Transbond Supreme LV, 3M Unitek). There was no significant difference between the overall failure rates of mandibular retainers bonded with Transbond (8%) and those bonded with Tetric-N-Flow (18%). However, the odds ratio for failure using Tetric-N-flow was 2.52-fold greater than that of Transbond. The failure rate of maxillary retainers bonded with Transbond was higher (14%), but not significantly different, than that of maxillary retainers bonded with Tetric-N-flow (10%). There was no significant difference in the estimated mean survival times of the maxillary and mandibular retainers bonded with the two composites. Both types of composites tested in the current study can be used to bond fixed maxillary and mandibular lingual retainers, with low failure rates.

  15. Bicruciate-retaining Total Knee Replacement Provides Satisfactory Function and Implant Survivorship at 23 Years.

    Science.gov (United States)

    Pritchett, James W

    2015-07-01

    One of the goals of a TKA is to approximate the function of a normal knee. Preserving the natural ligaments might provide a method of restoring close to normal function. Sacrifice of the ACL is common and practical during a TKA. However, this ligament is functional in more than 60% of patients undergoing a TKA and kinematic studies support the concept of bicruciate-retaining (that is, ACL-preserving) TKA; however, relatively few studies have evaluated patients treated with bicruciate-retaining TKA implants. I asked: (1) what is the long-term (minimum 20-year) survivorship, (2) what are the functional results, and (3) what are the reasons for revision of bicruciate-retaining knee arthroplasty prostheses? From January 1989 to September 1992, I performed 639 total knee replacements in 537 patients. Of these, 489 were performed in 390 patients using a bicruciate-retaining, minimally constrained device. During the period in question, this knee prosthesis was used for all patients observed intraoperatively to have an intact, functional ACL with between 15° varus and 15° valgus joint deformity. There were 234 women and 156 men with a mean age at surgery of 65 years (range, 42-84 years) and a primary diagnosis of osteoarthritis in 89%. The patella was resurfaced in all knees. The mean followup was 23 years (range, 20-24 years). At the time of this review, 199 (51%) patients had died and 31 (8%) patients were lost to followup, leaving 160 (41%) patients (214 knees) available for review. Component survivorship was determined by competing-risks analysis and Kaplan Meier survivorship analysis with revision for any reason as the primary endpoint. Patients were evaluated every 2 years to assess ROM, joint laxity, knee stability, and to determine American Knee Society scores. The Kaplan-Meier survivorship was 89% (95% CI, 82%-93%) at 23 years with revision for any reason as the endpoint. Competing-risks survivorship was 94% (95% CI, 91%%-96 %) at 23 years. At followup, the mean

  16. Computer-navigated minimally invasive total knee arthroplasty for patients with retained implants in the femur

    Directory of Open Access Journals (Sweden)

    Sung-Yen Lin

    2014-08-01

    Full Text Available Total knee arthroplasty (TKA in patients with knee arthritis and retained implants in the ipsilateral femur is a challenge for knee surgeons. Use of a conventional intramedullary femoral cutting guide is not practical because of the obstruction of the medullary canal by implants. Previous studies have shown that computer-assisted surgery (CAS can help restore alignment in conventional TKA for patients with knee arthritis with retained femoral implants or extra-articular deformity, without the need for implant removal or osteotomy. However, little has been published regarding outcomes with the use of navigation in minimally invasive surgery (MIS-TKA for patients with this complex knee arthritis. MIS has been proven to provide less postoperative pain and faster recovery than conventional TKA, but MIS-TKA in patients with retained femoral implants poses a greater risk in limb malalignment. The purpose of this study is to report the outcome of CAS-MIS-TKA in patients with knee arthritis and retained femoral implants. Between April 2006 and March 2008, eight patients with knee arthritis and retained femoral implants who underwent the CAS-MIS-TKA were retrospectively reviewed. Three of the eight patients had extra-articular deformity, including two femur bones and one tibia bone, in the preoperative examination. The anteroposterior, lateral, and long-leg weight-bearing radiographs carried out at 3-month follow-up was used to determine the mechanical axis of lower limb and the position of components. The mean preoperative femorotibial angle in patients without extra-articular deformity was 3.8° of varus and was corrected to 4.6° of valgus. With the use of navigation in MIS-TKA, the two patients in this study with extra-articular femoral deformity also obtained an ideal postoperative mechanical axis within 2° of normal alignment. Overall, there was a good restoration of postoperative mechanical alignment in all cases, with a mean angle of 0.4° of

  17. Using Blue Stragglers to Predict Retained Black Hole Population in Globular Clusters

    Science.gov (United States)

    Hermanek, Keith; Chatterjee, Sourav; Rasio, Frederic

    2018-01-01

    Large numbers of black holes (BHs) are expected to form in massive star clusters typical of the globular clusters (GCs). Sophisticated theoretical models suggest that many of these BHs can be retained in present-day GCs. Observations have also identified several BH candidates in Galactic and extragalactic GCs (e.g., Macarone et al. 2007; Irwin et al. 2010; Strader et al. 2012; Chomiuk et al. 2013; Miller-Jones et al. 2014). It has also been shown that high-mass and high-density clusters such as GCs are efficient factories of merging binary BHs similar to those observed by the LIGO observatories (Abbott et al. 2016a,b,c,d,e; Rodriguez et al. 2016). Understanding the formation rate and properties of binary BHs are dependent on a detailed understanding of how the BHs dynamically evolve within GCs. Nevertheless, directly detecting BHs in GCs is extremely challenging; BHs only in binaries with limited configurations can be directly detected by the detection of gravitational wave, X-ray, or radio emissions. We propose an indirect of inferring the number of undetected retained BHs in a GC by investigating the dynamical effects of a large number of BHs on the production of other tracer populations such as Blue Straggler Stars (BSS). Using a large grid of detailed GC models we show that there is a clear anti-correlation between the number of BSS in a cluster and the number of retained BHs. Being the most massive species, large numbers of retained BHs will dominate the core of the cluster as a result of mass-segregation driving away other low-mass species such as main-sequence stars from central high-density regions. BSS are expected to form from physical collisions between main-sequence (MS) stars mediated by binary encounters (e.g., Chatterjee et al. 2013) in cores of GCs. Production of BSS by collisions or mass transfer channels are suppressed if a large number of retained BHs in a cluster restrict the number of MS stars in the core. Extensive observational data exist on

  18. A systematic review of the clinical performance of tooth-retained and implant-retained double crown prostheses with a follow-up of ≥ 3 years.

    Science.gov (United States)

    Verma, Rohini; Joda, Tim; Brägger, Urs; Wittneben, Julia-Gabriela

    2013-01-01

    The objective of this review was to systematically screen the literature for data related to the survival and complication rates observed with dental or implant double crown abutments and removable prostheses under functional loading for at least 3 years. A systematic review of the dental literature from January 1966 to December 2009 was performed in electronic databases (PubMed and Embase) as well as by an extensive hand search to investigate the clinical outcomes of double crown reconstructions. From the total of 2412 titles retrieved from the search, 65 were selected for full-text review. Subsequently, 17 papers were included for data extraction. An estimation of the cumulative survival and complication rates was not feasible due to the lack of detailed information. Tooth survival rates for telescopic abutment teeth ranged from 82.5% to 96.5% after an observation period of 3.4 to 6 years, and for tooth-supported double crown retained dentures from 66.7% to 98.6% after an observation period of 6 to 10 years. The survival rates of implants were between 97.9% and 100% and for telescopic-retained removable dental prostheses with two mandibular implants, 100% after 3.0 and 10.4 years. The major biological complications affecting the tooth abutments were gingival inflammation, periodontal disease, and caries. The most frequent technical complications were loss of cementation and loss of facings. The main findings of this review are: (I) double crown tooth abutments and dentures demonstrated a wide range of survival rates. (II) Implant-supported mandibular overdentures demonstrated a favorable long-term prognosis. (III) A greater need for prosthetic maintenance is required for both tooth-supported and implant-supported reconstructions. (IV) Future areas of research would involve designing appropriate longitudinal studies for comparisons of survival and complication rates of different reconstruction designs. © 2012 by the American College of Prosthodontists.

  19. Biologically Complex Planar Cell Plasma Membranes Supported on Polyelectrolyte Cushions Enhance Transmembrane Protein Mobility and Retain Native Orientation.

    Science.gov (United States)

    Liu, Han-Yuan; Chen, Wei-Liang; Ober, Christopher K; Daniel, Susan

    2018-01-23

    Reconstituted supported lipid bilayers (SLB) are widely used as in vitro cell-surface models because they are compatible with a variety of surface-based analytical techniques. However, one of the challenges of using SLBs as a model of the cell surface is the limited complexity in membrane composition, including the incorporation of transmembrane proteins and lipid diversity that may impact the activity of those proteins. Additionally, it is challenging to preserve the transmembrane protein native orientation, function, and mobility in SLBs. Here, we leverage the interaction between cell plasma membrane vesicles and polyelectrolyte brushes to create planar bilayers from cell plasma membrane vesicles that have budded from the cell surface. This approach promotes the direct incorporation of membrane proteins and other species into the planar bilayer without using detergent or reconstitution and preserves membrane constituents. Furthermore, the structure of the polyelectrolyte brush serves as a cushion between the planar bilayer and rigid supporting surface, limiting the interaction of the cytosolic domains of membrane proteins with this surface. Single particle tracking was used to analyze the motion of GPI-linked yellow fluorescent proteins (GPI-YFP) and neon-green fused transmembrane P2X2 receptors (P2X2-neon) and shows that this platform retains over 75% mobility of multipass transmembrane proteins in its native membrane environment. An enzyme accessibility assay confirmed that the protein orientation is preserved and results in the extracellular domain facing toward the bulk phase and the cytosolic side facing the support. Because the platform presented here retains the complexity of the cell plasma membrane and preserves protein orientation and mobility, it is a better representative mimic of native cell surfaces, which may find many applications in biological assays aimed at understanding cell membrane phenomena.

  20. The Interaction Features of the Multi-Level Retaining Walls with Soil Mass

    Directory of Open Access Journals (Sweden)

    Boyko Igor

    2017-09-01

    Full Text Available The interaction features of multi-level retaining walls with soil base were researched by changing their geometric parameters and locality at the plan. During excavation of deep foundation pits it is important to choose the type of constructions which influences on the horizontal displacements. The distance between the levels of retaining walls should be based on the results of numerical modelling. The objective of this paper is to present a comparison between the data of numerical simulations and the results of the in-situ lateral tests of couple piles. The problems have been solved by using the following soil models: Coulomb-Mohr model; model, which is based on the dilatation theory; elastic-plastic model with variable stiffness parameters.

  1. The Interaction Features of the Multi-Level Retaining Walls with Soil Mass

    Science.gov (United States)

    Boyko, Igor; Skochko, Liudmyla; Zhuk, Veronica

    2017-09-01

    The interaction features of multi-level retaining walls with soil base were researched by changing their geometric parameters and locality at the plan. During excavation of deep foundation pits it is important to choose the type of constructions which influences on the horizontal displacements. The distance between the levels of retaining walls should be based on the results of numerical modelling. The objective of this paper is to present a comparison between the data of numerical simulations and the results of the in-situ lateral tests of couple piles. The problems have been solved by using the following soil models: Coulomb-Mohr model; model, which is based on the dilatation theory; elastic-plastic model with variable stiffness parameters.

  2. The Examination of Retaining Walls in Landscape Architecture: The Example of Trabzon City

    Directory of Open Access Journals (Sweden)

    Özge Volkan Aksu

    2010-11-01

    Full Text Available Number of problems about city order and its vision has been increasing rapidly. There is two main factors that causes visual pollution. The first factor is that cities are in an unplanned and dense urbanization process which has serious effects on appearance of a city. The second factor is retaining walls used densely in Trabzon city because of its open land structure. These walls which are set up for environmental construction security should be rebuilt with using some landscape plans so that the vision of dense concrete can be reduced. In this study, retaining walls are examined regarded landscape architecture. The continuous situation in Trabzon city is revealed with the help of an examination place, and also some suggestions for preventing the landscape problems which includes vegetal, structural and both vegetal-structural solutions are thrown out for consideration.

  3. Obtention of hydrogels for use as water retainers in soil by gamma irradiation

    International Nuclear Information System (INIS)

    Burillo, G.; Ogawa, T.

    1981-01-01

    We have been studying for some time the radiation induced gelation of aqueous polyacrylamide solutions in order to clarify the relationships between the gel structure and gelation conditions. The application of hydrogels as water retainers has been reported previously by some workers and there exist some commercially produced hydrogels in the market, but their costs are not yet satisfactory for use on a large scale in the agricultural region in northern Mexico, where scarcity of water is always the serious problem. In this work, with an aim of obtaining hydrogels most economically, acrylamide, polyethylene oxide, and mixtures of water soluble polymers with acrylamide monomer, were irradiated in solid state under various conditions, in order to find the optimum conditions for gelation and to obtain the hydrogels most suitable as water retainers in soil. The relationships between the gelation, amount of water in the starting materials, molecular weights of polymers, effects of additives and the dose rates, were studied. (author)

  4. Baseline estimate of the retained gas volume in Tank 241-C-106

    International Nuclear Information System (INIS)

    Stewart, C.W.; Chen, G.

    1998-06-01

    This report presents the results of a study of the retained gas volume in Hanford Tank 241-C-106 (C-106) using the barometric pressure effect method. This estimate is required to establish the baseline conditions for sluicing the waste from C-106 into AY-102, scheduled to begin in the fall of 1998. The barometric pressure effect model is described, and the data reduction and detrending techniques are detailed. Based on the response of the waste level to the larger barometric pressure swings that occurred between October 27, 1997, and March 4, 1998, the best estimate and conservative (99% confidence) retained gas volumes in C-106 are 24 scm (840 scf) and 50 scm (1,770 scf), respectively. This is equivalent to average void fractions of 0.025 and 0.053, respectively

  5. Wise retained in the endoplasmic reticulum inhibits Wnt signaling by reducing cell surface LRP6.

    Science.gov (United States)

    Guidato, Sonia; Itasaki, Nobue

    2007-10-15

    The Wnt signaling pathway is tightly regulated by extracellular and intracellular modulators. Wise was isolated as a secreted protein capable of interacting with the Wnt co-receptor LRP6. Studies in Xenopus embryos revealed that Wise either enhances or inhibits the Wnt pathway depending on the cellular context. Here we show that the cellular localization of Wise has distinct effects on the Wnt pathway readout. While secreted Wise either synergizes or inhibits the Wnt signals depending on the partner ligand, ER-retained Wise consistently blocks the Wnt pathway. ER-retained Wise reduces LRP6 on the cell surface, making cells less susceptible to the Wnt signal. This study provides a cellular mechanism for the action of Wise and introduces the modulation of cellular susceptibility to Wnt signals as a novel mechanism of the regulation of the Wnt pathway.

  6. Intraoperative Ultrasound-Guided Removal of Retained Mini Sling Anchor Causing Vaginal Pain: A Case Report.

    Science.gov (United States)

    Almassi, Nima; Goldman, Howard B

    2016-01-01

    Since the introduction of the tension-free vaginal tape, the surgical management of female stress urinary incontinence has undergone a dramatic shift toward synthetic midurethral slings (MUSs). The evolution of the MUS has led to the development of the single incision mini sling (SIMS), a minimally invasive procedure that can be performed under local anesthesia. Complications arising after SIMS placement parallel those of the traditional MUS, including pelvic pain, dyspareunia, and mesh erosion. The patient in this case presented with persistent pelvic pain due to a retained SIMS anchor after having previously undergone SIMS placement and subsequent transvaginal exploration with mesh removal. We report the use of intraoperative ultrasound for identification and removal of the retained SIMS anchor.

  7. Does the amount of trees retained at clearfelling of temperate and boreal forests influence biodiversity response?

    Directory of Open Access Journals (Sweden)

    Fedrowitz Katja

    2012-05-01

    Full Text Available Abstract Clear-felling is one of the main methods used in many parts of the world for the production of pulp, timber and bioenergy, leading to a simplified forest structure and species composition. One of the measures to mitigate the impact of logging on biodiversity is the retention of trees at final harvest. Tree retention approaches in forestry are still rather new, although widely distributed across different continents. Several studies have been performed on the effects of retention trees on biodiversity but to date there is no evidence on the relation between the amounts of trees, i.e. the number, volume or area per ha retained, and the response of biodiversity. The overall aim of our review will be to provide forest practitioners and conservationists in temperate and boreal forests with more detailed recommendations regarding the amount of trees that should be retained in order to achieve positive effects for biodiversity compared to traditional clear-cutting.

  8. Factors related to employers' intent to hire, retain and accommodate cancer survivors: the Singapore perspective.

    Science.gov (United States)

    Mak, Angela Ka Ying; Ho, Shirley S; Kim, Hyo Jung

    2014-12-01

    Despite the growing importance of cancer and return-to-work issues in occupational rehabilitation literature in the last decade, academic discussion is largely limited to survivors' perspectives and some exploratory studies from the employer side. This paper applies two classic theoretical models-Theory of Planned Behavior and Social Cognitive Theory-and key measures from previous studies to identify explicit relationships that explain employer factors to hire and retain cancer survivors. Data were collected from online surveys with senior management executives and senior human resource specialists from various organizations in Singapore, with a total of 145 responses. The 72-item survey instrument included a series of independent variables: (1) Attitudes toward cancer and cancer survivors; (2) Employers' efficacy; (3) Perceived moral obligation; (4) Employers' experience; (5) Outcome expectations; (6) Employment situation; (7) Social norms; and (8) Incentives, and dependent variables: (a) Employers' intention to hire cancer survivors; and (b) Employers' intention to retain cancer survivors. Regression analyses showed that the top three factors related to employers' intention to retain cancer survivors are perceived moral obligations (β = .39, p employment situation (β = .17, p Employers' efficacy was associated with intention to hire (β = .22, p employer and an employee when it comes to retaining cancer survivors and government incentives for hiring cancer survivors in the workforce. The present study provided an avenue to implement the proposed model-a potential study framework for the management of cancer survivors at work. Findings revealed that different messages should be tailored to employers toward hiring and retention issues and provided useful guidelines for employer education materials.

  9. Removal of Retained Adherent Placental Remnants Using the Hysteroscopy Endo-Operative System.

    Science.gov (United States)

    Zhu, Ke-An; Huang, Huan; Xue, Min; Subedi, Jigyasa; Jamail, Grace; Zhao, Weidong; Xu, Dabao; Xiao, Songshu

    2016-01-01

    Removal of retained adherent placental remnants (RAPRs) may be challenging using traditional 5Fr or 7Fr hysteroscopic grasping forceps because they are very small. This is particularly true when the retained placental remnant is large. This video demonstrates the advantages of using the Hysteroscopy Endo-Operative System (HEOS), a specially designed operative hysteroscope with a 13Fr working channel, to remove retained placental remnants. Step-by-step explanation of the technique using videos and pictures (educative video) (Canadian Task Force Classification III). Third Xiangya Hospital of Central South University, Hunan, China. A 32-year-old woman was diagnosed with RAPRs 5 weeks after the evacuation of retained placenta after a spontaneous abortion at 16 weeks' gestation. Gynecologic examination revealed an anterior 8-week uterus and no tenderness. Serum β-human chorionic gonadotropin was 150 mIU/L. Sonography revealed an irregular intrauterine mass, 3.5 cm × 3.5 cm × 3 cm in size. Removal of RAPRs using HEOS (Sopro-comeg Company, Bordeaux, France). The operation time was only 12 minutes. The RAPRs were removed completely and quickly in 1 procedure with no complications. The serum β-human chorionic gonadotropin titer normalized 1 week after the procedure. This study was approved by the institutional review board of the Third Xiangya Hospital of Central South University. When indicated, removal of RAPRs using HEOS is safe and simple because of its large and strong cold forceps. Additionally, it avoids electrical and thermal injury to the endometrium, which is particularly important in a population that wants to preserve fertility. Copyright © 2016 AAGL. Published by Elsevier Inc. All rights reserved.

  10. Strategies for Retaining Highly Qualified & Experienced Technical Teachers in Teaching Profession in Katsina State, Nigeria

    OpenAIRE

    Saifullahi Kasim Tafida; Che Kum Clement; Md. Abu Raihan

    2015-01-01

    The objective of this study is to identify the strategies for retaining highly qualified & experienced technical teachers of technical and vocational educational institutions in Katsina State of Nigeria. Two research questions were formulated to guide the study. A 26 items survey questionnaire was developed and used to elicit responses from technical education administrators, technical education principals/vice principals and technical teachers in technical and vocational education institutio...

  11. A Better Deal Elsewhere? : The Role of Organisational Support for Development in Retaining Employees

    OpenAIRE

    Bøyum, Hilde

    2012-01-01

    Employees are increasingly concerned of managing their own career and are thus becoming less loyal. However, to stay competitive organisations need to retain their best talents. The present study examined the relationship between organisational support for development and intentions to turnover, as well as affective commitment. Previous research has indicated inconsistent results between employee development and turnover, suggesting that organisational support for development might increase o...

  12. Review of the Nomenclature of the Retaining Ligaments of the Cheek: Frequently Confused Terminology

    Directory of Open Access Journals (Sweden)

    Yeui Seok Seo

    2017-07-01

    Full Text Available Since the time of its inception within facial anatomy, wide variability in the terminology as well as the location and extent of retaining ligaments has resulted in confusion over nomenclature. Confusion over nomenclature also arises with regard to the subcutaneous ligamentous attachments, and in the anatomic location and extent described, particularly for zygomatic and masseteric ligaments. Certain historical terms—McGregor’s patch, the platysma auricular ligament, parotid cutaneous ligament, platysma auricular fascia, temporoparotid fasica (Lore’s fascia, anterior platysma-cutaneous ligament, and platysma cutaneous ligament—delineate retaining ligaments of related anatomic structures that have been conceptualized in various ways. Confusion around the masseteric cutaneous ligaments arises from inconsistencies in their reported locations in the literature because the size and location of the parotid gland varies so much, and this affects the relationship between the parotid gland and the fascia of the masseter muscle. For the zygomatic ligaments, there is disagreement over how far they extend, with descriptions varying over whether they extend medially beyond the zygomaticus minor muscle. Even the ‘main’ zygomatic ligament’s denotation may vary depending on which subcutaneous plane is used as a reference for naming it. Recent popularity in procedures using threads or injectables has required not only an accurate understanding of the nomenclature of retaining ligaments, but also of their location and extent. The authors have here summarized each retaining ligament with a survey of the different nomenclature that has been introduced by different authors within the most commonly cited published papers.

  13. Functional characterisation of an intron retaining K+ transporter of barley reveals intron-mediated alternate splicing

    KAUST Repository

    Shahzad, K.

    2015-01-01

    Intron retention in transcripts and the presence of 5 and 3 splice sites within these introns mediate alternate splicing, which is widely observed in animals and plants. Here, functional characterisation of the K+ transporter, HvHKT2;1, with stably retained introns from barley (Hordeum vulgare) in yeast (Saccharomyces cerevisiae), and transcript profiling in yeast and transgenic tobacco (Nicotiana tabacum) is presented. Expression of intron-retaining HvHKT2;1 cDNA (HvHKT2;1-i) in trk1, trk2 yeast strain defective in K+ uptake restored growth in medium containing hygromycin in the presence of different concentrations of K+ and mediated hypersensitivity to Na+. HvHKT2;1-i produces multiple transcripts via alternate splicing of two regular introns and three exons in different compositions. HKT isoforms with retained introns and exon skipping variants were detected in relative expression analysis of (i) HvHKT2;1-i in barley under native conditions, (ii) in transgenic tobacco plants constitutively expressing HvHKT2;1-i, and (iii) in trk1, trk2 yeast expressing HvHKT2;1-i under control of an inducible promoter. Mixed proportions of three HKT transcripts: HvHKT2;1-e (first exon region), HvHKT2;1-i1 (first intron) and HvHKT2;1-i2 (second intron) were observed. The variation in transcript accumulation in response to changing K+ and Na+ concentrations was observed in both heterologous and plant systems. These findings suggest a link between intron-retaining transcripts and different splice variants to ion homeostasis, and their possible role in salt stress.

  14. Improving communication at handover and transfer reduces retained swabs in maternity services.

    Science.gov (United States)

    Lean, Katie; Page, Bethan F; Vincent, Charles

    2018-01-01

    To reduce the incidence of retained vaginal swabs and near misses. A review of previous retained swab incidents and near misses in a large maternity unit identified handovers and transfers as a key point of vulnerability. Interventions were introduced to improve communication at handover from the delivery suite to theatre and from theatre to the high dependency unit. Process data was collected to monitor compliance. The outcome measures were the incidence of retained swab never events and the incidence of near misses. Chi-squared analysis was used to test the significance of the results. For transfers from delivery suite to theatre, verbal handover significantly increased from 28.8% to 75.6% (ptransfers to theatre post-intervention: in 88 (30.2%) of these transfers a vaginal swab was already in situ. In 70/88 (79.5%) of cases the presence of the swab was communicated to theatre staff in three ways (verbally, written and transfer of opened swab packets) according to the new policy. In the post-intervention period there were 56 women transferred from theatre to the high-dependency unit with a vaginal pack in situ: 52 (92.9%) of these women had a sticker in place serving as a constant reminder of the presence of the vaginal pack to staff. Following a baseline of four near misses in two months, there has been only one near miss in the 15 months since the interventions were implemented, (33.3% vs. 1.1%, pcommunication at handover and transfer can reduce the incidence of retained vaginal swabs and near misses. Further work is needed to raise the profile of swab counting in maternity settings: swab counting needs to be the responsibility of all disciplines, not just the responsibility of theatre staff. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  15. A 26-Year-Old Retained Demised Abdominal Pregnancy Presenting with Umbilical Fistula

    Science.gov (United States)

    Daniel, Nnadi; Bashir, Bello; Ibrahim, Ango; Swati, Singh

    2014-01-01

    This is a report on a 72-year-old postmenopausal woman who presented with passage of fetal bones through an umbilical fistula. She was diagnosed as a case of demised abdominal pregnancy, which had been retained for 26 years. She subsequently had exploratory laparotomy, evacuation of the abdominal pregnancy, hysterectomy, and bowel resection. The patient's condition remained unstable throughout the postoperative period and she died from septicemia on the eleventh day. PMID:24639908

  16. A 26-Year-Old Retained Demised Abdominal Pregnancy Presenting with Umbilical Fistula

    Directory of Open Access Journals (Sweden)

    Nnadi Daniel

    2014-01-01

    Full Text Available This is a report on a 72-year-old postmenopausal woman who presented with passage of fetal bones through an umbilical fistula. She was diagnosed as a case of demised abdominal pregnancy, which had been retained for 26 years. She subsequently had exploratory laparotomy, evacuation of the abdominal pregnancy, hysterectomy, and bowel resection. The patient’s condition remained unstable throughout the postoperative period and she died from septicemia on the eleventh day.

  17. LEO P: HOW MANY METALS CAN A VERY LOW MASS, ISOLATED GALAXY RETAIN?

    Energy Technology Data Exchange (ETDEWEB)

    McQuinn, Kristen B. W.; Skillman, Evan D. [Minnesota Institute for Astrophysics, School of Physics and Astronomy, 116 Church Street, S.E., University of Minnesota, Minneapolis, MN 55455 (United States); Dolphin, Andrew [Raytheon Company, 1151 E. Hermans Road, Tucson, AZ 85756 (United States); Cannon, John M. [Department of Physics and Astronomy, Macalester College, 1600 Grand Avenue, Saint Paul, MN 55105 (United States); Salzer, John J.; Rhode, Katherine L. [Department of Astronomy, Indiana University, 727 East 3rd Street, Bloomington, IN 47405 (United States); Adams, Elizabeth A. K. [ASTRON, the Netherlands Institute for Radio Astronomy, Postbus 2, 7990 AA, Dwingeloo (Netherlands); Berg, Danielle [Center for Gravitation, Cosmology and Astrophysics, Department of Physics, University of Wisconsin Milwaukee, 1900 East Kenwood Boulevard, Milwaukee, WI 53211 (United States); Giovanelli, Riccardo; Haynes, Martha P., E-mail: kmcquinn@astro.as.utexas.edu [Center for Radiophysics and Space Research, Space Sciences Building, Cornell University, Ithaca, NY 14853 (United States)

    2015-12-20

    Leo P is a gas-rich dwarf galaxy with an extremely low gas-phase oxygen abundance (3% solar). The isolated nature of Leo P enables a quantitative measurement of metals lost solely due to star formation feedback. We present an inventory of the oxygen atoms in Leo P based on the gas-phase oxygen abundance measurement, the star formation history (SFH), and the chemical enrichment evolution derived from resolved stellar populations. The SFH also provides the total amount of oxygen produced. Overall, Leo P has retained 5% of its oxygen; 25% of the retained oxygen is in the stars while 75% is in the gas phase. This is considerably lower than the 20%–25% calculated for massive galaxies, supporting the trend for less efficient metal retention for lower-mass galaxies. The retention fraction is higher than that calculated for other alpha elements (Mg, Si, Ca) in dSph Milky Way satellites of similar stellar mass and metallicity. Accounting only for the oxygen retained in stars, our results are consistent with those derived for the alpha elements in dSph galaxies. Thus, under the assumption that the dSph galaxies lost the bulk of their gas mass through an environmental process such as tidal stripping, the estimates of retained metal fractions represent underestimates by roughly a factor of four. Because of its isolation, Leo P provides an important datum for the fraction of metals lost as a function of galaxy mass due to star formation.

  18. Talent management : Retaining and managing technical specialists in a technical career

    OpenAIRE

    Brunila, Alexandra; Baedecke Yllner, Emelie

    2013-01-01

    The purpose of this thesis is to investigate talent management and how companies should work with talent management in order to retain and manage technical specialists in a technical career. Talent management is found to be important for modern organizations because of the advent of the knowledge economy, new generations entering the workforce and the need for businesses to become more strategic and competitive, which implies new ways of managing human capital. Furthermore, talent management ...

  19. What diversity management practices do hotel managers and employees view as important for retaining employees?

    OpenAIRE

    Twum, Sophia Araba

    2015-01-01

    Master's thesis in International hotel and tourism management Abstract Research shows that the hotel industry is noted for high rate of turnover. Again, diversity management practices have been found to be a good human resource tool helping to manage and retain diverse workforce. A lot of studies have been done on employee retention and diversity management separately but the two concepts are related therefore there is the need to look at them together. This thesis aims...

  20. Identifying and Retaining Quality Naval Officers: A Quantitative Analysis of Job Matching and Lateral Transfers

    Science.gov (United States)

    2017-03-01

    happy face at the time. I am seriously grateful for your love and moral support. YOOHOO FAMILY! Thank you. Lastly, I would like to thank wine ...career match of naval officers, and therefore, the quality of Navy personnel. The benefit of this study is to contribute to the Navy’s efforts to...aligning officers with a more suitable community at the onset of their careers, the Navy stands to benefit from the gains associated with retaining

  1. The dinoflagellates Durinskia baltica and Kryptoperidinium foliaceum retain functionally overlapping mitochondria from two evolutionarily distinct lineages

    Directory of Open Access Journals (Sweden)

    Keeling Patrick J

    2007-09-01

    Full Text Available Abtract Background The dinoflagellates Durinskia baltica and Kryptoperidinium foliaceum are distinguished by the presence of a tertiary plastid derived from a diatom endosymbiont. The diatom is fully integrated with the host cell cycle and is so altered in structure as to be difficult to recognize it as a diatom, and yet it retains a number of features normally lost in tertiary and secondary endosymbionts, most notably mitochondria. The dinoflagellate host is also reported to retain mitochondrion-like structures, making these cells unique in retaining two evolutionarily distinct mitochondria. This redundancy raises the question of whether the organelles share any functions in common or have distributed functions between them. Results We show that both host and endosymbiont mitochondrial genomes encode genes for electron transport proteins. We have characterized cytochrome c oxidase 1 (cox1, cytochrome oxidase 2 (cox2, cytochrome oxidase 3 (cox3, cytochrome b (cob, and large subunit of ribosomal RNA (LSUrRNA of endosymbiont mitochondrial ancestry, and cox1 and cob of host mitochondrial ancestry. We show that all genes are transcribed and that those ascribed to the host mitochondrial genome are extensively edited at the RNA level, as expected for a dinoflagellate mitochondrion-encoded gene. We also found evidence for extensive recombination in the host mitochondrial genes and that recombination products are also transcribed, as expected for a dinoflagellate. Conclusion Durinskia baltica and K. foliaceum retain two mitochondria from evolutionarily distinct lineages, and the functions of these organelles are at least partially overlapping, since both express genes for proteins in electron transport.

  2. Magnet-Retained Two-Mini-Implant Overdenture: Clinical and Mechanical Consideration

    Directory of Open Access Journals (Sweden)

    Yuichi Ishida

    2016-10-01

    Full Text Available Two-implant overdentures have become the accepted treatment for restoring mandibular edentulism. The dimensions of regular implants sometimes limit their use, such as in the case of narrow ridges. Mini-implants with reduced diameters (less than 3.0 mm enable insertion into narrow ridges. A magnet-retained two-mini-implant overdenture system was developed and is described in this paper. Additionally, we describe a clinical mandibular procedure using the system and evaluate its biomechanical performance.

  3. Comparison of Wear Resistance of Hawley and Vacuum Formed Retainers: An in-vitro Study

    Directory of Open Access Journals (Sweden)

    Moshkelgosha V

    2016-06-01

    Full Text Available Statement of Problem: As a physical property, wear resistance of the materials used in the fabrication of orthodontic retainers play a significant role in the stability and long term use of the appliances. Objectives: To evaluate the wear resistance of two commonly used materials for orthodontic retainers: Acropars OP, i.e. a polymethyl methacrylate based material, and 3A-GS060, i.e. a polyethylene based material. Materials and Methods: For each material, 30 orthodontic retainers were made according to the manufacturers’ instructions and a 30×30×2 mm block was cut out from the mid- palatal area of each retainer. Each specimen underwent 1000 cycles of wear stimulation in a pin on disc machine. The depth of wear of each specimen was measured using a Nano Wizard II atomic force microscope in 3 random points of each specimen’s wear trough. The average of these three measurements was calculated and considered as mean value wear depth of each specimen (µm. Results: The mean wear depth was 6.10µm and 2.15µm for 3A-GS060 and Acropars OP groups respectively. Independent t-test showed a significant difference between the two groups (p < 0.001. The results show Polymethyl methacrylate base (Acropars is more wear resistance than the polyethylene based material (3A-GS060. Conclusions: As the higher wear resistance of the fabrication material can improve the retainers’ survival time and its cost-effectiveness, VFRs should be avoided in situations that the appliance needs high wear resistance such as bite blocks opposing occlusal forces.

  4. Challenges in Retaining and Attracting Employees to the City of Västerås

    OpenAIRE

    Kämpe, Juliana

    2012-01-01

    Employee retention is one of the biggest challenges for Human Resources Management nowadays. Change itself has become a daily routine in organizations. In this master thesis I investigate employers’ and employees’ perceptions on their employment relationship, through the lens of the psychological contract, looking closely to the role of family-friendly practices on offering work-life balance, thus retaining and attracting employees. This qualitative case study of the City of Västerås has show...

  5. Low-mass X-ray binaries from black hole retaining globular clusters

    Science.gov (United States)

    Giesler, Matthew; Clausen, Drew; Ott, Christian D.

    2018-06-01

    Recent studies suggest that globular clusters (GCs) may retain a substantial population of stellar-mass black holes (BHs), in contrast to the long-held belief of a few to zero BHs. We model the population of BH low-mass X-ray binaries (BH-LMXBs), an ideal observable proxy for elusive single BHs, produced from a representative group of Milky Way GCs with variable BH populations. We simulate the formation of BH binaries in GCs through exchange interactions between binary and single stars in the company of tens to hundreds of BHs. Additionally, we consider the impact of the BH population on the rate of compact binaries undergoing gravitational wave driven mergers. The characteristics of the BH-LMXB population and binary properties are sensitive to the GCs structural parameters as well as its unobservable BH population. We find that GCs retaining ˜1000 BHs produce a galactic population of ˜150 ejected BH-LMXBs, whereas GCs retaining only ˜20 BHs produce zero ejected BH-LMXBs. Moreover, we explore the possibility that some of the presently known BH-LMXBs might have originated in GCs and identify five candidate systems.

  6. Reduced Operating Time but Not Blood Loss With Cruciate Retaining Total Knee Arthroplasty

    Science.gov (United States)

    Vermesan, Dinu; Trocan, Ilie; Prejbeanu, Radu; Poenaru, Dan V; Haragus, Horia; Gratian, Damian; Marrelli, Massimo; Inchingolo, Francesco; Caprio, Monica; Cagiano, Raffaele; Tatullo, Marco

    2015-01-01

    Background There is no consensus regarding the use of retaining or replacing cruciate implants for patients with limited deformity who undergo a total knee replacement. Scope of this paper is to evaluate whether a cruciate sparing total knee replacement could have a reduced operating time compared to a posterior stabilized implant. Methods For this purpose, we performed a randomized study on 50 subjects. All procedures were performed by a single surgeon in the same conditions to minimize bias and only knees with a less than 20 varus deviation and/or maximum 15° fixed flexion contracture were included. Results Surgery time was significantly shorter with the cruciate retaining implant (P = 0.0037). The mean duration for the Vanguard implant was 68.9 (14.7) and for the NexGen II Legacy was 80.2 (11.3). A higher range of motion, but no significant Knee Society Scores at 6 months follow-up, was used as controls. Conclusions In conclusion, both implants had the potential to assure great outcomes. However, if a decision has to be made, choosing a cruciate retaining procedure could significantly reduce the surgical time. When performed under tourniquet, this gain does not lead to reduced blood loss. PMID:25584102

  7. The effect of prior tempering on cryogenic treatment to reduce retained austenite

    International Nuclear Information System (INIS)

    Stratton, Paul

    2010-01-01

    The consensus view is that a high carbon case gives gears the best overall properties provided that there is no carbide network and that the retained austenite has been reduced below 20% by cryogenic treatment. This view is effectively enshrined in the SAE AMS 2759/7 standard. The cryogenic treatment usually takes place immediately after the quench to avoid austenite stabilisation. However, for some parts with complex geometries that might crack during the treatment, a short low temperature temper is carried out first. Little is known on how this temper affects the subsequent cryogenic treatment. Three carburizing steels used extensively in the aerospace industry were carburized to produce high retained austenite levels in the case using two different, but typical carburizing cycles. The retained austenite was determined by XRD before and after cryogenic treatment carried out in accordance with the standard and compared with that obtained when an intermediate temper was used. This study shows that for three typical carburizing steels, carburized using typical cycles, the efficacy of the cryogenic treatment is reduced only slightly after the temper, and not enough to be industrially significant. (author)

  8. A Computational Modeling Approach for Investigating Soft Tissue Balancing in Bicruciate Retaining Knee Arthroplasty

    Directory of Open Access Journals (Sweden)

    Shahram Amiri

    2012-01-01

    Full Text Available Bicruciate retaining knee arthroplasty, although has shown improved functions and patient satisfaction compared to other designs of total knee replacement, remains a technically demanding option for treating severe cases of arthritic knees. One of the main challenges in bicruciate retaining arthroplasty is proper balancing of the soft tissue during the surgery. In this study biomechanics of soft tissue balancing was investigated using a validated computational model of the knee joint with high fidelity definitions of the soft tissue structures along with a Taguchi method for design of experiments. The model was used to simulate intraoperative balancing of soft tissue structures following the combinations suggested by an orthogonal array design. The results were used to quantify the corresponding effects on the laxity of the joint under anterior-posterior, internal-external, and varus-valgus loads. These effects were ranked for each ligament bundle to identify the components of laxity which were most sensitive to the corresponding surgical modifications. The resulting map of sensitivity for all the ligament bundles determined the components of laxity most suitable for examination during intraoperative balancing of the soft tissue. Ultimately, a sequence for intraoperative soft tissue balancing was suggested for a bicruciate retaining knee arthroplasty.

  9. A Computational Modeling Approach for Investigating Soft Tissue Balancing in Bicruciate Retaining Knee Arthroplasty

    Science.gov (United States)

    Amiri, Shahram; Wilson, David R.

    2012-01-01

    Bicruciate retaining knee arthroplasty, although has shown improved functions and patient satisfaction compared to other designs of total knee replacement, remains a technically demanding option for treating severe cases of arthritic knees. One of the main challenges in bicruciate retaining arthroplasty is proper balancing of the soft tissue during the surgery. In this study biomechanics of soft tissue balancing was investigated using a validated computational model of the knee joint with high fidelity definitions of the soft tissue structures along with a Taguchi method for design of experiments. The model was used to simulate intraoperative balancing of soft tissue structures following the combinations suggested by an orthogonal array design. The results were used to quantify the corresponding effects on the laxity of the joint under anterior-posterior, internal-external, and varus-valgus loads. These effects were ranked for each ligament bundle to identify the components of laxity which were most sensitive to the corresponding surgical modifications. The resulting map of sensitivity for all the ligament bundles determined the components of laxity most suitable for examination during intraoperative balancing of the soft tissue. Ultimately, a sequence for intraoperative soft tissue balancing was suggested for a bicruciate retaining knee arthroplasty. PMID:23082090

  10. Implant-retained overdentures for young children with severe oligodontia: a series of four cases.

    Science.gov (United States)

    Filius, Marieke A P; Vissink, Arjan; Raghoebar, Gerry M; Visser, Anita

    2014-09-01

    The treatment need is high in children with severe oligodontia and anodontia, because they often have functional and esthetic problems owing to missing teeth. Because the intraforaminal region barely grows after eruption of the permanent mandibular incisors, dental implant treatment should be considered a treatment option for these children. The purpose of our study was to assess the treatment outcomes regarding satisfaction and the care and aftercare of implant-retained mandibular overdentures in a series of 4 young children without erupted mandibular teeth from either severe oligodontia (n = 3) or anodontia (n = 1). Four children without erupted mandibular teeth, aged 6 to 13 years, were provided with an implant-retained overdenture on 2 implants. The surgical and prosthetic care and aftercare were scored by the clinicians. Also, the patients and their parents were queried about how satisfied they were with the overdenture. The median follow-up of the patients was 5.2 years (range 3.2 to 8.4). No implants were lost, no cases of peri-implantitis occurred, and the need for treatment and aftercare was low. Patient and parent satisfaction with this treatment was high. A 2-implant, retained overdenture in children with no erupted mandibular teeth is a safe treatment modality when appropriate treatment and aftercare can be provided. Copyright © 2014 American Association of Oral and Maxillofacial Surgeons. Published by Elsevier Inc. All rights reserved.

  11. PM-HIP research for structural and pressuring retaining applications within the electric power industry

    International Nuclear Information System (INIS)

    Gandy, David W.

    2015-01-01

    For more than 60 years now, the nuclear power industry has relied on structural and pressure retaining materials generated via established manufacturing practices such as casting, plate rolling-and-welding, forging, drawing, and/or extrusion. During the past three years, EPRI has been leading the development and introduction of another established process, powder metallurgy and hot Isostatic pressing (PM/HIP), for pressure retaining applications in electric power industry. The research includes assessment of two primary alloys: 316L stainless steel and Grade 91 creep-strength enhanced ferritic steels, for introduction into the ASME Boiler and Pressure Vessel Code. Continuing DOE and EPRI research on other structural/pressure retaining alloys such as Alloy 690, SA 508 Class 1, Alloy 625, hard-facing materials, and others are also underway. This research will have a tremendous impact as we move forward over the next few decades on the selection of new alloys and components for advanced light water reactors and small modular reactors. Furthermore, fabrication of high alloy materials/components may require the use of new manufacturing processes to achieve acceptable properties for higher temperature applications such as those in Generation IV applications. Current research by EPRI and DOE will be reviewed and emphasis will be targeted at advanced applications where PM/HIP may be applied in the future. (authors)

  12. Rational use of anchor pile material of the thin retaining walls

    Directory of Open Access Journals (Sweden)

    Yushkov Boris Semenovich

    2014-12-01

    Full Text Available The article considers the urgency of application of the reinforced concrete anchor piles in the constructions of retaining structures associated with the possibility of establishing rigid joint of element interface and more durable pile constructions in the soil. The features of the inclined anchor piles work as a part of sheet-pile retaining walls are noted. There was performed a study of the stress-strain state of the inclined reinforced concrete anchor piles of the thin sheet-pile wall with the reinforced concrete face members of T-section, combined with piles by a longitudinal beam. The authors consider a constructive scheme of retaining structure and list the applied loads. The efforts in the anchor piles were determined. The bending-moment curves show the character of the force distribution along the pile. A form of the pile ensuring the rational distribution of material along the pile is presented. The distribution of efforts along the length and effect of filling on its operation in the soil were accepted as the criteria of construction solution for a pile. The substantiation of the proposed design of pile is presented in terms of its stress-strain state and the rational use of material. The authors made conclusions on the reasonability of adopted design solutions associated with an increase in the flexural strength of pile, increment of the ultimate pullout capacity, stability improvement, effective use of backfill and exception of the «out of operation» areas of the pile.

  13. A soft-rigid contact model of MPM for granular flow impact on retaining structures

    Science.gov (United States)

    Li, Xinpo; Xie, Yanfang; Gutierrez, Marte

    2018-02-01

    Protective measures against hazards associated with rapid debris avalanches include a variety of retaining structures such as rock/boulder fences, gabions, earthfill barriers and retaining walls. However, the development of analytical and numerical methods for the rational assessment of impact force generated by granular flows is still a challenge. In this work, a soft-rigid contact model is built under the coding framework of MPM which is a hybrid method with Eulerian-Lagrangian description. The soft bodies are discretized into particles (material points), and the rigid bodies are presented by rigid node-based surfaces. Coulomb friction model is used to implement the modeled contact mechanics, and a velocity-dependent friction coefficient is coupled into the model. Simulations of a physical experiment show that the peak and residual value of impact forces are well captured by the MPM model. An idealized scenario of debris avalanche flow down a hillslope and impacting on a retaining wall are analyzed using the MPM model. The calculated forces can provide a quantitative estimate from which mound design could proceed for practical implementation in the field.

  14. Experimental Study of Dry Granular Flow and Impact Behavior Against a Rigid Retaining Wall

    Science.gov (United States)

    Jiang, Yuan-Jun; Towhata, Ikuo

    2013-07-01

    Shallow slope failure in mountainous regions is a common and emergent hazard in terms of its damage to important traffic routes and local communities. The impact of dry granular flows consisting of rock fragments and other particles resulting from shallow slope failures on retaining structures has yet to be systematically researched and is not covered by current design codes. As a preliminary study of the impact caused by dry granular flows, a series of dry granular impact experiments were carried out for one model of a retaining wall. It was indirectly verified that the total normal force exerted on a retaining wall consists of a drag force ( F d), a gravitational and frictional force ( F gf), and a passive earth force ( F p), and that the calculation of F d can be based on the empirical formula defined in NF EN Eurocode 1990 ( Eurocode structuraux. Base de calcul des structures, AFNOR La plaine Saint Denis, 2003). It was also indirectly verified that, for flow with Froude number from 6 to 11, the drag coefficient ( C d) can be estimated using the previously proposed empirical parameters.

  15. Estimating retained gas volumes in the Hanford tanks using waste level measurements

    International Nuclear Information System (INIS)

    Whitney, P.D.; Chen, G.; Gauglitz, P.A.; Meyer, P.A.; Miller, N.E.

    1997-09-01

    The Hanford site is home to 177 large, underground nuclear waste storage tanks. Safety and environmental concerns surround these tanks and their contents. One such concern is the propensity for the waste in these tanks to generate and trap flammable gases. This report focuses on understanding and improving the quality of retained gas volume estimates derived from tank waste level measurements. While direct measurements of gas volume are available for a small number of the Hanford tanks, the increasingly wide availability of tank waste level measurements provides an opportunity for less expensive (than direct gas volume measurement) assessment of gas hazard for the Hanford tanks. Retained gas in the tank waste is inferred from level measurements -- either long-term increase in the tank waste level, or fluctuations in tank waste level with atmospheric pressure changes. This report concentrates on the latter phenomena. As atmospheric pressure increases, the pressure on the gas in the tank waste increases, resulting in a level decrease (as long as the tank waste is open-quotes softclose quotes enough). Tanks with waste levels exhibiting fluctuations inversely correlated with atmospheric pressure fluctuations were catalogued in an earlier study. Additionally, models incorporating ideal-gas law behavior and waste material properties have been proposed. These models explicitly relate the retained gas volume in the tank with the magnitude of the waste level fluctuations, dL/dP. This report describes how these models compare with the tank waste level measurements

  16. Esthetic, functional, and prosthetic outcomes with implant-retained finger prostheses.

    Science.gov (United States)

    Aydin, Cemal; Nemli, Secil Karakoca; Yilmaz, Handan

    2013-04-01

    Traumatic amputation of fingers results in a serious impairment of hand function and affects the psychological status of the patients. The implant-retained finger prostheses are an alternative treatment. The aim of this case report is to represent the use of osseointegrated implants for retention of finger prostheses in a patient with amputated thumb and index finger. Dental implants were placed in the residual bone of the fingers using two-stage surgery. Custom-made attachments were used to provide retention between implants and silicone prostheses. Prosthetic fingernails were made of composite resin material. After 6 months, implants were clinically successful, and the patient was satisfied with the appearance and the function of the prostheses. The complications of broken prosthetic nail and mild discoloration were observed. Reconstruction of amputated fingers with implant-retained prosthesis is a worthwhile treatment providing esthetic, functional, and psychological benefits, although some complications might be experienced. Clinical relevance Implant-retained finger prostheses are an acceptable treatment modality for patients with amputated fingers. Evaluating implant prognosis, functional results and prosthetic results of the patients are necessary to address the benefits and complications of the treatment.

  17. AUTOMATIC THICKNESS AND VOLUME ESTIMATION OF SPRAYED CONCRETE ON ANCHORED RETAINING WALLS FROM TERRESTRIAL LIDAR DATA

    Directory of Open Access Journals (Sweden)

    J. Martínez-Sánchez

    2016-06-01

    Full Text Available When ground conditions are weak, particularly in free formed tunnel linings or retaining walls, sprayed concrete can be applied on the exposed surfaces immediately after excavation for shotcreting rock outcrops. In these situations, shotcrete is normally applied conjointly with rock bolts and mesh, thereby supporting the loose material that causes many of the small ground falls. On the other hand, contractors want to determine the thickness and volume of sprayed concrete for both technical and economic reasons: to guarantee their structural strength but also, to not deliver excess material that they will not be paid for. In this paper, we first introduce a terrestrial LiDAR-based method for the automatic detection of rock bolts, as typically used in anchored retaining walls. These ground support elements are segmented based on their geometry and they will serve as control points for the co-registration of two successive scans, before and after shotcreting. Then we compare both point clouds to estimate the sprayed concrete thickness and the expending volume on the wall. This novel methodology is demonstrated on repeated scan data from a retaining wall in the city of Vigo (Spain, resulting in a rock bolts detection rate of 91%, that permits to obtain a detailed information of the thickness and calculate a total volume of 3597 litres of concrete. These results have verified the effectiveness of the developed approach by increasing productivity and improving previous empirical proposals for real time thickness estimation.

  18. Intestinal Obstruction due to Complete Transmural Migration of a Retained Surgical Sponge into the Intestine

    Directory of Open Access Journals (Sweden)

    Takashi Kato

    2012-12-01

    Full Text Available A 56-year-old woman with a history of gynecological surgery for cervical cancer 18 years previously was referred to our hospital for colicky abdominal pain, nausea and vomiting. Intestinal obstruction was diagnosed by contrast-enhanced computed tomography (CT which showed dilation of the small intestine and suggested obstruction in the terminal ileum. In addition, CT showed a thick-walled cavitary lesion communicating with the proximal jejunum. 18F-fluorodeoxyglucose positron emission tomography showed abnormal uptake at the same location as the cavitary lesion revealed by CT. The patient underwent laparotomy for the ileus and resection of the cavitary lesion. At laparotomy, we found a retained surgical sponge in the ileum 60 cm from the ileocecal valve. The cavitary tumor had two fistulae communicating with the proximal jejunum. The tumor was resected en bloc together with the transverse colon, part of the jejunum and the duodenum. Microscopic examination revealed fibrous encapsulation and foreign body giant cell reaction. Since a retained surgical sponge without radiopaque markers is extremely difficult to diagnose, retained surgical sponge should be considered in the differential diagnosis of intestinal obstruction in patients who have undergone previous abdominal surgery.

  19. Retaining nurses in metropolitan areas: insights from senior nurse and human resource managers.

    Science.gov (United States)

    Drennan, Vari M; Halter, Mary; Gale, Julia; Harris, Ruth

    2016-11-01

    To investigate the views of senior nurse and human resource managers of strategies to retain hospital nurses in a metropolitan area. Against a global shortage, retaining nurses is a management imperative for the quality of hospital services. Semi-structured interviews, thematically analysed. Metropolitan areas have many health organisations in geographical proximity, offering nurses choices in employer and employment. Senior nurse and human resource managers recognised the complexity of factors influencing nurse turnover, including those that 'pulled' nurses out of their jobs to other posts and factors that 'pushed' nurses to leave. Four themes emerged in retaining nurses: strategy and leadership, including analysis of workforce and leavers' data, remuneration, the type of nursing work and career development and the immediate work environment. In contexts where multiple organisations compete for nurses, addressing retention through strategic leadership is likely to be important in paying due attention and apportioning resources to effective strategies. Aside from good human resource management practices for all, strategies tailored to different segments of the nursing workforce are likely to be important. This metropolitan study suggests attention should be paid to strategies that address remuneration, progressing nursing careers and the immediate work environment. © 2016 The Authors Journal of Nursing Management Published by John Wiley & Sons Ltd.

  20. Measuring air layer volumes retained by submerged floating-ferns Salvinia and biomimetic superhydrophobic surfaces

    Directory of Open Access Journals (Sweden)

    Matthias J. Mayser

    2014-06-01

    Full Text Available Some plants and animals feature superhydrophobic surfaces capable of retaining a layer of air when submerged under water. Long-term air retaining surfaces (Salvinia-effect are of high interest for biomimetic applications like drag reduction in ship coatings of up to 30%. Here we present a novel method for measuring air volumes and air loss under water. We recorded the buoyancy force of the air layer on leaf surfaces of four different Salvinia species and on one biomimetic surface using a highly sensitive custom made strain gauge force transducer setup. The volume of air held by a surface was quantified by comparing the buoyancy force of the specimen with and then without an air layer. Air volumes retained by the Salvinia-surfaces ranged between 0.15 and 1 L/m2 depending on differences in surface architecture. We verified the precision of the method by comparing the measured air volumes with theoretical volume calculations and could find a good agreement between both values. In this context we present techniques to calculate air volumes on surfaces with complex microstructures. The introduced method also allows to measure decrease or increase of air layers with high accuracy in real-time to understand dynamic processes.

  1. Excellent solar energy absorbing and retaining fabric material. Chikunetsu hoon sen'i sozai

    Energy Technology Data Exchange (ETDEWEB)

    Furuta, T. (Unitika Ltd., Osaka (Japan). Central Research Lab.)

    1993-11-10

    Carbides of group IV transition metals such as ZrC, which are used as solar energy selective absorption film for solar energy collectors, has characteristics of absorbing light with a high energy of 0.6eV or more and of converting it to heat when exposed to light, and of not absorbing but reflecting light with a low energy of less than 0.6eV. By using ZrC as fabric materials, therefore, portable and durable heat absorbing and retaining materials can be produced. The authors have developed a solar energy absorbing and retaining fabric material, 'Solar [alpha]' (registered trade mark), which absorbs visible and near infrared rays and converts them to heat, and reflects heat from a human body and confines it. The use of Solar [alpha] has been found in various fields such as clothing as a new material for winter-sportswear, slacks, coats, and swimming suits. In this report, the heat absorbing and retaining mechanisms, basic properties of Solar [alpha], and the results of wearing tests are described. 12 refs., 6 figs., 3 tabs.

  2. Low-mass X-ray binaries from black-hole retaining globular clusters

    Science.gov (United States)

    Giesler, Matthew; Clausen, Drew; Ott, Christian D.

    2018-03-01

    Recent studies suggest that globular clusters (GCs) may retain a substantial population of stellar-mass black holes (BHs), in contrast to the long-held belief of a few to zero BHs. We model the population of BH low-mass X-ray binaries (BH-LMXBs), an ideal observable proxy for elusive single BHs, produced from a representative group of Milky Way GCs with variable BH populations. We simulate the formation of BH-binaries in GCs through exchange interactions between binary and single stars in the company of tens to hundreds of BHs. Additionally, we consider the impact of the BH population on the rate of compact binaries undergoing gravitational wave driven mergers. The characteristics of the BH-LMXB population and binary properties are sensitive to the GCs structural parameters as well as its unobservable BH population. We find that GCs retaining ˜1000 BHs produce a galactic population of ˜150 ejected BH-LMXBs whereas GCs retaining only ˜20 BHs produce zero ejected BH-LMXBs. Moreover, we explore the possibility that some of the presently known BH-LMXBs might have originated in GCs and identify five candidate systems.

  3. A 3-year follow-up study of overdentures retained by mini-dental implants.

    Science.gov (United States)

    Preoteasa, Elena; Imre, Marina; Preoteasa, Christina Teodora

    2014-01-01

    This study evaluated overdentures retained by mini-dental implants (MDIs) as a treatment option for complete edentulism during a 3-year follow-up period. This observational clinical study included completely edentulous patients who were treated with MDI-retained overdentures. The MDIs were supplied by the manufacturer. Twenty-three patients received 7 maxillary and 16 mandibular MDI overdentures retained by 110 MDIs. Of the 36 MDIs placed in the maxilla, 8 failed (in two patients), 2 had compromised survival, 3 displayed satisfactory survival, and 23 were successful. Of the 74 MDIs placed in the mandible, 11 displayed satisfactory survival and 63 were successful. The marginal bone loss was more pronounced for the MDIs placed mesially (intercalated), in areas of decreased ridge width and bone density, and with lower values of insertion torque. The overdentures fractured in seven patients; in 4 of them, this corresponded to the implant housing area. Self-reported reasons for patient dissatisfaction included occasional pain under the overdenture (n = 5) and instability of the maxillary antagonist complete denture (n = 4). Based on this research, considering its limitations, it is possible to conclude that survival rates and health status are better for MDI overdentures applied in the mandible than for those applied in the maxilla. The most severe prosthetic complications encountered were overdenture base fracture, matrix detachment, and instability of the maxillary antagonist denture.

  4. Load Transfer Characteristics of Three-Implant-Retained Overdentures with Different Interimplant Distances.

    Science.gov (United States)

    Tokar, Emre; Uludag, Bulent; Karacaer, Ozgul

    Implant-retained overdentures are the first choice of rehabilitation for edentulous mandibles. Bone morphology and anatomical landmarks may be influenced by the location and angulation of implants and distances between the implants. The purpose of this study was to investigate stress distribution characteristics and to compare stress levels of three different attachment designs of three-implant-retained mandibular overdentures with three different interimplant distances. Three photoelastic mandibular models with three implants were fabricated using an edentulous mandible cast with moderate residual ridge resorption. The center implants were embedded parallel to the midline, and the distal implants were aligned at a 20-degree angulation corresponding to the center implants. Distances between the center and distal implants were set at 11, 18, and 25 mm at the photoelastic models. Bar, bar-ball, and Locator attachment-retained overdentures were prepared for the models. Vertical loads were applied to the overdentures, and stress levels and distribution were evaluated by a circular polariscope. The greatest observed stress level was moderate for the tested overdenture designs. The Locator attachment system showed the lowest stress level for the 11-mm and 25-mm photoelastic models. The bar attachment design transmitted less stress compared with the other tested designs for the 18-mm photoelastic model. Stresses were observed on the loaded side of the photoelastic models. The lowest stress was found with the Locator and bar attachments for the 11-mm photoelastic model, which transmitted little or no discernible stress around the implants.

  5. RESTOP: Retaining External Peripheral State in Intermittently-Powered Sensor Systems.

    Science.gov (United States)

    Rodriguez Arreola, Alberto; Balsamo, Domenico; Merrett, Geoff V; Weddell, Alex S

    2018-01-10

    Energy harvesting sensor systems typically incorporate energy buffers (e.g., rechargeable batteries and supercapacitors) to accommodate fluctuations in supply. However, the presence of these elements limits the miniaturization of devices. In recent years, researchers have proposed a new paradigm, transient computing, where systems operate directly from the energy harvesting source and allow computation to span across power cycles, without adding energy buffers. Various transient computing approaches have addressed the challenge of power intermittency by retaining the processor's state using non-volatile memory. However, no generic approach has yet been proposed to retain the state of peripherals external to the processing element. This paper proposes RESTOP, flexible middleware which retains the state of multiple external peripherals that are connected to a computing element (i.e., a microcontroller) through protocols such as SPI or I 2 C. RESTOP acts as an interface between the main application and the peripheral, which keeps a record, at run-time, of the transmitted data in order to restore peripheral configuration after a power interruption. RESTOP is practically implemented and validated using three digitally interfaced peripherals, successfully restoring their configuration after power interruptions, imposing a maximum time overhead of 15% when configuring a peripheral. However, this represents an overhead of only 0.82% during complete execution of our typical sensing application, which is substantially lower than existing approaches.

  6. Effect of heat treatment on surface hydrophilicity-retaining ability of titanium dioxide nanotubes

    Science.gov (United States)

    Sun, Yu; Sun, Shupei; Liao, Xiaoming; Wen, Jiang; Yin, Guangfu; Pu, Ximing; Yao, Yadong; Huang, Zhongbing

    2018-05-01

    The aim of this study is to investigate the effect of different annealing temperature and atmosphere on the surface wettability retaining properties of titania nanotubes (TNs) fabricated by anodization. The TNs morphology, crystal phase composition and surface elemental composition and water contact angle (WCA) were investigated by scanning electron microscopy, X-ray diffraction, X-ray photoelectron spectroscopy and contact angle instrument, respectively. After the samples annealed at 200 °C, 450 °C, 850 °C have been stored in air for 28 days, the WCAs increase to 31.7°, 21.1° and 110.5°, respectively. The results indicate that crystal phase composition of TNs plays an important role in surface wettability. Compared with the WCA (21.1°) of the samples annealed in air after 28 days, the WCA of samples annealed in oxygen-deficient atmosphere is lower, suggesting the contribution of oxygen vacancy in the enhanced hydrophilicity-retaining ability. Our study demonstrates that the surface hydrophilicity-retaining ability of TNs is related to the ordered nanotubular structure, crystal structure, the amount of surface hydroxyl group and oxygen vacancy defects.

  7. Automatic Thickness and Volume Estimation of Sprayed Concrete on Anchored Retaining Walls from Terrestrial LIDAR Data

    Science.gov (United States)

    Martínez-Sánchez, J.; Puente, I.; GonzálezJorge, H.; Riveiro, B.; Arias, P.

    2016-06-01

    When ground conditions are weak, particularly in free formed tunnel linings or retaining walls, sprayed concrete can be applied on the exposed surfaces immediately after excavation for shotcreting rock outcrops. In these situations, shotcrete is normally applied conjointly with rock bolts and mesh, thereby supporting the loose material that causes many of the small ground falls. On the other hand, contractors want to determine the thickness and volume of sprayed concrete for both technical and economic reasons: to guarantee their structural strength but also, to not deliver excess material that they will not be paid for. In this paper, we first introduce a terrestrial LiDAR-based method for the automatic detection of rock bolts, as typically used in anchored retaining walls. These ground support elements are segmented based on their geometry and they will serve as control points for the co-registration of two successive scans, before and after shotcreting. Then we compare both point clouds to estimate the sprayed concrete thickness and the expending volume on the wall. This novel methodology is demonstrated on repeated scan data from a retaining wall in the city of Vigo (Spain), resulting in a rock bolts detection rate of 91%, that permits to obtain a detailed information of the thickness and calculate a total volume of 3597 litres of concrete. These results have verified the effectiveness of the developed approach by increasing productivity and improving previous empirical proposals for real time thickness estimation.

  8. A Conjunctival Mass in the Deep Superior Fornix After a Long Retained Hard Contact Lens in a Patient With Keloids

    NARCIS (Netherlands)

    Zola, Enrica; van der Meulen, Ivanka J. E.; Lapid-Gortzak, Ruth; van Vliet, J. Mj; Nieuwendaal, Carla P.

    2008-01-01

    Purpose: To report a case of an upper eyelid mass induced by a rigid contact lens retained for more than 3 years in the eye of a patient with a general history of keloids and to provide a review of the literature on retained contact lenses. Methods: Case report. Results: A 45-year-old woman with an

  9. The effect of prior sandblasting of the wire on the shear bond strength of two different types of lingual retainers.

    Science.gov (United States)

    Kilinç, Delal Dara; Sayar, Gülşilay

    2018-04-07

    The aim of this study was to evaluate the effect of total surface sandblasting on the shear bond strength of two different retainer wires. The null hypothesis was that there is no difference in the bond strength of the two types of lingual retainer wires when they are sandblasted. One hundred and sixty human premolar teeth were equally divided into four groups (n=40). A pair of teeth was embedded in self-curing acrylic resin and polished. Retainer wires were applied on the etched and rinsed surfaces of the teeth. Four retainers were used: group 1: braided retainer (0.010×0.028″, Ortho Technology); group 2: sandblasted braided retainer (0.010×0.028″, Ortho Technology); group 3: coaxial retainer (0.0215″ Coaxial, 3M) and group 4: sandblasted coaxial retainer (0.0215″ Coaxial, 3M). The specimens were tested using a universal test machine in shear mode with a crosshead speed of one mm/min. One-way analysis of variance (Anova) was used to determine the significant differences among the groups. There was no significant difference (P=0.117) among the groups according to this test. The null hypothesis was accepted. There was no statistically significant difference among the shear bond strength values of the four groups. Copyright © 2018 CEO. Published by Elsevier Masson SAS. All rights reserved.

  10. 9 CFR 318.15 - Tagging chemicals, preservatives, cereals, spices, etc., “U.S. retained.”

    Science.gov (United States)

    2010-01-01

    ..., cereals, spices, etc., âU.S. retained.â 318.15 Section 318.15 Animals and Animal Products FOOD SAFETY AND...; REINSPECTION AND PREPARATION OF PRODUCTS General § 318.15 Tagging chemicals, preservatives, cereals, spices, etc., “U.S. retained.” When any chemical, preservative, cereal, spice, or other substance is intended...

  11. Effect of tightening torque on the marginal adaptation of cement-retained implant-supported fixed dental prostheses

    Directory of Open Access Journals (Sweden)

    Jalil Ghanbarzadeh

    2015-01-01

    Conclusion: Within the limitations of this study, the marginal misfit of cement-retained FDPs increased continuously when the tightening torque increased. After cutting the connectors, the marginal misfit of the ANRs was higher than those of the straight abutment retainers.

  12. Tensile test and interface retention forces between wires and composites in lingual fixed retainers.

    Science.gov (United States)

    Paolone, Maria Giacinta; Kaitsas, Roberto; Obach, Patricia; Kaitsas, Vasilios; Benedicenti, Stefano; Sorrenti, Eugenio; Barberi, Fabrizio

    2015-06-01

    In daily orthodontic clinical practice retention is very important, and lingual retainers are part of this challenge. The failure of lingual retainers may be due to many factors. The aim of this study was to assess the retention forces and mechanical behavior of different types of wires matched with different kinds of composites in lingual retainers. A tensile test was performed on cylindrical composite test specimens bonded to orthodontic wires. The specimens were constructed using four different wires: a straight wire (Remanium .016×.022″ Dentaurum), two round twisted wires (Penta One .0215″ Masel, Gold Penta Twisted .0215″ Gold N'braces) and a rectangular braided wire (D-Rect .016×.022″ Ormco); and three composites: two micro-hybrids (Micro-Hybrid Enamel Plus HFO Micerium, and Micro-Hybrid SDR U Dentsply) and a micro-nano-filled composite (Micro-Nano-Filled Transbond LR 3M). The test was performed at a speed of 10mm/min on an Inström device. The wire was fixed with a clamp. The results showed that the bonding between wires and composites in lingual fixed retainers seemed to be lowest for rectangular smooth wires and increased in round twisted and rectangular twisted wires where the bonding was so strong that the maximum tension/bond strength was greater than the ultimate tensile strength of the wire. The highest values were in rectangular twisted wires. Concerning the composites, hybrid composites had the lowest interface bonding values and broke very quickly, while the nano- and micro-composites tolerated stronger forces and displayed higher bonding values. The best results were observed with the golden twisted wire and reached 21.46 MPa with the Transbond composite. With the rectangular braided wire the retention forces were so high that the Enamel Plus composite fractured when the load exceeded 154.6 N/MPa. When the same wire was combined with the Transbond LR either the wire or the composite broke when the force exceeded 240 N. The results of this

  13. Periparturient stress and immune suppression as a potential cause of retained placenta in highly productive dairy cows: examples of prevention.

    Science.gov (United States)

    Mordak, Ryszard; Stewart, Peter Anthony; Anthony, Stewart Peter

    2015-12-02

    The immune system during the periparturient period is impaired. At this time the most important factor causing immune-suppression in highly productive cows is metabolic stress resulting from hormonal and metabolic fluctuations, a negative energy balance, shortage of proteins, minerals and vitamins which are required to meet the demands of the fetus as well as the onset of lactation. This stress can activate the hypothalamic-pituitary-adrenocortical axis (HPA), which results in increase plasma corticosteroids. As a result, the cortisol concentration during the periparturient period increases by several folds particularly on the day of calving. Cortisol is a powerful immune-suppressive agent. During stress, this hormone causes depression of the leukocyte proliferation and their functions. Decreased phagocytosis of neutrophils, decreased cytotoxic ability of lymphocytes, as well as depressed activity of their cytokines, make it impossible for the normal, efficient maternal immune recognition and rejection of fetal membranes (as a foreign, allogeneic tissue expressed fetal antigens-MHC class I proteins by trophoblast cells) and finally results in their retention in cows. The metabolic periparturient stress also activates production of catecholamines, especially adrenalin. Adrenalin activates adrenoreceptors of the myometrium and then causes hypotony or atony of the uterus. Thus, cortisol and adrenalin inhibit rejection and expulsion of fetal membranes and cause their retention. These mechanisms of retained placenta (RP) often have a metabolic etiology and occur in herds, where important infectious diseases causing placentitis are absent or prevented. The aim of this article is to show the fundamental mechanisms occurring during periparturient stress and the accompanied immune-suppression in cows, as well as their consequences in relation to RP. The paper also gives examples of the symptomatic prevention of RP in cows caused by metabolic and immune suppressive factors

  14. Selection of a Vegetable Water-Retaining Material and Its Effects on the Growth and Quality of Cucumber under Drought Stress Part 1 : Selection of a Vegetable Water-Retaining Material

    OpenAIRE

    Yang, Shang-Dong; Wang, Rui; Li, Gang; Egashira, Kazuhiko

    2008-01-01

    Water-retention capacities of moss, common water hyacinth and Late Juncellus were compared with that of SAP (super absorbent polymers), a presently used chemical water-retaining material. Moss was highest in the amount of water retained per unit weight among the three vegetable materials and showed a somewhat higher water-retention capacity than did SAP. However, it is difficult to collect moss enough for use as a water-retaining material, and collection of a large amount of moss easily lea...

  15. Magnet-retained implant-supported overdentures: review and 1-year clinical report.

    Science.gov (United States)

    Ceruti, Paola; Bryant, S Ross; Lee, Jun-Ho; MacEntee, Michael I

    2010-01-01

    Open-field aluminum-nickle-cobalt magnets have been used in prosthodontics for many years, but success has been limited because these magnets are susceptible to corrosion by the saliva and because their retentive force is weak relative to the initial retention offered by mechanical attachments. More recently, magnets have been made from alloys of the rare earth elements samarium and neodymium, which provide stronger magnetic force per unit size. In addition, a new generation of laser-welded containers has improved protection from salivary corrosion. The current resurgence of interest in this type of attachment appears justified because, unlike mechanical attachments, magnets have potential for unlimited durability and might therefore be superior to mechanical ball or bar attachments for the retention of removable prostheses on implants. To date, no long-term prospective trials have been conducted to confirm the clinical durability of this new generation of magnets for retaining dentures on either teeth or implants. The aim of this study was to document initial clinical experiences and levels of satisfaction among edentulous patients treated with mandibular implant-supported overdentures retained using a new generation of rare-earth magnetic attachments. At the outset, all but one of the 17 patients had had several years of experience with implant-supported overdentures. During the first year, the mean overall satisfaction among these 17 patients increased from less than 70 to over 90 out of 100 (standardized visual analogue scale). No unusual difficulties were encountered in rendering the treatment or maintaining the attachments. This report offers preliminary evidence of the excellent potential of these magnets for retaining mandibular implant-supported overdentures.

  16. Patient satisfaction survey of mandibular two-implant-retained overdentures in a predoctoral program.

    Science.gov (United States)

    Dias, Renata; Moghadam, Marjan; Kuyinu, Esther; Jahangiri, Leila

    2013-08-01

    In response to the Commission of Dental Accreditation (CODA) mandate of a competency in the "replacement of teeth including fixed, removable and implant" prostheses, a predoctoral implant curriculum was implemented at New York University College of Dentistry. The assessment of the success or failure of a program should include an assessment of patient satisfaction with the treatment received in the predoctoral clinics. The purpose of this study was to measure patient satisfaction with the mandibular 2-implant-retained overdenture therapy received in the predoctoral program at New York University College of Dentistry. A telephone survey of patients who received an implant-retained overdenture in the predoctoral clinics at New York University, College of Dentistry (n=101) was conducted. Two of the authors contacted patients for participation in the survey and, using a prepared script, asked about their satisfaction with items such as function, comfort, and esthetics in addition to their overall satisfaction with the treatment they received. Data were analyzed with descriptive statistics. The study revealed that 79% of participants were satisfied with their masticatory ability, 84% were satisfied with the comfort of the prosthesis, and 89% were satisfied with the esthetics of their new prosthesis. Additionally, 85% of participants reported satisfaction with the overall treatment experience, and 90% would recommend that a friend receive the same treatment. The results of this study support the incorporation of treatment with an implant-retained mandibular overdenture as part of the routine care provided in the predoctoral education program to meet the mandates of CODA. Copyright © 2013 The Editorial Council of the Journal of Prosthetic Dentistry. Published by Mosby, Inc. All rights reserved.

  17. Soft Roof Failure Mechanism and Supporting Method for Gob-Side Entry Retaining

    Directory of Open Access Journals (Sweden)

    Hongyun Yang

    2015-10-01

    Full Text Available To study the soft roof failure mechanism and the supporting method for a gateway in a gently inclined coal seam with a dip angle of 16° kept for gob-side entry retaining, and through the methodology of field investigation and numerical and analytical modeling, this paper analyzed the stress evolution law of roof strata at the working face end and determined that the sharp horizontal stress unloading phenomenon along the coal wall side did not appear after the working face advanced. Conversely, the horizontal stress along the gob side instantly decreased and the tensile stress produced, and the vertical stress in the central part of the roof had a higher reduction magnitude as well. An in-depth study indicates that the soft roof of the working face end subsided and seriously separated due to the effect of the front abutment pressure and the roof hanging length above the gob line, as well as certain other factors, including the rapid unloading of the lateral stress, tension and shear on the lower roof rock layer and dynamic disturbance. Those influencing factors also led to rapid crack propagation on a large scale and serious fracturing in the soft roof of the working face end. However, in the gob stress stabilized zone, the soft roof in the gob-side entry retaining has a shearing failure along the filling wall inside affected by the overburden pressure, rock bulking pressure, and roof gravity. To maintain the roof integrity, decrease the roof deformation, and enable the control of the working face end soft roof and the stabilization of the gob-side entry retaining roof, this study suggests that the preferred bolt installation angle for the soft roof situation is 70° based on the rock bolt extrusion strengthening theory.

  18. Failing to retain a new generation of doctors: qualitative insights from a high-income country.

    Science.gov (United States)

    Humphries, Niamh; Crowe, Sophie; Brugha, Ruairí

    2018-02-27

    The failure of high-income countries, such as Ireland, to achieve a self-sufficient medical workforce has global implications, particularly for low-income, source countries. In the past decade, Ireland has doubled the number of doctors it trains annually, but because of its failure to retain doctors, it remains heavily reliant on internationally trained doctors to staff its health system. To halve its dependence on internationally trained doctors by 2030, in line with World Health Organisation (WHO) recommendations, Ireland must become more adept at retaining doctors. This paper presents findings from in-depth interviews conducted with 50 early career doctors between May and July 2015. The paper explores the generational component of Ireland's failure to retain doctors and makes recommendations for retention policy and practice. Interviews revealed that a new generation of doctors differ from previous generations in several distinct ways. Their early experiences of training and practice have been in an over-stretched, under-staffed health system and this shapes their decision to remain in Ireland, or to leave. Perhaps as a result of the distinct challenges they have faced in an austerity-constrained health system and their awareness of the working conditions available globally, they challenge the traditional view of medicine as a vocation that should be prioritised before family and other commitments. A new generation of doctors have career options that are also strongly shaped by globalisation and by the opportunities presented by emigration. Understanding the medical workforce from a generational perspective requires that the health system address the issues of concern to a new generation of doctors, in terms of working conditions and training structures and also in terms of their desire for a more acceptable balance between work and life. This will be an important step towards future-proofing the medical workforce and is essential to achieving medical workforce

  19. Disc-retained tubes for radiologically inserted gastrostomy (RIG): Not up to the job?

    International Nuclear Information System (INIS)

    Kibriya, N.; Wilbraham, L.; Mullan, D.; Puro, P.; Vasileuskaya, S.; Edwards, D.W.; Laasch, H.-U.

    2013-01-01

    Aim: To assess the insertion procedure and performance of disc-retained gastrostomy tubes, recording complications and accidental displacements by prospective audit, and to determine whether primary placement of the tube off-licence was feasible. Materials and methods: Disc-retained 12 F single-lumen Monarch gastrostomy tubes (Enteral UK, Selby, UK) were inserted by three gastrointestinal interventional radiologists in a supra-regional cancer centre. The 12 F tubes required a 20 F peel-away sheath with four-point gastropexy fixation and were placed under conscious sedation, using electrocardiogram (EEG) bispectral index monitoring. Follow-up was performed in an in-house gastrostomy drop-in clinic at 1 week and 1 month, supplemented with weekly telephone follow-up. Patients also had open access to the gastrostomy drop-in clinic for immediate advice and complication management. Results: Eighteen patients underwent primary insertion of a Monarch gastrostomy tube over 5 months. A total of 6/18 (33%) tubes displaced; 4/18 (22%) completely, 2/18 (11%) occult into the peritoneum. Four of 18 (22%) patients developed infection at the stoma site. Due to the unexpectedly poor performance of the tube, the study was terminated early. Conclusion: Initial experience with the Monarch disc-retained gastrostomy tube demonstrates it unsuitable for primary placement with current protocols. In view of the potentially serious complications, the Medicines and Healthcare Products Regulatory Agency (MHRA) has been informed. A request has been made to the distributer to reassess the tube design and/or review the procedure promoted for primary placement

  20. [Application of single-retainer all-ceramic resin-bonded fixed partial denture in replacing single anterior tooth].

    Science.gov (United States)

    Lili, Yang; Debiao, Du; Ruoyu, Ning; Deying, Chen; Junling, Wu

    2017-08-01

    Objective In this study, we aimed to evaluate the clinical effect of single-retainer all-ceramic resin-bonded fixed partial denture (RBFPD) on the single anterior tooth loss patients. Methods A total of 20 single-retainer all-ceramic RBFPD
were fabricated and evaluated in a two-year follow-up observation. The restorations were examined on the basis of the American Public Health Association (APHA) criteria. Results A total of 20 single-retainer all-ceramic RBFPD achieved class A evaluation after a six-month follow-up observation. One single-retainer all-ceramic RBFPD was classified as class B for secondary caries after a one-year follow-up observation. After a two-year follow-up observation, one single-retainer all-ceramic RBFPD was classified as class B because of secondary caries, and one single-retainer all-ceramic RBFPD was classified as class B because of fracture. Conclusion Single-retainer all-ceramic RBFPD is a promising and optional method in replacing single anterior tooth.

  1. Dynamics of Passive Lateral Pressure in Granular Mass during Discontinual Movement of Retaining Structure

    Czech Academy of Sciences Publication Activity Database

    Koudelka, Petr; Valach, Jaroslav

    2006-01-01

    Roč. 10, I (2006), s. 271-276 ISSN 1335-2393. [ICE Experimental stress analysis 2006. Červený Kláštor, xx.06.2006] R&D Projects: GA ČR(CZ) GA103/05/2130; GA AV ČR(CZ) IAA2071302 Institutional research plan: CEZ:AV0Z2071913; CEZ:AV0Z20710524 Keywords : dynamics of passive lateral (earth) pressure * rotation about the top * retaining structure * history of both pressure component Subject RIV: JM - Building Engineering

  2. Recruiting and Retaining LGBTQ-Identified Staff in Academic Libraries Through Ordinary Methods

    Directory of Open Access Journals (Sweden)

    Elliott Kuecker

    2017-03-01

    Full Text Available In Brief While the American academic library field works hard to include all patrons and materials that represent less dominant populations, it should be more mindful of inclusivity in its own workforce. Particularly, the field does nothing to explicitly recruit or retain LGBTQ-identified librarians. The author proposes practical remedies to these problems that directly respond to workplace studies on interpersonal difficulties LGBTQ-identified librarians and others have cited as barriers to happiness in the workplace, and argues toward more inclusive LIS education and financial support.

  3. 14-Day thawed plasma retains clot enhancing properties and inhibits tPA-induced fibrinolysis.

    Science.gov (United States)

    Huebner, Benjamin R; Moore, Ernest E; Moore, Hunter B; Shepherd-Singh, Raymond; Sauaia, Angela; Stettler, Gregory R; Nunns, Geoffrey R; Silliman, Christopher C

    2017-11-01

    Plasma-first resuscitation attenuates trauma-induced coagulopathy (TIC); however, the logistics of plasma-first resuscitation require thawed plasma (TP) be readily available due to the obligatory thawing time of fresh frozen plasma (FFP). The current standard is storage of TP for up to 5 days at 4°C, based on factor levels at outdate, for use in patients at risk for TIC, but there remains a 2.2% outdated wastage rate. However, the multitude of plasma proteins in attenuating TIC remains unknown. We hypothesize that TP retains the ability to enhance clotting and reduce tPA-induced fibrinolysis at 14-day storage. FFP was thawed and stored at 4°C at the following intervals: 14, 10, 7, 5, 3, and 1-day prior to the experiment. Healthy volunteers underwent blood draws followed by 50% dilution with TP stored at previously mentioned intervals as well as FFP, normal saline (NS), albumin, and whole blood (WB) control. Samples underwent tPA-modified (75 ng/mL) thrombelastography (TEG) with analysis of R-time, angle, maximum amplitude (MA), and LY30. TEG properties did not change significantly over the thawed storage. 14-day TP retained the ability to inhibit tPA-induced hyperfibrinolysis (median LY30% 9.6%) similar to FFP (5.6%), WB (14.6%), and superior to albumin (59.3%) and NS (58.1%). 14-day TP also retained faster clot formation (median angle, 66.2°) and superior clot strength (MA, 61.5 mm) to albumin (34.8°, 21.6 mm) and NS (41.6°, 32.2 mm). TP plasma stored for 14 days retains clot-enhancing ability and resistance to clot degradation similar to FFP. A clinical trial is needed to validate these in vitro results. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. A conservative method of retaining an interim obturator for a total maxillectomy patient

    Directory of Open Access Journals (Sweden)

    Nirmal Famila Bettie

    2017-01-01

    Full Text Available Interim obturators are indicated during the postsurgical phases. It promotes surgical healing and serves as a temporary prosthesis to rehabilitate a patient with intra-oral surgical defect. Retention is gained by wiring, surgical suturing, and other noninvasive methods to enable functional rehabilitation and easy replacement with a permanent obturator. Interim obturators serve as an easy guide for replacing with definitive obturators by indicating prosthesis extensions and the required method of retention. A more conservative and noninvasive method of retaining an interim obturator for a maxillectomy patient is described in this case report.

  5. A Conservative Method of Retaining an Interim Obturator for a Total Maxillectomy Patient.

    Science.gov (United States)

    Bettie, Nirmal Famila

    2017-11-01

    Interim obturators are indicated during the postsurgical phases. It promotes surgical healing and serves as a temporary prosthesis to rehabilitate a patient with intra-oral surgical defect. Retention is gained by wiring, surgical suturing, and other noninvasive methods to enable functional rehabilitation and easy replacement with a permanent obturator. Interim obturators serve as an easy guide for replacing with definitive obturators by indicating prosthesis extensions and the required method of retention. A more conservative and noninvasive method of retaining an interim obturator for a maxillectomy patient is described in this case report.

  6. Sodium pertechnetate Tc 99m antral scan in the diagnosis of retained gastric antrum

    International Nuclear Information System (INIS)

    Lee, C.H.; P'eng, F.K.; Yeh, P.H.

    1984-01-01

    Retained gastric antrum (RGA) is a major factor in recurrent peptic ulcer. We studied 121 patients with proven anastomotic ulcers following subtotal gastrectomy and Billroth II reconstruction with sodium pertechnetate Tc 99m to determine the presence of RGA. Of the patients, 59 required surgery, 22 had RGA, and 16 had a positive scan for RGA. This noninvasive examination has 100% specificity. If RGA is identified before operation, minimal time is wasted in exploration of the abdomen, which is especially important in dealing with emergency cases. When an antral scan is negative for RGA, the surgeon is still advised to search for this condition

  7. Removal of retained biliary concretions through the T-tube track

    International Nuclear Information System (INIS)

    Daehnert, W.; Guenther, R.; Schmidt, H.D.; Staritz, M.; Thelen, M.; Mainz Univ.

    1984-01-01

    Within seven years 23 patients were treated postoperatively by percutaneous bile stone extraction. This procedure was successful in 18 patients. Although an interval of 5-7 weeks between choledochotomy and percutaneous extraction is recommended, the procedure was done 11 to 31 days after surgery with no negative effects. In six cases the stones had to be dislodged into a more favorable position with a Fogarty-type balloon catheter. The papilla of Vater was dilated in two cases. With the development of newer techniques trans-T-tube extraction remains the treatment of choice in retained intra- and extrahepatic bile duct stones. (orig.) [de

  8. Language learning apps or games: an investigation utilizing the RETAIN model

    Directory of Open Access Journals (Sweden)

    Glenda A. Gunter

    2016-01-01

    Full Text Available Abstract: Combining games with mobile devices can promote learning opportunities at the learners' fingertips and enable ubiquitous learning experiences. As teachers increasingly assign games to reinforce language learning, it becomes essential to evaluate how effective these applications are in helping students learn the content or develop the skills that the games are reinforcing. This article examines two English language learning apps under the RETAIN model (GUNTER; KENNY; VICK, 2008. The findings indicate that although these apps offer some language learning opportunities, they do not present scenario-based quality or gameplay, among other elements, if they are to be considered games.

  9. Use of overlapped reflection for determining the retained austenite by X-ray diffraction

    International Nuclear Information System (INIS)

    Garin, J.L.; Gonzalez, C.F.

    1988-01-01

    Retainec austenite in high-carbon steels has been determined by means of new computation techniques applied to the processing of X-ray diffraction data. Instead of using the traditional procedure based on the weak (200) reflections of martensite and austenite, intensity measurements of the overlapped (110) peak of martensite and (111) peak of austenite were performed. The separation of the peaks was based on a Pearson VII function, which is capable of describing all diffraction profiles. The accuracy of integrated intensities was then improved with the beneficial effects of higher precision in the calculation of the amount of retained austenite. (author) [pt

  10. Effect of Abutment Modification and Cement Type on Retention of Cement-Retained Implant Supported Crowns

    Science.gov (United States)

    Farzin, Mitra; Torabi, Kianoosh; Ahangari, Ahmad Hasan; Derafshi, Reza

    2014-01-01

    Objective: Provisional cements are commonly used to facilitate retrievability of cement-retained fixed implant restorations; but compromised abutment preparation may affect the retention of implant-retained crowns.The purpose of this study was to investigate the effect of abutment design and type of luting agent on the retentive strength of cement-retained implant restorations. Materials and Method: Two prefabricated abutments were attached to their corresponding analogs and embedded in an acrylic resin block. The first abutment (control group) was left intact without any modifications. The screw access channel for the first abutment was completely filled with composite resin. In the second abutment, (test group) the axial wall was partially removed to form an abutment with 3 walls. Wax models were made by CAD/CAM. Ten cast copings were fabricated for each abutment. The prepared copings were cemented on the abutments by Temp Bond luting agent under standardized conditions (n=20). The assemblies were stored in 100% humidity for one day at 37°C prior to testing. The cast crown was removed from the abutment using an Instron machine, and the peak removal force was recorded. Coping/abutment specimens were cleaned after testing, and the testing procedure was repeated for Dycal luting agent (n=20). Data were analyzed with two- way ANOVA (α=0.05). Results: There was no significant difference in the mean transformed retention (Ln-R) between intact abutments (4.90±0.37) and the abutments with 3 walls (4.83±0.25) using Dycal luting agent. However, in TempBond group, the mean transformed retention (Ln-R) was significantly lower in the intact abutment (3.9±0.23) compared to the abutment with 3 walls (4.13±0.33, P=0.027). Conclusion: The retention of cement-retained implant restoration can be improved by the type of temporary cement used. The retention of cast crowns cemented to implant abutments with TempBond is influenced by the wall removal. PMID:25628660

  11. Effect of abutment modification and cement type on retention of cement-retained implant supported crowns.

    Directory of Open Access Journals (Sweden)

    Mitra Farzin

    2014-06-01

    Full Text Available Provisional cements are commonly used to facilitate retrievability of cement-retained fixed implant restorations; but compromised abutment preparation may affect the retention of implant-retained crowns.The purpose of this study was to investigate the effect of abutment design and type of luting agent on the retentive strength of cement-retained implant restorations.Two prefabricated abutments were attached to their corresponding analogs and embedded in an acrylic resin block. The first abutment (control group was left intact without any modifications. The screw access channel for the first abutment was completely filled with composite resin. In the second abutment, (test group the axial wall was partially removed to form an abutment with 3 walls. Wax models were made by CAD/CAM. Ten cast copings were fabricated for each abutment. The prepared copings were cemented on the abutments by Temp Bond luting agent under standardized conditions (n=20. The assemblies were stored in 100% humidity for one day at 37°C prior to testing. The cast crown was removed from the abutment using an Instron machine, and the peak removal force was recorded. Coping/abutment specimens were cleaned after testing, and the testing procedure was repeated for Dycal luting agent (n=20. Data were analyzed with two- way ANOVA (α=0.05.There was no significant difference in the mean transformed retention (Ln-R between intact abutments (4.90±0.37 and the abutments with 3 walls (4.83±0.25 using Dycal luting agent. However, in TempBond group, the mean transformed retention (Ln-R was significantly lower in the intact abutment (3.9±0.23 compared to the abutment with 3 walls (4.13±0.33, P=0.027.The retention of cement-retained implant restoration can be improved by the type of temporary cement used. The retention of cast crowns cemented to implant abutments with TempBond is influenced by the wall removal.

  12. Effect of tightening torque on the marginal adaptation of cement-retained implant-supported fixed dental prostheses.

    Science.gov (United States)

    Ghanbarzadeh, Jalil; Dashti, Hossin; Karamad, Reza; Alikhasi, Marzieh; Nakhaei, Mohammadreza

    2015-01-01

    The final position of the abutment changes with the amount of tightening torque. This could eventually lead to loss of passivity and marginal misfit of prostheses. The aim of this study was to evaluate the effect of three different tightening torques on the marginal adaptation of 3-unit cement-retained implant-supported fixed dental prostheses (FDPs). Two implants (Straumann) were inserted in an acrylic block so that one of the implants was placed vertically and the other at a 15° vertical angle. A straight abutment and a 15° angulated abutment were connected to the vertically and obliquely installed implants, respectively, so that the two abutments were parallel. Then, 10 cement-retained FDPs were waxed and cast. Abutments were tightened with 10, 20, and 35 Ncm torques, respectively. Following each tightening torque, FDPs were luted on respective abutments with temporary cement. The marginal adaptation of the retainers was evaluated using stereomicroscope. FDPs were then removed from the abutments and were sectioned at the connector sites. The retainers were luted again on their respective abutments. Luting procedures and marginal adaptation measurement were repeated. Data were analyzed by ANOVA and least significant difference tests (α = 0.05). After cutting the FDP connectors, the independent samples t-test was used to compare misfit values (α = 0.05). Following 10, 20, and 35 Ncm tightening torques, the marginal discrepancy of the retainers of FDPs significantly increased (P marginal discrepancies of these two retainers (P > 0.05). The marginal gap values of angulated abutment retainers (ANRs) were significantly higher than those of the straight abutment after cutting the connectors (P = 0.026). Within the limitations of this study, the marginal misfit of cement-retained FDPs increased continuously when the tightening torque increased. After cutting the connectors, the marginal misfit of the ANRs was higher than those of the straight abutment retainers.

  13. Stability of retained austenite arising at low temperatures in low carbon steels with copper using TRIP effect

    International Nuclear Information System (INIS)

    Michta, G.; Pietrzyk, J.; Osuch, W.; Kruk, A.

    2003-01-01

    The magnetometric measurement results of decomposition of retained austenite arising during low temperature bainite transformation, obtained structure and mechanical properties are presented. Presented results demonstrate that the low temperature bainite transformation leads to formation of two kinds of retained austenite with different stability. Decomposition of low stability retained austenite was observed during cooling to -196 o C, the second with high stability was decomposed only during heating up to 560 o C. The first one was observed in microstructure as big grains and the second more refinement in structure was localised between bainitic regions. (author)

  14. Dividend Per Share, Retained Earnings, Book Value And Total Debt On Stock Price: Approximation Valuation Model Dividend Per Share, Retained Earnings, Book Value, dan Total Debt terhadap Harga Saham: Pendekatan Valuation Model.

    OpenAIRE

    khikmah, Khoirul

    2011-01-01

    This study examines to dividend per share, retained earnings, book valueand total debt on stock price: approximation valuation model. Data in this studyare manufacture firms listed on Indonesia Stock Exchange in 2005 – 2008. Linearregression analysis used to analysis this data. Result of regression analysis findsthat dividend per share, retained earnings, book value and total debt on stock pricehave significant effect to stock price. Dividend per share and book value havesignificant effect in...

  15. Retained primitive reflexes: Perceptions of parents who have used Rhythmic Movement Training with their children.

    Science.gov (United States)

    Grigg, Tessa M; Fox-Turnbull, Wendy; Culpan, Ian

    2018-01-01

    This article reports on a qualitative phenomenological research project that investigated the use of Rhythmic Movement Training (RMT) as an intervention for retained primitive reflexes. Participants were from seven families who each had a child between the ages of 7 years and 12 years. Through semi-structured interviews, parents described their reasons for seeking additional help with their child's development issues. They talked about finding RMT, using RMT within their family routine and their views on the costs and the benefits they experienced, both financial and time. While there has been a small amount of research into movement programmes targeting retained primitive reflexes, to date there appears to have been no studies completed on RMT. The data collected described searches for help, the stress and frustrations associated with the search and the range of interventions these parents tried. The families in this research found that RMT was easy to use within their daily routine and that it was a cost-effective, low-impact intervention. The families noticed a range of benefits for children who had completed the movements. The findings provide encouraging evidence to proceed with further study that will investigate the academic, social and emotional development of children using RMT.

  16. Effect of gamma-irradiation to prevent the spoilage of 'retainer type Kamaboko'

    International Nuclear Information System (INIS)

    Ito, Hitoshi; Iizuka, Hiroshi.

    1978-01-01

    The species of main microorganisms which can grow in retainer-Kamaboko a kind of fish meat jelly products were Bacillus subtilis and B. pumilus at 20 0 C, and B. pumilus, B. megaterium, b. cereus, Pseudomonas and yeasts at 10 0 C. When Kamaboko was stored at 5 0 C, microorganisms capable to grow were the species of Pseudomonas, Brevibacterium, Aeromonas and yeasts. Irradiation of Kamaboko at 300 krad and 450 krad reduced the aforementioned flora to the Bacillus and yeasts, and the storage life of Kamaboko was extended about 2 times at 10 0 C. The growth of Bacillus strains at 10 0 C was suppressed for 3 days or more after destruction to about 95% of the total viable cells by irradiation at 300 krad. The putrefaction in retainer-Kamaboko was brought mainly by Bacillus, which seemed to be originated mainly from starch at a manufacturing process. The number of microorganisms in Potato starch was 200 per gram, and they were consisted mainly of Bacillus. These bacteria in starch could be almost eliminated by means of 500 krad irradiation. (auth.)

  17. Recruiting and retaining family caregivers to a randomized controlled trial on mindfulness-based stress reduction.

    Science.gov (United States)

    Whitebird, Robin R; Kreitzer, Mary Jo; Lewis, Beth A; Hanson, Leah R; Crain, A Lauren; Enstad, Chris J; Mehta, Adele

    2011-09-01

    Caregivers for a family member with dementia experience chronic long-term stress that may benefit from new complementary therapies such as mindfulness-based stress reduction. Little is known however, about the challenges of recruiting and retaining family caregivers to research on mind-body based complementary therapies. Our pilot study is the first of its kind to successfully recruit caregivers for a family member with dementia to a randomized controlled pilot study of mindfulness-based stress reduction. The study used an array of recruitment strategies and techniques that were tailored to fit the unique features of our recruitment sources and employed retention strategies that placed high value on establishing early and ongoing communication with potential participants. Innovative recruitment methods including conducting outreach to health plan members and generating press coverage were combined with standard methods of community outreach and paid advertising. We were successful in exceeding our recruitment goal and retained 92% of the study participants at post-intervention (2 months) and 90% at 6 months. Recruitment and retention for family caregiver interventions employing mind-body based complementary therapies can be successful despite many challenges. Barriers include cultural perceptions about the use and benefit of complementary therapies, cultural differences with how the role of family caregiver is perceived, the use of group-based designs requiring significant time commitment by participants, and travel and respite care needs for busy family caregivers. Copyright © 2011 Elsevier Inc. All rights reserved.

  18. Crew change : attracting and retaining the next generation to the oilfield

    Energy Technology Data Exchange (ETDEWEB)

    Durocher, C. [Schlumberger Canada Ltd., Calgary, AB (Canada)

    2006-07-01

    Demand for petroleum products is expected to keep growing. However, the majority of oil and gas personnel are over 45 years old, and there are currently insufficient personnel between the ages of 25 and 45. Oil and gas operators are now examining ways of attracting and retaining skilled employees. This presentation suggested that the petroleum industry must act now to change public perceptions about the industry as well as invest in education initiatives. Enhanced relationships with schools, colleges and universities were recommended. Within the industry, career development programs, intensive technical and safety training and knowledge sharing programs were recommended. A diversification of the workforce was advised. By not encouraging women to work in the petroleum industry, the oil and gas sector is effectively ignoring 50 per cent of their potential future workforce. It was noted that employees are more likely to quit their jobs if they do not like their employer. It was also noted that steps to improve energy efficiency may provide solutions to some staff shortages. It was concluded that the petroleum industry must commit to diversity, create the right workplace environment, and develop good relationships with educational facilities in order to attract and retain skilled employees. refs., tabs., figs.

  19. Nanomechanical properties of bone around cement-retained abutment implants. A minipig study

    Directory of Open Access Journals (Sweden)

    R.R.M. de Barros

    2016-06-01

    Full Text Available Aim The nanomechanical evaluation can provide additional information about the dental implants osseointegration process. The aim of this study was to quantify elastic modulus and hardness of bone around cemented-retained abutment implants positioned at two different crestal bone levels. Materials and methods The mandibular premolars of 7 minipigs were extracted. After 8 weeks, 8 implants were inserted in each animal: crestally on one side of the mandible and subcrestally on the other (crestal and subcrestal groups. Functional loading were immediately provided with abutments cementation and prostheses installation. Eight weeks later, the animals euthanasia was performed and nanoindentation analyses were made at the most coronal newly formed bone region (coronal group, and below in the threaded region (threaded group of histologic sections. Results The comparisons between subcrestal and crestal groups did not achieve statistical relevance; however the elastic modulus and hardness levels were statistically different in the two regions of evaluation (coronal and threaded. Conclusions The crestal and subcrestal placement of cement-retained abutment implants did not affect differently the nanomechanical properties of the surrounding bone. However the different regions of newly formed bone (coronal and threaded groups were extremely different in both elastic modulus and hardness, probably reflecting their differences in bone composition and structure.

  20. Evaluation of contiguous implants with cement-retained implant-abutment connections. A minipig study

    Directory of Open Access Journals (Sweden)

    Raquel Rezende Martins de Barros

    2014-03-01

    Full Text Available Aim: The presence of a microgap at the implant-abutment interface may permit bacterial contamination and lead to bone resorption, interfering with papillae formation. The present study evaluated adjacent implants with cement-retained abutments as an option to control such deleterious effects. Materials and methods Seven minipigs had their bilateral mandibular premolars previously extracted. After 8 weeks, four implants were installed in each hemi-mandible of each animal. The adjacent implants were randomly inserted on one side at the crestal bone level and on the other, 1.5 mm subcrestally. Immediately, a non-submerged healing and functional loading were provided with the abutments cementation and prostheses installation. Clinical examination and histomorphometry served to analyze the implant success. Results A total of 52 implants were evaluated at the end of the study. The subcrestal group achieved statistical better results when compared to the crestal group, clinically in papillae formation (1.97 x 1.57 mm and histomorphometrically in crestal bone remodeling (1.17 x 1.63 mm, bone density (52.39 x 45.22% and bone-implant contact (54.13 x 42.46%. Conclusion The subcrestal placement of cement-retained abutment implants showed better indexes of osseointegration and also improved papillae formation and crestal bone remodeling at the interimplant area after immediate loading, making them a promising option for the treatment of esthetic regions.